3T3MB

A novel high affinity integrin alphaiibbeta3 receptor antagonist that unexpectedly displaces mg2+ from the beta3 midas
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
466
structure length
466
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Design of a High-Affinity Platelet Integrin alphaIIbbeta3 Receptor Antagonist That Disrupts Mg2+ Binding to the MIDAS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin alpha-IIb
total genus 118
structure length 466
sequence length 466
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3t3mB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3t3mB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3t3mB03
3IBSA 1FE8A 3FCSB 3AFCA 5E6SA 3EGDA 1M1XA 1ATZA 4NEHB 5HJ2A 4G1MA 1Q0PA 4C2BA 1JEYA 1T0PA 3EG9B 1RTKA 4GZ8A 1N3YA 5KYUB 2VDOB 1FNSA 4MMYA 4O3UB 2X5NA 5KYNA 2I6QA 1JEQB 3NVQA 4HQFA 1YVPA 2NUTA 1RRKA 2VDMB 3K6SB 3K71A 2QTVA 4FWWA 1LFAA 2VDNB 4WFQA 1ZOPA 3E2MA 3AL8A 1DZIA 2WINI 4MMXA 1JV2A 1QCYA 3OL2A 3EGXB 1XDGA 3EFOA 2VDKB 3VI3B 3IJEA 1IJKA 3ZDXB 2ADFA 3NIFB 4WK4B 5KYXA 5E6RA 3FCUB 1PT6A 3TVYA 5E6UA 1M2OA 1DGQA 5KYYB 4M76B 3EH2A 3K72A 4DMUB 5KYXB 1V7PC 4O3TB 2VC2B 1CQPA 2NUPB 4A0QA 1T6BY 3HXOA 3EOBI 3EFOB 3OL2B 3OKYB 1JV2B 4MMXB 3NIDB 2VDQB 2VDLB 1M10A 1IDOA 4HQLA 2VDRB 1U8CB 3GXBA 1ZOOA 4PN7A 3TXAA 4MMZA 2WW8A 3BN3A 3K71B 3K6SA 1SHUX 4C29A 3EOAI 3QA3E 2UZYB 1IJBA 1PD0A 2IUEA 2XWBF 5BV8A 2B2XA 5KYUA 2XWJI 1SHTX 3EG9A 4IXDA 4O02A 2ODQA 1JLMA 3ZE1B 1MQAA 1ZONA 3ZDZB 4C2AA 1M1XB 4F1KA 5E6SB 3FCSA 1N9ZA 1SHYB 1UEXC 4WJKB 5HGJA 5KYWB 3HXQA 1M2VA 1IDN1 1PD1A 4UM9B 1L5GB 2O7NA 1YVRA 4O02B 4CN8A 1CK4A 1QC5B 4WK2B 4HQOA 3PPWA 5LN1A 3ZE2B 3ZQKA 3F78A 3PPYA 4CNBA 1AO3A 1SQ0A 4XW2A 4MMZB 2ODPA 3PPXA 1OAKA 2NVOA 3PPVA 3ZE0B 1U8CA 3F74A 1BHQ1 1MQ9A 4Z7NB 4Z7OB 2NUPA 1SSLA 3K72B 3ZDYB 4K3JB 1AOXA 2I6SA 3HI6A 1OLZA 4IGIA 4HQNA 5KYYA 1XUOA 2XGGA 3TW0A 5E6UB 2ICAA 5E6RB 3V4VB 5ES4B 3T3MB 3IJEB 4JDUA 4FX5A 1RD4A 3EGXA 1U0OC 3AL8B 3VI4B 1TYEB 4UM8B 2VDPB 4WK0B 1PCXA 2NUTB 3EH1A 3RAGA 3AL9A 1JEQA 3Q3GE 1NA5A 4MMYB 2I91A 4UM9D 2P26A 3TCXB 3T3PB 5KYWA 1JEYB 2P28A 3NIGB 4G1MB 1MQ8B 1RS0A 1U0NA 2M32A 1XDDA 3BQMB 3EGDB 4G1EA 3BQNB 4NENA 1QC5A 1BHO1 1M1UA 3V4PB 3M6FA 1MJNA 1MF7A 1AUQA 1L5GA 3OKWA 3N2NA 4HQKA 4IHKA 4CN9A 1M2VB 4Z7QB 4F1JA 1MHPA 4JX0A 1YUKA 4NENB 4BJ3A 5HDBB 4G1EB
chains in the Genus database with same CATH superfamily
1VJGA 1JZQA 1JP7A 3GK3A 2VK4A 1SC6A 4YVNA 3C43A 2JD1A 3GMMB 3H2ZA 1AHMA 3TQOA 1F1BA 3K74B 4RGBA 5AKKA 2W8BA 2AS5M 3W38A 3FJTA 1DMRA 4R7DA 4D8PA 3RTQC 2QVFB 2HMWA 2DD8L 2Z91A 3CZAA 1U2HA 3ESRA 3CQPA 3KYNA 3QYAA 4IBYA 1XTMA 1K08A 2OMUB 4NBWA 1FZMA 3UTCA 2CJTA 1DCMA 1EP1B 2FSHA 2C4XA 4K7PX 3KM0A 5DTIA 3C75A 3FU7B 5EEXA 2QX4A 1F14A 2JJ1A 3F58L 1TA9A 2D59A 2QVLA 1RERA 3OUUA 4G81A 1V5WA 3TLGA 5G5DB 1AI1H 5IK2A 3FA2A 1BIIA 4DLPA 3TNMA 4QNMA 4TZTA 3M5DA 5DASA 4EUPH 4OM8A 3F78A 3HXKA 1RZKL 1HQKA 2YSSB 2PMKA 1MN6A 1BOFA 3RTEA 4LMBA 3FAKA 3QKRA 2WZDA 1TJGH 3IDIA 3QVKA 2FXIA 4MW9A 5DRNA 3QCTL 2PUQT 3T1VA 1KWGA 1YR3A 2FEEL 2Y23A 4NPAA 4QAMB 3OHMA 1KDRA 1T36A 2FL5B 4LVNB 3G6JE 3IOYA 3SPGA 4AGLA 3JYPA 2PLFA 1RLOA 1YAJA 1ZMTA 4OGKA 4L1KA 3SJUA 2R86A 4G80B 1A77A 3WLSA 3WXBA 4JZKA 5JHMA 1LV7A 4P34A 2OP0A 4CM4B 2GPNA 1OWWA 4M6OH 3I5XA 2Q99A 2K4MA 3VGFA 1L7QA 4N0RA 2ZEJA 3PQ8A 1VIVA 2XNJA 4WY7H 2VM4A 4C6RA 1EP9A 4ZPVB 1QHIA 2ON6A 3DZIA 4ONHA 2XA1A 1R0XA 4CPDA 1WBZA 4ZUVA 5KINB 4A2HA 5C0RH 1XRSB 1CUSA 2HL6A 5LNK6 1TVKB 1GZ6A 1JYEA 3DNKA 4WTWA 4AQ1C 5L6YH 3SQLA 5F7YC 1L7RA 3B89A 5G4KA 1IKFL 4JDEA 5AOLA 5CUSL 3AM4A 4QHKI 4ND1A 4WN9B 2IS2A 1CUVA 3FN0L 2YSSA 1I8IA 1ZC3A 5JYMA 3NEYA 5HVFB 3LFHA 3CW9A 1VFAA 5LQDA 4PYOA 3JZDA 3GVCA 4ALAC 4BNHA 4PJEF 1GGVA 3A28A 4GWGA 4RM3A 3JVUA 1FP7A 3GFSA 4CKZA 4I3RL 5FYJH 2MQ3A 2F58L 4AKSA 5GGQL 1DEDA 3Q40A 1GJWA 3A3KA 4R2MA 2V3DA 1J8SA 2H2GA 1LDPL 4K9EL 2BFVL 4A1FA 4PX5A 2VYRE 3TOCA 5ADHA 2BUCA 4DIOA 3EIFA 1PR0A 4G23A 2ONJA 4JOSA 3VH4A 4MVJM 2ESVA 4I48A 4I4TF 1Y3FE 3CG8A 4RGNE 4CBVA 3LHDA 3OKNA 3PWJA 4BN5A 4C88A 2IHJA 4FA6A 3EDRA 3AB7A 3JALA 1RYDA 1BS9A 4IXMA 1DBWA 3UBHA 4ZVQA 4M87A 1XV5A 3R5KA 5FF6A 5JQIB 1KQFA 3S1AA 5LGJB 5F3HA 3WMWA 2DQMA 5B8CA 2DYPA 1QMPA 5KWVA 1IK4A 1G3IA 2H1OA 1DJXA 1ZN2A 2QMJA 2PUAA 1MZZA 2VYNA 1UB5A 3B5GA 2H0FA 3QW2A 3IESA 2J88H 3ARYA 1TT7A 3P2DA 3HCPA 1O6FA 2YR3A 4PLCA 1ISPA 7REQB 3WN5A 2FPLA 2R84A 4L3ED 3FO0H 1N0LB 4BUZA 5B57C 3B9DA 4Z86A 4BUHA 1NBVH 3GHEL 1GZPA 5FX3A 3AESB 1K86A 2VLKE 3A4YA 1UCBH 4KK9C 3RU2A 5MFZA 5ALNA 5TPWL 5C09D 5ALZA 2IDSA 3RRXA 1MJGA 4FVTA 2Q41A 4RZCB 4ZQKA 3WJ2A 3B6SA 3CVCA 1WFIA 5BRZD 3EIXA 4KRPD 3PNKA 1ORWA 2KBEA 3SOBH 2DX7A 1D5ZB 3U79A 5H3LA 3O95A 4ZIRB 2FVYA 1ZJJA 2XBLA 3CPJB 4A1OA 3E1SA 4JB0A 3BIJA 4LWOA 2R2EB 1N5LA 4DGYH 4URYR 1G5RA 4CN8A 1ZXLA 2QZQA 2YBRA 1M2WA 4A0GA 3BN3B 1JGDA 1ICEA 4ZMZA 1RJEA 4JLVA 1BAGA 3U1SH 3BS4A 4DVBA 3ZIYA 1DWUA 3SS7X 4V2CB 3KB2A 1T1XB 2W91A 4CTJA 2WUBH 4XGKA 4PGBB 2FTKE 4OAPA 4PYIA 1VYVA 4KZPA 2WYUA 2ATVA 4TL8A 1G41A 5HPMB 2A6KA 1M74A 3ZT6A 4HAYA 4M1OA 1V25A 2NTNA 4GRAA 4JY5H 3HN5A 4LZKA 5JMWA 3EBPA 2PYZA 3HI6H 2ZSBA 3A6ZA 2PGIA 1O95D 4PB9L 1J88A 3N5AA 2GBLC 4P7BA 3GUCA 2MJLA 3QVOA 2WV7A 4P4RA 1BVLA 1T6ZA 4L0MA 4U00A 3MF4A 1P1IA 3ZTTA 1FJ1A 4WHCA 3C6KA 4ZFFB 1PJTA 1PDOA 5BNFA 1G19A 2GPZA 5T3XD 5FO9B 1YEIH 4MYRA 5JO9A 3JWNC 5KS2A 1V11B 3AUJB 3V6ZB 4I99A 1B4TA 3ESVF 3ONEA 4PRIA 3H9GA 3LIPA 5C08E 4ETMA 4NZTL 5EC8A 2X05A 1QVOA 1SF5A 2ODQA 2AQRA 1D2AA 4B3TB 4LY9A 4X8OA 2Q1EA 4W1PA 4G2NA 5LBGA 5EXDA 5LWHA 1K8QA 4M1EA 4KHXH 5IDWA 5E9QA 2EH8L 2H1WA 1FYXA 3VJMA 1XHLA 4IU3B 1ZGLB 4A6XA 1YEKL 3K6NA 3QFCA 2E9WA 1YYML 1Y7HA 4HLUC 3CLEL 5EVCA 3AS1A 2G60H 4GE3A 3OURA 2EIMB 1YU6A 4RJLA 3TLMA 4TUKL 4NUQA 5EIFA 3VD3A 3ZKWB 1SU4A 5DSCA 3AEZA 5KTYA 4C3ZA 3KNBA 3A67L 1EB9A 1JIBA 2H32H 3CHOA 5E0FA 4OI8A 3MODH 2O4UX 4HT3B 4QJIA 1U0RA 2IV9A 5KO2A 1KELH 2HJKB 1VBFA 2PL3A 3I6KB 1GYWA 3B56A 2R15A 2ZXFA 1F38A 4FFNA 3KR3H 4NULA 5JMOA 1Z2CA 2X3BA 4ZV9A 4HH8A 1BFSA 3LH2H 2UUDH 4Y9GA 2VDLL 3U7FB 2O8CB 3HB5X 4OJFH 1SURA 2CLHB 5I4IA 4URXR 1MFEH 2EKJA 1UFUA 5HUJA 1VA9A 4JFZH 3Q2NA 3CT6A 4HUNB 2E3JA 1CUDA 1XCXA 1TT6A 1OAKH 4XB1A 3IF1B 2OBGA 3BPLB 3PNSA 4WPGA 4AZ0A 4AYTA 1DCLA 1YSCA 5B1IA 1EM8B 1XQVA 5C07B 1V41E 4GSLA 2EJ1A 3KXDA 5C8YB 2XG5A 5K1NA 4ZVTA 1V1MB 3MMEA 1JMYA 4F92B 3QNWA 4ZDWA 5AM1A 4S0HA 2EGUA 2YNMA 4QPDA 2LW3A 3MLUH 4C6TA 5BR1A 4TM7A 4HEHA 2EDKA 1FGNH 3O2WL 3LLVA 3MPCA 4GMXA 1TTCA 5B4MD 4APXB 3BD7A 3HNVH 5JOFB 1AMOA 2VLRD 2QD3A 1G1OA 1DVFD 3IPFA 3UICA 3P0EA 4U3SB 1IGMH 4BQOA 2VDPB 1V7QA 5GTDA 4UE2A 1LVUA 1KPUA 1Q6ZA 3REOA 5E7BA 3SDCA 3N1FC 3BRGC 4PIMA 3Q2CA 3G85A 5CCJA 3RSFA 4CUZA 1R12A 4P2CG 3RVXC 4WJZA 4GBXB 1EGJH 4Y9EA 5ESQB 1L7OA 1T2FA 3I2CL 4L07A 4DG9A 1RUKH 2JJMA 1W2HA 3RVRA 1GQYA 4C2BA 3FETA 4XYBA 1BZ9A 1C3JA 1FCGA 1YOBA 4BKRA 3M1OA 2G07A 3VDBA 3DAHA 4E9TA 2BM1A 3M6WA 1DOHA 3HJEA 2AQHA 2GBIA 3AG4B 1DEEA 3RDTC 3RFFA 1Q15A 2YYAA 4FGSA 2P78A 1G59A 5BVGA 4NO3B 5TEVA 3O8CA 2VHYA 3KKQA 4KXVA 3MTDA 5AVQA 2BNRB 2D7NA 4OVKA 2YJGA 4GT0A 2NM0A 1FO0A 5ISMA 3ZQUA 1GY8A 4TYYA 3GUVA 3C5JB 5LWYL 3CH7A 5FLUA 1B6SA 4AF8A 1X7QB 3I6BA 3TJPA 5CINL 1MB2A 1UWCA 3NH7L 5IMSA 3P1JA 2VDWB 1XB6A 5GQSA 2FJGB 3EGOA 5TQ0H 3ERXA 4LJYA 2NY6B 2GPAA 3QYJA 4YLQT 3QORA 2WKLA 1UZNA 3DOHA 3L0OA 3QIUD 3P9PA 3UAOA 1IQPA 1RYBA 2O2ZA 1XZEA 3ELUA 4G5SA 2ITEA 4OIAA 4J3OD 4YHZL 4C14A 4Y2GA 2FMKA 2BKUA 1XCQB 3SJVE 2RHBA 4TTIA 4ZPJA 1I3MA 2UZ4A 4DWVA 1X9IA 3LCVB 4NKDB 3TD6A 2MYNA 2XQJA 4CU8A 1JFTA 3T0BA 4RLFA 1IBBA 1MOQA 2UU9B 3BGFB 1H4TA 5ICYB 4ZQFA 3OT1A 4BE4A 2N9UA 3DHWC 2QX9A 3U1BA 2ZRAA 5IFHL 5GZ3A 1ISHA 2XTJC 3PHSA 3IDOA 2XU9A 4FXGB 4JBGA 5DMKB 4DB4A 3BI9X 4AI7A 3VAAA 1T6WA 4U2KA 4X4KA 3PHOA 2A2QT 1D5WA 3G7UA 2DH2A 4AIIA 2RG1A 5A7EA 5MN6A 3ARGA 3Q9QA 4MVCA 3HDGA 4ADGA 2YV3A 3KYIB 1ECFA 2IJGX 3EFOB 3EO0A 4KGLA 3DW3X 1FIUA 1UJBA 4RMNA 5F2FA 1S2IA 2WWYA 4DUZB 1H4SA 5GZND 1RULH 4FTWA 4TMVA 4B96A 3K2BA 3OAUL 5AW9A 1BGVA 5C0NC 1I85C 4G5HA 2VFAA 3OQJA 4BMYA 4GH7B 4LOFA 4JC0A 3U7GA 2O2JA 2DQ4A 4GR9A 3R0IA 5D01A 2COUA 2XJ4A 3EA4A 3LCJA 4OFIA 2AB0A 2H5IA 4B8YA 3U7RA 2E9IA 3FZGA 1ADQL 4W9NA 5SV2A 1QZXA 3IFLL 3H83A 2HSZA 4HJJL 1VKJA 4XNQA 2H16A 4IRMA 1TZ2A 4WFGE 1DN2A 4XXCC 3MSXA 2FLRT 3RKDD 3KUDA 3X1KA 1RQRA 1F90L 5FGSA 2YMMA 4H3SA 1P2CB 2P5EB 2Z1KA 4WHDA 3X3HA 4U2BA 6ABPA 4RHTA 3ESPA 4AQOA 4KR3A 2DEWX 4IBWA 1PW7A 3LQMA 1JJBA 1HE8B 4U33A 4AJ4A 3QR2A 2BSDA 5C8DA 2XTSA 3HWSA 4PJIB 3ETEA 4B84A 3QEMA 4AMVA 2HSEA 4CG1A 3V4FA 2RH8A 4LYYA 2OZ4A 3CLUD 4N0YH 5FYKL 1X5KA 4G7QB 4XFDA 2DWEA 4N5EC 1Q84A 1HYEA 3HFMH 2QTRA 2VT7A 2WP3T 1PR6A 3IAEA 1K1EA 1M2NA 1AR2A 2R0LH 4MJ2A 2REBA 2I9LB 1PG7L 3PWUB 4F7CA 1KSRA 1QU3A 1KI8A 2D0PB 1YECH 3O91A 4DKAA 4L0CA 4PCTA 3DHNA 1H05A 4KI5E 2PRIA 3L6DA 4D94A 3LUFA 3OPUA 1IWBB 4KTVE 3EPRA 3DUUA 4CADA 4QF1A 1FPQA 2VF4X 1A6UL 2FZ4A 4QELA 1KMQA 5CVDA 1PR9A 4NWTL 2B92A 4HCRL 3SM9A 1O7VA 1BPLB 5FA3B 4M8KA 3D5EA 3M9LA 4OV6B 3GUFA 1USWA 5GGRA 3NHSA 4K6CA 3FUNA 2IOQA 4N5HX 3LRLA 2RBEA 5C4IA 1EX6A 1OU0A 1PKQE 1D6VH 3ZJYA 1OPOA 3FX2A 1A9EA 3AR3A 2B7DT 4OFDA 4HHGA 4DUWA 4XNBA 1X77A 3BUTA 4NQED 1NASA 4P80A 1F5NA 1XA4A 2W0FB 3WDIA 5JW5A 2P3LA 3S70A 2M32A 3BVVA 1JT2A 2PO5A 2VZEA 2FLBT 2DR2A 5JADA 4ZMNA 5C5IA 4NIYE 1TZKA 4KXXA 1I9GA 1SQSA 3O4VA 4ZOQI 4D82A 2X4QB 2EFJA 4YHML 3RZCA 1JSZA 2FAUA 5D7LB 5FW7A 4KMLB 3MJGX 4G1MA 2V6JA 3FCEA 1G6VK 4I6JA 3VMFA 2IOFA 4RS4A 3FTWA 1IGCL 1OAKL 5ITWA 3Q2WA 1CTQA 2XXGA 5T1DH 5HEKA 1Z5HA 1P80A 1KQPA 2DMRA 1MNQA 3C8HA 1S02A 4G9DA 4P32A 4WGGA 2Y2YA 4RTQA 1ZXQA 2QU7A 2HN7B 3SZMA 4YPOA 5LYYA 2XE4A 5T3YA 2BF7A 4MVJD 4MHHI 3C60B 3C2SA 4PLZA 3VR0A 3USZA 3NC4A 4XYMA 1X1CA 1L7XA 4O4LB 4EVQA 2HFGH 5GJSL 4MJID 4OLWH 4M0KA 4YT5A 1U8EA 4X90A 5JAQA 1ZE3H 3ENVA 2MFNA 4TL4A 2AV7B 3W9EA 1N1DA 4XO9A 1C7SA 2DBZA 1DUZB 1T4CA 1XBRA 3DIDA 2G9KA 3IMGA 3AVPA 4TQAA 4WVRA 3QOYA 3D7RA 4EY3A 4OI7A 1HL7A 3EFHA 4Q0MA 1KYOK 5ICXA 5E2IA 5DN6D 1YNTF 4V0NA 4X61A 3RJTA 1HC7A 1E3TA 1YNLL 2W98A 3RWCB 3QE5A 2RMNA 4ZEMA 4GNKA 2ZKIA 2HMYB 4HIEA 3R8CA 4FX2A 5KVDH 5CBPA 3WTWA 3H13A 3ECVA 3D2CA 4OAWA 4GO6B 1ZGAA 1YMMA 4F1JA 1QBML 1LP9E 1JJ7A 3GRBA 4DKDC 1P7ZA 2OLJA 3AC0A 3VR5A 4RWYL 5EEYA 5FUCE 1CYXA 3HWWA 3VXUD 2WMPA 1A1NB 2O9JA 2O5YL 4B5KA 1AIFA 4O2BA 4HF7A 2R68A 1V7PC 2JFQA 1E5XA 2ZOWA 1SBZA 4KYTA 3ZE0F 1SVOA 3LZFL 4RXTA 5FV2A 2E46A 2F8MA 4IOKA 4P9HL 4FINA 5E9AA 5EHGA 1KTDA 3L8EA 5ERWA 4MXWL 3UTSD 3DZDA 4RGOH 5E00B 4RVSA 4ZCPA 2V6IA 4F2DA 2QVIA 1MC4A 3OJVC 3MB5A 3C4QA 2BFNA 3VU9B 1N5OX 3CVJA 2PSFA 2KT6A 4QXUH 1MCCA 4I7EA 1UPAA 2EIJB 4QWWA 1D5BB 4FQJH 2JGDB 1XZWA 1S9VA 1HHJB 3V8NA 1AKJD 2VOEA 1VIWA 2A9QA 2CBGA 4DQKA 4AVKA 1WXDA 4PLJD 1FNAA 1FB5A 4ITRC 4L4TD 4WTQA 2R2AA 4LNAA 3WLLA 5JXHA 3QWRD 1TJIH 4ENWA 4YV1A 2KBFA 2AVFA 3MREB 3E35A 3OPZH 5I7WA 3BUDA 1QH1A 4Q1FA 4LMQE 4HXAL 3D2LA 4PPGA 4UTZA 4F2HA 1L6RA 4WZAA 1CUAA 3FOLB 4FC7A 3TXXA 1A3RH 1D7CA 2EJTA 3I50L 4RH1A 3DROA 4FFLA 4NZNA 4K6FA 1R5IB 4AO6A 2UZ1A 4QICA 2P9GA 4UT6A 3JTSA 3GBML 4XVUC 1E4XH 4TQPA 5DJCA 5LZ4A 2IOMA 2XXFA 4L4RA 2PU5A 5I8PA 2YAFA 2BIIA 4MFHA 3F6CA 5JRDS 3U4BL 1MHHA 3MS7A 1BQRA 2X12A 1DBML 5FO0A 1TYRA 1YZVA 1HH6A 1T5DX 2H2SD 4EG4A 2OI9C 2G67A 2HV9A 2PYDA 1J9SA 2RH5A 5GGUB 3RTCA 5CLHA 3P40A 1R5OA 4O5LL 3HHMA 2QDWA 3DQQA 4YRJA 3F04A 2F7SA 5AHXA 1SXJD 3E15A 4PSPA 4HLCA 3E3QC 3HCCA 1YEKH 3R7NA 3R0VA 3FFXA 4RKYA 5A4MS 2IBZY 1OD9A 2HUPA 1X7TA 2RHWA 2GPTA 2W0KA 4YT8A 4ZT4A 1B15A 4YBQC 1QGED 5E3IA 4J16A 3IAPA 3EPJA 1IAKB 4ZEXA 1W0VA 1ODAA 3N0PB 3P9CA 3OX8A 1PBYA 4IJTA 4LNUB 2BNQB 5KYGA 3LBYA 3GLGB 1OAYL 13PKA 3SDYL 5AW5A 3DFZA 3TOVA 4ZYZA 3B7TA 1JIQA 5FO1A 1SY6H 3U4IA 3ZWNA 3TIGA 2IOOA 1EZVY 1THGA 3RSHA 3WXWL 3QE0A 4BZ2A 2NZJA 3GZNB 1U6AH 3EEFA 2HFJA 5BSVA 4DNPA 3HI4A 2VSXA 3KT6A 2Z7ZA 4GW5B 4PJGF 2P45B 3HPRA 2RARA 1RQPA 5EF2A 4DKTA 2NY2B 5DEZA 1M34E 2UKDA 3A1UA 3B1UA 5FO8A 3II3A 3T8MA 4JAVC 4HH4A 2XVGA 2F3QA 2QA5A 1WSBA 4H8WL 4RULA 3QUZD 3CYFA 2A9DA 4U3CA 3FDZB 1KPIA 5IM4A 4EI5C 2VCYA 3UA3A 3MCTA 1OTUD 4GG1A 3P9MB 2HSWA 2D2XA 1D1TA 2R56L 2NCEA 3SDBA 3OO1A 1Z3IX 2V6GA 4RZSA 4AENA 3I6LD 5J4VA 3VAEA 2XQ0A 4V0LA 3CBKB 1S2EA 1TK3A 2EIBA 3O45B 1A7OH 4YJ3A 4YVUA 3UH1A 3MWEB 3W90A 4B81A 5C0OE 4ZI7F 4WFHE 3BXOA 1RJWA 3NNSA 1EFPB 1IBRA 4DR7B 5F2OA 2Q2VA 3NOVA 2A4MA 3SKNB 3SPCA 3NHFA 3G9QA 1BD4A 4UYPA 1W6LA 1UXMA 1EWTA 4PVBA 3KG2A 2DYPD 2BSCA 5L4MA 1XQ1A 4HB3A 4G5YA 4WLNA 2HT3D 4R96B 4TTJA 3FPYA 4G0ZA 1RCYA 1KFAH 4ODUB 4HZIA 4MDJA 1Y18B 2JHAA 4MJ5B 5JSZB 2C8KA 4YZFE 5FWXB 3M88A 1HQDA 3TDNA 1UC8A 2WYHA 2XYPA 1QZZA 2XB9A 1VP9A 2VNKA 1XCQA 4ESHA 5KSVB 1Y9AA 3PFBA 4OAQA 4TTAA 4HXBH 3H0TB 3EFDL 3UGJA 3MGAA 3NEXA 2FAXA 1Y4AE 3IPBA 3VPAA 1Y7LA 4YV2A 1UQTA 4NBZB 3OESA 4BMCA 4BO8A 1GZVA 4DLYA 2CO7A 4UOQA 3AREC 3MODL 1PAMA 2VYVA 3R0QA 4Z3IA 1QIKA 1HS6A 4OBSA 5BNXD 2C2OA 5D55A 5B1JA 4Y88A 1EFAA 4R9RA 4ANFA 4UOJA 3R7BA 3A2KA 3ZWCA 2XETA 1KS9A 5LLSA 3DK0A 4XJXA 2QG4A 5AVXB 2ODWA 4EI6B 1ETJA 5F7AA 3TBCA 2MHAB 3Q8FA 4ARBA 2K9FB 4ALNA 2C4NA 1JSYA 3U48A 1AQYA 2X6UA 4UAOB 3X0DA 2WLIB 3WFZA 3AQDA 3TONA 3REFA 4H9GA 4G5FA 4PRBB 4WO4B 1E6WA 3P4OA 3DDNA 2BNUB 3HFJA 3IU4L 1LX7A 4K40A 1SGWA 3GKWH 3L7MA 3MGTA 3K9NA 1YFLA 4AOFA 1G60A 1D7AA 2J6BA 3GLHB 2GZHA 2PABA 2FK7A 2JEZA 4ENRA 1A4CA 4PJ7B 4M0FA 1XXHA 2H2IA 2I7VA 4CQMB 4RVOA 3SKUD 1ZD4A 4OHZA 4EYEA 3IXAA 4K07A 5FTKA 4AWJC 5C09E 2LGNA 4E5KA 1WBJB 2AN3A 2NO6A 2YHIA 1VIMA 4IWYA 2R1ZA 3JD2A 1E3MA 5TX7A 4PRID 1QS0A 4Q3DA 1UMBB 2ZP0T 3GNMH 3U7WH 4KSYA 2H1HA 2R00A 1MTZA 3ENQA 4C6TB 3LXXA 5ALYA 3O8LA 1KYDA 4RMSA 1CGUA 3QZBA 4AH2B 2JAQA 4BMVA 3UF0A 4TMXA 5E9JA 4A2CA 2FWJA 4GRMB 2IYQA 5CZKA 5H81A 3QULA 2DIAA 1W25A 4O8CA 4NXNB 4GPEA 1GZSA 1FNBA 5AFSA 3U56A 4DEXA 1MX9A 3H5VA 3HMWH 5CFZA 1JU3A 3DX9B 3WHE1 1RZKH 2DQ6A 3ZY6A 3SEAA 5LVAA 2CK3A 5G40A 3ARGC 1D2EA 3ECBB 4JZNB 2ZX6A 3K1TA 3LUGA 5IXSA 3WBFA 2ORBH 3L4BC 3T41A 1JZ3A 4IRZH 2OMWB 5TF4A 1CXIA 3L08A 3S2AA 4XHQA 1HE1C 2AEEA 3HG5A 4LQFL 4Z0TA 4BEIA 1UWYA 3IHKA 1Q9LA 2WWRA 3OEHA 2HYDA 2DYRB 4X60A 1QTYT 3B5IA 3ODPA 1MOSA 3PQ7A 3QG7H 5H2BA 3O81A 1NQBA 2XPGB 3MNWA 1YI0A 5EOCJ 2JD0A 5LVEA 1V6CA 1JEYA 1XZDA 4BZ2H 2HT4D 3BILA 2YGVA 3QVAA 1CK0H 4DVRL 3L0ZA 4YI5A 3BMNB 2Z35B 4X9XA 4M7OA 1NFIA 3O82A 1SXZA 3QYNA 4KN9S 2KBGA 5CINH 3PHQB 1ET8A 2VDJA 3IUSA 1S8FA 3PGKA 4KBFA 1P9RA 3UJ9A 1BHGA 4P4TA 4N8PA 3CR3C 4FMFA 3D06A 4RK4A 3H11A 1B0RA 3HN2A 4BJ5A 3OF3A 2BSTB 3LMJL 4XIIA 3M9WA 4L8LA 4BTEA 3KSRA 5TPWA 3JT0A 5TDPA 5F93C 3NASA 5A0TA 3MBEA 3KYJB 4C4YA 4EVRA 3K20A 5KG9A 1EUDA 4KTEH 3CWGA 3L1OL 4Z2YA 2HLAB 4U49A 3S8YA 3SZLA 5AOZA 4AMZA 4LQDA 3CA8A 4F46A 1IOWA 3FUTA 4B3GA 3IMKA 4RE6A 4OTZA 2P1DA 4W9NC 2CDGA 1V11A 1FL5B 1DSFL 2ZCKH 3CXDH 2FCBA 5CH8A 3AY3A 3DR3A 3OQNA 3IM1A 2DKOA 1FGNL 1KDJA 4NP6A 1XNJA 3O2WH 2HF8A 4M2LA 4HWSA 4NKMA 1RJ9B 1ZJ4A 4JXZA 1AQHA 5T3XH 3EVZA 1UDRA 4GBGA 2VIIA 2VLJB 1CR9L 4HIQA 4S1WA 2D7MA 1Z38A 3WFEL 5I6KA 2ENUA 3L3OC 1NBME 1A6PA 3ABZA 2J31A 3EA0A 1U2DA 1A96A 1GYRA 3AIMA 1PR4A 2TSYB 3FLBA 1I6WA 4JZYA 1OTTC 1L7TH 2E5WA 1MQKL 2WINA 4KACA 4ZW6A 5HGBA 1URLA 4TQHA 3P3YA 4X7DC 1OZTG 3KBPA 2PJZA 3AF2A 4TT8A 3L1FA 5A7GA 4RORA 3ZNPA 2QUJA 3IYLW 4CCAA 4Z7UB 3U49A 3I2FA 3TQCA 3PS6A 3A1WA 4RSRA 3FTNA 2IH1A 4UHKA 4ELME 3EVAA 4X6UA 1B6DA 1RUAL 2J1KA 3BF7A 5EU6B 3GLFA 4OCRL 4XNMA 4XCVA 1JVSA 4EZEA 2OHIA 3L4BA 3TQTA 4BNFA 3SBWC 2C1EA 3OWOA 2I3ZA 4MS4B 5E95B 4RMHA 4YWHA 4Q6WA 3GFBA 4TTPA 1XKXA 3H3JA 1MQ9A 4X80H 1T2UA 2AABL 2AJZB 2IHVA 4ZHQF 4Y4HA 4B2IA 2VQUA 3CFCL 4GRWB 3MUNA 4E51A 2GX6A 3THXB 1RC0A 1W87A 2HWWA 4PCKA 1U1FA 4CGYA 3UMFA 3SGDH 4I9FA 3NRFA 3LKPA 4FZ3A 1IM3B 3ND7A 3P19A 3UK1A 5G02A 4IFBA 1W0WB 5DZOA 1WULS 2NLOA 5JVDB 4M37A 3G0DA 2P5EE 3I9V6 5DK6A 1F8YA 1BDJA 1UBRS 4GLBA 4P59H 3RS9A 5A4AA 1F1JA 1QIIA 1UM9A 4EAQA 4L05A 4C78A 3VVVA 4R3SB 5KOIA 5DD5H 3RVJA 5K99A 5D72L 1UXKA 3WJMB 2X5NA 1DBJL 1W16A 1XX9C 2JJ1D 2W5PA 4JM0A 4L4VB 1Z7YA 4BKQA 1TMYA 1MO5A 2ZXUA 2Y06L 3WIDA 1XQWA 4DR1B 5BV7A 3ZVRA 4DKFL 4MR8A 4IH1A 4HY3A 1TZGH 4AW9A 3BVWA 5E5MA 1F17A 3KE0A 4D9NA 2A1WL 4QE3A 5DM70 1G1YA 5FW8A 3QJRB 2DR0A 4QASA 3EFFB 3FQ1A 1IIIA 1CVLA 3ETBJ 3B9KA 4F38A 3U82B 3E8XA 3HY3A 4DKXA 2Z56A 2ES4A 4ZVMA 3O1JC 3GDBA 3U7QB 1V4NA 4PHCA 1R66A 5AKLA 4MJIA 2V4ZA 3FFCB 4LG1A 1UXWB 3MRMB 1KJWA 5B2FA 4B35A 1KT2B 1WFNA 4OGXH 3LD8B 3T0EC 3OCVA 1D7DA 1AR1C 2NZXA 3DW1X 2DWTA 4O5OA 1XK6A 1PIWA 4RD3A 3RNOA 4CEJB 5JZOA 3EBHA 4BNYA 1JAIA 1DUYA 2Z43A 4KC3B 4JY4A 4MNHA 4F37K 3UYPA 1U0QA 2X4RA 5ICMA 3N9IA 5BW7A 3RPIB 4DGYL 1ZWKA 1J5XA 2JI7A 2G5CA 2WT8A 2BBWA 1GNQA 4G0NA 1HEIA 5BXQC 3DPUA 3EYFA 3EG9B 3LEVL 1A6WH 3DDHA 3RSGA 3OKLA 3S37H 5CFQA 2GASA 2O0JA 3WWYA 5DHDA 5HK8A 1SN7A 5EBMA 4ADJA 1G17A 1NP6A 1UXHA 4KQFA 3O4LD 3TG8A 3QP9A 1Y8AA 2D9QB 2Z65C 4HULB 2PSEA 5EMHA 1RC8A 3TBBA 5F7DB 4JI0B 4NE7A 1VJ5A 1RWNA 3GRGA 4XFJA 3NIDB 1CUHA 2IPXA 5GOTA 4BNTA 2YJTD 5EO0B 4NQUA 4OIFA 2ADJB 2OXEA 4M62H 3T6QC 3UC5A 3G2HA 4GMGA 4Y16B 5I15L 1WPQA 3ZCXA 2BE9A 2VN6A 1HDIA 4FCCA 3X1WA 2WTRB 1Y1RA 1S6NA 1AGFA 3FMIA 1IZKA 4Z9YA 5DTFB 1QG6A 2GTPA 3H75A 1CLUA 2XTMA 1CPYA 3NCCB 3H6JA 3RFVA 1P73A 3UYRL 3U6RB 2P48B 4ILKA 4A6YH 1SLWA 2XVYA 1SXQA 1ZRNA 3VVBA 1W4AA 3ZLUA 3G82C 1V48A 2PKYX 1J8VA 4P2BA 1N8SA 3AVVA 2XVMA 3TFQA 4FAAB 3CZFA 5CZVH 5TK2A 3P9SA 3VZPA 5DQ9B 3RG8A 2IDKA 4FM9A 4R2JA 2OZVA 2ZTSA 3MYZA 2W59A 2XBTA 2WI8A 5DNVA 1DRKA 3T5TA 2YJ5A 4GUOA 3OVMA 4K6HA 3K70B 2QMYA 1PD1A 5E8DH 5I76B 2X4TA 1PWZA 2XT0A 3HQ4O 3AEYA 4P2OC 2ATPB 1IJNA 4IKIA 1O1YA 3UHFA 2CHXA 4ZQHA 1DLFH 3PGJA 3C6XA 2JK0A 4JCWA 1CZ8H 3AZUA 4IICA 2Q8NA 1CUIA 3OH8A 3CTPA 4UXJA 2WP0A 1FMCA 3O4LE 2X6RA 3BWCA 3SKOB 1W4CA 4TVSa 3T7KA 3BWAB 5BQ3A 2PWAA 3SGJC 1TSRA 1E40A 4UAGA 4YR9A 2XICA 3KPQB 4WBXC 3L1OH 2W70A 3RWBA 3MRXA 1PT5A 2IXFA 5BNIA 3WGKA 3T71A 3NZHH 1FA9A 4PUBH 3ABRB 3JQOB 1VOTA 2X42A 1R3LB 1TM3E 4IH4A 3PNYA 4NQEA 3NCFB 3S4YA 3VFOB 2CFOA 4ZSOA 3RRNA 4QRPE 1PR5A 2FT6A 3K96A 1QRRA 1O96A 3ZS8A 1QTRA 5CP8A 4LF3A 5CXPA 3BZFA 2VDMH 3LIUA 5F9JB 2PCXA 5JDJA 3RWDA 2WJ5A 2GA8A 5BW6B 2J8UA 5JSUA 2C5BA 1HKLL 4A5SA 5KWEA 5CEJA 3IK2A 4KI1A 4MD5B 3L3BA 1FC0A 2BS8A 5BO1H 2FB9A 2ZWPA 1WBYA 3WJJA 2XV1A 4MYCA 2F5BH 3GHBL 1I4FB 3G7TA 3JXEA 5ENWA 1Q50A 2ADIB 3CMGA 4JYZA 2OGTA 4ZW8A 4F7DA 4Z54A 2VDPH 5CJ5A 4C4BA 3GEWB 3OHXC 5MI0C 3GLSA 4KXZI 4HJGA 1E98A 1XF5B 4JG5A 4NN5B 3F6IA 3VXMD 1NYLA 2ITDA 3PAYA 1BEYL 2AXHA 5EZJA 5JHLL 1N5JA 3TPCA 2EUVA 1EUCB 1ILSA 4OD2A 1N64H 1U8KA 3NKFA 3D3EA 1PIFA 1YC7A 2DOCA 3VFNB 3P54A 4HADA 3PRZA 1GPBA 3PZBA 1JD9A 4BFNA 1R3HA 5D1QC 1X92A 1KB3A 3G2JA 3TJZA 1NPTO 5E8EA 3NP3A 3O4HA 4N3NA 4YRGA 1KTKE 5D1QE 4B9YA 5C0AD 3JR7A 5IF3A 3BEVA 4Q6IB 5KIAA 2NTVA 4I5BA 4FFPA 1XD1A 1FBIL 3HR7A 4RPGA 4IS2A 1Z0DA 1AZWA 2VSQA 4KWTA 2OZ4H 1QDLB 3EYUL 4U1GC 4DBZA 1PEKE 2O1WA 4RTKA 4R1LA 4PJGE 3WKML 4U2CA 5FBKA 3NWJA 3O3DB 3LC2O 2TMDA 2QUKA 3CRMA 1SOSA 1ZLWH 3QUQA 5FA8A 1Y3AA 5LBSA 5H94A 4NDMA 1HZJA 4Z3OA 3GFVA 4YE0A 2Y1WA 1CZHA 5MEOB 4JE0A 2XQVA 1JDBB 4ZVVA 3C1TA 4BS9A 4MNQD 3G6DH 4QBTA 2GVDC 2FZWA 3FPXA 4Q97A 3S27A 5IQ9B 3O3CA 1DJNA 3MS4A 2H1RA 2KLRA 3RS8A 4TN9A 1SVCP 3GPDG 4H7EA 4LVOC 2WIFA 1MFCL 4K7PY 5SWQB 1CI5A 2JLVA 1HFKA 4XP4H 3SJCA 2AFRA 2OXFA 1F4VA 2DLCX 1WAAF 4MX8A 3SGJA 3WUZA 4COKA 4LWZA 3IIKA 3BXPA 3HDQA 1R3JA 4W9MC 2C5AA 4TRRA 1QP0A 2KPWA 4O8ZA 3JQAD 4NOLA 3QPKA 2OBMA 3M1IA 4PJ8A 3DF7A 4EEZA 3TLRA 2I5YL 2F90A 4QYWA 1YVLA 1QRNA 1W1UA 3VZDA 3AQZA 1UK7A 1TJHH 3CZKA 3I2JA 1ACJA 3RZCD 1BW9A 1M83A 3TI9A 2R25B 5ADUS 2NOYA 5GS0H 3F84A 2VLRA 3VWKC 3PDWA 4HEJA 4YO0B 3LS4L 4KE6A 2QR3A 4LGMA 1U42A 4GQBA 1E4YA 2BGJA 5KQRA 5AVRB 4M55A 1RWMA 1R5WA 1E3WA 4MGHA 4I3GA 3MLRH 2PETA 1D6SA 3L7YA 1KI3A 4OIBA 2ZE6A 4KKZA 1VJ1A 3DA0A 2RAUA 5I17A 3FPJA 3ZHZA 4DMLA 1MNUL 4FE4A 2KMWA 4YMTA 3O75A 1S7QB 2VW6A 3WKQA 3EHBC 2EVGA 1FU8A 1I3NA 2JHPA 4CMIB 3PJRA 1JGUL 4ODTL 2RHCA 3PXEA 1UM4H 1ZISA 1XX6A 4HWZB 1NFKA 3WGLA 2J12B 1XH3B 4DP0X 1FFXA 2WT4A 1PYDA 4RQQA 3DX0A 3E6AA 2XV6B 1JYFA 1E2NA 3T6KA 1KMNA 4I19A 2HTLD 4HA1A 4NWUL 5C6WH 1L5GA 1AOZA 4GBMA 4JMLA 2PH7A 4GH5A 4E9RA 3INOA 4LC1A 2JQMA 4N1EA 1WR8A 1I3RA 1OA0A 4APQB 2W7TA 3C6LA 1LO4L 2MSEB 4X8HA 2F67A 1DZ3A 3QM1A 3HR5B 4LZJA 4RACA 3S99A 3QI7A 5ADOL 1KVUA 5H35B 1ST3A 4U2EA 1UKVY 4EUFA 2ZCLL 4BFYA 3BMOA 1X1EA 3USES 4JM4H 2YGQA 5CB4F 2G5BA 2FEEI 1WSWA 5CD3B 2XCMC 3D3KA 3PEFA 3NGMA 1UZ8A 3MTGA 4RAHA 1VMDA 1RZUA 4RQUA 5CTAA 2AZTA 1N6QL 1T2AA 4MW2A 1KMMA 5ESDA 4KBGA 12E8H 1OAZH 2E27H 4F60A 2CSXA 3ZHUA 1ND0B 5J2TA 5C5EA 4JMPA 4H8HA 4UEKA 5C0EA 1Z4PX 4X8MA 4IIYA 3HXMA 3GRUA 4HD5A 5M04A 4XN9A 2EW8A 4G9FD 2M1ZA 4BB5A 1K3ZA 4MAAA 1Z6GA 5TE4H 5B1JC 5GGSY 1S7XA 3L2OB 1F8TL 4W68A 2JIPA 4DDWA 3LHSA 3QRFM 3NRPA 4WKNA 1OKKA 3KVOA 4FNOA 2V5MA 4RDCA 1IZJA 1O97C 2RAMA 4R1UA 1E4OA 5CJXA 1AE6H 3H1BA 4KXYA 4C76A 2ZYHA 2CXGA 3GJZA 1JZTA 2Z9BA 4BX3A 3I05A 2ZWLT 5KSAA 2XUAA 3AKCA 3SE7A 1PK8A 2FSEB 2K6ZA 5KC9A 2H1FA 1AKJA 3D39E 1RFGE 4U3JA 1E6LA 1CFNA 3UMTA 3HN6A 1MELA 3UQYS 5DF1A 2J0QA 1UPCA 1RRKA 3VRIA 2OSVA 3VFWB 2GAAA 3I3SR 1LL1A 3TNFA 2ID8A 3MD0A 3B3BA 3UT5A 4CMCA 2GS9A 1I7UB 4KH0A 2MMCA 5EU3B 2YUZA 2OLEA 4DEYA 1AGEB 1GAEO 2H6OA 3LNIA 2J8OA 2C57A 1RUAH 2VSNA 3NC1C 3R6DA 3EFDH 3DV9A 1KCBA 2GEVA 2H07A 2QVYX 2ZF8A 1KH1A 2GZMA 3C4VA 5BR7A 4QGFA 3X1MA 5AQ0A 2UWEA 4Z4FA 1P4HA 4WV3A 2Y8EA 4LLQA 3EXHA 1PZCA 3FPCA 3FYUA 1XDZA 4HWGA 3CG4A 4IKPA 1O5DT 3RWIA 2HSDA 3G0IA 2HJHA 4Z8FH 4IMKA 3K1AA 1QE3A 1V8BA 5BQFA 2EACA 3VXUA 4Q48A 4HAKA 1UATA 2A5UA 3QA9A 3L1GA 3KC2A 5D3ZA 4O9HH 5MERB 3P9YA 5C0BB 4CRPA 3NAMA 1G7MA 4HUWA 4E70A 1JIXA 2CSUA 3S2GA 2OZLA 1C3EA 1CJCA 4I5FA 4Z7AA 1LNZA 3FUCA 3AEKA 4X8JB 2PR9A 4FGLA 2WBJA 3LP5A 3WYEA 1WA1X 5JORB 1MF7A 3F7NA 3MR9A 2AR0A 3LS4H 3RS0A 3JBG7 1U5BB 3DSFL 4Y1GA 4Q66C 4X45A 4C4AA 4ONEA 2JJ2A 2D1FA 4M1DL 3UC0L 3NMUF 3SHFA 1EWRA 4IW4C 1T7YA 3JAWA 3SP1A 3DEFA 5GOZA 4PJDB 3JWGA 4JE4B 3SBDA 1VG0B 2PD6A 1NUDA 3QRGH 4ZD6A 4V3CA 4QPCA 1ZVQA 2NX5A 1A7NL 3L7JA 4C57C 3NZEA 3NHWA 2WFLB 1WAAE 2WBJD 1AB6A 5H4GA 3WFBH 1XLUA 3QJHB 1OW3B 3UK6A 5EKXA 3JR3A 2B7CA 2WD9A 3M2TA 4EHFA 3SYRA 4C4TA 4XMZA 2GK0B 1M6YA 4E03A 5HKBA 1QPPA 3MROB 5E08H 4E5XG 3GLRA 4GQAA 3WZ2A 3GGGA 2QTLA 3Q0IA 1QSFE 1ZXBA 4IRJD 4C43A 3HBJA 2WD7B 3AOGA 2AJVH 3WHIA 3N40F 3U9PH 4UILH 1A4JA 1Q20A 1OSZA 4PJEE 4RKWA 3CDCA 4YSDA 1GKEA 1QYGL 4YHLL 2RHTA 2A0YA 1R18A 3WYAA 4M9QA 2CK0H 3P0VH 1UL1X 2WUWE 2B4CC 4H5SA 2V9UA 3DE0X 5IVZB 3H1AA 3O6FC 1UP6A 4DMKA 4YRAA 4J29A 4OL0A 2EEAA 4D57A 4PN3A 3T7SA 4EHHA 1U99A 2ZWMA 4HGPA 1A2YA 1HG1A 4EW1A 3F58H 4KUCF 5C92A 3NZ8B 4HNGA 3WNZA 4KKAC 2BFFB 5I1JL 1T5LA 1HYQA 4LF7B 4A7VA 1USIA 2O2CA 1PYWB 4Q0XH 2XT1B 4DIMA 2ZJ5A 3SDSA 5EEHA 1WTLA 4K2HA 1TQWA 3S5LA 2AUTA 1JYXA 3N0TA 1B2YA 2BJHA 4HKXA 1WBDA 3DMMC 4NM4L 1LQUA 4DBLE 5FUZH 1BVHA 1EH5A 4II2A 1MAVA 4RCZA 4L4XA 2PX4A 4E6PA 3EQ2A 3EPPA 4XPBL 1E9EA 4DDUA 2I66A 1GRWA 2EBWA 3GZNA 1GFZA 5CZRA 2X15A 2IELA 1ECLA 4ZCIA 2ASEA 4UDTB 2A88A 1E9FA 2JLAA 1CYEA 2WZ6A 3DLBA 3VR6H 2AZ4A 4FYSA 4EGAA 2JVIA 5JFGA 3F7OA 4AG4L 2HNAA 5F88B 1EP3B 1BDIA 2W8CA 2H63A 2HWYA 5D5PA 2DULA 3UTPE 4PG7A 1PV2A 1EVLA 2AC7A 2H17A 1PL6A 1FE8L 1HEZB 1YHPA 3QHQA 4KZDL 3LRGA 3HB3B 4X6CA 1YA8A 4JR2A 5JO5B 5D6DA 2RHGB 2P0AA 3AS2A 2EW1A 5GV7A 4UM9D 1RUML 4NAUA 1KCWA 5JU6A 1AR1B 3ACBA 3D0RA 1U8QA 3G9ZA 4B5EA 3BWEA 3LKOB 3OIUA 5H0IA 3DARA 5LZ9A 1RU9L 4LCBA 1F2TA 1O54A 5LDGA 2WQ8A 2UWEB 4B5ZA 1BE1A 5C2JB 3U30B 2WVJA 1DIHA 3PABA 2Q9AA 4N8VB 1U91A 3E2IA 3TN7A 4ND2A 4DCVA 1O95C 1LO2L 3DEYX 4QPNA 5C71A 3H8NA 3O4OB 3VTFA 5BN3A 2P79A 5E6ID 1GUBA 5SY6A 3MRCB 2ECOA 1I3LA 3QFHA 5JECA 2PUGA 2CNZA 1NMYA 3TR0A 2UWEE 1T9BA 3G2PA 3SBXA 1N3NA 2VT3A 4G7SB 3OIWA 2QP9X 4IJWA 3JQBA 2JCBA 3QIWC 4LAQH 2OVFA 1GZHB 4C03A 4KPGA 2AIRA 1E3ZA 4G1BA 1QCDA 4QXTA 1FQWA 5DO8A 2BOLA 4LSZA 4XVOA 2O54A 1M34A 2XFXA 1C8VB 5TQ2A 1E8WA 5FOTA 1V3VA 3D51A 3FOLA 1TKBA 1FNMA 2B2NA 3FU3A 3G8YA 4ZI3A 3IDFA 4UU9A 4AWAA 2ZG1A 4CTOA 2GLUA 5MP6L 5FEBA 5CURA 2APWA 3O03A 5E1GA 4QHLA 2AEPH 2O0MA 1IXZA 3CF2A 1J05A 3D52A 4DGIH 2ED9A 4QYAA 2HA2A 3OLGA 1I6KA 4WLVA 4APQD 1YS6A 2OK8A 2XXBA 2W6OA 5AENA 2ZDQA 1NFDF 5C0ND 2WBLC 3FZNA 2G70A 3VUAA 4QGBA 1XEWX 3ZCTA 2VDOL 4A0HA 1TVBA 5FOVA 4I1UA 1AQ8A 1GGNA 4D41A 1KXTA 2C1PB 1SKBA 3GIZH 3S7TA 4LHXA 5DJXA 4HDNB 3WTBA 5KVDE 1WCQA 3VXNB 5J1TB 4NENB 2JFOA 4LY6A 3RIXA 1QLHA 3H9BA 1HURA 3SOBL 4QUOA 3RJ9A 4DNLA 5CH3A 5GJBA 3G3LA 1QBLL 2A5YB 1SVWA 3RK0A 1I4LD 1XSKA 3EFEA 5CA1A 2QPOA 3UW3A 1D5IH 2YRZA 3QFGA 1BEEA 3RQ3A 4M76B 2ZT8A 1AVTA 3GAZA 1AQIA 2BZ7A 4RSGA 4PLHA 3H2BA 3NT5A 2EDJA 4MUNA 3N1PC 2ED6A 1LI4A 3LPDA 3ZWMA 4BOYA 4OM0L 3NJHA 5SY9A 4HLZH 3NBAA 4OI1A 4PJ5D 2Z31C 2YD9A 4L2IA 1KH2A 2FJPA 1H0DB 2YOGA 3ZZNA 2QGFA 1XIWD 3ZDYB 4OQTH 2IIPA 2W6NA 1ZHBB 5HBBA 2XB2A 2V98A 2JLQA 1FAIL 5ADVA 4FX5A 1E64A 3FTCA 4IIXA 1KBOA 1RK7A 4FK8A 4JHUA 2DI9A 1G94A 4N40A 4OGXL 4KHZA 4GLOA 3FQUB 4UU7A 1G9EA 1T7WA 3LCYA 4HDSB 2VXQH 3BYYA 3I02B 2HB6A 4NMMA 7YASA 1UEMA 3IVKB 2HMVA 5CR8A 4OV5A 5F3BA 1WMBA 5IB3A 1C0KA 4BX9A 4Y5XA 1H1TA 3AFCA 4YT4A 1MT3A 5DCYA 5KBPA 1VJCA 1LF0A 1OM3H 1T2QL 4JHAH 5BQ5A 1O6BA 3AO0B 4UINL 3VTTA 1Q9WA 3GH3A 3BFXA 3NBYC 4AXBA 1BW9B 4EIBA 1WF5A 4F1ZA 4C06A 5ICFA 5JBNA 4ARZA 1HTYA 2X0DA 2FGKA 4QKXB 3RWHB 2AW3A 2F1KA 3OBBA 4B7AA 4DKEL 4U6XA 2B7LA 1GGCH 3WSWA 5F21A 1KU0A 3QU4A 4MV0A 3H9SB 5AD0B 5AWNL 3HC0B 4Q7QA 2OUKA 4QEKA 5ID1B 1RZ8A 1KZ7B 1XJWA 5EUKA 5C0BD 4NHCL 1A2KC 2QRVA 1IBSA 1VL6A 2LE0A 4RPKA 4U5XA 4CU7A 5BT8A 3P3TA 3MG9A 4P3OA 3LKBA 2B9BA 4ZT6A 2Q7YA 1MIML 1BZ7B 1OGYA 1EINA 4E1VA 3VGEA 1H3XA 2OHFA 3GT0A 5JW5B 3HA0A 2IY8A 2PPAA 4WEMB 4R1MA 5EE5B 5IAOA 3SDAB 2WXKA 4GW1B 1CQIB 1UM4L 4EIGB 4AMYA 1I1AC 2P7TB 1KY6A 1S7SA 5DRXB 2PWZA 2QW8A 4AQ1A 3RTDA 1CLOL 5BR4A 2O8FA 3TMAA 5AUOB 3VH8G 1YK1A 3KJXA 5DEFA 1P6FA 1M71B 3CC5A 3MROA 1MCHA 3LPAA 3TBWB 4L5IA 2CXTA 5CA0F 3UTZB 4OZFA 5JDSA 5IJBC 1MCFA 5EIHA 1U2YA 3SF0A 3BGVA 3CVIH 4Q3AA 3RROA 2J4WL 5COAA 3S2SA 1CDCA 2D3TA 2ZE7A 3RGGA 3HDHA 4GI6A 4Q6IA 4BUGA 1BSIA 4L3EE 5TF0A 3B9AA 3K0BA 2WBJC 4FQ2L 4PQXA 4WKZA 1IO4C 3T5GA 4R1QA 2BNRD 3J07A 3DCNA 5J9PB 4PJDA 4GI1A 4H4CA 4MYUA 1X7YB 3UG6A 1U0GA 1UGKA 1YDPA 4UARA 4EEKA 2DS4A 3DG9A 3FYHA 3U9SA 3F6YA 1PMYA 3EAKA 3D39D 3B3FA 4HZAA 2PUCA 5GGYA 3SY6A 2X0KA 2HPTA 2E4YA 4HJGB 1R10A 4JQXC 3VXUE 2G04A 3D0VA 5GHWH 3ETBF 3TECE 3DVNA 3BB1A 4DPCX 3IQHX 4GMTH 2DKUA 4EFKA 2AJUL 3UHOA 2C5SA 2B0SL 3B1VA 5DS1A 2YQ5A 4E3ZA 1VERA 2VPXA 3RNLA 5TB5A 5IB1A 4TKUA 3IEVA 2DT5A 5D93C 3UP1A 3KHUA 4DGWC 2FSDA 2I5YH 3D85B 3QW4B 1A97A 1I51A 1ZHLA 5GY7A 2ONKA 4E88A 1SEBA 2JKTM 3FH7A 2P5WB 2CCKA 2WJ4A 4AIZA 1G3QA 4OXRA 1I3GH 4XP1H 3BFKA 4Y2DD 5DJ6B 3AV0B 4FDTA 3QLEA 2YD8A 4XWGA 3X1JA 4JIGA 1TF2A 4G2TA 5JALA 5TGBB 4PHTA 3ZGIA 4PGGA 4UM7A 3UPRB 1KR2A 1DELA 4FQQA 5JO5A 1KY4A 2ZT9C 3EC7A 4CMAA 3O9WB 2ZSDA 2VR3A 3BWAA 2E9GA 1BN7A 4R05A 1K4KA 1G2OA 2R7KA 2E9JA 1QFOA 5DWDA 1QHGA 4PC1A 1Y4UA 2C7VA 2UXGA 2GSDA 2MYUA 4K2AA 4OQYA 1YA6A 4WU7B 3LLUA 3KSUA 2Y27A 5CB4B 2WWVD 1INDL 2JHFA 2Q2QA 5L95A 3JTTA 3KSMA 1MCQA 3O4LA 1GMEA 4PRIE 1NGZB 3DHJA 1E3JA 4RD1A 5ICYA 1GEGA 1R19A 3A4LA 4UZSA 1T66C 2OQJA 6AT1A 1VI2A 2YKLH 4ZQTA 1GRNA 4JC8A 2HRGA 4NRZA 2FN9A 2XVXA 4PRYA 4QDXA 3EEYA 1HYBA 1SVSA 2F1OA 2AITA 3IDXL 1D7FA 3NCJL 2J20A 3DKVA 1MCSA 1N6LA 4M3KB 1M33A 3BFVA 1MT0A 4FLHA 3D3JA 4KN5A 4GG8A 3W2IA 4BDVA 1YZTA 4H1UA 4GIAA 5IROC 1UBCA 3W0WA 1FDWA 1IQUA 2NY1B 2XXJA 3V8PA 3M1BA 4HYTB 4Q24A 4EITA 1EFQA 4PLTA 5AOCA 4DYHA 1ND0A 4NJMB 2PSJA 2BFPA 2VJDA 2VLKB 4KRLB 3N2YA 5I74C 4QCIB 3RJOA 2O2HA 2D7JA 3SIKA 1ZGLP 5BVGB 3LY5A 1Q1QA 5E2TH 3VA7A 3IEXA 1HNZB 2BVQB 4OTXL 4WQMA 1KIFA 1X7SA 4AZ3B 2XIDA 1JFLA 5DFVD 1OSZB 2KERA 2PWYA 3WICA 4S1RH 1WVIA 1TTGA 3CXHJ 2IFTA 4F15C 4PF1A 2VQ3A 4YDKH 2KE5A 2JIXA 5L2KD 3KD4A 1S78C 4UBDD 1FUNA 3A6BH 3WL8A 2HW8A 4E5NA 4Z7NF 4IHOA 3MN8A 4IVNA 1USKA 1FW6A 2J6CA 3QIBB 4NBUA 4D0BA 1NGWB 3VNBA 5LXVA 2VAPA 3QFSA 1GOTA 4DGVL 3WWZA 2J3KA 3RPIA 1WEHA 1WB9A 4BK8A 2IL1A 4IIQB 4Q6KA 2HK7A 1EPUA 3ZIUA 2QVTA 2PAFA 3KP1A 1PJBA 2J4WH 2YAOA 3WMXA 4BVJA 4BN0A 1ZA6A 4UT9L 1EFKA 3KR3L 4KTEL 3GO1H 3GS7A 3T12A 4CVXB 3GDWA 4NBXB 1BD2A 5JTWA 2D31B 1MI5E 1TUBA 2QM0A 4U2ZA 4FONA 4PFJA 1HE4A 2DWYA 3HUJA 4ZZFA 3PD0A 1Y7IA 3TA4D 1K68A 4PRHE 1U7TA 4BBZA 3U7QA 2UV3A 4XWGH 4IRZA 1GYAA 4JRXD 4R7TA 2TRHA 1RI4A 2R1TA 4JI5B 5CMAB 3B9KB 4IIZA 3GUTB 2BFWA 4JDVB 2FPIB 4W82A 1P1FA 4HS3A 4QTIH 1NVBA 4ZT1A 4A04A 3AM5A 4RSHA 2Q3ZA 5DWUH 4WV1C 1CRWG 1AGBB 4X50A 4Y0VA 1X3SA 3PDOB 2WKOA 4PS3A 1VYUA 3RASA 1SKMA 5HZHA 4PJ8B 5ICUA 3VXMA 3OPYB 3DPIA 5LAXA 3WJLA 1HNNA 4CMGA 3HHSB 2R1XA 2WNXA 1I7TA 2QTVB 1TGVA 2GLXA 3IFNH 1M2GA 4RLDA 2OTWA 1IXSB 1WLSA 1RAMA 4TXJA 3TGWA 3O41B 1GVHA 5I9BA 4R97B 4E5DA 1KB9K 1A8JH 1VDGA 2QSUA 4K9EH 4B0MM 4IY1A 3AP2A 3PPEA 4K5QA 1LI5A 4H7FA 4OGYH 1IWOA 5GGXA 1CZRA 1I1AA 3I9GH 3M33A 3EWAA 4GUDA 2L4OA 1WJGA 1DQMH 4C4OA 3BX1A 1RVDA 1AKMA 4GX0A 3ZGYA 1L8AA 2YY7A 1YJDL 1IBLB 1KIRA 4IU3A 1ZGLA 4WASA 2JAOA 1CY8A 1E0KA 2DTML 4OFZA 4IEIA 2VAAA 4HWBA 4QRPD 1T3SA 1XTUA 3LE8A 1YCDA 5LJYH 4BQQA 3V9CA 4ZV4A 5JSFA 2JKVA 2C2MA 3DAYA 4Q7MB 4MS8C 1D5XA 2B5WA 5GIRA 5KTSA 4HPJB 3VISA 2CLIB 4L22A 2O05A 3WU1A 4RMGA 2F3TA 2IWRA 3QUYC 1BXVA 3NTCL 4IDLA 3AF6A 1JKJA 4GP8B 2UUDK 1EFVA 2I6TA 1ZTXL 5AT1A 1P4IH 3RFRA 4F9LC 3KLDA 1YFKA 3HACA 3C8KA 2A38A 4R1SA 4OCZA 4KK6D 4W9HC 5EXSA 2FH6A 1RXYA 4U8HA 4V1DB 2WN3A 3MJSA 3LB6C 3GCGA 3NGBC 5FH9A 4N2IA 1EE1A 3L4ZA 3DVIA 1YUKB 5IVOA 4HUVB 1YBVA 2F53B 4ELKB 3ULUD 1FL3A 1UQSA 5JCJD 4NJ9H 5IKCB 4HD8A 2IP1A 3E5HA 4OGYL 2Z31A 1T3ZA 4CG0A 3STZA 4NN7C 4YJGB 3ETJA 2AF2A 1NVVQ 2FHPA 3P9RA 1DBAL 1FYVA 4XB6B 3PAZA 3JQ9A 1KUMA 3GDCA 4UNUA 4EYOA 2O23A 1HZLA 1KEWA 3A6JA 4TWJA 4BNZA 3COJA 3K8QA 5JPNC 4WXPA 1RY7B 2X41A 3NDPA 3TFKC 1ULZA 4G8IA 2I2CA 3BZFB 5I1AB 4JGBA 1BA2A 1FPMA 5I9TA 1J5OL 1G20A 3JVGA 4G1EA 3GUZA 5BSTA 1MCPH 3UJ8A 3IMVA 2HCBA 3QNMA 4FCAA 4GYBA 4NS1A 4PJEA 1KR5A 3KSZO 4BMDA 3TASA 5AW1A 4BK4A 1D5MA 3GN2A 4UMDA 1AJ7H 4Q00A 2C8LA 5BV0A 1V1RB 4E7PA 2BSTA 2GUWA 3EOYG 3BAJA 4PWEA 1H9VA 4KV5F 1FNEA 2WINI 2EBHX 3IDQA 3PU6A 4R9NA 2N1BA 4H8UA 1GAFL 3FCTB 3JWJA 5TV2A 3MV9D 5IN5A 4FUQA 4PLKD 4TLUA 3V4PH 5E94A 4RTPA 4FW9A 3VH1A 3MMZA 3KWTA 3FLEA 4AY5A 4D3XA 2EUXA 4WO4C 1JHMA 3B78A 4X5RA 2PWDA 3KZNA 4LP4A 3IP9A 2WZPA 1R5WB 3Q9SA 3GG9A 4UAOC 4JP2A 1J7KA 3VD0A 1T1RA 2WDPA 1F5WA 5H2BB 2J3JA 3JVVA 1I3CA 2YYSA 5KNBH 5IG7B 2C4MA 3EZ8A 4MPPA 2FU5C 4JLBA 5F3HB 1ZI6A 4G1CA 3CEHA 1TZGL 3RY4A 4MYTA 3NR2A 3N87A 3GFTA 4DIFA 2J6WA 1DC7A 3OFNA 4YNYB 1LEHA 1XGYH 1H9CA 3UAJD 1U2QA 5F9HA 1R0SA 2Q4OA 1VEOA 1AA9A 2J3LA 1QFSA 3FO1A 1C50A 2WAHA 2ZQ5A 3MQ2A 5EA0H 2M6LA 1KY7A 3WQBA 5AW7A 3D48R 3GVIA 4Q9QL 2WYOA 3GELA 1N2EA 1ULSA 2BMAA 4OQDA 4IINA 4R7XA 4HFWB 5GRYA 2VOTA 3V5DA 3ZH9B 3R1GL 4EW6A 4HATA 4MA8L 4OLXH 2C4UA 4J4PA 4QRFA 3Q3GB 5D3MA 4NPJA 3BWSA 3T1WA 5CTJA 1UK6A 1HL3A 4ZYXA 3TH3T 1Z68A 3GSXA 3ET4A 2O0HA 1H4QA 3FFAA 1XXFC 3N9GL 3ARXA 4RSVA 5EMLA 3R7SA 1JV5B 2UX6A 3AHJA 1IOLA 3Q2LA 2X8LA 4NX2A 4DO5A 3GF8A 2EQ5A 3QPBA 4A4DA 3HCOA 1C9KA 3FRPA 4O29A 2AVNA 3L02A 5AHWA 3BYTA 2BIQA 2HK8A 4DN3L 5CT8A 1D7OA 1Q83A 4BWTA 4PPTA 3CSUA 4LL4A 4OZIB 1RHHA 3DOSA 1M6EX 4TKMA 3UO1H 1YONA 2GN1A 3TEYA 3EMDA 5AL0A 2W1NA 4RTMA 5C09A 2GD0A 3KS9A 5GSVB 3V8QA 1ZSVA 4L1TA 3B20A 3LWBA 4BZPA 1A76A 3W6UA 3SO5A 1I8UA 3TCNA 1SEQH 2OENG 4GPD1 2P8SA 1BXGB 5BUGA 3OHMB 1XR9A 4FJ1A 5I8OH 2C9YA 4H1LH 2WV3A 3WDJA 3GGOA 4UREA 1Z5UA 3G1WA 1YFZA 6PCYA 2AQSA 5IEKB 4U7PB 1FFHA 2Q2OA 1PSZA 1R24A 4RMRA 2ZCVA 2QT0A 4YAOA 2ZBFA 3LVTA 4W9CC 3F64A 4BXSV 4MA8H 4V2UA 4XVQA 3MLRL 5ALQA 1G9XA 5DJ2B 1IIRA 2ZRNA 4LRUA 2HBQA 2HQRA 1ADYA 1NLFA 2D2EA 2W5UA 5FBLB 5EB9A 4NZYA 5G1OA 1TKAA 2CYCA 3BSHA 5G41A 1K63A 3CFEB 2EJCA 3N6RA 4D9GA 1X7YA 3WUWB 3IS1X 1WBYB 2VW7A 1SU6A 1VLQA 4NWIA 3P3UA 3S2IA 1GCUA 1BXGA 2QRQA 4OQTL 2PLAA 2HA4A 4I1SA 1J8QA 1DJPA 3QWNA 4FSXA 5J2UA 1TOAA 2QP3A 1B2RA 2BONA 2G72A 3MHPA 1NL0H 5IWAB 4FIZA 4R6WA 3H2QA 4ERNA 4EKGA 1Y9JA 1CNMA 5IULC 4V0SA 2JLYA 4I0PA 2E75C 1SKYE 2W9EH 3R76A 2I24N 2HEIA 1S78D 1YZQA 3U16A 1AUOA 1G2QA 4EG3A 2NZYA 1WFOA 4PC3A 1FP4B 2DEYX 4ODHL 4IHOB 4J3OH 3I12A 2BKXA 2FOLA 4MR7A 4WNQA 3JVEA 3N0XA 1KL7A 5H8DA 4BC1A 4AJ1A 1NBYA 4IGBA 3VRJA 2J9GA 4YAIA 2XRAH 1BMWA 3SQWA 2BGRA 4ZT5A 2PCLA 5IOKA 1X9GA 3AM8A 5T1KA 1NYTA 3IRVA 4WFED 1QTSA 4CTNA 3VFGH 4JENA 3T9EA 3FAWA 5DMIL 5M7EA 3S4SA 3WTVA 1N5KA 1LTHR 2O5NA 4DDMA 3CPSA 1LB1B 3FTDA 3IHWA 4PJ8D 4HX9A 2WSKA 1W80A 2K4AA 4KEAA 1E5ZA 3F7PC 4MWFA 5CR9A 3R44A 4X71A 1F2DA 2IIBA 4WEUD 3FMVA 3HA2A 3GQBA 2UAGA 2H59A 3WNVA 4WOBA 5D1QB 1H2FA 2C7FA 4WFQA 4YRLA 4HISA 2XYQA 3WLHA 4PM4A 3QF7A 2QDKA 2G9QA 3CUYA 3RDTB 2BPOA 4YXLH 1SU8A 3QXDA 4EEXA 5C81A 1LC0A 3MD9A 1HI9A 4J7AA 2RA1A 1I0LA 1MOEA 5HM6A 2X4OB 1WAMA 4LJ4A 3KVDD 4YHIB 7FABH 1NAHA 1WU7A 5I7SA 5CN3A 5L4JA 4XT1C 3E61A 3E8UL 2YMXH 3GZKA 2POQX 2AK4A 3HZOA 3GLKA 5K0SA 1T25A 1O6GA 3BHMA 1CXEA 4BZXA 2OV2A 1K8DA 2W94A 4HDSA 1G291 4M7WA 1K9VF 1WIOA 3QF4B 3G5MA 4MK4A 2ZXBA 3OXSA 3ZGNA 3SE8H 3T06B 5IJKC 5EOVA 5KS9B 5HGAB 1VE7A 4X4MA 1GTRA 5KVQA 3PX2A 1JHXA 1HINL 3TWCH 5I66A 2I7DA 3AB8A 4Y5VB 4YHPB 1NL3A 4OIIL 3EXIB 1IEQA 1Y80A 1HN1A 1PEYA 1MWAB 2OD7A 1CICB 3KLAB 3U2JA 2BZSA 2VZVA 2H18A 5T1LA 3ELBA 3IP5A 1MHPA 2QORA 2WG0A 4H3HB 4G1EB 1X3LA 5D9SA 2OPCA 3WY4A 1P1KA 3SPVB 4EDFA 4E7OA 4W5OA 3VWJC 3UAWA 4XIJA 1XF1A 2W07A 5JPMC 2I4RA 3VG9C 1EO8H 4EMTA 2VHXA 3QEGH 4AWBA 4W5WA 2XIBA 2YD2A 4ZUTA 1YS4A 3TO4B 3STZB 3MXVL 2I2FA 1SN0A 1FHNA 2XCUA 2VDLB 4HIXL 8OHMA 3D8BA 5EBLB 1OPRA 3HA5A 4HQRA 4DMMA 4EI5D 2ONYA 4RVUA 3ISRA 3OSZA 2LP4Y 4QIHA 3P9WB 2DBYA 1QYVA 2ZCLH 1NNI1 1NQ5A 4BB9A 3L3IB 3CSYB 4O4JF 4FF9A 1DAFA 3EQ7A 4P4UA 4XMTA 4ZEWA 5ILOA 1T4WA 1BFDA 5C0CE 3BIXA 3SWWA 1ITBB 3H17A 4PYMA 1UXSA 4K3JB 2W9DL 2O0LA 1E2EA 3S2CA 2YBEA 1D07A 4N8VG 4DARA 1UJTA 5JLAA 2LBPA 3NEJA 4UTBL 4R69A 4HNAB 3WLWD 3DXAB 4DP8X 1FK8A 2K8QA 3G17A 4A2EA 2A33A 2NTSP 5THXA 1QEXA 3VKUA 2FFBA 2ICEA 5D1ZI 2XDHA 5JOPD 1WTCA 3PUWA 1GH7A 1L1FA 4CC4A 5E00A 1YHNA 1PSWA 1KACB 1Z0FA 2RFXB 2VNAA 5ECDA 2CBOA 3MLVH 2WIMA 1M2EA 2PUDA 3DJTA 4BGIA 4MNGB 2PP8A 3AR4A 2CNOA 4HXGA 4XHJC 3DVFA 3F7MA 1X94A 4MMXC 3V0DA 1GMIA 4FQXA 2HJSA 3EHDA 3GBMH 1TE2A 4CGTA 4IG4A 2HRZA 5DI3A 2AQTA 4NQEE 3VW3H 5ITBL 4IVRA 3OI7A 1INQB 5KYUA 4F7TB 2ZJYA 1JT9A 3AXSA 4HDRA 2CWDA 2YEQA 1LMKA 3TLEA 3OJ0A 4WEOA 1TTUA 5YASA 1ROCA 3NCEB 1C1EL 3MLSL 4FRWA 1WWBX 3GLHA 2VQ1A 1CJKC 2XV2A 3H9SA 2CRZA 5AD0A 4MDEA 5JD5A 4ICIA 2H8PA 3AHEA 1QCCA 3FN9A 3WYBA 2IKQA 1AS6A 2IYVA 3LY6A 2P8JA 3AYXB 5I4KA 1MCIA 5HF9A 3A4EA 5IBRA 3ZGOA 2AI1A 3GLGE 4X0KB 5ES4B 4YASA 3L7FB 2YICA 3RVTD 3POHA 3U46A 1ZH0A 5BWNA 1X3DA 4XR8C 1TAGA 3V6OA 3AMKA 4PUBL 4FR5A 4RA6B 1E1RD 1UJ3C 3D4OA 5I5JA 4EI2A 1AC6A 2XEDA 5H1YA 1E4JA 4DT1A 4JYCA 3KUKA 1KZQA 1ESZA 1AZNA 4L9RA 1OUMA 1I1RA 3VI3E 5DHTA 4F8NA 3FB1A 1MHCA 5DRWA 3QTBA 3HPLB 4NKMB 5CU5A 1Y3IA 2I8LA 1Q7RA 1YI8A 3FDIA 2IPTH 1EVTC 2UZIL 1J0XO 4OK6A 4KGJA 2J43A 4MRNA 4D9EA 2VP6A 1ZS8A 3ARPA 4Q19A 3M34A 4LDOB 3QVWA 3LLCA 4RDIA 4P38A 5GJTH 3VU1A 1M2KA 1M2FA 1H0DA 9ATCA 1RU9H 1VI5A 1TPZA 1FJXA 1XRPA 2I4NA 4X3PA 5JDIA 2FO4A 4LYJA 4Y4KD 3ZYZA 2JQZA 2IH3A 3AIIA 1BW8A 4PMFA 2JJSC 4K86A 1I2DA 3M81A 3QEKA 2VM3A 1AANA 4UW9A 3R06A 3QUMB 4CM9A 2OGZA 1E9RA 1GYPA 5IQLA 2IV2X 3I50H 1O8CA 3PUCA 4FQ7A 4PP1C 1X15A 4H5SB 5DD0L 4ELMA 3UENA 3O74A 1ZDMA 1G7RA 1HNFA 3FT3A 3ZTCC 1VENA 4P9NA 5EERA 1L4YA 1OSPL 1WZ1H 1OILA 2GN2A 3SFVA 3PWNA 4KQ4H 2FECI 2WK1A 5K0FA 1B4DA 5FOJA 5B6JA 3AVUA 3LXAA 4UXIA 1QSFD 4JKOA 1YQXA 4GT7A 3QRWA 1XVUA 5F5XA 3D1MC 1E79D 2ZUEA 1QC5A 4NJEA 4TPKA 4YUZA 1J9ZA 2ZJSL 4TKZA 1NDTA 2X0WA 1E2BA 4K94L 5FFGA 4KQ9A 4X8CA 1L4GA 4XH9B 2GI4A 2DDQH 1NF9A 2P28B 4FFYH 3I9FA 1T0PA 3CH5A 3SYCA 1ABFA 1DO2A 2Z2KA 2AV1A 4QNRA 2D0OB 4YCDA 1FWXA 1DKQA 2VP4A 2GR9A 3EJYD 4N28A 1Z39A 4FMPA 1SCDA 5BSMA 4CYMA 3SEPA 1BOGB 1VM6A 4FNLL 4XVJH 5T5NF 2QDVA 1FTNA 4R4NC 1QHQA 1XZIA 5I28A 3SJZA 4UTXA 3LY8A 2EO7A 2YUWA 3I61A 2WSPA 2ZWKA 3KYOA 3I9OA 2DPHA 3F5MA 3FTGA 5AW0A 2IXTA 4LPSA 2NY4D 4M0EA 5G3ZA 1H3UA 5T3ZD 4TL7A 2G5PA 5MHTA 3AEKB 2DBRA 3WKAA 2DJIA 3LNGA 2QTAA 4POZC 1PYGA 5GS3A 3FSZA 1VA5A 3DONA 3V6LA 1CQJA 3BFPA 2GSGA 2FPXA 4MBOA 5EINA 2OMNA 3LBHA 3RFZB 2NAFA 3VXUB 4B4DA 4A2LA 1VG9B 2XJKA 4PRHA 4E41A 1ZC4A 2XZAH 3LB6D 5T1MA 4KPUA 4LARH 2NSDA 1BIFA 4LZLA 3G6WA 5FB3A 5K6AA 4WAFA 3GMIA 2V65A 1JEDA 4NV1A 3QU2A 3DBLA 1P5VB 2A9RA 4RY8A 3F5WB 2OCYC 4WOKA 3BKWA 1SEBB 4YJFB 4G0MA 3OE4A 3M6MD 3OB8A 3C12A 2I34A 1ESEA 5DVOA 1BGXT 1GHFL 1JGUH 4ODTH 3LBIA 1VPLA 2D00A 2JFZA 4I2XA 4QDGA 2IANE 5CJQL 2WWMC 1ZGZA 4BO5A 5EIBD 3V9PA 5KYXB 1R4NA 3WY2A 1A7KA 2VC2B 5AYTA 2BEUA 2A6DB 2XYGA 5AVXA 1YRQA 3GI1A 1YNTB 4RXUA 2VR6A 2X70A 4LCJA 1CF8H 1N2GA 2WJ3A 2OSWA 2CVPA 2CV0A 5JLZB 4P4KD 1CLCA 1B4LA 4R5TA 5IKMA 1RK0B 1OB1B 1H6AA 1T0MA 3QNXB 4KOAA 1GC1C 2BS9A 1LRJA 1KJ2A 5FOXA 4I1YA 3Q6IA 3Q2KA 2YD1A 2C3GA 3MAWA 2I3DA 1P1BA 4XBPB 2BZDA 5J9PA 3BHBB 1YU9A 3BUQA 2RHLA 1J10A 5LZ7A 3RC1A 5HTOA 2DIBA 5DT2A 1F58H 1CL7L 3ANNA 2KW5A 1OF0A 2IQAA 2XB8A 3GA0A 3W9UA 1WS6A 3KZKA 5BWMA 2EEBA 4YP7A 4DCPA 2KJQA 1DLJA 1PGQA 4I81A 2CKMA 4L4TE 4E9YA 2NW3A 2Q49A 2ZE5A 5BRZE 1MCEA 4L8BB 6PFKA 4D46A 1J0JA 4UNIA 2P5ED 4BUQA 3U7JA 1IFHL 2FOXA 2ZDGA 2NYRA 2D8AA 3OJCA 3I9AA 2HC9A 3CC5B 3NKLA 2ZSIA 1WIUA 4M46A 5K39A 3QG6A 1DFGA 4KLCA 3IJSA 1WFJA 2QB5A 5JAZA 2NW6A 2ZYSA 2CFIA 5A3VA 1RIVH 1KTIA 2X1XR 2X7LB 3O1LA 3GHHA 3W5CA 4WFFD 2IOFK 4O3TB 5GISH 5DM4A 3D4YA 2C7PA 4KQJA 2GJZA 5DN9A 4U2DA 4ELMB 3VXOB 2DKNA 3L3GA 1DXYA 4N3CA 2A5LA 4W5TA 5LAPA 1U8HA 2X0RA 2P41A 2NZ2A 3V0GA 4IIUA 1HLFA 4IRUB 3ROZA 3H3KA 5E6SB 5LCVA 1X2EA 3QVVA 1T7XA 4GSKA 5DFAA 1H23A 1ZANL 4A39A 3NJFA 2EQDA 1KARA 2BJMH 1KXZA 2HFEB 2C9MA 1XH3A 4YAQB 2VS1A 5GGTL 4YRIA 3REVB 1AC0A 2IYRA 1CQZA 4PJFA 3UXMA 2WXMA 2Q0SA 5E0OA 5COBA 1P5UC 2R4SH 3ARBA 5C7ZA 4W4OA 4D9FA 3FVRA 2GBAA 5BOSA 5LNGA 1KG0A 5REQB 1KEGL 3BAZA 4F8OA 2HMAA 5CM8B 3JTBA 3RGVA 4PPFA 4HUKB 5T5NG 4RHUA 4UBIA 1GL6A 2Z2XA 3TLJA 5AW5B 2E0IA 2UWEF 1XLVA 5TPWH 4Q9IA 4FA7B 2YAMA 3ZDDA 3D9QX 2MDTA 3OKMB 2ISSD 1V1MA 2AJTA 3L7DA 1B0PA 3IL2A 4LRWA 2CLSA 3CUSA 2J9RA 1WP9A 2NY7L 4ID3A 4UUAA 4AZ0B 5ALCL 5MN5A 4PX3A 3U2QA 1TT5A 2XCOA 5I7EA 5TARA 1UR5A 4LXGA 4DUGA 5MEQB 3SDDC 2ADFA 4KHTL 4ZDHA 3VC1A 3Q6MA 1P84K 3DLCA 4U7GA 3PQYE 3FBTA 2M1XA 2RB5A 4HXBL 2PANA 5H37A 3CG0A 3GXMA 4NCC2 1E96A 4EKJA 4LPVA 2N01B 1JG6A 2VT6A 1N32B 3W3BA 2ORWA 5KC8A 5K8TA 3KOXA 1ECBA 2E21A 4Y5YC 3NGBB 1COWA 3H9QA 1ZHNB 2QRGA 3C1AA 5J4MA 3D7MA 3IE0A 4R2XA 5SWQA 5F9DC 1CETA 2YBDA 3W2HA 3G7SA 1MAJA 2WHEA 2JVJA 4MKHA 5CEEA 1YQWA 5D1HA 4YL4A 2IW1A 4MVBC 3RB7A 3BAWA 1I1YA 4WNAB 2XB6A 1D0IA 1AMUA 2W6JD 3GJ5A 3NANA 2W95A 4JANA 2VUOA 2OL3A 2VXSH 2HRDA 4I6EA 4EAEA 1UH2A 3C98A 1PGRB 3IN2A 1QONA 3HGMA 5DNEA 3MV01 1KRWA 5CBEB 5HY9B 4CKVX 1ZGBA 1KJIA 1IQ0A 1B90A 1QHFA 1MLDA 3D7SA 3TQFA 3V4PA 4DZBB 4IOFC 1MVFA 4N54A 3UTPD 2FQ1A 3O8QB 3NW9A 5DOZA 3APDA 2P9RA 2DY2A 1DQJB 1WEJL 5DD5L 3FN4A 2OTCA 2X4DA 4HCJA 3SDZA 2OE2A 4AJYV 5FA4A 3TQIA 4C58B 2X8AA 3O2DL 4ZI7B 1JGIA 2BGLA 2G1PA 2DI7A 3RAJL 4DWOA 1JKIA 3RVMA 1H3TA 2V7HA 3LMJH 2XDQA 3IS0X 3IAS1 5AUNB 1H3NA 3QJGA 2JANA 4A6YA 3QUMH 3AY4A 3EZXA 3R0ZA 3I01M 4YHKL 1K8XB 5F7XA 3P94A 4UNNA 4FP8H 1DAEA 5IGXL 2M2DA 2OBBA 3A27A 1T3GA 3F8SA 3I2HA 3TUIC 3BMWA 2D2OA 1MMFB 4JUIA 3WL9A 4FXGC 2XFGB 5HHNA 3MW8A 2HIAA 3BT2L 3OAAD 3TO4A 5ENWB 5BUSA 3TE6A 4G5ZH 3WO4C 3FJ1A 1J12A 4FYIA 3ZDYF 2D3NA 4NHCH 2WHXA 2Z93B 3UO8B 1FNGA 5DM2A 3HK2A 1E1KA 4OQQA 4K9LA 4DLUA 1SBIA 2H1LM 5B3SB 4XOIA 3RWDB 1QFUL 1KCRL 4CLHA 3K09A 4TQ9A 4LQFH 3MRVA 2HA1A 4JYPA 1ZEMA 4X6CE 5E9DE 1QJ4A 5C7YA 3HADA 1ZN9A 4JUCA 3VD7A 1LD9B 5FB8A 3UKJA 3QXWA 5BRNA 3EDCA 3LRSB 2VL7A 3DD5A 2TSBA 3PRHA 5HJ2A 3EJPA 5ALLA 1UZLA 5AW9B 2XT6A 5D1NA 2BP8A 2CRMA 4KY1H 1ZQ1A 3ECQA 1RQ7A 1PFVA 5CCEA 1F60A 3JYHA 4G6ML 4NQXA 1N9PA 3KPQA 4H77A 2R66A 2A5DA 1DDHB 3MWYW 3SBPA 2YASA 5IF0B 2J6IA 1IGML 3EFOA 3PGFH 4Y8DC 3QDGD 1SHMA 4IV8A 4AQAA 4IIQC 3W9EB 4Q4JB 1N5YH 3HJFA 4KIGA 1T2NA 3R8QA 3KEOA 4XRCB 3TF7C 3HJTA 2B83A 4A38A 2ZIXB 3CBQA 1MY5A 3A0RB 3HCEA 4RZQA 3OT1B 3H54A 4RVNA 1A2OA 3ZMEA 1LBSA 4RLSA 5KSBE 5CB0A 4BKLA 5EIQA 2MJWA 1YQDA 3VOSA 3S2UA 3I58A 3CUKA 4FNSA 1A02N 4I87A 5DQ9A 1JWUB 2QN8A 4HXEB 1KLGA 2Y06H 3URKA 2R11A 3HB9A 4EI0A 2C1XA 4ETYA 1P7YA 4HQQL 4ZI2A 2UYLA 5DD6B 4HR7A 4I4NA 2HJGA 3EYQC 5CCKH 3S3PA 4H7IA 5BR8B 4M6NH 2E4XA 3W78A 4PE5B 3FHCB 2V17H 3BD9A 4GRDA 3SCMB 4N8EA 4Z23A 4OHXA 3KTDA 4D8TA 1VF5C 3FF7A 3TBSA 2FWIA 2F68X 3F7KA 1TD9A 3VFTB 9PCYA 1VMIA 4G8AC 5DU2A 2Y5EA 3BWZA 4RDHA 4AYFA 4AW4A 4EG8A 2A67A 3WRWA 4RHFA 2XN1A 3PDGA 4M48H 1R6TA 4LHWA 1CE1H 3T0XA 3MCUA 4M7PA 3VI3B 3TZVD 1KGWA 4OUOA 4CC0A 2HG5B 1HDZA 2XYCA 3DZJA 4KE7A 1L0YA 1JHDA 3BUIA 1F2UB 5HS4A 1PZ2A 4LDAA 2WWHA 1OCWL 2ALWA 3BE4A 5JS1A 3SDXF 3IT2A 3GRRA 4GMFA 3VX4A 1IJBA 1CXHA 4U4IA 1J39A 4G9BA 4C56A 3BPLC 4OU4A 3RX8A 3U4EB 5F6IC 1QWHA 1AOHA 1E9SA 1FFAA 1XIWC 2WXJA 1Q1ZA 1XF9A 1WT5C 1T2CA 5CFPA 3CRNA 2PKRA 5D6CA 3C6ZA 1BHQ1 1UJNA