3T3NA

Molecular basis for the recognition and cleavage of rna (uuccgu) by the bifunctional 5'-3' exo/endoribonuclease rnase j
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
550
structure length
550
Chain Sequence
GPQDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGAEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Metal dependent hydrolase
publication title Molecular Basis for the Recognition and Cleavage of RNA by the Bifunctional 5'-3' Exo/Endoribonuclease RNase J.
pubmed doi rcsb
source organism Thermus thermophilus hb27
molecule tags Hydrolase/rna
total genus 160
structure length 550
sequence length 550
ec nomenclature ec 3.-.-.-:
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3t3nA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 3t3nA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3t3nA01
1DDKA 4DIKA 2BC2A 2YNVA 1ZNBA 5EHTA 3SW3A 3ZR9A 5ACVA 2ZNBA 2I7TA 3DH8A 4GYQA 4EYBA 3IE1A 2P4ZA 1X8IA 5HIQA 4RL0A 5EVKA 4P62A 1A8TA 2Q0IA 2NYPA 4J5FA 4Z5ZA 5LE1A 1XTOA 2HB9A 4B87A 2BIBA 3IDZA 1X8HA 4D1TA 1ZTCA 1YCFA 1WRAA 4BZ3A 5A0VA 5AEBA 5AXRA 5AHRA 2YCBA 4XWTA 2BGAA 4EFZA 4XUKA 1WUOA 3ADRA 3JXPA 3WXCA 4PVOA 3LVZA 4C1CA 4ZEJA 5IQKA 4JO0A 2AZ4A 2BTNA 3BK1A 4C1GA 1HLKA 3I11A 5HIPA 4HL1A 1YCHA 4ZO2A 4EYFA 4C09A 3IELA 4C1FA 1E5DA 4EXYA 3G1PA 3MD7A 2M5CA 3F9OA 4FR7A 2XF4A 3BV6A 4YSLA 4Z67A 5KIKA 3FCZA 1P9EA 2BFZA 4V0HA 3SRXA 3DHBA 4C1HA 4AD9A 2YNTA 2ZWRA 2WYLA 3AJ3A 5B15A 2WHGA 5LMCA 4RAWA 2P1EA 4TYTA 4UWOB 2BR6A 2YNUA 3IEMA 2XR1A 4EXSA 2AIOA 2BG8A 3X2ZA 2Y87A 3DHCA 2OHJA 4TZEA 5HH4A 5HH6A 4NQ4A 3IOFA 2P97A 4DILA 5ACXA 5EWAA 3FAIA 1VJNA 5EVBA 1JT1A 2QDSA 4TYFA 4RAMA 2VW8A 4FEKA 4HKYA 3VQZA 4NQ6A 4AWYB 4AX1B 3SD9A 3I0VA 1YCGA 1XM8A 4PVTA 4Z60A 3IE2A 1WW1A 2GFKA 2CBNA 4D1UA 4RBSA 2YNVB 2FU8A 4H0DA 5AHOA 3RKJA 3ESHA 4EYLA 4F6HA 1DD6A 4Z6XA 2DOOA 4D1WA 3T3NA 5FQAA 5AYAA 1A7TA 1VMEA 2BG7A 1JJEA 1KO3A 3X30A 2FHXA 2WRSA 4UWSB 1QH3A 2FK6A 4NQ5A 2I7XA 3BK2A 5ACUA 2A7MA 4D1VA 1BMCA 2BMIA 4NQ2A 5EV8A 2FU6A 3I13A 5A87A 5LLDA 3KL7A 3T3OA 4Z5YA 3PY5A 3IOGA 3I15A 5A5ZA 4Z7RA 5LS3A 2FU7A 5K4KA 4FSBA 5ACQA 3A4YA 4RL2A 2DKFA 3SPUA 4D02A 2BFZB 5ACWA 3ZQ4A 5B1UA 4AWZA 1MQOA 2YNTB 2ZO4A 3RKKA 2GFJA 5HIOA 3AF6A 1JJTA 5B3RA 2BG8B 5LSCA 5LCHA 1DXKA 2QEDA 3X2YA 2QINA 3IE0A 5LCFA 4UWRB 3PG4A 5EV6A 2NXAA 3X2XA 2NZEA 5ACPA 4GCWA 4AX0B 5LM6A 4U4LA 3H3EA 3PY6A 5HISA 1KO2A 1L9YA 4YSKA 2BG2A 2BFLA 2ZZIA 3L6NA 5FQBA 2H6AA 3P2UA 2BG6A 1ZKPA 4F6ZA 5FQCA 1SMLA 4UBQA 2OHHA 4EY2A 5EH9A 4C1EA 2Y8AA 1BVTA 1M2XA 2Q9UA 1KR3A 5EVDA 2QDTA 4UAMA 2FHXB 1VGNA 4HL2A 5ACRA 4UA4A 3BC2A 2GCUA 4TZ9A 2GMNA 4ZO3A 2WYMC 3T9MA 4J5HA 3Q6VA 5A0TA 3I14A 5K4MA 2BFKA 1X8GA 3AF5A 3SFPA 3IEKA 2OHIA 3KNSA 5K4NA 3RPCA 3TP9A 3S0ZA 5ACSA 4BP0A 1WUPA 2WYMA 5ACTA 4TZFA 2M5DA 4RM5A 3DHAA 5K0WA 2Q0JA 2E7YA 1K07A 4WD6A 1BC2A 4KEQA 5EW0A 3ZWFA 3SBLA 2YZ3A 5KILA 4XWWA 4YSBA 1QH5A 2QJSA 2Y8BA 4C1DA 2UYXA 3ZNBA 2I7VA 3KNRA 2Q42A 4UWPB 3VPEA 2FM6A 4CHLA 4KEPA 3R2UA 2GKLA 2FU9A 2P18A 4TZBA 4GYUA 5LCAA 1Y44A 5DPXA 4ZNBA 2NZFA 4O98A 5HH5A 2R2DA 2YNWA 4LE6A 3QH8A 5AXOA
chains in the Genus database with same CATH superfamily
3KX2A 5FBHA 3PF9A 2C5HA 2YHAA 4KXLA 1MO6A 1H9BA 5LXTB 1NQUA 1R9JA 3X23A 1UFQA 1X8IA 5CM2Z 4WNAB 2HF2A 4RD3A 4FDVA 3R5FA 2ZCUA 3OAAD 1P19A 2AUNA 3O74A 5KNBA 3DR5A 4KW7A 2JAQA 2GTHA 2X7HA 3HJCA 1I7PA 1X1BA 4UASA 2P3QA 2CDBA 1HWYA 3RUIA 1CQXA 2A84A 1E2UA 2J3EA 4J2OA 1OLOA 1YIOA 4EJ6A 1YQTA 4QYWA 1JSZA 3PXEA 5A05A 2ZQYA 3L7BA 5ALXA 1XD2A 3A70A 1SUSA 5FOTA 2FUKA 1V3TA 1SBYA 2WHPA 4KO8A 5IOIA 3LBNA 5G0TA 3Q98A 4LXXA 4KWEA 4XYCA 1UBFA 3UAYA 4OP2A 5H3HA 1N5KA 2ZIUB 1ZJJA 4D44A 1J2UA 4BKPA 2CVHA 4CLOB 5LZ4A 3ZJYA 3C3CA 1H6BA 1E5TA 2XA9A 1L2NA 1D4FA 4TKNA 2QD4A 1U99A 1G1MA 2WKQA 5A3QA 2ODBA 4HLEA 2NUPB 1R74A 1S2GA 3ZNOA 3C4VA 2XTNA 3QA3E 2KHZA 1RRFA 2AQKA 3UF8A 5I4BA 4PIPA 5KWVA 3CF0A 3AFMA 4BFLA 3TW0A 3AO0B 4U9IS 2OC9A 3Q2IA 3BZDB 1XQQA 3A10A 5ARBA 4I81A 2ZI4A 4PGMA 3EGWA 1RI3A 3T7KA 1PGNA 1RWVA 2Y1XA 3L4EA 2G72A 4H0DA 2R2GA 5DNDA 3U19A 2CXRA 3EK2A 1BHJA 4XYLA 3UPTA 5C8YF 2ISQA 4INOA 3EF1A 4UARA 4WJOA 2L69A 3BICA 4D3FA 5J9FA 1EVIA 2Z58A 1ND6A 1FRRA 1RP7A 5ACUA 1YS9A 3O8QB 1E0AA 2HMWA 1ECPA 3FPGA 3U9TA 1HTWA 1PNVA 1ZVJA 4AJ1A 4BAUA 3H0CA 3SJAA 4F2GA 2KS6A 3BMOB 3PI7A 3NWEA 3ENVA 3EGVA 4YMVA 1ENFA 1UMCB 4IVQA 4XVHA 1VMDA 1Y8QA 1PF7E 4R1SA 4M02A 3KEGA 1UPUA 4IIHA 2QG4A 1KI7A 1G60A 2XWJI 4AK9A 3I6YA 4AQ7A 1V95A 5JAHA 4PR0A 2QLLA 3U4MA 1MJGM 1P7FA 5JBQA 3LYHA 1GZSA 5G41A 1Z6AA 5GZ6A 5TT0A 1P3QU 1AWDA 1JEYB 4JX9A 4G8CA 1JDJA 3DULA 5FULA 4EMUA 3UJCA 4OFZA 2DX7A 5H68A 4H31A 3SK0A 3RU3A 1U9IA 2IYAA 4DPLA 1BU5A 2GI4A 4YJ2F 3N3KB 2EDAA 2GPJA 3PNQA 4JODA 5C8DA 2DY0A 2F8TA 5FR6A 5CH8A 5FP0A 2D07B 1P7VA 1AKWA 4HFNA 3E8MA 1CEQA 3IQZA 2PUAA 4V3BA 4ZRIA 2PEYA 1C29B 4BLVA 3EG9B 5FUBA 1IWOA 1D2AA 1U2EA 1T35A 1WW8A 3GQVA 4BU1A 1MQ9A 5GVRA 3QFTA 4P83A 2VTBA 4JR2A 3G8CA 3L79A 4KXVA 3AL3A 1EFVB 1OBHA 1MOSA 2DPMA 2WM3A 2ZRCA 2O6LA 3BWUD 1WNTA 4YUZA 4N9WA 3UXMA 5CLIA 1O6BA 1DP4A 2J5RA 2N1BA 1NATA 3GH1A 1NMYA 3AUKA 5D01A 1JKXA 1I1QB 1T2DA 1FNVA 3WLIA 2J6IA 4AQDA 3HK2A 2QTVA 2QIPA 3OKPA 4M0FA 5AI8A 4IGKA 1H2ZA 2QT0A 1A9TA 3EJ6A 2N9PC 2OWDA 2ATXA 2I7VA 1ZGAA 1C4AA 1HTTA 1XPRA 3JASA 5MFPA 4RKWA 1FM0D 2QN7A 3ZWDA 4F4FA 4GI1A 5JROA 1FUEA 3I9V6 3VDXA 1OQRA 2RI1A 5EJ9A 4KRYA 2YNVA 5C8XA 1C9YA 3OPNA 2P4ZA 1MABA 5HK8A 2OUKA 1MV8A 1PEYA 2HPAA 5IT5A 2WV7A 1FW6A 2R6HA 1CP2A 5C8VA 4BNNA 1CY6A 3SICE 3REFA 4QQ8A 5DASA 1W30A 1KI1A 3PUHA 1TL7C 3G88A 1KFYB 1GLGA 1H4QA 1JBQA 4LZZA 4RUKA 1L4DB 2GD0A 3B8EA 3SS8A 2HQOA 3BK1A 4ZZ0A 4QASA 3D7KA 4REMA 3UK0A 1P72A 2ODPA 1U1FA 3U4DA 2F3QA 1GPNA 3JSXA 2OC4A 3DFUA 4QIHA 2JL1A 1SGHA 1XTBA 4JQWC 4N6NA 1RAAA 1TVEA 1LB1B 3IQFA 2Y1LA 2CY0A 2QSDA 4HR7A 2I76A 4OPMA 3H86A 3UXYA 2L83A 3OUUA 2JKZA 3FSGA 3TEJA 1L6RA 4BO4A 3P4UA 1IEVA 1TQ4A 1W59A 4MEAA 3BIID 2ZAOA 1MT0A 2LZ0A 4EPRA 1AZTA 1CBUA 4YSZB 2EW8A 4RHXA 4FGSA 3ZZMA 5CXUA 4QAJA 3TYXA 1JPNA 5L6MB 2F64A 1TC2A 2LI5A 4HFRA 4O4JA 3GLTA 2W6MA 2QLNA 3Q3GE 1QDEA 3C6KA 3OOEA 4L02A 1H2YA 1J7JA 3T3IA 4YI5A 3OLZA 4JJ7A 2V7WA 1AOXA 4Q47A 4CG3A 4B4DA 3A4NA 4RZHA 1NW9B 3RYTC 5DHSA 1GYQA 4WZBE 3AUUA 4UPVA 1A50B 3RVMA 1K8RB 3PL5A 3WSTA 3TDNA 1IVSA 3GWZA 3SYLA 5AKGA 4ALIA 3K20A 4HYTA 2XTZA 3W2EA 4XYGA 1IVNA 3F5SA 3GUUA 1SKAA 2AF3C 3DYBA 5LQUA 5C1PA 3LHKA 2O57A 2R8RA 2PGJA 4NWIA 3JX9A 2CYBA 3VA7A 4ZHQA 2L3ZA 4MLZA 2IT1A 3QY0A 4KIWA 4QXAA 4KE6A 4OQPA 1JVSA 1OILA 1QNFA 1QRDA 4MIYA 1RHUA 5TARA 1IATA 4AP9A 2XKJE 1QIHA 2DXIA 1VCNA 3DHEA 2VJCA 3JZAA 4DDTA 4X93A 2D3TA 3TUZC 3LBHA 3EVDA 5U4QA 5FNVB 5LXTF 1E2NA 2QHOA 2OXFA 4D0RA 2Y1GA 3E7FA 5FA5A 3EWIA 1RZRD 5KSWB 2OV4A 1N34B 1KP9A 5IZCC 5ALIA 3AVOA 3L7NA 3VO1A 2BHNA 4ALNA 4R0MA 1HDGO 3ZNGC 4ZTBA 3H6NA 4MS1B 4TRNA 3VO9A 4RCOA 13PKA 3H13A 3K9BA 3VU0A 1QR6A 1KFJB 3UPUA 3KOMA 3RYIA 5K6AA 3ISVA 4IIEA 5ESXA 3CN7A 2D59A 3AJ9A 2QNRA 4IDNA 1X7HA 2N42A 4DRZA 5F1OA 2DTEA 3O1LA 3UH0A 1Y1PA 4AJWA 1E2IA 1SIUA 1U7OA 5C7YA 3I14A 1CB7A 3LC7O 1US8B 2KMAA 1Q50A 2C8LA 3CUUA 4AU1A 1T2AA 3GAFA 1DCFA 1APBA 3PNSA 1LC3A 3DJFA 1GCUA 2NYVA 4YQZA 4LDJA 4N9QA 3RK4A 2V4IB 1WYGA 4A23A 2DFTA 1PBTA 4IUCS 3RS8A 3LT0A 4NF2A 1BWRA 1XCMA 2WVGA 2YZ3A 2Q8QA 3OUZA 1VB5A 4IJ5A 1XJQA 3HPRA 6PFKA 3H04A 4LRTB 4XASA 5CRIA 2ACEA 4UTOA 4FT4A 2JRLA 4RKYA 5EXSA 2M1MA 4IMRA 4ZYXA 2UVPB 5CBKA 521PA 1NBMA 5BOVA 4UFPA 1E94E 3F6CA 3K94A 5DPWA 4QVIA 3AYXB 3IAS1 4DIKA 4K6HA 1NU6A 3SC2A 4G97A 5DRTA 1FDOA 1L2TA 3FNHA 1JF8A 2II6A 3DVNV 3GPBA 2C3YA 5AXDA 3UGBB 4O4IA 1L3CA 5JPCA 4HGQA 2AHOA 1KDRA 2QU8A 4QT0A 3NKLA 1JW9D 3CNLA 3AEQA 1JIVA 1X1AA 1G6Q1 5FL3A 4DMUB 2YOGA 2Y93A 2LUOA 5SYNA 4TZ6A 2O2YA 1BXZA 2O1WA 3HDQA 1KDYA 3U80A 4FFSA 4ISCA 3KVYA 5CLJA 4BLOA 4B6GA 2VHXA 1SC3A 1C3XA 3ZK7A 1WAMA 2O8BB 4HKQA 3W05A 4C4VB 2H59A 4C29A 3H1FA 4GMDA 3O8OB 4M0DA 1E1NA 3FXAA 4OYRA 2IX3A 1ID1A 3GVHA 2P9TA 1E9DA 3JW0X 4YV2A 2AL7A 3RK1A 3BE4A 2KD0A 4F4CA 2IV7A 1R0BA 4HLDA 1SG0A 2CHGA 4C22A 1KRWA 1VL2A 1EX1A 3P2EA 2CYAA 2XK5B 3FRHA 3I05A 5FO0A 2QXYA 2OG2A 3THXB 1VIDA 4POAA 5LWQA 3A8TA 5I7RA 3GD5A 4FVTA 4O29A 3AB8A 2B1GA 3IXLA 1V1PA 1COZA 4P7IA 1RSZA 4P33A 3F3SA 1ODJA 1DCTA 3QV2A 2E6KA 4RBSA 3U49A 4X24A 4H18A 1GVNB 4ZT3A 1QYWA 4FBLA 1SB3C 2QVBA 3GPDG 2D7CA 4X90A 5JLAA 4WERA 2UV8A 3S1LA 5FORA 1WVIA 1EBBA 1IOLA 5NLLA 3RUIB 4IDDA 3OIDA 5DM4A 1ZI9A 3MT0A 4K5QA 4EOGA 3PEEA 3FPFA 3AKZA 3N8HA 2J33A 4BEVA 1J0GA 4RTJA 2BKAA 1XD2B 2PS3A 3SR3A 2YYYA 4NXNB 2WHPB 3P0FA 4RDCA 4FDMA 4NBKA 2VTDA 1L5SA 1PR5A 1HQDA 3QK0A 3REQA 3H3JA 5ALNA 4JC0A 4FINA 3PPXA 4F96A 1QNLA 3S4YA 3K05A 4Q3DA 3SPUA 5KNBH 2BH2A 4V3CA 1EP9A 3VNQA 1WLSA 2PQ6A 4GBGA 3QMWA 1NQWA 2ZKLA 2BE9A 3TIVA 3NBYC 5B3RA 1FCCC 2E37A 3TLCA 4ARBA 3SZGA 4YDQA 4ZICA 4DTIA 1GNUA 3ZDCA 2XNAC 1R0LA 4MV9A 1OYVA 5TPWA 2ZSDA 4PY2A 3L9WA 2IZ0A 2IJGX 1GTZA 4KQCA 3U4QB 2FQYA 1PX0A 1UBJS 1PZFA 2ON6A 3G2MA 2I3ZA 1ZGBA 1E79A 2NGRA 2QP3A 4L0DA 2OHHA 2DY1A 4L9WA 1RYMA 1GZVA 3D32A 1JYSA 3YASA 4Z3KA 1IHDA 1JN0A 3PFGA 4FYXA 3FTQA 4N0EA 1J8QA 4RTMA 1J25A 4GOCA 2GCOA 3N7AA 5BWMA 5TF0A 1EXDA 3OETA 3MC0B 2QE7A 4ZAXA 4DCNA 3A7EA 2R1TB 3IXSA 1FC0A 5DTEA 4O4HA 4W7IA 3VUEA 3NHPA 2G9QA 2HIMA 2R2AA 1BE1A 3I72A 2Y4NA 1HNZB 3KZNA 1HDOA 5KOYA 1SIBE 1G8YA 3O83A 4TQGA 4K05A 1Z34A 2XCSB 1KSFX 3ID6C 1VMIA 1A2QA 3LDAA 4H6XA 2FNAA 4MRVA 3GH3A 1Y8QB 3DDCA 4QJIA 4YTNB 3Q0EA 4ZRQA 3VHLB 1CB0A 4CU5A 1Y5RA 1WU7A 2M19A 4PV7A 1VSQA 5L3QB 4OW0A 3H9QA 4ZC8A 1R12A 1KYQA 1N1EA 1RXCA 1A4RA 4BUCA 4EJ0A 3I01A 4JWUC 2ZNVB 3ZYCA 3V7FA 3TPZA 1F3LA 3LX6A 1QM5A 1NEKB 3WAPA 3WWEA 1JE1A 3DLBA 2OSVA 2JJ2D 5KYWA 2BLNA 3ROQA 3PQDA 2VIIA 2ZEQA 2NU6A 3O3OB 1L7XA 2ZYSA 1H1TA 1NW4A 4UOEA 2WR8A 4DYVA 1QP7A 1X94A 4KVAA 1LDBA 3VMMA 4ZOBA 1UDCA 4TUYA 4IVNA 3PL1A 1WZ3A 4G89A 1MB2A 2RPQA 2VQFB 2VTBB 4OXQA 1Y1KE 2FA9A 1UWMA 1S9DA 1F4VA 3C7TA 5TDHA 2ETVA 1TADA 3F1KA 1P1JA 4DLVA 2H11A 3AC0A 4EEZA 2HRBA 4XIYA 2WTAA 4DCMA 3LM8A 3CLTD 2PLFA 4RHFA 1Y7IA 4DRYA 1RD4A 1M1ZA 2I4TA 3AJAA 3R41A 3MWFA 1F1BA 3L4BC 2ODWA 3QNMA 3CUYA 4HV4A 2Y87A 1ZDXA 1G3QA 3UOAB 1TUEA 1YMVA 1VYVA 5T8IA 1F38A 2HGZA 3K6SA 3KR1A 3JSVA 4P3OA 3ESBA 2AOXA 3JASB 1AZLA 4RACA 4OI0A 4S0XA 4B4UA 5CLGA 5EP3A 1G7RA 1CUZA 3DP9A 4LZAA 3LIIA 1TD1A 3KQYA 3U1VA 4JLUA 1N33B 3U0BA 5IC6A 3R3YA 2YNVB 4YRPA 5H9WA 2XOEA 4ACFA 5AI5A 2Z43A 4TKVB 4F1JA 4E74A 2Q4EA 2JA1A 1MABB 2FPWA 4G9GA 4H3HB 3LAWA 1YVEI 2IDJA 3C97A 4V0KA 2WXGA 1E61A 4FHJA 3MXOA 5MGBA 3I9MA 4I50A 3JWHA 1U6JA 5EKUA 1I7QB 1IRXA 3PWKA 1TS2A 2JGKA 2FU6A 1QCCA 1A5BB 1IY0A 3OPYA 3LDHA 4C5CA 4D4IA 4X7BA 4RK5A 4RLFA 2H2DA 4Z0TA 2A78A 3BC1A 3KDAA 2J59A 5E0KB 4NBUA 4YAIA 5C35A 2SBTA 4XFDA 2YMLA 3ZXVA 1HA3A 1UXKA 4BVBA 3PSEB 1GPUA 1XLQA 2FUHB 1NBHA 2DZKA 1VLLA 2H85A 1U1IA 2WWIA 5LUBA 4N54A 4RZSA 2FK8A 4N0QA 4PRKA 3ZQKA 5A71A 1GYRA 4YECA 5ENZA 1QLJA 1WE7A 3C5CA 1T9DA 2IXDA 2POCA 4IZ6A 1D4ZA 2NAPA 1IN6A 2G5PA 4O4JB 3HWWA 2ECQA 2WXPA 1BXTA 3NHZA 1CS0A 2IU3A 3MMSA 3EMBA 3NONA 3E7PA 1A2KC 1R1DA 5CFMA 2ZBFA 1UBHS 4E5SA 5YASA 2SICE 3O2SB 3GUVA 4RULA 4LHWA 5DSTA 3RS0A 3GMTA 3NJ4A 3IPXA 3Q9NA 4LDRA 2FWAA 5ALZA 2LWIA 3NHKA 4EY7A 1ISFA 1SCIA 3RMKC 1JUDA 1I0IA 1SXJD 1YL7A 2M6RA 3UQYS 1J1IA 5JTUA 3QBVA 4HEJA 3ZLJA 4NTZA 5I7EA 1QTRA 4BFCA 1GPH1 3ANLA 2BD0A 5E9JA 4Q7JB 3WLEA 2VJNA 3K0EA 5D2MB 3ZVVA 5T6BA 3BA1A 3H99A 4ZHQB 1CEXA 3PDUA 3AUXA 4BZAA 1K75A 2PUWA 2M5DA 2YS6A 2UYGA 3DHAA 3H1TA 1WZCA 4Q9DA 1MAVA 1JDTA 2GJ8A 5EW0A 4IGAA 2A33A 5KUTA 3OZCA 2J4DA 2W2NA 2MRPA 1UBQA 1GFIA 4TV9B 4A4DA 3TMAA 2O8DA 4DMMA 2CSUA 2WSSA 1XVTA 1TDJA 2ZYTX 3V4ZA 4YQEA 3EAGA 1HBJA 2WY2D 3QFSA 1O5IA 2CHQA 3M89A 2X0RA 4AY2A 2QYSA 2ZW0A 1QQBA 3HLTA 4MO2A 3FSJX 1ODFA 3AUFA 4RZ2A 2IO2B 3WO0A 1YCDA 2DCMA 4JENA 3PFKA 2NVOA 3NAMA 4A0FA 4D7AA 1YWGO 4YCCA 2PE5A 4REZA 3LDZE 3E9DA 3DONA 3NANA 5C7IO 3RVQA 2BBOA 2P9ZA 3RGWS 4XB2A 2PE6B 4P7FA 2DR0A 3NH6A 2ZBDA 3UW3A 2XAAA 2EGGA 4D0GA 1OXSC 3RV4A 3OLCX 3RYIB 2ATEA 3FIJA 2IDZA 2ZI6A 4HDAA 5K20A 3ONFA 3ZTYA 2H4YA 4J3NA 2H1OA 2W2MA 2FY8A 2BTNA 1INLA 3ZJ5A 3X43A 3R0IA 3I11A 5GQSA 1NBIA 3A2NA 5ITVA 2QIEB 3CLSD 4KOEC 4EVRA 3L6UA 2X8BA 5C34B 5IYZA 3Q1LA 2QT9A 5EWMA 5ALPA 1KDZA 3DB2A 2B4QA 4LPSA 5M2QA 1O1YA 1H2HA 3O4JA 2BGUA 1N5LA 4N12A 2KHWB 3N5CA 1ZR4A 3VYUB 4J0CA 1Q44A 4MRAA 1XKTA 3OH8A 1XHLA 1UODA 2AFIA 3ZGXA 3LBAA 2ZYDA 1NG9A 2AR0A 1OC4A 4BB9A 4M1TA 4WSOA 3MCTA 4GU2A 3HJBA 4R6WA 3WALA 3HS3A 4XLZA 1BAPA 4FHZA 4K0KB 2DLNA 4AFNA 5DM0A 2ZRKA 2D7JA 1M6HA 4J0EA 5A5EA 5CG2A 3OZUA 1OAAA 2Y05A 3AKCA 3E27A 3B60A 2YFYA 3SC2B 1O6FA 2FU8A 1WR8A 3CLRC 3KL4A 3PDCA 3SEFA 2H17A 1IG0A 4F7ZA 3H11A 2X40A 4O4IB 1WSDA 3QE0A 3TLBA 2WYUA 2FE1A 5EKDA 1SKYB 3AEQB 2IELA 3D4BA 1TM1E 5BRAA 4A2QA 1WPXA 4CMEC 3EVEA 4AURA 1U0TA 4CV3A 1SEBD 1TCVA 3DEFA 4M4SA 5TR9A 2CLLB 3DE4X 4Z53A 2G76A 2YW9A 3VNUA 3BIOA 4WFKA 4HXFB 5IJ9A 3RRYA 4W9MC 4I9GA 4PYRA 1E3WA 2D1SA 3W8FA 4Y2RA 1Z4OA 3F7TA 3KXKA 2CXSA 3JQBC 5D87A 1YTLA 1JHRA 4YXWD 2Q7OE 2XXJA 5FPSA 1OYYA 3IUNA 3MRTA 5K7SA 1X0XA 4BKOA 4A91A 3F4LA 1AKEA 2H29A 3RTCA 1ZDVA 1WKBA 4K1RB 2B2XA 3UINB 1CZPA 4BGVA 3AF6A 1N60A 4Y7DA 4YJDA 4EZEA 1PQSA 4GLLA 4IFEA 1YZFA 4EKDA 4CDMA 1WXHA 1YB1A 4ND7A 3BK7A 4AYXA 4Y2XA 2N7DA 2GM9A 1NAIA 4MLCA 2C00A 3PJFA 1UPFA 1V1PB 3MYRA 1FYEA 4IWPA 2ZJBA 1P7EA 4BVGA 3VBEA 5C4GB 2YZGA 2QSZA 1G2OA 2XB4A 3W2FA 4HEQA 1EFUA 4UU0A 2BGGA 2JJ1A 3R6LA 1NZJA 4U5QA 1N2IA 1I4EB 1NN0A 4ZO6A 4URUR 4J43A 1EU3A 2DNFA 5G3ZA 2CD9A 5KPDA 3PUKA 4RWEA 3AUTA 5F35A 2ZTMA 3MRSA 4Y2PA 1OTHA 3FETA 1M66A 2DPLA 5AW5A 1S2DA 3NP7A 1JDVA 5D3DA 2BGWA 1X39A 3W1SA 5J3JA 4BKGA 3RAEC 1QDLB 1S01A 3IVCA 4OGKA 2DC1A 1QX3A 2PZAA 4FC7A 2YYAA 3REQB 2DUMA 2CUTA 2XVXA 1T6NA 4B4KA 5CNKA 1TMYA 3P96A 3Q87B 1N2ZA 3UC9A 3ELDA 5KILA 2W70A 5FO1A 3CPEA 3MYYA 5B7PA 2ODTX 3FMGA 3BY4B 1UPCA 2RAFA 3ZIAD 1UKYA 3I04A 3HGQA 4QUEA 3PC8C 3RRXA 4NV3A 5A5DA 1QGUA 2J7KA 1B14A 1S2IA 3R8BA 3JQ8B 4EG1A 4EJMA 1HQKA 1XDUA 1HA5A 3LD9A 3ORYA 1Z25A 5JASA 2IODA 4OGLA 2JSVX 3MWEA 5DDIP 4YJGA 4MDEA 3Q3NC 2NO4A 3HPQA 2Z2IA 1DO2A 1MQSA 1ZCAA 3Q8BA 3OZXA 1DGJA 3I32A 2IYRA 3Q6NA 4EHHA 1IXYA 4MGKR 3GPCA 1PK7A 1CF2O 1T5DX 2OKGA 1A7AA 1DQZA 4IOKA 2QAGC 2AXNA 4I8IA 3UCFA 2GCOB 1U81A 4BLQA 2VRNA 4ZAGA 1XMQB 1YCHA 4ZRDA 4WBNF 5E6UA 5BR4A 2IEGA 4QBGB 2IYPA 2C3UA 1W0JA 4F9GA 3CH6A 1VL8A 2V59A 3HBMA 1YJJA 1LLQA 3WB2A 4I08A 3X3HA 4ZK2A 2BBCA 1N2BA 1CY1A 1CMXB 5SICE 1B0ZA 2EFJA 1EGQA 4R2MA 3OZSA 1EM6A 4OH1A 3SXUB 3JQFC 4ASUD 3WAOA 2BZSA 5IFLA 4LYAA 2HRRA 3NTOA 4NAWA 2ORED 3DDCB 3WISA 8MHTA 3PHBE 1DUVG 3N2NA 5AIJA 3ND8A 2NU8A 4JDUA 2WTBA 4QECA 1MR3F 2Y1KA 2VK2A 2WQYB 1EFAA 4YP7A 4A8JC 1P8AA 4PZUA 5KSPA 4WTOA 1XP5A 4U2KA 5KTPA 4P98A 3B7WA 4CN9A 1YMUA 2R9VA 2VK1A 3KLBA 4MW2A 2X9VA 4B95A 2ZTVA 4WESA 1Q22A 1C8KA 4TL9A 4LUCA 1D5MC 4P4SB 3G6KA 2VTKA 3AL0C 5GOTA 5KYWB 3R23A 3L01A 1K9SA 4QGGA 1E6EA 1YS4A 2WXIA 4OZCA 2JFWA 2GRIA 1CUBA 2G3QB 3T5TA 3VPFA 3WGQA 4DQ0A 5EXTA 4I99A 4TUYB 4YMHA 3OWOA 1YACA 2GZ1A 5ED4A 1RIFA 3WWDA 3VUFA 3KXLA 1JIJA 4TV9F 4P93A 1K8YB 4QDJA 1A9OA 3UBMA 3UGKA 2HB6A 2C99A 3GAMA 1HF3A 5A0FA 2FZCA 4H27A 3SFDB 4G23A 2FUCA 4JBNA 4YRKA 2OHVA 3KAKA 4Z7QB 1GSOA 2Q5HA 1WXVA 2KPOA 3DVGX 1GZ7A 5IEBA 3IBEA 2ZCCA 2IC5A 1FPYA 4W9NC 1GCAA 4LDPA 1BA3A 4F06A 3MCAA 4OUDA 3GMIA 4HNAB 4J6EA 2EKEC 4I7EA 1L9YA 1NASA 1SVSA 4Y2UA 1RQXA 4JC8A 4DR4B 3L1IA 2WWVD 3GUZA 1UJ5A 1IHYA 2OZEA 3GCDA 4AX8A 3TD9A 1F2TB 2WVHA 5MHTA 2XCQA 3D4IA 2RHDA 1BCRA 3PQ8A 5JXGA 5JBIA 3SPXA 4BJHB 4JMLA 2JCYA 2FPGB 2YEPF 4UBOA 4PSCA 3JATA 5K51A 2DYBA 1MC1A 1BSVA 3NP9A 3A27A 1QYIA 3AOEC 3QPWA 3A9KA 4UHJA 3QKRA 5FRDA 4PGAA 1MEOA 4P54A 1QH8A 3OPYB 3TCKA 2IOFK 3N2GA 2FYTA 4PYNA 1FSGA 2X6QA 4K6CA 3IDOA 3JQDA 3X1JA 5HKHA 1CUIA 2AC7A 4E12A 2C04A 4AULA 4CL8A 1BXKA 5AOAA 5CA1A 1KEVA 1ZNQO 1N5RA 3WWOA 3VOSA 1WHSA 3R2TA 4PXSA 1TYBE 2GI9A 2IK8A 5B5SA 5TJ9A 4C4PA 4K6GA 3U60B 3G02A 2CJWB 1L8QA 3N74A 4BRSA 2OAQ1 1EFTA 2WPDD 4MUNA 3MIIA 1GOZA 1DAHA 2DB3A 4FFLA 2DU8A 4GKVA 4A2PA 3QELA 3KD2A 5GGXA 2RC5A 2VBIA 2BFPA 1CS0B 3IAAA 1NQTA 3L0CA 5F7ZA 3LIPA 2UUAB 3RN9C 3JALA 1AF7A 3LPCA 4UW9A 3B48A 1XQWA 1WGDA 4II3B 1V97A 1U2PA 2O1XA 1ZTCA 2QQGA 2CUZA 1TK2A 3RT9A 2JLCA 3OM1A 2AN9A 1TJ5A 1BD4A 4AJHA 2GYYA 3EX7C 4LWZA 1OGYA 2ONQA 3K09A 3O8CA 4MAFA 4RF0A 1JXQA 3IP9A 2BWES 2N9LA 3ZJ4A 2PKEA 3KB1A 1YQDA 4PONA 4XJTA 3ENQA 3QQPA 2WS3B 1RYZA 1X80A 4Q66C 1V0JA 5KWIA 3FROA 3QX8A 4M0WB 1RWBA 1ZXBA 1LKZA 2WYLA 2XCIA 1M3SA 3L7MA 4LXTA 3HXTA 1T1JA 3RZWC 4MVJE 2EQAA 3FJOA 1NVAA 4XGQA 1DC3A 5JAMA 1VE3A 3V4SA 2O8DB 1UP6A 1ISSA 4P5DA 5GINE 1I7HA 4FP9A 1OBCA 1DMRA 4BLRA 3QG5A 4BGIA 3DBHI 2NPTA 3FNEA 4CL2A 2NLOA 5HR5A 4N5DA 3I58A 3DCGA 2J4FA 5IWAB 1M74A 4M22A 5LWHA 3DKIA 1T5IA 3D7NA 3RASA 3L93A 3CUVA 1RRPA 3SSOA 3TI7A 2GASA 2WTMA 3DOIA 1QVVA 5AKIA 4WUTA 3ZEAA 3DCNA 5CCEA 2BF7A 4N9F4 4YXFA 4V1CA 3T7IA 4D1VA 4MR7A 4ER6A 1XKXA 3IEUA 1OT5A 3ESQA 3SS7X 5E2AA 4E1AA 3VH1A 3H8VA 4OXIA 3OQMA 3S5UA 3OJEA 1U7HA 3JTEA 2VWGA 3C87A 4PCAA 1PNOA 2QUKA 5IYZB 1F6DA 2XQGA 4OLAA 1G17A 5EWMB 3D2LA 2OHGA 3GJ5A 3SLKA 1ZHFA 1U63A 1YZKA 2WVAA 3MT8A 4RM2A 4LMRA 2WOJA 1KXZA 3M7IA 2R6AA 4X61A 4H0FA 1P74A 4WN9B 2AFIB 3SFZA 4ZJPA 3KYBA 1UXJA 3PPYA 2ONKA 3MPOA 5BRJA 1D4OA 3HM2A 2WYQA 1KAEA 3DNFA 1Z6GA 2N7JA 3OVMA 3FF1A 1GN8A 2QZ4A 3H3EA 2DLDA 3FDJA 2G6BA 3KQQA 1PFWA 4HVCA 2GEJA 3QP9A 3WL4A 5DLPA 2GD2A 2WAAA 4I4LA 4BE7B 5DM1A 4EY2A 1KHTA 5I7FA 3HJUA 4IR7A 3C41J 3JWEA 2PVSA 2N1VA 1GV1A 1NIPA 4Q6BA 1EFPA 4RCVA 3BYYB 4M55A 2W6ZA 2JH9A 1WMHA 3QWFA 4UQLA 2VRCD 1R4NA 3QM1A 5JFTA 1WB9A 3P7MA 2VOEA 1GSIA 1CU1A 4F8YA 3RV3A 1MZPA 3UJHA 3RSLA 2OZLA 1V5EA 4C4ZA 4OI4A 3STTA 5KREA 1AUPA 3KAJA 5CURA 3SFPA 4G0OA 3KOZA 3OU6A 3V80A 4OHRA 1DCKA 5JJ5A 3GJ7A 5EIAA 5K0TA 1VI5A 5EKSA 3TK1A 1ZU5A 3OJOA 4TQ9A 1NUQA 1RC1A 2EX0A 3IRVA 2X9NA 2QORA 3H7PA 2OECA 3N5KA 3VKFA 3S1AA 1PLJA 2GN6A 3MOSA 1XPJA 2V3CC 2JGMA 1UC4B 5IH3A 3HU1A 1I94B 2LVPA 1X3SA 1N5XA 3K9GA 4UUMA 1V26A 1AB5A 5B1SA 3MWDB 3NDIA 4WKPA 1NGSA 3E23A 4RD1A 4KE7A 4TUYF 1UBRS 1N61A 1SNYA 1TKCA 5J5AA 3UWSA 2DWCA 4TLEA 1BS1A 2B61A 1ONNA 1ZW7A 4HWSA 4D8TA 3VH2A 1N7JA 2C9MA 3EY9A 1VGVA 1HFKA 3R2JA 3EH2A 1P2SA 1RYEA 3BGWA 1CV2A 3OQHA 3UW1A 2EP7A 3RJMA 3TFOA 2B5VA 5F2NA 5HHTA 3RFCA 2IP2A 1JAYA 2FUEA 1ULTA 3HEBA 3VC2A 1EK0A 1B16A 4WOPA 4OHMA 1Z5GA 3O0DA 2OQ2A 3ZNHB 3FGPA 4V0HA 4L5BA 3HVIA 1QB8A 1QH0A 4FXPA 1XI2A 4G0YA 4R01A 1HK7A 1NP7A 2GKSA 3P45A 3A3NA 3GPLA 3PPWA 3OLXA 1V11B 1DKPA 3TG8A 1F1JA 4RVOA 3JQPA 1GAQA 1JXMA 5JNUA 1Z2NX 2R6FA 2AZDA 3ZDDA 4FEEA 4DA6A 1QGUB 4NPNA 1XLTA 3FGZA 2AFHE 1M34A 3D3NA 3FLEA 3TG2A 2B3TA 2WYWA 3VYVA 4F6HA 2HWUA 5JVDA 3AOGA 4EKEA 1HV8A 2JXXA 5CVDA 2EJTA 2AWOA 4YP1A 3DD5A 3NHJA 4WY5A 3DE3X 1Z3CA 2NTJA 3WLOA 2MHJA 3EWSA 5EFZA 1PG2A 1WA5A 3E53A 5LXIB 4ENVA 2A57A 1T4MA 4IDFA 2P5UA 2ZYGA 4TM8A 5L3RA 1YDFA 5KNCH 1VTKA 2LXNA 3PY5A 1T0IA 2COKA 3ZE9A 1KI6A 2VUHB 3NHMA 3IT2A 4M98A 1XIVA 1U7UA 2WKWA 4RL2A 4RSGA 4KZCA 2AHRA 3M5DA 4JUAA 2OQRA 3U7GA 1KAQA 2BFCA 4Q7KA 5A6SA 5EE0A 4DDHA 4NAWB 2IDMA 2B76B 1D0VA 4MCAA 3QHTA 1C2TA 1JRUA 1NJ1A 3WQBA 2XQVA 5K1ZA 2HCRA 2MJEA 2RH4A 1A9YA 2NU7A 2O3UA 1DQYA 4W82A 2C5GA 1O2DA 5ADUS 3PF8A 1F0NA 5FUYA 1QZTA 4AJPA 3S8YA 3CMMA 1A5TA 4RQAA 1GA6A 3J7TA 3BGDA 2GF2A 5ENVA 2ZWVA 4KRXA 5CLHA 3ZS9A 1JFFB 4UOZA 2G9UA 1WMEA 3DHYA 4N82A 3CTMA 1GC7A 4WESB 4QG7A 5LSAA 2I8AA 2PGIA 5H8WA 2YZ2A 2C58A 1RIIA 3R2IA 2FPPA 5EZYB 2XD9A 2QENA 2WYIA 3EXFA 1I5OA 4HL2A 3VSEA 3BHMA 3WIMA 1CQWA 1USVA 5BSKA 3BDAA 1CQZA 3X1DA 2VJMA 1M8GA 3SC6A 3I12A 3FTCA 1XEFA 3SXPA 3KOOA 3KQNA 2O2VA 2RGDA 2IZZA 5A7HA 5K3EA 1EJ6A 1C79A 3EOBI 2BS4B 5G55A 1J0XO 3U8ZA 1YAHA 4DHZB 2M0XA 3ZWCA 1G0NA 1SAYA 3R7LA 4MW4A 5FLYA 4XDGA 4OHZA 4UD6A 1URPA 3SIPA 1EMDA 1KJYA 2VAMA 4Z5XA 3HM6X 4C76A 3TN7A 5ECGC 4BNIA 2PCLA 4HUJA 3RNCC 5JHHB 4LPKA 4EY3A 4P53A 2ZT6A 1YQ4B 2WUVA 4TTSA 2RHOA 4DQKA 3K8ZA 2JCVA 2PR2A 4NYJQ 1FU4A 5JO9A 5CEFA 3EIXA 1WKVA 5AK4A 3EGOA 3E5NA 3TRJA 3EUFA 5CVUA 2MMCA 4QYIA 1Q0WB 2AB0A 3LZ6A 3ZJVA 3C6YA 4PT5A 4N3BA 2HT1A 4UDUC 3OFVA 3Q0IA 4DYHA 3L82B 1KGSA 3DV0A 4EENA 3KAQA 2OZPA 1BCRB 4ZGWA 4EG4A 3T06B 4INZA 4AI6A 1N5JA 5JS2A 1J2EA 2PFKA 3ER6A 1EX9A 4LWQA 2R62A 1XZMA 3RSGA 3CRVA 2XI4A 4BX0A 4BVUC 4UMEA 3F9OA 3A9KB 3QKRB 5AVQA 3C39A 1U7DA 1NNI1 1QH8B 3UB3A 1V9LA 2BVCA 1T3GA 3N2GB 3H19A 4J3OD 5IXJA 3DMYA 2X8WA 3A9CA 3BXEA 1H6DA 4BZQA 3EZ9A 3WK4A 1UEJA 3IIJA 1G4UR 1L5PA 2KFKB 5CCDA 5AK6A 5CA1B 4MKXA 1WHSB 5B6JA 1ZH0A 1W88A 4B3GA 2V3VA 821PA 3DUWA 1T6ZA 4I5IA 1G8GA 6LDHA 4NQZA 4I3FA 1S89A 3FVTA 1IM2A 4NQ6A 3FDXA 1BNCA 4HHEA 1QPZA 1P9DU 4JT9A 1VCBA 2RD2A 2REOA 3AI7A 4JAVC 3F7NA 2HLDA 2QZPA 4QPCA 2Z9CA 4MGZE 4NQKE 3CW2A 3JALB 4NJEA 5LN1A 2HJGA 3H5NA 4FYJA 2CLIB 3O8DA 2RHBA 1R15A 4B74A 3F67A 2IH2A 1ESFA 1Q11A 2BFFA 1VJKA 1ODCA 3K4QA 4LOLA 2O9JA 4CO7A 3IPAA 2WMOB 2X5OA 1KYXA 1WOYA 3O6VA 3LWBA 3Q41A 1GNVA 1S7GA 2RHCA 1H05A 5G53C 3H42B 3R7WA 4DREA 1GL7A 3A3OA 5J5VA 3KPUA 4C00A 4PLWA 1E1RA 1E60A 3C3JA 4YN3A 2V4UA 4KUHA 2R7MA 1A0OA 4ZEOA 1RYFA 4LF5B 2KK8A 2WI8A 3AV3A 4LXGA 4NU0A 3CRMA 2AKEA 2IHJA 2W83A 1ZRSA 3KJXA 2H1IA 3F90A 1KOTA 3NT2A 3HACA 3VPHA 4ZU3A 1A7UA 2FGJA 4FMBB 5TVGA 3ZVKA 4OATA 5JH5C 5ILQA 2DFVA 1GCOA 4KMRA 2WW8A 4B7XA 1EHYA 4R3DA 2KWIA 2O2XA 4TTQA 5I5EA 3CR8A 2JLVA 4N5IX 1Z38A 1ES9A 3TVYA 5IVIA 1U31A 3G1TA 3IP1A 3TAXA 2VWHA 4GXNA 2WQZA 4MW7A 1YSCA 5G3YA 1E8ZA 4IDOA 4YIKA 2NPTB 1CETA 1E64A 2WD8A 3TSOA 1G4HA 3QXJA 3OTQA 4QDTA 2VCYA 2ZITA 2YCLA 3FHCB 4F3CA 4FBMA 4IQ8A 1XNRB 2JASA 2X22A 1BDHA 3N2KB 4AZTA 4RIHA 4ZQBA 4DJJA 3IVRA 2FSVC 3G2NA 5JMTA 2QE6A 1VFNA 3AE8B 3KW5B 1ZOSA 3KZKA 4WLEA 4V1CB 5I7AA 5FUVA 1IJFA 1VLHA 3LE8A 1OLUA 4UE3S 3C1OA 3Q2KA 4CM5A 2FF7A 1VYHA 1V8DA 3AKYA 1E58A 1QC5A 1KYTA 4B3JA 3L9XA 4X57B 2Y6VA 4RPKA 3DCYA 5LQNA 3RKSA 2P4EA 1UBGA 1MA3A 1FDVA 1G55A 4IP0A 5T64A 3U7DA 2IPXA 2CBXA 3IT3A 5AHKA 3BJZA 4H6WA 1QMPA 4NMXB 4IX9A 3RHFA 2BPSA 3PZBA 1HOTA 2V6BA 2NADA 2HZBA 3L2OB 5BV7A 2C2ZA 3A3KA 1I7NA 3MFQA 3P32A 4Y9TA 1PU2A 2TSYB 3SNHA 1N63A 3Q8MA 4WA7A 1FMTA 4KUEA 4F4IA 2JWUA 4KODA 2WF6A 3R3MA 4HLCA 5FPQA 2LGSA 3RVLA 5EI5A 2SKDA 1H1LA 1HZZC 2QW1A 1Z0ZA 2Q9BA 1EFPB 2EZ8A 1SCNE 1W5BA 3PHCA 3L7CA 2YWFA 4YMGA 1XA3A 1R4NB 1NMXA 1KY3A 1PVOA 3CH4B 3LUBA 1XAHA 2YJ5A 2R84A 4YR7A 1WXGA 4CMCA 1Z12A 3W4KA 4I1IA 3VXWA 3OF2A 1G38A 3A04A 2VZLA 5CNIA 3MJTA 4HRXA 3VI4B 1ESEA 4MVJM 3UAGA 3A58B 4DQOC 4ND6A 4ADSG 4MJLA 4ZVMA 3E8SA 2A7QA 1L4LA 1YS6A 3QVTA 5DWDA 3ZZUA 4HZGA 5DTJA 3K9PB 1WUIS 3IHTA 1QOBA 5H81A 4IRUB 2ZJ2A 3WKDA 1FYFA 5HCUA 3H7PB 5HH4A 3S1AB 2LP4Y 3AEBB 4KFCA 2PZJA 3D8NA 1T4CA 2VJPA 2J4XA 2G7MC 5EZYF 4UPEA 1M1YE 2JLSA 3NIGB 4EO4A 3ETLA 1NM5C 5L8VA 1KQFA 2PXCA 4BNGA 5HGJA 1F4LA 4L4XA 1CRLA 2QRHA 1NAHA 2C5BA 5KYTA 2CDCA 4FFDA 3BXFA 3EVAA 1XMXA 1Y8RC 1G8AA 3UEOA 2DZIA 3EXG1 3JYUA 3IO3A 3JVIA 1X92A 2AD1A 2GPBA 4CL3A 1IIRA 1FNDA 1IK6A 3R75A 4N6EB 4HJXA 4JBLA 3ZTCA 5JAOA 3QLVC 4F6RA 1SBCA 2FZEA 1DI0A 1LCIA 3F73A 2L0XA 1SKQA 5B6IA 3LPMA 1Z4LA 5GMVA 1WXDA 3TCAA 3ZBTA 4TTPA 3I37X 4OTZA 4YT5A 1KE2A 1C4PA 3CWQA 1JSRA 2QLMA 2YOFA 2Y5PA 5AT1A 1WW2A 4US2R 4RH6A 2P6UA 2FAZA 2GMIC 4QXMA 4Y2HA 1FX1A 1SVMA 3GJ0A 2HH9A 3PXCX 4TS3A 3EC8A 1U4NA 4W9LA 2G7ZA 1Q6ZA 1K7YA 4HLUA 3P4PB 1OPXA 1GUFA 1U28C 4AMBA 4YCNA 1GAQB 5EJ4A 1UZNA 2MU1A 3RVNA 2ZJ4A 4XZ4A 4GRAA 3OCJA 5FF9A 1AHIA 1JR4A 3O3MB 4DLPA 3N8KA 5JV5A 4MGZR 1RLOA 1NV8A 3D6UA 1RJWA 1M34B 1RVDA 3WB0A 1DELA 2JI9A 2ACWA 2VSYA 5I4KA 3UANA 5JVDB 3N20C 2FZLA 3ZHCA 3MJDA 5TMPA 5EVDA 4OQNA 4KQIA 2QMOA 1CE8A 3HCCA 4CW7A 3SHVA 2O19A 5ELXA 2RAPA 5KYXA 4BMPB 1GILA 1COWA 2H07A 1QAMA 5B36A 1W6RA 3IOBA 2BMAA 5CA1F 4TM7A 4EMBA 2J3QA 5FNVF 4C3OB 5HPYB 1TS3A 3OTGA 1N8KA 1VD2A 3UK2A 1XZFA 3AVTA 1AKYA 1AD2A 3B2GA 2IZ6A 1QGZA 1UQUA 3KJEA 4JLMA 2RIRA 4FYMA 2F2TA 3K0SA 2Q0JA 2QKYA 1U2SA 1D6NA 2ACVA 2H7VA 5JWRA 4TYPA 1Q57A 4IQ4A 5UKDA 4UFNA 2P9FA 1LI5A 2QTVB 4XIFA 1L5LA 1ZVVA 5BV2P 3A6ZA 4BLWA 1E9MA 2ON8A 3VUYA 5DJ5A 1K53A 4Q1CA 1GOTA 1GPBA 3KXIA 2DQ4A 3GJYA 1L6UA 1J9ZA 4XDYA 4BYMA 3P9QA 3BSYA 1GD1O 2GR9A 1Y4DE 3U7QA 3O95A 3CMMB 1MVOA 4M0MA 1DBIA 4OV6B 3K1TA 4Z5ZA 2IHVA 4RH1A 2MX2A 2OEPA 4H16A 2X19A 3ILHA 3IDZA 3UVEA 5CXXA 1TW2A 4QO8A 1L7NA 1NF3A 2G1EA 2HWXA 4YAEA 3C8YA 2FPPB 5CA0A 3MHPA 1JHMA 4YVFA 5JARA 3EXFB 4YTEA 3VNVA 1GAEO 4GSKA 3EPJA 4RFVA 3OM8A 4TKLA 1X9GA 1V5WA 3GK3A 5HXAA 2DUNA 2VJMB 3PUIA 4DLXA 4IS2A 3DBRA 3AETA 4X45A 1YC5A 1E1DA 4HYYA 4Y3UA 5B1DA 4HQNA 5DIZA 1UJ2A 2O2VB 3PNYA 4DDMA 1Q0SA 3C43A 1EHIA 3LI2A 1L0YB 1IK4A 2MJLA 4CCAA 5L4NA 1OFUX 2AMVA 5A06A 4ON9A 1L1QA 5EYPA 1T8WA 1BFUA 1TTQB 5IVHA 4MA0A 1YR7A 3KYCD 1BHSA 1XRQA 1XQXA 3P9PA 4B82A 1F2RC 1FNNA 3GNLA 3DQVA 1WOMA 3MC8A 3WFZA 4A6XA 2FN7A 1FUUA 4BE4A 2PWYA 1MA0A 5EHIA 2FOXA 2Z8LA 4MQMA 4WEQA 5F64A 1WNFA 1ETUA 2QILA 4QYIB 4CM9A 3ORSA 1EWYA 5DYTA 3LJ3A 2TMDA 4JCCA 1E1KA 4BOYA 2WZCA 1OZHA 1EK2A 5HJEA 3IQDB 1R3DA 3X1KA 1R4MA 1GU1A 1VI6A 1YGPA 3KYJB 4OIMA 4FDLA 2QTRA 5LU8A 1CRQA 1MAWA 4EUEA 4KB5A 3KB2A 2BMIA 8ADHA 3JQCA 5GJVC 1WXAA 2LEKA 5KQGA 1UGMA 4L5YA 2BBTA 3LVQE 3UI3A 4LFAB 2OZKA 4E6PA 2I1KA 3V4RA 3DKRA 1XZQA 3X1MA 2J1LA 1KYZA 4XM0A 3F7OA 3SR0A 2OLEA 5BURA 3R24A 1UOEA 4BP9A 2VZKB 4R71A 1QXSA 5PGMA 3ESAA 1BDBA 4G63A 4EBBA 1UPBA 1E9RA 3OU2A 2AL3A 4GVLA 1P5RA 1W88B 2CYCA 4I8XA 4IXMA 1XK7A 3GW8A 1SUWA 3G2LA 1YB6A 2ZSEA 4BO9A 1G5HA 2YV1A 3SWWA 3E2MA 1YFLA 1OX5A 4A20A 1EXMA 3L16A 4LOHA 5JISA 2NV6A 1PUIA 3B5JA 4D6PA 1J2TA 1HRKA 4R84A 3A6KA 3OG9A 1JSXA 4W9IA 4YCMA 3R7SA 1PFDA 4F8CB 4UC0A 1ZJ5A 1ML4A 3AQ4A 1E2KA 3QUCA 2F3RA 3DTVA 5JS8A 1D7OA 3WGJA 1KJZA 4JJFA 4WIPA 4RTKA 4J76A 3KOWA 4FFWA 4PO8A 3PC4A 1U4SA 1LZKA 3KJNA 3JPWA 1HDYA 5B64A 2KQUA 3PDJA 2DKNA 3GLFA 2BFFB 3N2EA 1NXOA 3TEMA 1K7EB 1OH7A 1HNNA 4M9SA 2IYUA 4V0RA 4DM3A 5CTRC 3WHKA 5IKCM 1Y5IA 3C3EA 1JVBA 4DUGA 2IF0A 3SF0A 2WSLA 1BZYA 3DFMA 5FOUA 1GY8A 4AVYA 3QU9A 5K8TA 4I2VA 4DMRA 3O9ZA 4ITUA 4OHFA 1GFZA 3T1QA 2FSFA 4FYVA 4DQLA 4QSHA 2MOKA 4Z9YA 2JGAA 2XB8A 3GL9A 4HQ0A 4TTAA 3MMNA 2H0RA 3VHQA 5JHBA 3UPDA 2ZXUA 1ECFA 1MMFB 2OCLA 3DP7A 4NABA 2YV4A 1DAGA 5IJZA 2G63A 1CR0A 4ZT4A 4PZZA 2GJAA 4A3OA 2L17A 1VBKA 3RIGA 3NRZA 4XJXA 1UZMA 1SEVA 3X1ZA 2Q0QA 2Q0HA 1KFKB 3KSAC 3WNCA 2NT3A 2A4MA 3L07A 3B85A 2BIBA 3PZDA 2W8ZA 1YCFA 2XTJA 4X84A 3VNSA 4G1EB 3DTTA 1SHLA 1K68A 1J39A 1UT5A 3GLQA 1LUAA 5EAIA 2ZK7A 3I2KA 5JMWA 3IV7A 2ZIWB 5HFNA 1KH3A 2B4YA 3KUXA 1Z5UA 4IY1A 5A7FA 2ZJZA 4XOIA 2HA0A 3LUCA 2DENB 1NTOA 1FW8A 2JX5A 3JD3A 3V55A 2Q6KA 1OLUB 1DIBA 3P27A 1R0SA 4LNNA 4ZQFA 1QC5B 2GPTA 4FMDB 4LXYA 2EFEB 2V6JA 2VQDA 1Z62A 1XWFA 2AZTA 1FUYB 1UAYA 4EXSA 2ZB4A 3WNQA 3T0IA 5MN6A 3QFFA 3D7SA 4DMCA 4RTRA 4PX5A 3FFTA 1U2GC 5JVDF 1C9EA 1Y4AE 4X3CA 4XH9B 3ZR4B 5DBGA 4RAMA 2RDBC 1YN3A 5BN3A 4E3CA 2VQEB 5DHPA 1WZ0A 1TLFA 3V9PA 1PG5A 1K6JA 3DHGC 1H2FA 3EUAA 2DERA 2CBZA 1K50A 2BCJQ 3TBKA 3PZRA 1P6XA 2BI8A 3ENWA 4L5AA 1L4MA 1BUIC 2GSWA 2VS1A 3MT9A 4EH1A 1ZOLA 4JL9A 3OICA 4DQDA 5GZ1A 3AE1B 4Q12A 3A33B 4PWYA 4F3NA 2WZQA 1C4OA 1H1LB 2MCNB 4K46A 4L95C 4V39A 4LF6B 2JY6A 1E9VA 5K0FA 2FFHA 3TLJA 4M01A 2KI5A 2DPGA 1YB7A 5JHAA 4ZP1A 1QYXA 4FDTA 3QEOA 2G5GX 3GGJA 3ET5A 4OYHA 3KJIA 3EB9A 3HVZA 1IY9A 3NBXX 4KAFA 1HZ5A 1Z0DA 2NZ8A 2P1RA 1V8FA 2D1RA 1B7GO 2JAWA 1H8CA 4Q4DA 2Z1NA 3VR4D 5CR9A 2KQ7A 2PCJA 4YQFA 4ZTUB 1XCJA 4LZNA 4JLJA 3RHTA 3QVOA 1R7SA 3WQHA 4EJ2A 4CHTA 2O6VA 3AI2A 1NRIA 5FI1B 4FM9A 3LX8A 1WUHS 4OOEA 1KIFA 2GZMA 4HN2A 5KNCA 2X38A 2ZS7A 4PHFA 1T4CB 4OM7A 1R16A 4HNTA 3AHEA 1YQBA 1YRWA 3C98A 5TPWB 4FYWA 4NMHA 1MPEA 3BKWA 2YR0A 4XQ9A 4HMOA 4RGTA 3H9CA 3UJPA 4G0PA 1SWWA 1BX0A 1NWCA 4MKHA 2D06A 2JF5A 4EFNA 4GR5A 3FPAA 1NRXA 2YJGA 2YWHA 5HCIA 1XTSA 4M1MA 4FGJA 5FOQA 1ZD4A 3JQ9A 3QKUA 2YDYA 2JRCA 1KZHA 1EK1A 2VHTA 3W3AH 1OWPA 1QHYA 1QGOA 1EE2A 3B2QA 4HNHA 4WNIA 4RD4A 4HWRA 4F6RB 5H4HA 2N47A 3NJ8A 5AVVA 4O4HB 4B44A 1I4WA 2I54A 4R8MA 3E2PA 1SJED 3KZVA 4I1PA 3PVZA 3IKJA 5IHXA 1JFRA 2A0FA 4PHGA 3QUSA 4MKRA 3S8EA 3JXEA 4O4JF 4QTTB 1A2OA 1NY6A 3ZWFA 4HLQB 1XZKA 1KHHA 4TTVA 1BD3A 4AM8A 1Z07A 2V7PA 4DJTA 3QVWA 1RE0A 3F8TA 5DHTA 3EVCA 2MSKA 4R81A 2HREA 4ECEA 4RLSA 4KO4S 3DOOA 4V02A 1PV4A 1JXAA 1N78A 3O75A 2NZUG 1I4HA 4QJ4A 2NZJA 2G70A 2ZNBA 4GOXA 1U0FA 3JS5A 3I3TB 1GV0A 2AFVA 1W75A 3QOXA 4KR6A 4EFOA 2HTHA 4EVIA 1SD5A 4Y6SA 1PJ3A 3OLWA 4MA4A 2CBGA 1N9ZA 5DN9A 1V4NA 4D4LA 4BGUA 3NUZA 1JLRA 2G6TA 1WRAA 3BFKA 5BSFA 2NU6B 3WYFA 2YV5A 4ZHQF 3WKEA 2HXYA 2VAWA 3VNAA 4NX2A 2AJLI 4JLDA 2QP4A 4IIXA 1MG4A 5B55A 2E49A 5KYXB 1GTSA 1XZAA 3UJ7A 5CP8A 5HUQA 4JJ4A 3CWZA 3DQQA 2D1YA 1FXWA 1FEHA 1YUNA 1EGMB 1SN7A 5IN4A 1XDBA 2H52A 1VBMA 2WJIA 2FRVA 1DC6A 1HG0A 5FOVA 1RABA 1DCMA 1TVCA 5E4FA 3AR2A 1G21E 4LDTD 5KKCA 2YRFA 3TQFA 2GFIA 2IS6A 1RLMA 2GKGA 3WGYA 1ISJA 2D0OB 2PUJA 2HD4A 5A62A 3J80A 3MRVA 2BG8A 1ZQ9A 2NPIA 2MBEA 3CONA 3G79A 5DCWA 5E3JA 4ZDKA 3MAGA 4WD3A 4M8NE 4QNNA 1GTL1 4HGYA 5KDLA 3DVSX 4R7ZA 5GPBA 4P4NA 1U9JA 1VA5A 3ZU3A 1CYEA 1CK4A 3IFWB 4BNHA 3VQZA 5ALVA 2IXTA 3K6SB 3DPIA 1ZUHA 4UBMA 4BDTA 2D5LA 3JSVB 1WW1A 5B53A 1C3EA 3EYWA 3QLTA 1OH5A 3GRYA 3KFLA 2XWQA 1QH1A 3C7DB 1TEZA 2XE7A 3AM3A 3LP8A 2K6DB 5AKJA 2IUEA 4BKRA 1IFXA 2CMFA 1NVXQ 3PGLA 5I8PA 4OO3A 3DSRA 2QUBA 1KQGA 1H4RA 2YASA 4LZLA 4H3SA 1JU9A 4NQ2A 5CA0B 2BUAA 2AX4A 4I50B 1T5HX 5BQFA 2QMHA 4DA4A 2E7ZA 5CLQA 2ANBA 3DBRB 3AETB 2GARA 5I9TA 1Y8AA 2WDTB 2H1WA 3HUIA 1WRDB 4GB9A 1ACJA 4KNWA 3K0HA 3BAFA 3OOJA 4MZDA 5KTMA 2VHEA 3PITA 3PLNA 1F0ZA 2AXPA 1NLZA 2PXHA 3KSRA 2ZNVC 4TSKA 5EYPB 2C1XA 2F55A 1ZCFA 1U9IC 3A4LA 3I34X 2D2VA 5D1NA 3WL5A 3OZAA 2PUVA 1YT5A 4RX1A 4HP8A 3KTAA 3OCCA 2P7HA 1TM3E 4HPXB 2V7BA 4O4IF 2XT9A 4UUAA 4BFXA 2CW5A 1DIOB 4LOJA 3W1YA 1OROA 2INPE 4XDCA 1R6VA 2ECFA 1SKUA 4I6JA 3LECA 3OBIA 4XGNA 3H05A 2WU2B 3VZQA 3BAZA 1ZGHA 4RE6A 4DBZA 1X1MA 1P0PA 1P1IA 4RPCA 4KXUA 3N32A 1DEHA 4OP3A 1LXDA 1KU0A 1I3KA 4JQCA 2O4UX 3EZ2A 5MPOA 2VO1A 4RGQA 4UCWA 3TAHA 1FTSA 1ULZA 1V1RA 4GKBA 2D0PB 1L4EA 1YB4A 2RHHA 2V4ZA 4JI2B 3A9SA 2Q4OA 4GPZA 1NT4A 3FOFC 4D82A 4X1YA 3GB9A 3GO4A 2Y3IA 1AN9A 1BDIA 3MHZA 1V2YA 1ZL2A 3FFBA 4Y6PA 3PFHA 1Z22A 3HFGA 4E4YA 3KKOA 4CCWA 2EHDA 1ZVKA 2XUHA 2ZSHA 2H2HA 5HWSA 2REXA 1QKIA 4KDEA 1EZZA 1K27A 4HCJA 1BVUA 2CUNA 1PW5A 4EQ6A 2IGGA 1JTEA 1RCFA 1EESA 2QUZA 2D54A 3ADCA 4P9NA 3U0VA 3RUEA 2JHPA 5EP2A 2WA1A 3LY9A 5GTDA 4NBSA 2XODA 1FFSA 5KOIA 2HPHA 4GX5A 5TV2A 3H9GA 4AO8A 3BB1A 4J7AA 3TZQA 3DMTC 5BW4A 1V5FA 1HQYE 3AHDA 4G0UA 4NCNA 2Y3AA 2PGAA 2P35A 1BGWA 4JASB 2V98A 2HF8A 1S2LA 3KDPA 4WOBA 1ZDMA 1NN1A 3FNRA 4ZVRA 1SXQA 4JY7A 1Q1EA 1U3UA 3SBDA 2QS9A 3K4PA 4PYKA 2NZWA 1EP1B 4W99A 2QRQA 2ZYAA 1PWXA 3U81A 3ZVRA 3QENA 3AXTA 4D97A 3OE4A 4OJKA 2ZBVA 4AMYA 1TCUA 3EZLA 5CVVA 2L0TA 2EMTA 2RC6A 3DTVB 3KXPA 4EKIA 3NNNA 2HUNA 2Q1XA 2DULA 1C3LA 2VP6A 3Q12A 1HQCA 3DQZA 1LPBB 7MHTA 4EL5A 5IZ4A 3GLFB 2AYXA 3NZEA 3UT5A 1DIGA 1NUPA 3BIWA 2Z95A 2ZCVA 4YMLA 1XRPA 1TA4A 5FAKA 4KO2S 4YAWA 3ADPA 4DBVO 2HZ7A 5CU7A 3UGJA 2V5UA 3KL2A 5D85A 3RAJA 2GYUA 4PAWA 1M7HA 1DUIA 4IIDA 3NI2A 3L41A 1P75A 4IW0A 1DC4A 4KRFA 1FS5A 3FAIA 4RVDA 1P73A 1L7QA 2CZCA 1Z29A 1BMTA 4BASA 4X54A 1KAHA 4R5MA 2C9YA 2Q5OA 2ZPNA 3EASA 1YZVA 3C3AA 3JQAA 3UGQA 3T5PA 4HPWA 4P16A 2NVBA 4V38A 2VG8A 1JJEA 4F2PA 2OO7A 2FPRA 3W8RA 4Q9AA 1A98A 5JMPA 4O4HF 2ZYUX 3DNPA 3H11B 3NHEB 1Y7LA 4HJRA 4EHKA 1T8UA 2ZG6A 2YOHA 3GGSA 3WGUA 1Q83A 2WU4A 1U2DA 2NIPA 3Q7RA 5JIBA 3HG7A 2ORWA 4C3ZA 3AW9A 4DJFC 3AE2B 1R6TA 4WJLA 4PC1A 2BYFA 4IWYA 4W9JA 1VHDA 4C0LA 3WAJA 2F43A 3RRFA 3FGOA 3F98A 1KGDA 4BMVA 5IJ9B 5ADHA 4BKQA 4BBAA 2EIHA 2AVDA 1J8DA 1E3WB 1XTJA 4MQEA 3WVNA 1HFEL 2GFJA 5E0OA 2FI1A 4K1LA 1UFOA 3MA0A 3AMZA 4CF4A 1HYEA 2K6GA 3IS3A 5C5DA 4ZDVA 6NULA 3BDIA 2C7OA 4MMXB 3HKCA 1BT0A 2CNDA 5BSVA 4JUCA 3T9BA 4AT1A 4B1FA 3K9HA 5K6AC 3MELA 2YJ3A 1ZD5A 4IIJA 3D8TA 2C2HA 1MEEA 3NVKI 3DM5A 3BXZA 2J42A 4E31A 4AO6A 1FP6A 3GJRA 4A5SA 1XP8A 2I3BA 4UNQA 3KJGA 1O3YA 1Z2AA 3RCZA 4UAMA 3OD1A 4Y18A 3BB3A 1FFGA 3T4EA 5GVSA 2P8JA 1CDZA 1X1DA 3NTVA 3ICQB 4D0NA 3M6WA 3I4FA 3LLUA 3SYKA 4TV8A 2OHIA 3QNUA 3LT5A 4AUEA 5TS3A 1WMAA 1OTRB 2Z30A 4AIIA 1U6IA 2VT3A 5M7EA 5C7LO 5EGSA 2IEDA 4UCXA 2BYEA 3PS9A 1UJMA 1LDEA 4BJ6A 2D5GA 5KJ6A 4R41A 4F4DA 2LE0A 2B2NA 4FEYA 5TMBA 2IO3B 1SURA 3INTA 1XELA 1EYZA 1UGJA 3PFBA 1D2MA 1VB3A 3F4BA 1FLNA 1Z5PA 3E3LA 4GF5A 4CHLA 3TRDA 3IMEA 2I1QA 4P4TA 3AIMA 1GGMA 5FI3A 4J8PA 4MS4A 2O6VB 2ZULA 4UEJA 3IMGA 1UZAA 2WEKA 1S8FA 4HSEA 3UCEA 1KFEB 4O02B 3H5WA 2ZBRA 1U0JA 4Q01A 4AS1A 3A6HA 4KQFA 3R76A 1MV5A 1DT5A 3MWEB 2XYGA 3UAWA 4YJGB 1OFGA 4I50F 2BGJA 3ESXA 4RLQA 5B3AA 2CKHB 5DW0A 3P9YA 3GJQA 5AHRA 2HJ1A 3R9XA 1Z16A 3KSBC 3EQ8A 4KGSA 4L51A 2ROQA 3VO2A 1XMJA 3HWSA 4TKUA 1NVVQ 4LGVA 1HTBA 3OCWA 3LXXA 1XLNA 3I3OA 4L1KA 1PD1A 2ZKIA 3Q5EA 3L06A 1SG6A 2D2EA 2XF4A 4NZYA 5E6UB 3LZDA 3VPDA 4W7SA 4EX7A 2QVZX 1PNTA 1QCDA 3SRXA 1I4DD 1XTUA 3GLHE 5C81A 3M6IA 3FYSA 2AFRA 1OWNA 4Z4HA 3R4CA 1O77A 4YP0A 5J4KA 1LBHA 3P97A 1QP8A 3QJYA 1D7AA 4OKSA 3KSUA 5A2QA 1Z2DA 1E6WA 4S05A 4YT2A 2BS3B 5FR1A 2IGHA 3PFFA 4FN2A 3NFRA 4PTZA 2NU8B 1B42A 4QTXA 1O95D 4BVJA 2RI0A 2W9XA 3GZJA 5CYOA 2G80A 3VX4A 2IY0B 4ICVA 4ZYNA 2CHVA 2WYOA 3KQOA 2I34A 1L1RA 3H2GA 3MNFA 1VMKA 2D3CA 1SVLA 5ENDA 3OEED 4NPCA 1G42A 3QXSA 3NKVA 4E1VA 1L5FA 3WFIA 1N36B 2OO5A 4KKJA 4YRFA 1QRTA 1RAEA 1E6EB 2VCEA 3CG0A 1MH9A 1U1DA 2BYTA 1CIVA 4TV3A 4DM7A 2FR1A 1E3MA 3CISA 2FU5C 2QTWB 5AJUA 4OFWA 3Q3IA 2EJVA 4C2BA 1W48A 2NYRA 3E0QA 3E9EA 4FCWA 3H4VA 4WY2A 1YA4A 1BIFA 2QY6A 1C80A 4ETWA 5KVCA 5B1UA 4MDFA 1FQJA 3F6YA 2FJ0A 3AXSA 3GFRA 1DRWA 5L6LB 4QVGA 5B1YA 3U3XA 4CMKA 2WIGA 3B2EA 2BEWA 2NBWB 3TLGA 3RJTA 1FRZA 5EJ6A 2LGJA 4WX2B 3HUEA 2BG8B 2O2EA 1A9RA 3T9LA 2DAPA 2JH8A 3PJEA 1W4BA 4FJ2A 1MTZA 4WRRA 1QIKA 4AJKA 1DHTA 4ZCIA 2A35A 1HL3A 4IDCA 5CM9C 4OUDB 5DLQC 1ZH6A 3DPDA 4AC9A 1K4KA 2O8VA 2I6XA 1QGYA 2W11A 4B3MB 4F5WA 1QH1B 5LP6A 4H0NA 2O8NA 3NC4A 2VDKB 3I6MA 2WB4A 2LW7A 4RE5A 3SVZA 3O2QB 5IYZF 4MCIA 5BYSA 4HQFA 1X86B 2ZAGA 3QX7A 2VJKA 2YWGA 4HB3A 2E3TA 2DFDA 1BOFA 4C7OA 1KY4A 1D3ZA 1WDKA 2BFBA 4NZMA 2OBXA 1PZMA 2HNBA 4BRWA 3JATB 3ENEA 2ZRGA 1IJKA 1TZJA 5FKJA 3L0IB 5MN4A 3OAAA 4GE0A 3IA2A 2WQ6A 1CIPA 4CV0A 3F5QA 4C2UA 3IGFA 3BREA 1W93A 2VDMB 1NI4A 1K88A 1XTPA 3PNMA 4E08A 1Z17A 4HRSA 4L22A 1AHPA 1J56A 3L17A 1P45A 3CLUC 4A0QA 1EP2B 4HEHA 2FKAA 4GPAA 3AF3A 4NDAA 1WJNA 4A90A 1WEKA 4NBNA 2YWEA 4WOJA 3FCUB 1LV8A 1Z33A 1AZSC 1MO3A 3KTAB 4Y2VA 4KWIA 5AMXA 5BORA 4QRDA 1MLDA 2WD7A 4L7QA 3QELB 2AC2A 3O65B 2WAXA 4KN9S 5JDIC 2VSXA 2HA3A 2X7XA 2BKXA 3SYNA 4W9KA 2PA3A 2GH1A 1PZEA 2B4KA 3MC9A 2XMRA 1P1FA 4IQ0A 2BEKA 2PKCA 3AFNA 1N77A 2O2CA 3DEAA 2YN0A 3EDOA 2YJ6A 3IBYA 3DCJA 3ZXXA 5LQCA 3FSEA 5FOWA 1ZJ6A 2PUCA 4JH0A 3COWA 3ADRA 1U1GA 2EGHA 3GN2A 1SQGA 1V1RB 3BILA 3UWDA 3PPIA 3Q10A 4TL7A 2DOKA 2AD5A 4G67A 5K0EA 1LX7A 4LJ9A 3EUEA 4RY2A 3BB4A 2M5CA 5HI1A 4ZQHA 2IUYA 1HKHA 1SD1A 4Z4GA 1JWSD 4MHSA 4F21A 2F1JA 2APJA 3DVGY 5DBOA 1IWPB 4LVOA 3IMFA 4E2YA 2REXB 3CUWA 1M2VA 5L7YA 3C14C 5K2MA 5ADWA 3OE7D 3WP1B 4ZODA 1KAMA 4NPHA 4BQFA 1K5GA 2CDNA 3OTIA 2OHFA 1X80B 1V86A 1E7MA 1A5RA 4RM9A 1TJPB 4HX9A 5D7NA 3GNSA 4YAFA 4AG3A 2XVAA 1PP4A 4JJZA 2UUBB 3RI3A 1O8BA 4KH0A 5IS2A 4NQ4A 2R87A 3WKCA 4XQEA 3KR9A 3MS4A 3TQCA 1T1SA 2CNWD 3ZHYA 3LVRE 5I45A 3AVPA 1BJTA 4QFMA 4XX1A 2D10A 1Z35A 1EDEA 3R5KA 3MJRA 4JLBA 2AR9A 4L6AA 1GARA 3O31A 2BMDA 1MIOA 4MQ5A 4R9NA 4CKXA 3SY8A 1PGXA 3RUPA 1W9MA 4PZCA 2JIDA 3N2ZB 3W8NA 3K96A 1P77A 3IR5A 1Z5VA 4DV2B 2CHUA 5DSXA 1XXHA 3A28A 3N39C 2HCTA 2EELA 3RIHA 2VP5A 3N2LA 2VNKA 4PO3X 3B3FA 2QRLA 1E3LA 4PRLA 1ZK3A 3KUCA 2H5LA 1B1AA 3OAWA 4E5NA 2QZZA 1P1KA 1ZGCA 1KM7A 4MR7B 1MAAA 2VLBA 2MYTA 3UT5B 2CLSA 1D1PA 2I99A 3KFVA 1A7KA 1TKYA 3THOA 3E4CA 4AMVA 1VHLA 3PR1A 3VDNB 1WX1A 4HROA 3QKTA 4CIWA 4RENA 4KWCA 1TO6A 1YFJA 4XPIA 4GC5A 2A9VA 2JFNA 3ISTA 1OGWA 1E9EA 3W2GA 4Z3DA 3BRWA 4ALJA 5F76A 1SXPA 1G9XA 5BNTA 2Q5CA 4YQYA 3R7NA 3EVZA 3KEFA 5EV6A 5AH0A 4ER3A 3IHWA 1WXIA 3MOGA 2JIOA 2ZVPX 3V48A 1KDOA 1GB1A 2M6SA 3K72B 4BNLA 2KMCA 2O7RA 2QL9A 2G28A 2XMGA 3T5GA 4W9FA 3LKVA 3TB4A 3NXSA 2ZI3A 3BBLA 1UZUA 3LVFO 2X9QA 1F6WA 1E8YA 4OREX 2SKCA 3CU5A 5A4DA 2DHDA 2H0AA 3ACCA 2L00B 4X6XA 1WMHB 3EDMA 4JROA 4B6JA 1SA0A 2BONA 5LZ9A 1USUA 3NBUA 5IDWA 4HMQA 2W54A 4K9DA 3U9LA 4UNPA 1I3OA 2XIJA 5HRCA 4PGFA 4B4WA 4ZI3A 2BHRA 2E4UA 2OZLB 4IDQA 3BD8A 4JT8A 4QU0A 4KN5A 1LBQA 1NVGA 4GDFA 4Q7EA 3QYJA 2JRIB 2F43B 3ETDA 3T1OA 3P2BA 3M3DA 1FF9A 1GPAA 3FJYA 3Q7PA 4XB1A 4P35A 4RGYA 5P21A 3AP1A 4TWBA 4UVIA 1HMYA 3TMKA 2IQ5A 4S1TA 4HOYA 4MQEB 1LK0A 2HO4A 4HD8A 4M0LA 4ZJUA 5C3JB 4NICA 5HE8A 5AJZA 5IXSA 5DH9A 1N75A 1JR2A 5IAJA 1QOQB 5EC8A 1OXVA 4RDHA 4CIBA 3WAKA 3KB6A 3W3AA 3JYQA 1TM7E 1Y6QA 1WPRA 1N5MA 2FMKA 1ANKA 5AW9A 2P6RA 5DX0A 3HKCB 5FCDA 2KMLA 4EI8A 4UUNA 2H65A 4M8LA 2QPLA 5TX7A 3DFIA 3HHMA 4ZRJA 4GM1A 1DRVA 4IIJB 5CUQA 2FSSA 2CZQA 1EHCA 5SZJA 4N5LA 1YIDA 1K3FA 3CM0A 1AO0A 3AE4B 2ZAYA 3ZDTA 5AEBA 4O8ZA 1W5SA 4RMNA 3HDVA 4DBLC 2ZTHA 3RT1A 1WZEA 5DBEX 2R47A 2GD6A 4ZO2A 4U7GA 3PCTA 3KQKA 1GZ6A 1OYWA 1ZONA 4J7UA 3E6AA 2HEGA 3M3HA 2RHGB 4B0MA 2YTZA 4J49A 5CB6A 3H2JA 4IDGA 1ZVQA 3BV6A 1WJGA 4JSTA 2I4MA 3V1TC 2P2DA 1E62A 4R2JA 3OLQA 4Q3BA 4D80A 2PL1A 5DK4A 3CH5A 2H89B 2NZVG 1GYPA 4OHWA 3K9NA 1QIMA 1NF9A 3K1AA 2R48A 4GPIB 5SYMA 2AE1A 3LS2A 4N01A 2FCMA 3CO0S 4FFNA 3AR3A 1IY2A 1Y89A 5EZ6B 2W2VA 1I4XA 1N5DA 3TCNA 1B4DA 1K7XB 3BIJA 3NGXA 1FS6A 4MS4B 1HG1A 4OX9Y 5C5EA 5J18A 1A9QA 4CV2A 3MBOA 3KZXA 2XCTB 5HIJA 5JY6A 1YIWA 4CTMA 2PIDA 3U4EG 3S2EA 4TMXA 1YR6A 4XE0A 4IICA 2ZWPA 3ZZ1A 4NE9A 3ZE0B 1Z75A 1T9KA 3D6TB 2Z3VA 3OKCA 4P3KA 4L8FA 5J43A 3O9VA 2VTVA 4TMZA 2AEMA 1YJBA 3R9XB 1JL3A 3G7UA 2OAEA 1Q15A 3F6RA 2OYSA 1SJHD 1H8ED 4TKUB 5D8DA 2CFTA 3JQQA 1Z5NA 2IH4A 1FNCA 4X97A 4GAEA 2VHYA 1C4KA 3PDIA 2GZRA 3I62A 1DAEA 2IDYA 1B1CA 4RK0A 3MCUA 4KSKC 2GLTA 1T9BA 3LGXA 3TLMA 2E3JA 1KI6B 2WWRA 1B8UA 3WDMA 3CRZA 5JAUA 5EGNA 2HQBA 3M82A 3CIFA 3FI0A 5B58C 4Z0HO 3WV4A 2BFCB 2K7FA 2A5LA 5A6SB 3ZCQA 5LSCA 4EGJA 2JANA 1AG9A 1K66A 3V4LA 5AW0A 3IXMA 3URYA 1VCMA 2CLDX 1GQQA 4KGVA 5KQLA 4YRLA 2CHWA 3B6ZA 1GP2A 5K3DA 3PKIA 3QEBZ 1T0HB 3O7WA 1A5SB 1KO2A 4H7PA 3OPXA 1ZCJA 4JA2A 3CRNA 2NU7B 4DZZA 4MSUA 2RGAA 3TKAA 1ARZA 1WXEA 3P9CA 4DTCA 2OB1A 1NVWQ 2IY1B 4RMGA 4US8A 1G98A 3WFJA 2V0CA 1YRQA 4AW9A 3ZBQA 1AO3A 2XVYA 2QIOA 3V34A 721PA 3LA8A 4UQOA 1ODKA 1UM9A 2RCNA 4G4SO 2QV7A 2RMKA 2EP8A 3NVZA 3CNEA 3M6AA 3GS2A 1G8JA 3Q6VA 5DB4A 4W5TA 1GNTA 4F1SA 5K4MA 4HAWA 2I2AA 3BZBA 4DCVA 3ILSA 4YRDA 2VH5R 1QOFA 2X58A 3EIOA 4BCCA 5FBWB 2IZ1A 4UATA 3RR2A 1KFCB 1P60A 4DB4A 4MM3A 5D2CA 3WNVA 3N3AC 2Z8XA 5B6PA 1WBDA 1TGYA 4R2HA 3UAOA 3ZXYA 4LMAA 2PLAA 1H9CA 1MG8A 2YXEA 2ISSD 1WXFA 2MYUA 2CS4A 3A6JA 1E1CA 4PRYA 4ECAA 2UYXA 2HMSA 5B2FA 2WJVA 2BEWB 5LBTA 1HR0B 1XFAA 5EIBD 1UJCA 1EM7A 4OB8A 3OM0A 1KKLA 1Z0JA 2H18A 3ZC3A 2B3DA 4QICA 4XEUA 3ML9A 3FKSD 3GCXA 4EHJA 3QE4A 2P3SA 4RIEA 3ZU5A 4K0RA 2HU7A 5BYRA 3PGA1 2TECE 3P0HA 2JW5A 2XGMA 2VH1A 2NUBA 1N3YA 1XTOA 2JFFA 2AMFA 4UAGA 5TR5A 3B3QA 4X71A 1IGCA 5BT8A 2FPUA 3TOCA 3OOWA 4MKGA 5LP6B 5EG5A 5AW2A 4MUKA 4OL9A 3RNLA 2IL1A 2VYQA 3ZO5B 4OXNA 3DV0B 3JAKA 3ETJA 3QOWA 1PFGA 4J0JA 2ZVNA 1NMSA 4C7OB 4WA8A 2BFBB 1CUUA 3PJGA 4NEGA 1NDHA 2A9KA 4JVOA 3UKOA 2OQIA 1ZKMA 2JJYA 4LOAA 4CQLA 5FFMA 2W4QA 4ER7A 3KWMA 3JY6A 2YY6A 3AM9A 1ZM4A 1GEGA 1NI4B 1M2OA 1QV9A 5FTJA 1A88A 4XWYA 1WB4A 1KJ8A 5FI0B 1MIHA 4JKIA 1WSWA 3NIDB 1ZIXA 5TSDA 4EKUA 3PWSA 2P97A 4R1PA 3NTQA 4U7PB 2J3MA 1Y56A 2PVPA 4FLMA 2IXFA 4UTXA 4IW3B 1KEPA 4KSYA 1TF7A 1L4HA 3WMXA 4B33A 4JUBA 3C8DA 3LRXA 1O0CA 4WWMA 4EGFA 2GQ0A 1K06A 5F5LA 2G8LA 2ZM6B 3N07A 2FE4A 5ISMA 3QXXA 1Q0LA 5T67A 5K6RA 4FW8A 5JSZA 3VR3D 1CD5A 4DL9A 3CVVA 4NNOA 2PX3A 1PT7A 3D4NA 1UMKA 4C6SA 1KARA 3IQGX 3P0EA 1YZ3A 1IUNA 3WYDA 4NJEB 3VHRA 4AL4A 5H1YA 4YUYA 3FPLA 1P8JA 3TLAA 3FMFA 2PRSA 1UKVY 5KO2A 4DMKA 2HJVA 4P4GA 4AN1A 4LV6A 2WWFA 4AG6A 1D3AA 1U6KA 5EMJA 4L27A 1EGHA 4Z7RA 4BLPA 2ZUDA 3EVTA 2GAAA 3EECA 5KOHA 1KETA 2DHQA 3R7WB 4QUBA 2EU8A 3EE6A 2R86A 3N76A 4EI7A 1M2VB 1B3BA 1KERA 3HCAA 3LT4A 2KMMA 3LLCA 3TOXA 4BY9E 3IHLA 5TGZA 3DOWA 2JLYA 2GNAA 4IIJF 5F9MA 4M36A 1K0FA 4Z1MA 4TYMA 3K3PA 5I3ZA 1JQKA 4YT0B 2QLFA 2HK7A 3GZNA 3R6GA 4YJFA 4LC9A 2DT8A 1N1GA 2QQFA 4G24A 5H80A 3AEZA 3LRPA 2Z2ZA 3OEHD 2JAUA 4OGGA 1QKZA 2WJ3A 3EPRA 1KOGA 4OJMX 1DOZA 1SHJA 3FYCA 1RRBA 1U9ZA 1XXHB 4KIGA 1J8MF 2AI3A 3W34A 1WDWB 4TZKA 3TZHA 5DGCA 1T0UA 4OQDA 2FJPA 2PW9A 2D0IA 1RAGA 2DYOA 3PTLA 4IJVA 4YV1A 7MDHA 3KT3A 1MJHA 3KUCB 3APDA 3TXYA 1YMHE 4IWQA 2A5FA 2CE7A 4CE6A 4MS3A 4FTWA 4CM4A 3SF8A 2XBUA 4M00A 3O91A 1DJLA 1OF1A 4GOKA 1H0HA 3A6PC 1WUYA 4KWTA 2N9XA 3JVEA 5EIXA 2C61A 1E2HA 1XTVA 4XPIB 2Q4RA 2HSWA 5AVOA 4RVGA 1UPXA 1MRSA 1V39A 3I8OA 3DAFA 1S8AA 1WXXA 3A9VA 3Q3HA 4LCBA 4ETIA 3QF7A 3VGPA 1HYGA 5KEIA 4JNCA 5JNLA 2ZXFA 5E4JA 3AY0A 3QH8A 3EDYA 3C1TA 1PL0A 1PJCA 3QIVA 1MI0A 4RF1A 3QWHA 1QRSA 1CUWA 1EINA 3SJ7A 2BHSA 3V9AA 2PMCA 4L6IA 3O93A 2D8AA 4EARA 4ZVOA 3GZTB 1RYJA 3K09C 1EDDA 1SBNE 3EA5A 1D4AA 1Z6PA 2NSYA 1XRSB 5KCZA 2XNKA 1H0KA 1FDSA 3D9QX 3T8MA 2R1ZA 3R7FA 1BTOA 1M8JA 1C8VB 1Z88A 1T9ZA 5M34A 1J99A 2HSGA 1V5OA 1EJ2A 1DO0A 4CTJA 4FDAA 4KN8A 1ISGA 3RAGA 4M21A 1JT9A 2OCDA 4R31A 2J3KA 1B15A 2JLZA 1UBTS 3SS9X 3H1UA 2WP0A 2GN2A 3AQIA 5T41A 1USWA 4C89A 3GD7A 5FHQA 3AR9A 4CU2A 5CDFA 1KI2A 3QJ5A 2X0FA 2KX0A 4QBFA 3COVA 2N0SA 4G5HA 1M8KA <