3T3NA

Molecular basis for the recognition and cleavage of rna (uuccgu) by the bifunctional 5'-3' exo/endoribonuclease rnase j
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
550
structure length
550
Chain Sequence
GPQDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGAEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Basis for the Recognition and Cleavage of RNA by the Bifunctional 5'-3' Exo/Endoribonuclease RNase J.
pubmed doi rcsb
source organism Thermus thermophilus hb27
molecule tags Hydrolase/rna
molecule keywords Metal dependent hydrolase
total genus 160
structure length 550
sequence length 550
ec nomenclature ec 3.-.-.-:
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3t3nA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 3t3nA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3t3nA01
2YNVB 2BFKA 4AD9A 2GFJA 2I7TA 2BGAA 2OHHA 5FQBA 4HKYA 3F9OA 5LMCA 2YCBA 2E7YA 1X8IA 1ZNBA 2BIBA 3LVZA 5A87A 5HH5A 1BC2A 2QJSA 1WUPA 2BG6A 2M5DA 4HL1A 3ZWFA 3ADRA 5EH9A 2H6AA 3R2UA 5HH6A 2NYPA 4O98A 5ACWA 2FU7A 1DXKA 2DKFA 1VJNA 2ZZIA 3VQZA 5ACUA 4GYQA 2ZNBA 4XUKA 2QINA 5ACXA 3I0VA 4C1DA 1ZKPA 4U4LA 4DIKA 5AYAA 4KEPA 2NXAA 3IE2A 3QH8A 2ZO4A 1VMEA 3DHBA 5LS3A 4RL0A 3IEMA 1A8TA 3IOGA 4D1TA 4EXSA 1XTOA 3IELA 2BFLA 5K0WA 4PVOA 5DPXA 2AZ4A 2BC2A 4NQ5A 2M5CA 5LE1A 1XM8A 3I13A 2QEDA 4TZ9A 3PY5A 2WYLA 2FU8A 3DHCA 3SRXA 2FU9A 4TZFA 3DH8A 1KO3A 2BFZA 2FU6A 4EYFA 3BK2A 5IQKA 1ZTCA 5LSCA 2NZFA 4WD6A 1YCGA 5HISA 5AXRA 2I7XA 4Z5ZA 2Y8BA 4UWOB 2FM6A 5KILA 4UAMA 2P4ZA 5EW0A 3Q6VA 4FSBA 3RPCA 2BG8A 4TZEA 4FR7A 5LLDA 1E5DA 2YNTA 2A7MA 2AIOA 4Z5YA 2GMNA 5K4MA 2YNVA 3A4YA 1YCHA 3DHAA 1VGNA 5EVBA 1L9YA 4RM5A 4J5FA 3WXCA 2BFZB 4TYTA 5AXOA 5EV6A 2DOOA 3FCZA 3RKJA 5LM6A 2WRSA 3P2UA 2GCUA 5ACPA 3H3EA 1KO2A 4AX1B 4ZO3A 5EVKA 4D1WA 4RBSA 4NQ6A 1WUOA 4P62A 1YCFA 4HL2A 5HIPA 2Y8AA 2NZEA 3ZNBA 4Z7RA 5ACRA 1JJEA 4TZBA 4J5HA 4BP0A 4JO0A 3BV6A 5FQCA 4YSBA 3IE0A 4ZNBA 4C1GA 5A5ZA 3IDZA 5B15A 2Q0JA 4C1HA 4YSKA 4GYUA 3X2YA 4ZO2A 3AF5A 3IEKA 3PG4A 1QH5A 3MD7A 5EVDA 5LCAA 4TYFA 5A0TA 4GCWA 1DDKA 4C09A 2WYMC 3L6NA 1M2XA 5ACSA 2HB9A 4D1UA 5ACTA 2Y87A 2FHXA 3VPEA 4C1FA 5HH4A 4EYBA 2QDSA 3TP9A 3KNSA 4DILA 3T3NA 2WYMA 5B3RA 2YZ3A 1DD6A 3IOFA 1JJTA 1BVTA 2FK6A 3JXPA 3AJ3A 1SMLA 2I7VA 4ZEJA 2Q0IA 2YNWA 2FHXB 4FEKA 4UWPB 5AHOA 4B87A 4UBQA 5ACVA 3ZR9A 4PVTA 2YNTB 3X2XA 1BMCA 3AF6A 3SD9A 4EYLA 2P18A 4Z60A 4BZ3A 4CHLA 1HLKA 3G1PA 2CBNA 1WW1A 2GKLA 3IE1A 4UWSB 3S0ZA 2WHGA 3SBLA 4H0DA 2BTNA 5EHTA 5HIQA 1X8GA 4UA4A 5AHRA 2R2DA 5AEBA 2UYXA 2XR1A 3I15A 2OHIA 4C1CA 2ZWRA 4D02A 5KIKA 3SFPA 2YNUA 5A0VA 2BMIA 4RL2A 5K4NA 3SW3A 2BG8B 2GFKA 4RAWA 4F6ZA 2BR6A 1JT1A 4Z6XA 4D1VA 4EXYA 3RKKA 5LCHA 1MQOA 4Z67A 3X2ZA 5K4KA 4V0HA 2VW8A 4KEQA 2OHJA 4AX0B 2P97A 4EFZA 4LE6A 5HIOA 1QH3A 3I14A 3ESHA 5B1UA 4AWYB 2Q42A 3KNRA 5EV8A 4YSLA 1WRAA 1X8HA 2P1EA 4EY2A 1KR3A 3T9MA 2XF4A 5EWAA 2BG7A 1P9EA 4XWTA 2Q9UA 4NQ2A 5LCFA 3FAIA 1K07A 3X30A 1Y44A 4NQ4A 4RAMA 1A7TA 3T3OA 3ZQ4A 3I11A 3SPUA 3PY6A 2QDTA 5ACQA 5FQAA 4F6HA 4XWWA 3BK1A 4AWZA 3KL7A 2BG2A 4UWRB 3BC2A 4C1EA
chains in the Genus database with same CATH superfamily
4OG2A 1BA2A 4AZWA 4EBBA 4RK4A 3CH6A 5K6TA 4DR6B 2WSSD 3A2LA 4PYKA 3PC7A 2GFJA 1QWOA 2C5GA 2IA5A 4TWIA 2W2VA 1Q22A 5KWJA 3N05A 3SJZA 3M63B 3ESXA 3PRKE 2PMBA 4BE4A 2J08A 3PPXA 1TT5B 4KI0A 1W36D 4PS3A 2NXWA 5G0SA 2X8JB 1XMIA 1EGAA 3BSSA 3O2SB 5MN6A 3TINA 4OXYA 4C0XA 1Z36A 1D4AA 4TUYB 3FG9A 4RGTA 2VPTA 1IN5A 1LGYA 1PFUA 5FFNA 1RYZA 1UMKA 2A4MA 2LD4A 2ORWA 3CMCO 4X90A 2WXPA 3PREA 4FA6A 1SFRA 1VHJA 4Q4LA 3LBIA 1L4LA 3T95A 4M83A 3VO1A 5BV8A 3VZQA 3CPHA 2P9GA 1ZUHA 2OYSA 4JT9A 5FR1A 3QVXA 4C08A 2KMAA 1A9RA 2NO1A 4ZYXA 3W1SA 4KQMA 2AYYA 1K0FA 4OHCA 5CT4A 2PBZA 3GROA 3NM4A 4JC5A 2H2AA 2BISA 4M0MA 3U1BA 5B5SA 1KFJB 4P34A 4WCFB 4FLMA 5DPRA 3UK7A 1TMYA 5EH9A 4MCHA 3D43A 4FZ5A 1UGJA 3GMDA 3UH1A 1US8A 3V4SA 2WHQA 3TFWA 4WFKA 2MYPA 4MYUA 1I80A 4V0MA 4G23A 5A3QA 4J2OA 3P4SB 3ZV5A 4BYMA 1YJIA 2M32A 3I5MA 1ONNA 3H4TA 3KUXA 3D6TB 3SHOA 3L8GA 4CM4B 3T52A 2FU7A 1FFBA 2YINC 4B0MA 1GYPA 3DFIA 3AVYA 5I8ZA 4GYQA 3R5XA 2BEWA 4KN9S 4ZK6A 4D9IA 2B35A 3N1ZC 3CEHA 2AJCA 3KOWA 4GVLA 2P30A 3MWEA 1RABA 4O02B 1WR1A 1P0CA 2IK8A 4A9AA 2BM0A 3V4LA 5A5GA 1ZVVA 3IE2A 2NZ2A 5IJZA 2B4TO 2QRNA 4TSFA 1EUCA 4K3VA 4C4PA 4A20A 1L6VA 1S3IA 2ZSDA 3NDRA 1N4DA 1L3BA 1VMEA 5HMLA 1WI0A 2GT1A 3SHVA 3SJBA 1J8MF 1E2UA 3CG4A 3HBAA 3NTUA 3L77A 4HX2A 2WS3B 3S40A 2QVXX 1A8TA 1F1HA 2GZDA 4YY3B 1TBEA 4N8DA 3PNLA 4Q39A 2PX3A 4QOEA 4FC6A 2C5FA 2IX9A 3FNQA 4FMDF 1VKHA 4GR4A 4RV9A 1QDLB 2QUZA 4XYCA 3ISVA 2VNIA 2YZ7A 4GOXA 1R37A 5EJ9A 4OQ4A 2UU9B 2NLOA 3H2HA 3H11A 2JBWA 4V3CA 2RDGA 2FMUA 4LOJA 3I1FA 4UHJA 4G0ZA 3H2JA 3C3YA 3I4LA 1E9BA 1O96A 1P45A 1NBEA 1LVGA 3AESB 1VZ7A 1Z6QA 3M4YA 3R3JA 5CRIA 2HNAA 5T4BA 3RW9A 3WP0A 1JEYB 4JKYA 2PCLA 2QN8A 2XOKD 3ONFA 4IRMA 4L5JA 4FZRA 4IDIA 2HK7A 3VKHA 4IW3B 4HP8A 2W54A 1OEYJ 1H3FA 4K3UA 3PWTA 1T9AA 3OOJA 4OHXA 3TR5A 1RJFA 3ND7A 2WFAA 4Z4CA 3CLTC 2XWBF 8ATCA 5JMWA 3CZMA 4YI5A 1P3QU 2GWRA 3HVZA 3ADDA 2JPHA 3CX4A 4FFNA 4EKGA 2GN2A 3MINA 1E0AA 4OV6B 3L5KA 4JQSA 1HV8A 3AR3A 4IGFA 5AVTA 1E61A 1E0SA 1YCGA 4GZLA 1K5GA 4CRWB 9MHTA 2K4MA 4Z5ZA 4KDEA 1JA9A 6REQA 4QG7A 4WZAB 2KAJA 4LYYA 2DPLA 4TGLA 3D3JA 3SICE 1A9YA 3QHAA 3G5TA 4LYAA 5THXA 3WK5A 2I29A 3QKRB 3V1YA 4IFTA 3IR7A 1E32A 1ZS9A 3NYIA 1RIIA 1B6TA 3OBIA 4WBNA 4WFQA 2Y67A 4U7GA 2KDIA 3CA8A 4F2GA 5KILA 3ZWQA 4XSVA 3AE3B 3SBXA 3U81A 1SOMA 4NATA 2WXRA 5CVEA 3ZVRA 4LQCA 4OK6A 5JAUA 1QFMA 5CEJA 3BVZA 5DGDA 5JAIA 3E03A 4B3CA 2J9FA 3FLBA 4RSGA 1W93A 5E7QA 3K8YA 3KQNA 4OW0A 2O3RA 3B08A 2ZIXB 3WYDA 5F7JA 3CGWA 4D56A 1NAHA 1TZ1A 2WHXA 3FCYA 1G0OA 2G9ZA 5LJIA 1XYGA 1SCQA 4QBIA 1AYFA 1B6SA 1N2CE 3RSOA 2A7MA 2PRZA 4P83A 1QQBA 3I2YX 2PAFA 2OXFA 3CUVA 4CTOA 3AFHA 1GB4A 3U4CA 3ROGA 4P2GA 1WY8A 4DVGA 1P31A 3R76A 3CVYA 4DS3A 1ZSYA 4HV4A 4QFMA 4XGRA 5G4KA 3SFZA 4IW0A 4Y6GB 1NQVA 2NYVA 5B3JA 4CM8B 3EC1A 4G2NA 1WCWA 2CKDA 3DBHB 1SEVA 1J2YA 1U3WA 2YZNA 2ADFA 1A8SA 1PT9A 3KPYA 4LXIA 3RIEA 2BFZB 4BLVA 5D3IB 4E2FA 3BORA 3DEAA 1Z7GA 5REQA 5JU6A 3IR5A 2AYOB 3EQ9A 2H07A 3FCZA 1HEZE 4NEHB 4H6WA 3MC9A 2NADA 2FUCA 2OCDA 3E2MA 1MIHA 3MBKA 4X63A 3E53A 5L4LA 1Q0SA 1WR6E 2HXGA 1C4CA 2D54A 2BMFA 2N1BA 2VUHB 3B52X 1CKEA 5AM5A 4DLLA 4Q7MB 3RC2A 3QM1A 3VPGA 2I4IA 1UZAA 3CRVA 4HN4B 4IDBA 4OX9B 2P68A 1VLHA 4TQUS 3R8BA 4RA9B 2WWRA 5JZVA 3N5CA 3SAJA 1RYBA 2PA3A 1WSAA 3BXPA 3TM5A 5A1JA 2J3QA 2G07A 1UR5A 5E6OA 4LGYA 4P22A 5JDCC 5CEFA 1WUOA 1UFRA 1VKOA 2A5GA 4OHBA 1V2HE 1JR4A 3ZDMC 2XCIA 5D3DA 3CKYA 4Y1RB 5GV8A 1N6PA 1HL7A 1B0ZA 2E5WA 2JAQA 2YBEA 3EZ7A 3MOSA 1YZVA 4G4SP 4QBFA 3B1LX 1Z39A 4XCXA 3PVZA 2Q5WD 4DXGA 1OLUB 5IP5A 4JEIA 3TTUA 4BKMA 5CG2A 2JVIA 2Y0PA 1X7GA 2ZAGA 2G7ZA 4C3UA 1TXGA 3DGFC 1P9OA 1LSUA 3F6CA 3IT0A 3H2ZA 4TS4A 3F97A 3VH4B 4XTRA 4BNFA 3W9BA 5TXGA 1NNEA 5D87A 2ZW9A 4L74A 1Y4ZA 1HZZC 1CJVC 4D0LB 4ENQA 3URMA 3HB5X 2KYRA 3UAOA 5KNDH 2PTLA 2D10A 4OEHA 4DXAB 1UK8A 4AUNA 2RGNC 2EWMA 4QPJC 1U8CB 4KPGA 2MINA 3D5EA 1SC4A 3Q87B 4H0CA 4KAAA 1E79A 1GFSA 1HDYA 3O1IC 1WF3A 4I4LA 3SR4A 5IZ4A 3H8WA 2AJLI 3X1ZA 3DB2A 4JH0A 4Z7NB 4OLHA 3FSJX 1LLUA 2ZI7A 4BOZB 4JJ8A 5JJLA 4HZUB 1XRLA 2HA4A 4Y0NA 4BDTA 4C0KA 3D8RA 3HKDB 1R88A 1Z6PA 2R85A 3CLUC 1L1RA 3L6CA 4J3JA 1BXTA 4JHXA 4FJ2A 4WMLA 2YC4C 4MGKE 1PT7A 1JN0A 4OJQA 3RUEA 1S7CA 2OCLA 4XE0A 1ISPA 1E7WA 3NHKA 2JGEA 1PS8A 3HPQA 5JQGB 3KUDB 4MUFA 3LXUX 1TZBA 5A0TA 1XAJA 2WX0A 2VDKB 4P7JA 1BXRA 5CT9A 3FNRA 1ZRSA 3JARA 3NXKA 3RUDA 3ZTWA 4DMGA 4ENVA 2CXNA 1NENB 5CYFA 4LDJA 5E1BA 2CLLB 4JLSA 4Q7EA 2P4EA 4GMDA 3AWIA 5A5FA 1JDUA 3VAYA 4W9GA 3WMRA 1EF1A 4MAMA 2V9CA 4DBLE 3WQQA 3G0GA 1IQUA 2DU8A 1W30A 3ODGA 4OAQA 5EEHA 5JCJD 2G4LA 2QDSA 2Q3BA 5AK4A 2GZRA 2QY6A 1FDIA 1HMPA 3B5EA 5DYTA 3T3NA 4B2LA 3M0EA 4CQJA 5AM0A 2NVUB 1T5BA 4WURA 3RYTA 3GGCA 1EH5A 1I14A 2IE8A 5FPHA 1EDDA 2W6NA 3E82A 1UXOA 3LDAA 4NJOA 4ZC1A 4DLAA 1SBHA 2Q1UA 2ZI6A 1XZPA 4JOQA 1BJRE 5FAKA 4CL3A 1EZ4A 1YB7A 2YWGA 2JS7A 2X1VA 1Y8CA 4O0LA 4BB5A 2X2FA 2QKYA 1KZ7B 2FK8A 3RB8A 1ROEA 4LF6B 1I8TA 1VPLA 3PLRA 1YMQA 4MKXA 4Y6LA 5AOCA 3R7FA 4LF7B 3PL5A 3BVMA 3RPEA 3JD0A 4YMIA 1XNRB 5J18A 1BE1A 1GA4A 1SC9A 5BWLA 2XRYA 5CX3A 4BRWA 3OUTA 3ZHRA 3K6SA 3P5BA 2Z83A 5CVTA 1W1IA 4DMKA 2AYXA 2XPCA 2XWSA 4DUPA 5BSFA 3QPBA 1VZ2A 4IX9A 3U37A 2O59A 2CDAA 4PVTA 3KO8A 2C99A 2I4TA 1ID8A 4PO8A 5J5VA 4CCWA 3ZK8A 4HNTA 2H89B 4AMYA 3C8ZA 4C05A 4HDRA 2G80A 4TTTS 1XTSA 3O94A 4UD2A 4KO2S 3V4RA 1R0KA 3KHSA 4LWOA 5C80A 5LDGA 3ANNA 2OK7A 1I2AA 3SZUA 3X30A 1X7YA 5GZ3A 3J7TA 3WAOA 2X1LA 1U8AA 4HLUA 2XCSB 1J24A 1HLKA 3B20A 2GTIA 1ISIA 2JLVA 4YJ2F 4IGEA 2AE2A 3CNNA 4LY9A 1I3NA 2GD0A 4ZMBA 2ZUBA 3C3DA 4UWSB 1QB8A 4RD6A 3DPDA 2YRFA 3QQ5A 1T36B 4BRUA 3U4EG 3EFCA 2VAMA 3ACCA 2VDPB 5G2NA 3HDYA 3ZI0A 3SC3A 1G21A 4U6QA 1MAWA 5B2ZA 3MRVA 5KOIA 5ELLA 4UCQA 2SICE 2ZIXA 1BKYA 3KZMA 5FX2A 3MWFA 5EHTA 3DULA 5F7OA 2GDZA 3AETB 7ADHA 3CVOA 1XMOB 2NX2A 4JX9A 2JBAB 4LXUA 2WZBA 2FPSA 1XWFA 1OXUA 2BMJA 2H57A 3QEMA 4B9KA 1H4RA 1P4SA 2AKEA 4GDLA 1QBKC 3COYA 1MW8X 2IIVA 4HSEA 1EX1A 4MGIE 1KSJA 1PL8A 3AU9A 2INGX 3QBTA 4CNBA 2HTME 4KDRA 4P7KA 2ZTLA 2I4NA 1LS1A 2GM9A 3KUUA 1OYYA 4PZDA 3S99A 1ZKMA 4HH3C 4HB0A 2C77A 3IHKA 1MV5A 1O9BA 1PHRA 4CF3A 2O8EB 2KKCA 2YTZA 1Y3IA 1YZLA 3EA5A 3KZKA 3QYFA 2D0PB 2O7QA 4ZOHC 3VTAA 2BVCA 1DKNA 4MUJA 1PIWA 1T0JB 3RUIB 4C5CA 4YMLA 2V7TA 3K7EA 2DUNA 3D7SA 3R5HA 1GT91 4TUYA 5TQJA 4C2TA 1F8FA 1R6BX 1WD7A 4RIGA 3IKTA 5KJ1A 1JW9D 4RK6A 1E2DA 1UEIA 3MAJA 4KAJA 4J7XA 4KXLA 2ZGVA 4Y9UA 4YNBA 3CPSA 1KMMA 2Z4RA 3E2IA 3Q7PA 4P36A 4F6ZA 3KPUA 5TPWB 1JBEA 4LJRA 1WDLA 4DMRA 3QU7A 3RNGC 1QP7A 2LI5A 4DIEA 3T5MA 1RHUA 4TYQA 5CVUA 1VJRA 2F3TA 1R9JA 1K7XB 2VOJA 5K3FA 4D1VA 1KYXA 5F2NA 1LJ8A 1WXFA 3I42A 3KSRA 4MRMB 1JBQA 4FHJA 4MICA 1G19A 4WZAA 3CZ9A 2ZSAA 3RFXA 4HEA1 1SZDA 1L4YA 2Q62A 2EATA 5EIXA 2FPXA 4JLDA 4OI4A 2PX2A 2J1LA 1VCOA 3K4HA 4TVOA 4UDUC 1UXHA 3TRHA 2GD1O 5DRTA 2A58A 4FCWA 3UNXA 4EHFA 2P97A 3DEYX 1WWTA 1AO0A 3R0VA 4PO1A 1CY2A 4HDMB 2MP2B 1DC8A 2EHJA 2W8BB 1QPBA 3BD8A 3OE4A 4GG1A 3DWMA 2G88A 5EUBA 5I3CA 1QH3A 3HRKA 4ZIRB 2YCLA 1SBTA 1UBIA 4M22A 4QYTA 4IWNA 4Y9TA 3KB8A 1TCBA 4DA8A 3U40A 5B1UA 1XD2B 2B2XA 2NTEA 2W2XA 4ZCSA 5KPDA 2CJNA 2JAPA 1LVUA 2V7QD 5IF3A 5FWDA 1Q7BA 5EV8A 2Z1MA 3ZXVA 1Z47A 2GYUA 1U0LA 5AK0A 1YMHE 4GL4A 1G17A 2VJMB 3M89A 4MEBA 1D6NA 4LNNA 4R05A 1L5HA 2GA9A 3KVOA 3O82A 1ESFA 4N4AA 2CNWA 5LC1A 5JY6A 1YVRA 2EKQA 4IQGA 1BTOA 2XF4A 4RPLA 2NV0A 3CPJB 4G65A 1U04A 3N8HA 4QM7A 4GLFA 1IUOA 1GRQA 2ZREA 5EWAA 1A8UA 2B0CA 2YBDA 3QWFA 1W4LA 3A9UA 3AR6A 1HFEL 3IAXA 2J45A 1BVYF 3IQEA 4MIEA 2NUPA 4TV3A 4RF2A 4EPWA 5COQA 4C7OB 3BN3A 2OPHA 2AXEA 1IBKB 1QE5A 5D8DA 3DCJA 3DDNA 2E87A 2DPGA 5C9ZA 1E2IA 1MC1A 2C5BA 3I1IA 3L93A 4KUGA 4PHCA 3UAWA 3UVEA 2LWPA 1U1GA 1J00A 1CP3A 5KI6A 3WKCA 1HX7A 4TV8B 1T0RC 2DAFA 2L69A 1W2GA 2JCGA 4V0ME 1Z4MA 5DXAA 1W59A 3KEGA 4M1EA 4ZCIA 5BNWA 1EIWA 5FWYB 3B53X 5DISB 3U7QB 3EW9A 1C41A 4G1MB 1P77A 5K6RA 1PNVA 3GOQA 3EPKA 1V37A 2BHRA 1QJ4A 4Q9JA 2WXFA 1LVHA 2YV3A 3BV6A 2A9KA 1DCMA 2DHEA 1KQGA 4X1OA 3AMZA 1JAIA 2CHZA 4BLPA 4CMBA 4ESEA 5A4JA 3CW9A 2Y05A 4MSQB 3A1EA 1DELA 2AR0A 2I6TA 3NWJA 1XDGA 3QWAA 1GC6A 3QUTA 4I3GA 1JR6A 4R2WA 5L3RA 3SY8A 4ESHA 3HKCB 3FKSA 1ZN8A 3QLJA 4RS3A 3F5QA 4GS5A 1WXHA 3JPWA 4LN1A 4R4JA 4YRKA 5IUJC 5HKHA 1YBAA 4NJMB 1I5OA 5J63A 2KVZA 3PQ7A 1EKXA 1DOZA 3C8MA 4O3MA 3QLEA 4AI6A 2B7CA 2JFUA 4DWJA 2MR6A 1M76A 2PNFA 2IZ1A 4BVBA 3RKKA 5F12A 4OPMA 5AJXA 1C0IA 3CF0A 3HHMA 4ALKA 4D80A 2BGAA 2QP3A 3E23A 5A7FA 1Y42X 3NORA 4EDFA 1PSDA 2KXJA 3E3NA 2IZVB 3JVDA 4G85A 3QVSA 4JC8A 1L4ZB 2ZANA 3WV5A 1X2BA 3GJSA 2RB4A 1KARA 2YCBA 1GQFA 1P1JA 1KFKB 3OA2A 2C83A 1V6EA 2JAWA 4C7YA 2BYTA 4HWKA 4ARIA 2O57A 4ZZIA 1FSPA 2DFLA 4EARA 3TZQA 2AQ1B 1OAKA 5JSUA 4HPXB 5JY1A 1NLZA 2A1TR 2JFOA 4DLBA 1NN3A 2CEAA 2ZRFA 3MMXA 5B1SA 2PX8A 3GDOA 2Q0SA 4MO9A 3TKAA 3SC6A 3LD9A 2I03A 2VYVA 2IUTA 3GZNI 1CZOA 1JIIA 3PNKA 4GXRA 5T57A 4CKWA 4G0QA 1PDOA 3HACA 1F8UA 1YNTE 1NQAO 5AKXA 3HBFA 3ADRA 3TEMA 2IX3A 4LHZA 3DLBA 3DDWA 5CBPA 1WVMA 4IVNA 2JANA 1RKQA 1N0WA 2R86A 2JFFA 1TA0A 4QOJA 1UL1X 1XI2A 4W1SA 1E5LA 1JWBD 1RHRA 4L8LA 3PXUA 1R15A 3CZ5A 4PFJA 3A9VA 3IIKA 5E3JA 4KYTA 4PIPA 7YASA 1JHRA 1GR0A 2A9QA 4PXSA 3MMPA 4DM7A 4HYTA 4NFHA 3SFEB 1JQ3A 1Y33E 3NGMA 2EP5A 4ISBA 2FSFA 1GU1A 1P0RA 3KHTA 4MINA 4RZSA 3QE4A 1RWWA 1NBIA 1FDTA 1XJ0A 1RFAA 3GLSA 5JVDF 5JASA 4NIMA 3ST7A 2ZIEA 1M2NA 5G5GA 2D1QA 1UPAA 2WUEA 4KQIA 4OHVA 1ABEA 4FN4A 3P0FA 1KEVA 1ZEMA 1T0UA 2O07A 4WCFC 3STYA 3U0BA 1Z18A 2ZNVB 5BQ3A 1ODLA 2VXCA 4GI3A 4BMYA 1U4AA 1F7VA 3JU3A 1PQWA 4MSMB 4LA4A 5IC6A 5E1DA 2WJIA 3SGLA 2W3RA 1GQYA 1HQKA 2JT4B 1Q1AA 4GOCA 3FTPA 3INTA 3Q0IA 5IS2A 5EC8A 2CLOB 4BDSA 4DN6A 3A6JA 5KHLB 2DBVO 5JBNA 1X9IA 3FYHA 3WVNA 1NR1A 1PEAA 1JB9A 1Z0ZA 4UXHA 1NX6A 5TC4A 4IJ6A 1PJQA 2AZ4A 3FWPA 2Q4OA 5BSEA 4K1RB 2PH7A 5JDCA 3QVGB 3TQQA 3P20A 3EGDA 3Q9NA 4P8RA 3NUHB 5AKIA 4ZVNA 1TLLA 3DEFA 1DQNA 5AHKA 1T2VA 3RI3A 2OCGA 3GVCA 5JCZA 3PI6A 4OZBA 3BJMA 1A9OA 4ZZ1A 3MWYW 4V1CA 2XVMA 4AVYA 2VRBA 1P61B 1JEOA 3P2YA 4EVSA 4FKMA 2X0RA 1UWCA 1SR8A 1PVOA 2IODA 2AD1A 1U3VA 2VK8A 4XIYA 1Q6ZA 4HH1A 5K3FB 1V26A 1X9GA 5FFFA 4AX4A 3FETA 6CHYA 2QHOA 3W1YA 5ALMA 2BFBA 5DM0A 3K2EA 2F8TA 3O0TA 2K6DB 1LLCA 1QF6A 3NYRA 2R6CA 4XYEA 4L8WB 4IOIE 4QGBA 3FX2A 2A3NA 3RKRA 3WQBA 1U2EA 2YJZA 4CNQA 1GWNA 1T9DA 3B1KA 3UT5B 4ZA2A 1F8XA 5DKFA 5CM9C 1F48A 2CJXA 2FLKA 2K6GA 1E4EB 3IESA 1RAXA 1TS2A 1ZN7A 1QKJA 1U0FA 2HJHA 4QC2A 5CX4A 1RNLA 2XSZD 2O8DA 1ONSA 4R9UC 2L0FA 2BG8A 3TDNA 2BP7B 4RVFA 2HSGA 1ADJA 2W6IA 3V2IA 1XK6A 3VKUA 3IEIA 2OGZA 2GXQA 1AKNA 4D4GA 3GRFA 2WE8A 2GBLC 3CLHA 1H2YA 3NHZA 4UM9D 2IE0A 2M6LA 4DJTA 1I32A 2NWQA 2DUWA 2OMKA 5FA8A 1SE3A 5HI1A 1M7GA 4ANFA 1Q0PA 4J8PA 3OCJA 1RC0A 1E8YA 2FOXA 4OQPA 4B5LA 1T15A 4ICIA 5HFYA 1TW3A 4MVJG 4Q00A 2YNVA 4RMGA 3ZLVA 2MSEB 3JATB 3I8SA 2OSVA 5HEKA 1WVGA 5JT1A 2Y6VA 3E7DA 1ISJA 4WN9B 2M1MA 2OLEA 4IQ0A 4L5YA 2AR7A 2ZKLA 4WH0A 2XUQA 1BMLC 2ES4A 3ILHA 4YCLA 4MH0R 4L16A 3B6KA 1KYTA 2EDCA 1LPPA 1G9SA 3T3PB 1SXJB 2PMVA 4HKQA 2JGFA 3FWNA 1UPXA 5CNIA 3VPAA 3RFVA 4DLKA 2P5YA 1L0XB 1SD1A 2WOJA 4K2AA 1TGZB 4L3OA 4S0ZA 5DX1A 3RKSA 3R7LA 1JRUA 1ZJZA 1Q92A 3DZCA 3NWPA 2CNLA 1F0KA 1TK2A 5E6JA 2ZRGA 1DRJA 1N25A 5H59A 4CR7A 3ENEA 2GERA 4DZRA 4YV7A 2O54A 4N8SA 1XDZA 1SY7A 1AV7A 2CHUA 4PG5A 5F76A 4B4KA 2PUGA 2GCUA 1AG9A 4NHOA 4GXBA 5IP4D 1G291 5IBPA 3ZEIA 1DOHA 1KO2A 5DBEX 3HEMA 3Q8BA 3PD7A 1L5VA 2WXOA 1O0SA 4MR9A 5DHTA 3MTBA 1O8CA 4Q9NA 4BO7A 5EVKA 3DONA 4I81A 4FX5A 4IDFA 3D7MA 1CIPA 4HDOB 3P0EA 3EHVA 3D7NA 3PQ4A 4DUGA 2A7XA 3LPDA 3RRXA 1T9HA 3GRKA 4HSGA 4MW5A 5B1EA 1THMA 3WLJA 4NJMA 4ND5A 3B6MA 3ZNHB 2J0SA 2IXTA 2RHGB 1X92A 4A1FA 1VMAA 3AUKA 1EU3A 2GPAA 5E38A 4KV2A 3RYFA 2C3PA 3Q3OC 4C0AC 1FFYA 5J43A 1VLLA 1WB5A 2Z2YA 1LDNA 3OQIB 4RIHA 4IMIB 4BVFA 2VKTA 2XGMA 1F2RC 1E9VA 3BRWA 3GPDG 3ZH2A 1A5ZA 1O08A 2ZT6A 3NUQA 4UTZA 1JDTA 4M8KA 4JO0A 3G0HA 4HNSA 4B6EA 1GVNB 4TWRA 3TXAA 1Y8QA 4ODIA 1MPXA 3IMFA 1Q6YA 1Y5MA 4Y8VA 5DP1A 4KSKC 1JAZA 3H9QA 2MSKA 2E6KA 1AIPA 2OENG 2XN9C 5THQA 1TQHA 5EVJA 1FP4A 1OLSB 4EQ6B 1XEWX 3L9XA 1A7KA 2XQGA 3ZKWB 2FUHB 1YQBA 3MJRA 1JHQA 1P8AA 1LRJA 1E96A 2X76A 3JVZX 2ZIGA 1RWPA 3HB1A 3HYTA 1F20A 3QKTA 4HR7A 4CQMD 4HNRA 3QOXA 3JWGA 3EZYA 5FUWA 2Z0EB 2OV2A 4FFOA 2WYOA 5A2QA 2BKVA 1SKUA 4ZRMA 1OX6A 1UH5A 2ZVDA 3DE1X 3KTFA 3OE7A 4LHWA 4LJAA 5AHWA 4AN1A 2VXBA 1PS9A 4DDTA 1E0DA 1QH5A 1F2RI 4IS2A 4XGQA 2Q3LA 5LBUA 5ALDA 4M88A 1S2LA 2WNIA 4Q1CA 2ZI5A 5A6VA 3UKJA 4E5NA 1OBVA 5EQTA 3Q3JB 1H2FA 1V7PC 4IQ4A 1I6WA 1KK1A 1XVIA 3QTBA 4C0LA 1YVPA 3V97A 3ACBA 1FU4A 1RVDA 1XZKA 1KE1A 3NBQA 4UZEA 1FP2A 3NAGA 4DB2A 5FUYA 4E32A 2H1IA 4DSTA 4ZYLA 4YROA 1A4XA 1XB2A 2CL7X 4F5YA 5GP1A 3JZMA 2N1WA 2BEUA 4E4TA 2HUPA 2QLBA 3LWBA 4JJEA 1XF5L 3AKEA 4BFCA 3CNOA 5DO9A 1E7PB 1YDHA 1M6NA 2A1IA 4C56C 1VE5A 2TMKA 2ZSBA 3IUNA 2AEEA 3K9GA 5SV2A 2YZ3A 2IZOA 2XQJA 3DHNA 1U6KA 2IYLD 4P7FA 2BZGA 5DX8A 4B79A 1E8MA 2D7JA 3VUFA 3MRTA 1AGYA 4OFWA 1SBYA 1IVSA 5D5QA 3BZDB 3UIEA 4WJNA 1JQDA 5DM1A 3WV4A 2F4VB 2X3YA 4I4IA 4MV1A 2AFIB 3AOGA 1L8OA 3EHDA 3KXDA 2CFTA 3S2AA 2OO7A 2I34A 3H05A 4KZKA 2JATA 5KMGA 1R4MB 5B6IA 2YH2A 2A8YA 3C6KA 2BIFA 4A27A 2HO5A 2YNWA 4DQ0A 2ZSFA 1OEYA 1IE3A 2QQFA 2XTAA 3H0KA 3ISJA 4J94A 4QQ8A 3KBBA 1ZHHA 4XJVA 4I4CA 4UWPB 1U2TA 2RHJA 3EASA 4B87A 1V8ZA 2VZLA 5G0TA 4B17A 5K0ZA 3A8TA 2CYCA 3AF1A 3PWZA 1BOOA 4MS3B 3EGEA 1RS0A 2IPKD 1GGEA 5K3DA 4DV2B 1HORA 1ZP6A 3WDSA 4DCNA 1A1SA 3UCXA 3D4PA 5CDFE 4GX5A 1YNOA 4Z1MA 4JBYA 1VL1A 2XKBA 4FEGA 2BW2A 3PNYA 4FDVA 4KQWA 3H4VA 3KTAA 3NEJA 3R5JA 1MIOA 2P4SA 5CBPB 4MYTA 3HWRA 4YMUA 1OB2A 1GNTA 2VRCA 2EXXA 4XI9A 2IYOA 5FP0A 3TXYA 4E12A 2WHPB 5DE3A 3GT7A 4ZARA 2Y9MB 1Q3HA 4KIKA 2ZM5A 1Z0FA 3HN2A 1PV2A 2BOVA 4DJFC 4PO3X 3N7TA 3F8TA 5HIKA 2A1UA 2DMRA 2NW6A 2KFKA 1JX6A 3UT5A 3RANA 2XZTA 2NU8B 2Z6VA 3W8RA 5F78A 1BGXT 3VQIA 1E3QA 2ODWA 2FN7A 4ZC8A 3IP7A 3ZE9A 2FWAA 4HFMA 2HRDA 2HMUA 2ZUUA 4AKTA 1ZOOA 2PV0A 4OLBA 1JHZA 2V59A 3LF2A 1KDTA 3AQ4A 1HTOA 2LHEA 1KKLA 4P53A 2YWBA 4KLZA 1T13A 2R6HA 5LIPA 3RKUA 4BEVA 3NZ3A 3G3EA 3W5DA 2BP7A 2BGRA 1IEXA 2PUJA 2REBA 2OG2A 2J0VA 4G63A 1OU4A 1M2EA 3HM6X 2A5JA 1W8IA 5JJIA 4YRIA 1O77A 4K8RB 1LQUA 1NLMA 1XGKA 2PKEA 3ICVA 3R5TA 1OPRA 1EVZA 3GEMA 4PHGA 4UW9A 4P98A 5K1ZA 1ZOPA 3JVVA 4TSKA 4F71A 2V3NA 5CD9A 4DR7B 4BMXA 2J6CA 2CXTA 4MVWA 4WH4A 2VYNA 4DREA 1AGRA 1WMHB 5LJLA 3E70C 1JHAA 2XGJA 2IGHA 1ULHA 2X58A 4UEQA 4JKIA 4BEWA 2VH5R 4HMPA 1FC0A 5LN1A 2QRPA 3FGOA 4PYLA 1KBOA 4EKNB 1NNLA 1I9GA 1WM2A 1P5ZB 2NQ8A 4Q7KA 2P69A 3QFSA 4XGIA 3QBDA 4LNKA 3VVLA 5I7HA 1FQWA 1V5TA 2NM0A 4RA6B 1Y6RA 4ZOAA 5JHBA 1U7XA 5G40A 4N76A 3TNFA 3I6IA 1D3AA 4KAFA 3TSWA 4XD2A 5HKLA 1CEYA 3V8PA 3ZU4A 1EA7A 3HUDA 2LDBA 2ZE5A 5JRZA 1N6ZA 1AX9A 1K3FA 5AVSA 4INAA 4PZEA 4B6SA 1P3DA 1RRKA 2PUWA 4GSYA 4OSPA 4R40A 3JWEA 4BNTA 4ZYUA 1NEKB 1U5BA 5B37A 5AW1A 1P7ZA 2ZB2A 3WB0A 3R7WB 3NS1A 4F1SA 1DIHA 5AZHA 4NXNB 1ZMRA 2NPOA 4LDNA 2PL5A 2R8EA 2JGMA 5TARA 4D9EA 2VQEB 3H9DA 1C14A 2UVDA 3A4LA 4LRTB 4XDYA 2WWGA 4Y18A 3FUXA 1LUAA 4A0RA 3X2ZA 2FR0A 4WVLA 2NCNA 4J75A 4L0CA 1W87A 1JEAA 2C1XA 1XC7A 2BONA 4AF7A 1U2RA 3WTCA 2GZ3A 1YI8A 2ZUSA 4PZLA 2JLBA 5FJIA 4DYHA 5HE8A 1C29B 3L43A 2JZ3B 1AC5A 3A9TA 2ET6A 2UZAA 4UU8A 4ZAFA 1WB4A 4CBVA 4GU5A 5BWMA 1OH5A 1SQ6A 3PXDA 3ZVKA 2WIAA 1M0EA 4LECA 4K6KA 1A4UA 4C01A 2VC2B 5IPFA 4FGUA 2AC4A 3GRRA 5IVHA 2PGJA 4PY2A 2P2CA 1ZU4A 1VDVA 3RIMA 4QXRA 3RVMA 4AECA 2Q42A 5KNCA 4D9KA 1W8DA 3RSQA 3HDVA 1ULSA 3C3CA 3B38A 4ALNA 2XGGA 4HCPB 4HNUA 2FZKA 4FOTA 1QJCA 5CYGA 3OSUA 4S1OA 2YHIA 4RPHA 3QXCA 4E0BA 1M2KA 3JAKA 4M02A 1PUTA 1R5BA 3O0DA 2CF6A 5ITZA 2J48A 4WXYB 4A0SA 3LW7A 4BEJA 3PF9A 5IAGA 2P65A 4WN9A 1EWRA 2CBZA 2NYUA 1A5RA 1NBAA 2F00A 1RT9A 3UGQA 1KDRA 3MGBA 5EKTA 3WR5A 2GNAA 5JD4A 2ZE8A 5B1HA 4A82A 1VYUA 4OQEA 3ZDEA 1P5JA 2ATIA 2D4AA 4U9HS 3OP4A 2PGNA 3A05A 1Z3CA 3FVTA 1AS0A 4O29A 4Q7JB 1KI6B 2IYYA 3AV3A 1W4RA 4O2BB 3MA0A 4RJJA 3TSYA 1H2RS 4AO8A 4PYJA 1KY4A 3E48A 1E9RA 5AKYA 3MK31 5JADA 1ICEA 3NH6A 1CY0A 5EJ6A 4ZT5A 1PLKA 3RTEA 4WTOA 4DLZA 2PLPA 4BCBA 1EVQA 4L23A 1GN8A 1PV1A 2DSTA 4KN6A 2WXMA 2Y1KA 1C1XA 2OGUA 5ACQA 2N7EA 3DNMA 2JKVA 5EWLB 4QT4A 1RD4A 3OZVA 4CG1A 3IVCA 4UVGA 5IABA 1CUAA 4XWWA 4G8BA 4P4NA 5ECYA 4IWXA 4OI1A 4RJIA 1CQJA 2G0AA 5BR4A 1E8NA 1YGYA 3QGMA 4GPTA 1QZTA 5PNTA 3ESYA 1HEYA 1NV8A 4CM4A 2K7FA 4ZPXA 2AWNA 2POQX 3HO6A 3D7KA 5BUQA 5KTSA 2CDBA 4DIBA 3OZDA 2OC9A 2QU8A 2XDAA 2ZUWA 1UUFA 1ZVKA 3DMGA 4US8A 2B82A 2H0AA 3GPIA 3NPMA 1REQA 1V8CA 1PX2A 1QO0D 4H77A 4IDOA 4PQRA 1NF2A 5BPFA 5JNUA 3PGVA 3A37A 4YCNA 3ZE1B 3AVVA 4NOLA 3HU2A 5EKXA 1A71A 1ZN2A 1EVLA 2UYZB 1GPNA 2Y68A 4OF4A 4QTXA 2FWMX 1X3LA 1Q0UA 1R5NA 4LC0A 5DYWA 3SQMA 2L32A 5LMCA 3H3XA 3PXXA 2X15A 2KTFA 2FUEA 3F7TA 1A2BA 5FEMA 3SOZA 3T4XA 3TRIA 5IAAC 4YCSA 5LKAA 4GGMX 1FDUA 4M9ZA 3ZKWA 1Y3HA 1TRHA 3FLAA 1HZJA 5DTQA 4PDXA 2JKYA 1K1EA 1E5VA 4C76A 5IT5A 3ANLA 4Y30A 4RC9A 2VCEA 3KWFA 3CEMA 4YJHA 2AE1A 3QQ8B 1R1DA 5CXXA 3OOEA 1EB9A 4PHFA 1MO2A 1AXRA 2AMJA 4J16C 3VKVA 1HXYD 4NZPA 1JI0A 2B92A 2ZJ5A 3K1AA 5JAQA 3UENA 1DRKA 4H3SA 1MO6A 2BTQA 2M5DA 4TSFD 4IYJA 4EO4A 4LJ8A 4OHYA 4L1BA 2FEXA 4HWIB 1SCBA 2IUEA 3DE6X 3FIJA 4IG7B 4XDDA 3KTAB 3W5VB 3G2KA 4IJQA 4YJKA 3ZDYB 3KKNA 1O6BA 2VT2A 2ZWPA 3ETGA 1MMFB 2VZ9A 1N8NA 4E4RA 4EENA 1JLLA 1I3MA 1HQRD 3FWKA 2V3VA 4EELA 2IKQA 1YJJA 1Y37A 4FJ1A 2XDWA 3EZ9A 4ZI7B 1FVHA 1H2EA 1KF6B 3HGMA 2D07B 3UT0A 5TMPA 4QJ4A 1EFAA 1DXKA 4OFBA 2NU8A 1BEZA 3HNRA 3PBKA 4M9QA 5E0KB 1KNQA 5EWJA 3A6GA 4HXEB 3PYXA 3MIZA 4BLQA 1BDMA 4QNRA 5A05A 4R2MA 4HNVA 1F17A 2EGUA 4NFSA 2G09A 1AZWA 3QOWA 4X84A 3PRPB 3UTDA 5LQMA 3ABSB 1SUDA 1I3OA 2PJUA 2ZETA 4FNAA 4EJMA 1ZSNA 2Z6AA 4GGOA 3Q15C 4IXNA 1OWLA 2A92A 2VHYA 1SU6A 5AXBA 4YPOA 1OI3A 3QE0A 3KYBA 4U00A 5IH7A 1W85A 2ACZB 3NM5A 5DLDA 3TEZA 4K0RA 1CF4A 1TM4E 2XCUA 2H7XA 5FR2A 4RL0A 4ITUA 1FJXA 3USCS 4D97A 1GIAA 1C8VB 1PK9A 5THKA 5KSZA 4D1TA 1VIVA 3GFBA 4DV4B 4H0NA 4IMPA 3SEZA 4IH4A 2W0SA 1NP6A 1JLHA 1Q77A 1XJWA 3JRNA 4I4TA 4P81A 4QYSA 4BZQA 3LTNC 4JWUC 4DUGD 3CNBA 2L76A 1Z38A 2R6AA 4FYMA 1E10A 5FKAC 2C9DA 2P9QA 3D6NB 4NBKA 2VBCA 1ADGA 5CAEB 4H6PA 3EXEB 3R0QA 3WLOA 3ZBPA 2PS0A 1DADA 1RI3A 2BKAA 3PE4A 2E6XA 4GF5A 2D13A 2YUIA 1Z0UA 5MHTA 2WD7B 4C89A 3PY5A 3F3YA 1KMNA 1IXZA 1UP6A 5FH9A 4ARCA 1O2DA 2HLDD 2PS3A 5AVKA 4B8WA 4L3VA 1S8NA 2V7XA 3ZQ6A 4ENSA 1LDMA 2PE9A 2W2OA 5B4UA 5HRUA 1CQWA 1FMFA 1DTSA 4HNAA 4RKEA 5IJXA 4Z9BA 3W3ZB 4PS7A 5IG2A 2SHKA 3LUCA 1KC3A 3GXBA 2WKQA 5JAHA 2HSZA 3NHMA 1DC6A 3C15C 4LXTA 4RBNA 3DBHA 3TG2A 4QEZA 1JT2A 2H2HA 1OZGA 1NZJA 3DAPA 4REOA 4MJ3A 1AO3A 1FP7A 3SR6A 1V6CA 2LEKA 1IBCA 3FNIA 4OXXA 5HZMA 2XNKA 5JANA 5AJLA 5EINA 3QITA 3QF4B 3QPVA 3NTQA 1HMYA 2BRUA 1GZ5A 5T3UA 4BNDA 1I2CA 1J8DA 1J99A 2GRIA 3Q40A 2BB5A 2INDC 2CHEA 3FBTA 4PIMA 1L5KA 1HLDA 1ZZEA 4BAUA 1OLXA 1M1YB 5I01A 4C2BA 1H4QA 3D6VA 4LSMA 3OOYA 4LE1A 1RQ2A 3OKPA 4EZKA 1TZOA 1SUSA 4HX9A 1OV4A 4TRJA 3S5UA 3B13B 3D3KA 3EXAA 4FSBA 2FWPA 4LVNA 1B0AA 2QL9A 2HRBA 2WM8A 3D2BA 1Z62A 5DLEA 4XSGA 3UPDA 1KI8A 3ZD9A 4TZEA 2HSDA 2RHCA 4DADA 4MUYA 3KVYA 4USAA 2GH1A 4F5EA 4MUIA 3K1JA 3A6FA 1Z35A 2O6VB 4QBKA 1GZDA 4LNHA 1YL6A 3PIRA 1O95C 1W5FA 4FR7A 3ITDA 1KIAA 4K8OA 1R6AA 1RTKA 2CB9A 4NENA 3KYCB 2VO1A 4BMCA 10MHA 1YV9A 1RZUA 2R47A 4MYRA 5D84A 2H17A 4PQFA 1U7UA 3FWYA 3U2SC 1N5DA 3NC0C 3NRJA 5CA1B 1GZUA 4TWJA 2PKCA 4WNYA 6AT1A 3IAM6 4FYXA 5ALEA 3RUPA 3P0JA 3GIDA 3ZOZA 1NLYA 3Q5DA 4G67A 5FK9C 1T4MA 1YUMA 2VHJA 1L4DB 2HSJA 1QRTA 2HI0A 1U7ZA 1CJTC 3FCXA 1I42A 3PTLA 1UWXA 1K8RB 3PO0A 1OIVA 2C94A 1N6KA 2L42A 1VZ6A 1QIGA 2RIRA 1F9JA 4R8LA 3ZHXA 2FYTA 1L1FA 1EVKA 3FUWA 4LYJA 4UUOA 3DL0A 4BQQA 1O5IA 2EBHX 3PFWO 1OWMA 4Z4HA 6Q21A 2PAAA 2WM3A 5E2IA 2B8NA 1V80A 4LI0A 5P8WA 3S2IA 3SQOA 4E70A 1GZVA 3RVDA 1X7HA 3HA7A 1WHTB 1GCUA 3G2JA 4M1KA 1X6VA 4WDQA 4EAAA 4C7XA 5B4TA 1DHRA 3DBLI 4PLCA 3ROMA 3DEHA 1M1UA 2X8LA 2ZRIA 3GWZA 4WI1A 3VNRA 2P1DA 2XOXA 3TMAA 5IAOA 4PGHA 1WJ6A 4BZXA 2RAVA 2I78A 2VHXA 1JT9A 3I64A 4U2GA 5K0JA 3MERA 4FEAA 5GM1A 4MPTA 1NJSA 3LL7A 3VTZA 2V7EA 2WHPA 2RHLA 3DD1A 1CQXA 4QNMA 1DB3A 2QGZA 1V1MA 1DXYA 2GI4A 5ALGA 4D74A 1FNWA 2F67A 4DY6A 3NTOA 2B4RO 2DWPA 4JVSB 4YCCA 3I73A 4LC1A 5DM70 2XUOA 3LB8C 3F6BX 3R4VA 1LY1A 4EL5A 3D5QA 1UBLS 3TZEA 4JLNA 2OOBB 3AE5B 3G7NA 3Q8AA 1CUXA 3TLGA 2IXBA 4P0QB 2JJ1D 2OFPA 3DFMA 4I6NB 3ETCA 3N2EA 1QOQB 1S9DA 4Z86A 1XZFA 3CCBA 2NTTA 1IM2A 1KYZA 2WTAA 2ZTMA 4L28A 1RRFA 5FTWA 4IOLA 1AT1A 1WPGA 4B6JA 3N2NA 3VJRA 4ZRQA 1N5WA 4FD3A 2Q0JA 3WP1B 4QUDA 2AVNA 4YO8A 1BVHA 3O21A 2LASA 4JBXA 2Y0BA 1R27A 1ZK4A 1C7ZA 4GEKA 5I4BA 1I6KA 1W76A 2WTBA 1ZW7A 3K1AB 4H15A 3VM6A 4CIAA 2QEJC 4HPWA 1VG1A 4BB9A 4JN6B 2WLTA 3T0IA 2SBTA 5HCUA 3E8MA 3JD4A 2RHMA 3VSBA 4QGSA 2B83A 3F73A 3NBUA 3M82A 3B51X 5E8JA 2XKJE 1WX8A 3PNSA 3PT5A 4H1HA 3C5CA 5ES3A 2DTEA 3GFSA 1H3EA 1WU8A 5KSYA 3R5SA 2Y1FA 4E7PA 4IVPA 5EVDA 3WRYA 3H7IA 4KBYA 2GN6A 3OZTA 3TEJA 3NDJA 1J8QA 1WUHS 2R8YA 2O3JA 3STXA 1PUXA 5FR3A 1MJ5A 3CO0S 5DYGA 4DA6A 3S28A 5LUAA 1ATIA 2NQ2C 4IDCA 3JSVA 5DTEA 4AFNA 1I30A 3JYPA 3OEYA 1QIFA 2ECKA 2WYMC 1FUKA 1E7YA 4Y3UA 2XBMA 1FLAA 2RC6A 3GNTA 4RX1A 4E3ZA 1DT5A 1JPVA 4J49A 4F3TA 4YV0A 1RZVA 3ABOB 3VYTB 5AW3A 4NZ9A 1ZUNB 2W6ZA 1SQFA 3W77A 4ES6A 4RPJA 4UXJA 4ZCTA 3MHPA 4KR0A 1DFIA 1WFYA 2GVNA 4R8VA 2K2QB 2P1RA 1A5SB 5HQ3B 1JEJA 2B8TA 2PUCA 3PEVA 2MCNB 4Z0TA 1XLVA 4ZU3A 2D11A 4L5IA 2IELA 2CSXA 5FWXA 2J6HA 1FS6A 1JHUA 3GLFA 3OT1A 4MP8A 1AZTA 2QYHA 2AFRA 3REGA 3TPFA 2HPHA 4M38A 1Q3KA 3ZWWA 4CXMA 4ZV7A 2DJ5A 5IYZA 4F4UA 1T6XA 3ZD8A 4ZIRA 1FCJA 4Y0AA 5KNCD 1KDYA 4X24A 2KDFB 1LBEA 4UOZA 1CFZA 4CTKA 5CAEA 4A0QA 1GTSA 3I62A 2G1AA 4J29A 1KYIA 1AQUA 4LHVA 2FE4A 2ZJDA 5G2OA 1MX9A 3PC4A 3KQVA 5FL3A 4NV0A 3PC3A 4ENPA 2VH2A 1UJ2A 2VDNB 3SSAA 1MQSA 5BYSA 1TCAA 2FP4B 3RJMA 2PSHA 4MA5A 5KBYA 1I94B 2Q2QA 2FKNA 4EZEA 2PMCA 2KE5A 4TKMA 2WTUA 2EFGA 4AJOA 3RNFC 3M4XA 3WFJA 1HZZA 4ARAA 1EUYA 1DV1A 2DWUA 3U3ZA 1A77A 1ISSA 4LV6A 1ZK3A 5ICFA 4ZQBA 2XMQA 2J3JA 4E13A 3FMVA 1UPCA 1N7IA 4LTNA 2L18A 3DZKA 5EZ5A 4OAOA 3P4YA 2P18A 3E6AA 2I6QA 3DPIA 1BRTA 2JEOA 3MCTA 3IKMB 4I1YA 1F7UA 4JODA 4AY4A 5T7BA 3DVSX 1Y98A 1ZBQA 3ELBA 5SZKB 4CM5A 2ZDQA 3I4CA 3ZJTA 4GLLA 3KQHA 4K05A 3CVUA 4YMSA 3IL2A 1T3TA 2GPTA 4Y7CA 3BE4A 3BE6A 3PFNA 4TT8A 3ZQUA 5C8YB 3AEBB 3LPNA 1JZSA 2NVOA 4GGQA 1SU4A 5DI9A 3CPEA 5H3HA 1MVOA 3PHHA 3G89A 1T91A 4B3IA 4C2UA 3ICEA 3RS9A 4E74A 1YQGA 1C2YA 4HDSA 2JLYA 5JO9A 3SKXA 3G8CA 2H5EA 2Q5EA 3BCRA 4NNPA 4ID3A 4BJ5A 3TNJA 4ERNA 3ILSA 5AHRA 1HTWA 3V4FA 5SY9A 3AG5A 3HCWA 3RF6A 2BM1A 4J91A 3UV3A 2IPAB 3VR6H 5KYYA 1KYQA 1OFUA 1SVOA 4FX2A 3TFOA 3HYNA 1J0BA 4C1CA 1B8NA 1Q1EA 1ZD3A 3KYDD 1O6CA 3E8XA 1QHGA 3SVLA 1M4VA 1Y6JA 2VDUE 4CT0A 4ZZ3A 2E4VA 3LHSA 1O94A 4I66A 3SFPA 3FYTA 4LNAA 1N2XA 4XQEA 1POXA 3LHIA 3K9QO 2VFAA 1L5WA 1OWOA 2ZVQX 3HVIA 4IF6A 5AXAA 5J1SB 2CJFA 4RL2A 2Y5CA 1FRNA 1X1DA 3EAGA 3PR1A 4IPTA 4A55A 4QXQA 4BVEA 3HYRA 3R7DA 5AUPB 1QZEA 1QIJA 2F90A 5ALNA 2ZYSA 3PHCA 4A2WA 4ZJUA 1WXGA 1BMFD 4C04A 3IP8A 2KANA 1X7WB 3EK2A 5ECDA 3I72A 4J6EA 5K0LA 5SYNA 3JSAA 3TSZA 4Q7QA 3NATA 2IZ7A 4UU0A 4RTQA 4MH8A 1JFRA 2YKGA 1U2PA 2YRXA 1ADBA 4QBHA 3MC1A 1ZRNA 5CXSA 1M1YE 2QZSA 4Z6XA 3KKMA 1JE1A 3IUYA 3E61A 2ORYA 4G8JA 3ZWYA 1V9LA 2J7KA 4NVRA 3V48A 1ZHFA 1EX7A 1K7SN 2H11A 3VZSA 4D8UA 1DV2A 2QLMA 4DEVA 3IMKA 3DFZA 5F77A 3UGJA 1CIVA 4KFUA 4EA8A 2MX2A 1DI0A 2C5EA 4F85A 2BYFA 1UKBA 2Q6IA 4M1OA 1XXHE 1EMDA 4DV3B 3MUOA 4CO7A 3O8DA 4KR7A 5JHAA 1N6LA 4JB2A 3CR3C 2I66A 3FF4A 1FNDA 4KNWA 2OV3A 4YO7A 1MC4A 3M6AA 3AC0A 4PLFA 4DIUA 4LZPA 2KW5A 2WSMA 4CM7A 2G4SA 1X7ZB 4PZ0A 4QRHA 4RF4A 4AB1A 3X2SA 3QWBA 3WWEA 1JGTA 3UFBA 5K0EA 3W5AA 2ZPYA 1JG3A 2EF1A 3U7HB 4QTYA 4I6PA 2ZBPA 3D2CA 4FKZA 4N12A 3FPSA 4ZTBA 1N9GA 1PQPA 1S3GA 3FZGA 4WCVA 4MKZA 3ORFA 4FDTA 1E69A 3L3BA 1B0UA 4KPEC 4ZGBA 3AEDB 1GOZA 2FEPA 1TT5A 4GR5A 2CSUA 2BBOA 4AJNA 1UZUA 2GPWA 3SEFA 3FPLA 4XVQA 3VC7A 4K40A 3OMLA 1RXCA 1XEAA 3G9TA 4ZKEA 1XHEA 3WSVA 3AERA 2VT6A 3G8BA 1RXUA 3WGVA 4L51A 3WAKA 2I4LA 1CQVA 3QLVA 5HQJA 1AUPA 1O6GA 1P44A 2C20A 5DN9A 1E7RA 4ARZA 1PT6A 2G5TA 3GUYA 3KLOA 3TE6A 1RRMA 4R0MA 2CVFA 3U39A 6PFKA 2QCZA 3GLFE 1DINA 1A7TA 1G8PA 2G82A 3LQRA 4DG9A 2EFDB 4HDAA 4D6PA 3CTMA 4UM8B 3R23A 2A2ZA 3LCJA 2HOQA 3PK0A 2MU1A 3ETHA 3T1NA 3GYBA 2XW6A 1XMJA 2ZDHA 4YR9A 1U2SA 2FZLA 4MWCA 3W5SA 2I9PA 3UQBA 1H4TA 2JHFA 1VA5A 4Y98A 1M1ZA 1TO1E 2JFPA 3UJ3X 5FI1B 4CFZA 2HL6A 1VJTA 3N1XC 1IN8A 2C9OA 3DCYA 3RTAA 1PNRA 4ITKA 2NZ8A 1PDXA 4R3NA 2Q5LA 1T2CA 4A91A 2HCFA 3GLTA 16PKA 1CD5A 1MNAA 3VU0A 1KKMA 3DLTA 3I9V6 1PUJA 1TVMA 4BN0A 3QU5A 4B4DA 1PYWD 1IM8A 2PZKA 3LU1A 5DNVA 2KYWA 1K9SA 1ZE3D 1LC0A 3T8MA 4ZQIA 3KQUA 4W7IA 2JH8A 1IXYA 5IFLA 1D0IA 4J1QA 5CCDA 4A16A 2HEGA 5HIJA 5FWXB 4RDCA 3IAHA 4MZXA 3DO5A 4TYNA 1GPLA 2HCTA 5BSUA 2QR5A 2FMIA 3DT8A 4UVHA 1SVUA 3MWGA 2V97A 4P3PA 1OVMA 2ZR0A 4FT2A 1IYZA 3C0KA 3HA3A 5BXYA 3OQOA 3HCFA 4URKA 4XDZA 3V8EA 2WU8A 3G0DA 1XG5A 2OJWA 2I4RA 1H8HD 2DY0A 1UKVY 1E2NA 3DHGC 1AXEA 1NM5C 2RPQA 1H0KA 1QHNA 5HKBA 1P1CA 3RC9A 4W1QA 1C78A 1XZIA 4RIIA 5HF9A 2R60A 2MHJA 2Y1GA 1V47A 3VMMA 1AKRA 3IAS1 3AILA 3P2JA 2O6VA 3OZCA 3WGQA 2IZZA 3T8YA 2Z3WA 3PJFA 4M8NE 4I1OA 2RK3A 4O8ZA 4AQ7A 2Q7DA 1GZ4A 2XMRA 2YHUA 3MWLA 3LOPA 1TGVA 2O8BB 4GUDA 2PN1A 2A30A 1WUPA 3P0RA 1ZO8A 3IQGX 1XEXA 3AL2A 1ADCA 4RFSB 4CM9D 4NBSA 1PR4A 2D5CA 3AR4A 3U3MA 1VHTA 4Y2TA 1VMIA 2B6HA 2RHRA 2EFEB 3HVJA 3MT7A 4UCFA 4DMLA 2M6RA 3I3OA 3MWDB 2X4DA 4ZHSA 2Z9CA 1OTXA 4XPIB 1URPA 3IXMA 1E6EB 3NJ8A 4TSSA 1CJKC 3FTNA 4S2UA 3W6UA 1U8TA 2IGBA 3RE1A 3BB3A 4JQCA 3ASVA 1T8RA 3R3ZA 4AS1A 5J9FA 2EKDA 1X13A 1P2VA 4KAXA 3UGKA 3U30A 3U7FB 1JTEA 2J07A 2JK0A 3LLCA 3LQ1A 2SAKA 2JVCA 1J8CA 2HSEA 3GVPA 4NV1A 1G2PA 4MVJH 3WI7A 1JIUA 4RDHA 2VDVE 3E22B 4P7GA 1G18A 5JD3A 3CIFA 3HN7A 4MNTA 1RBYA 1U2DA 1E4OA 1MR3F 1RWMA 2OECA 2YUTA 5DNEA 4DJJA 4KI7A 1YL7A 4BFZA 4BVKA 3LDZE 1TVKB 1ZKPA 1WYWB 1BXGB 1WHTA 3PGMA 4K5QA 3F8SA 3RCBA 1J70A 1Y1LA 3MGCA 3UYLA 4OO3A 1GRCA 5TEVA 4DCJA 2MSCB 2XZLA 2EEZA 2M1ZA 1WG8A 1FYEA 2ZVPX 2KJHB 4FMDB 4HWRA 4D0NA 3WIMA 5A5VA 1GCIA 2RONA 2G71A 2R1ZA 2XD9A 1FSGA 2FGKA 2YHBA 2Y99A 4MW7A 1WE2A 1YQEA 2O1EA 2WPDA 3BK7A 4MO2A 5I6DA 1XWIA 3AVWA 4GW3A 3UHOA 1BA3A 2KK8A 1R74A 1E2GA 1JHDA 1KJQA 1S7GA 2ODNA 2RGXA 3BHNA 1CQZA 3CH7A 1P75A 1K0UA 3GUUA 4LZWA 5EGSA 5ARCA 4WBNF 1XTOA 4F6LA 4ZO9A 5BQXA 2HLPA 5B1YA 1SJED 3LRXA 3TTWA 2XQKA 4G0YA 4JI7B 4PANA 4NQ5A 3G2LA 4KGZA 1WXQA 3MWEB 2AX5A 1KMIY 5IM5A 3SEQA 3TX2A 5FDFA 2BUAA 3AF0A 4MLZA 4ND6A 3RT1A 3PA6A 1QGYA 2SCUA 2G1PA 4YCMA 3W06A 2VLIA 1ZJWA 1FPMA 1CUBA 3B6ZA 1F52A 2TSSA 3N8DA 5F2KA 3CM0A 3K5WA 3GQBA 3ZKJC 2ETVA 3BD9A 3FUTA 4GPBA 4PWYA 2W48A 3ELDA 2X8XX 1DL5A 1PJ8A 3H5LA 1C77A 2XECA 3PPYA 4FU0A 2X0FA 1YZGA 2GXAA 3LXMA 3EF3A 4YP9A 4DANA 4OZCA 1RYMA 3HEAA 4NYIQ 4C0BA 5BY2A 4BKTA 1YR9A 5DF1A 2XH8A 5U4QA 4LNFA 2R1TB 2KACA 3PUIA 1MT3A 1WXDA 2PUTA 4KW7A 4W82A 5FLEX 4B45A 2UU7A 1E0JA 3D8NA 2ODPA 4KTTE 5H9WA 2PKQP 3NPAA 3VJLA 5TMDA 1YJAA 3CS3A 1C80A 3L4JA 1A70A 2KJQA 1GAEO 3P4UA 5CHEA 1UWLA 3KIPA 3DOFA 4TMWA 3Q3HA 1M54A 2Z08A 1IG3A 2C4NA 4PS1A 4ZREA 2CYBA 2X9NA 1Z0JA 4ZAXA 1RCTE 1X8LA 1RHQA 4X93A 4FYPA 3EPLA 5JALA 3NC1C 1E3MA 3RPCA 1X80B 4LJ9A 4P3OA 1B4DA 4N5HX 4KJZA 4OMUA 1B00A 3SXJA 4X65B 2GQ0A 3DPUA 5FORA 2PK3A 1JZQA 1U0JA 3GA0A 4FLFA 4IICA 1K6XA 1H3NA 3VTWA 2MR5A 3KFVA 4PYRA 1SE4A 3LXFA 3G9UA 4IZIA 4EDHA 2JGNA 3A4VA 3CGGA 4NAWB 4TZ0A 2E9SA 4DA0A 3U4GA 1KPGA 1B26A 4NKRA 1IOWA 2DZJA 4LS3A 4D82A 2JFWA 4Z6KA 1IY1A 1OT5A 1TS5A 1SSNA 3OKFA 4AU1A 4CM6A 2IO2B 2VXOA 1U11A 5K7SA 2GNOA 2OV8A 1T0YA 2VYFA 3PB3A 2ADMA 5JMPA 2BBCA 1QNLA 1Z25A 1W4BA 4F1WA 4CQNA 4GM0A 1T1JA 2CFUA 6NULA 1JYFA 1CT9A 3A11A 4HUTA 2ZRMA 1P80A 2N3ZA 3F3KA 1QTQA 3IT3A 2CV0A 4UHFA 3SHQA 1XSEA 1K88A 1KZ4A 3K9NA 3IUPA 4DQDA 1J19A 3BGIA 3MG9A 5L51A 5KYXB 4DIOA 1MI0A 2YZGA 1VLQA 5ER9A 4I2VA 2Q5IA 3HR4A 1A7UA 2WXKA 3FFAA 1VQ1A 4KNVA 1KFCB 2C5HA 3O8BA 4IUCS 4LRSB 3RC3A 3TFQA 4ALMA 4D9GA 3ESBA 3RQIA 4RXTA 2Q6VA 4D9MA 4CEHB 2JGLA 1DXOA 1X0VA 4WK6A 2G3QB 1HI9A 1OZFA 3CSSA 4GT1A 5DOZA 4HJKA 3CX6A 2Z09A 1HDOA 1VRVA 1HXHA 4IIVA 1ZH0A 4NECA 1WRIA 1Q21A 2JGKA 2ZJ1A 2CG3A 3LGAA 5FTMA 1WO8A 4LZJA 1ZD9A 3NQ41 4GXTA 4POOA 4KRFA 4P62A 1EAMA 1WXMA 4Z0HO 2FW8A 4EUEA 4BPBA 4HL2A 5FUMA 1GL9B 1PU2A 3CWQA 4QWWA 4WBSA 1D09A 4FWBA 2NZEA 4U3JB 4H3HB 4J1TC 5AI0A 3QIJA 3HB9A 1SZCA 3U19A 1VBNA 4L8GA 2KC1A 2AW5A 2IPNA 4N3CA 5HFNA 1ODSA 9LDBA 1DKRA 2H88B 4LY3A 3FZYA 2MYTA 3Q6IA 4WERA 3FM9A 1DC7A 3WTBA 2F9MA 5BV0A 1WMBA 3NHEB 2HIHA 1R6XA 4YQZA 2JARA 4V0QA 5FUXA 4YLYA 3DP9A 1Q7CA 1SWVA 2QTVA 5KYUA 4C07A 4FMCF 4W9LA 3K35A 4RANA 2ZDGA 1MNQA 1PZXA 4WJOA 3MELA 1J0DA 4RA9A 1F2VA 4GNRA 4H7DA 5HOQA 4ZEWA 1DAHA 2GM3A 2H2DA 1P3Y1 3TRFA 3PTAA 4C1GA 1FA9A 3F4BA 3IHWA 3PEEA 3TSSA 4JL9A 4ANXA 1E7SA 1I4GA 1PVVA 2FWNA 3KEMA 2XAUA 4JK3A 1XZNA 1RHJA 1RYFA 2CJWA 2ZLBA 3II6X 4CQLB 5KQMA 2RGGA 3FPKA 4Y1RA 1D6EC 3FGZA 3LQQA 4L9AA 2ZWAA 2FEMA 2O6VD 1GAJA 1K7FB 2LKDA 1NPTO 2XRFA 1P60A 3BULA 3INYA 3OZXA 4PQEA 5A7HA 3ZIDA 4I5IA 4LNOA 4US1R 5JBQA 1IULA 2ENWA 5L4SA 2VTBA 1R9MA 2YW2A 4LV5B 1IIBA 4BWFB 4MWZA 2QLNA 2M2IA 3WBKA 3I0ZA 1JWAB 4D3SA 1SHZA 2E18A 4W9DA 1V7QA 4EB3A 2XE4A 2P67A 4G9BA 4EA6A 1U5AA 1YHNA 1UM8A 4PPFA 3MCWA 5L6MB 2Q3MA 4J7AA 3S2GA 3TXXA 1HZ6A 1VD2A 3P9IA 5BWCA 1O94D 2ZRKA 4RZ3A 1NW7A 3EZLA 1XLOA 2BMEA 4MVJD 3X0DA 5LXTB 3HCDA 1XCGB 4TVSA 3EPHA 4WLEA 4FYKA 1QLJA 4B7AA 4M0PA 1Z2PX 4QELA 2C5AA 2B1IA 2WYWA 2G40A 4YYZA 5TVKA 1ZI9A 3RS8A 1EGHA 4P3YA 4KIKB 3R6WA 3ZU5A 5HBGA 3DAFA 1QKZA 1E1YA 4MA4A 2H1OA 3ESZA 1QZUA 4DRZA 4EI2A 2CLSA 3BTUA 4P31A 1JVNA 1LFDB 1V8BA 4UJ3A 4KR6A 2WYMA 1SKBA 3CN7A 1QE0A 3IFWB 1P72A 1Z12A 3RRMA 4F6CA 3WJAA 3F5DA 4FR2A 1YBHA 3G2NA 4K9SA 4Z8XA 3C8UA 1QLBB 3QVTA 2ZYTX 2CMFA 2IYEA 2BE9A 3FPEA 4GM1A 5LR6A 5DLYA 4JZYA 2IUSA 5K4HA 3MM4A 4OQDA 1HDZA 2ILVA 2IPXA 1CY4A 4JXKA 1YULA 3Q1LA 3AJ3A 3V4ZA 1QK3A 4EUHA 2AQ3B 3SYKA 1WWKA 2QD4A 1I3CA 4OHKA 2J3KA 1N6NA 1AUQA 4HB2A 4LDTB 1F3OA 1SHUX 4KXMA 4PC3A 2GYVA 2SCUB 1WTAA 2JI7A 3LVFO 1Z82A 4G09A 4IDEA 1N1DA 1SM4A 1L5LA 2Z8YM 1W9MA 1C9NA 1NQWA 3L8ZA 3NBMA 4G0OA 3K8OE 2PVSA 2XV1A 2G9VA 1WABA 4IIJA 3DV9A 3NASA 1DCKA 3AE6B 2QUIA 3N59A 2IY1B 3E9RA 2C9BA 3KRTA 3N2ZB 2YNTB 4Y2VA 5WRFA 2YVLA 5BVGA 1QQ5A 1TEVA 3DVRX 3QX3A 4K2HA 1XDDA 3EWIA 3O3NB 1F4VA 4POAA 2R96A 2XYQA 4QX6A 4KGVA 4B83A 3OQBA 3L6RA 1G20B 3LC2O 2WDZA 4MVJP 3P45A 2HR1A 3AB5A 1M74A 4JC0A 4WZAE 1IFXA 2NTJA 1P1IA 4L78A 4ZVPA 4FLEA 3TL2A 1EFDN 2BGIA 1JDJA 1B41A 2PKYX 3PT2B 1RYJA 3VFDA 2NOAA 1T6ZA 1W35A 1MABA 1FP1D 3PKJA 5CR9A 5FIUA 5T67A 1EHYA 2O8DB 1BN7A 3V3TA 3K6JA 2E3TA 1QZZA 2X4LA 1Z15A 2AUNA 4B6WA 4K7UA 2P8JA 1EFRA 1E62A 3RI7C 3GJYA 4HGNA 4LYEA 5J17A 1RQNA 3A6LA 3WGIA 1QG2A 1X80A 1IHYA 1ZWKA 4YMTA 1N92A 1OROA 4XXHA 1V95A 3CLTD 5C8YF 3OFNA 2C58A 4JUAA 4ON9A 2N0SB 1BO6A 2VBIA 1K4MA 2VSXA 2PLWA 2HTFA 2YEPF 3ZE8A 2R8BA 4WOKA 4BNZA 2GBPA 5FA6A 3TQOA 1E1KA 2MP2A 4RD4A 3GEIA 3KW5B 2WPNA 4D3ZA 4ESOA 3LV8A 1JPJA 1CY7A 1JXMA 2GWHA 2N9UA 3OICA 1XLPA 4HNGA 4E30A 1ZJ6A 2KJRA 1ZMTA 3P9QA 5DK4A 5EMHA 4HAXA 5C4GB 4ZMRA 5AUOB 3HY3A 4JIMA 3CT4A 5DN6D 2EP7A 4I3HA 4N8EA 5D3MB 3W8DA 2AF3C 5JZEB 2A14A 2G5PA 1KHTA 4U2FA 2GA8A 1KI2A 2WV9A 1CUYA 3L7LA 5EN4A 4R69A 4QGGA 4RQBA 3X1XA 1N57A 2JASA 2RGEA 4I1UA 2NMVA 5ESDA 3QNWA 3MEQA 1N36B 4UNQA 1DOYA 1N3YA 4ER3A 1SXGA 3KKOA 1CY1A 5MFZA 1QK5A 1WDWB 3LWDA 3KQQA 4KFRA 4XVUA 2RJNA 4N9WA 4LRXA 1YQ9A 3PZDA 3N2YA 3OQPA 4YP6A 3JXEA 5AJUA 3ZLTA 4A1OA 2QYTA 1G2IA 4KGXA 5ARBA 1TYZA 2YWCA 3VPHA 1YX5B 4EOGA 5EE5B 4JBGA 4JLMA 4DTCA 1QYVA 3C3MA 4XUGB 5AWFC 2QDXA 4NJ6A 1X8KA 1CF9A 3ADOA 4YH1A 5CFOA 3F0TA 4L4YA 2Z0MA 1PFWA 2H85A 1W52X 3WG9A 4D3XA 3VUXA 1NY6A 2D5BA 2ONKA 3DBLA 3EXHA 3H13A 3JASA 3H8JA 3R6GA 2GCNA 5JH5C 1KH2A 3FYSA 3OFKA 1OZHA 1VIDA 5CA0B 1FL9A 5KDDA 1W5TA 4R2LA 4E09A 4WXMA 2OHJA 5AXCA 3NHWA 4BKUA 2LZ6A 2PJHA 2GCPA 3STHA 3TIVA 5JYCA 5KEIA 3DTVB 1BU5A 2YIJA 4XW2A 4QOIA 2AOUB 5D1NA 4CM1A 2EX0A 2VA9A 3VOAA 4EJ6A 3S29A 3ZWVA 1JIQA 3I14A 1FNBA 4OQFA 5JSZA 1K08A 3DBVO 1N5IA 4UARA 4G0WA 1PGPA 4ZJZA 3ZR4B 1R4NB 2FQQA 4RZUA 3EOZA 1U80A 2C5SA 4GI1A 1Q74A 1WB6A 1KO1A 1CRWG 1X7YB 1WJNA 1E7MA 1N5MA 3OJOA 4O2AB 4F60A 1WRAA 1UM9B 4U5XA 5DM2A 3CMMB 4G37A 1GNSA 3L1JA 4X1YA 1UINA 2E4XA 3ER6A 4UQLA 4HJRA 4K7SA 3AEQA 2OZVA 4IV0A 4WXEA 4CF4A 3WNQA 1ML3A 4UU7A 3WYGA 4EVQA 5CD1A 1CQIB 3LKVA 1HSZA 4M9SA 5LU9A 2D6FA 3THSA 1I7PA 3ZLJA 1PLLA 1P19A 5IEJA 3K1YA 5AM2A 2XADA 3GCZA 4ZU1X 3X1YA 2NZWA 1NXXA 3PQ6A 3PUWA 2VPYA 2VDWA 3RBXA 2QW0X 4GOOD 1UBTS 4HCNB 3AM4A 1FCLA 3LPLA 4WFJA 4HDNB 2BMVA 2YMMA 4PYMA 2V9ZA 4JJ7A 1EFTA 3F5SA 4RAMA 3PNVA 5KTTA 1WF6A 1SD2A 4Q4DA 4LZLA 4XB2A 1JRPA 4GI7A 3BKXA 2CJYA 1E98A 1I4RA 2VJMA 4I3FA 1MKYA 4HVAA 2K9XA 2IH5A 2EBWA 3NVAA 3HKEA 3A58B 3I34X 4CGYA 2DX7A 5FBVB 4GSWA 4NJEA 5IXJA 4F6HA 2BFWA 5BYQA 5DTJA 4IHKA 4R1OA 4R83A 2AN3A 1OTRB 1Y34E 2NU9B 4OJNA 4BNNA 4DTIA 1N33B 2AI2A 5EWMA 1KJTA 4CIBA 3ERCA 1ZD8A 4M98A 4DHEA 2ODTX 2FVXA 3OG9A 1J09A 1L4HA 4LEIA 5ALPA 2O2VB 4GU2A 4BMVA 4Z7QB 1Y9AA 2AHRA 5KOHB 1EK6A 1Y3CE 3QV2A 3FPHA 4XIIA 1K92A 2P4QA 4EUKA 4F4IA 1J2UA 1WGDA 1ES9A 1IL0A 3IDFA 3SYNA 1Z8HA 2D1RA 2ZAYA 3ZY2A 4BO8A 3PGLA 4TKVA 3DVAA 4AJ9A 4AZVA 2I7TA 1UK9A 1MVKA 1T9BA 1XEWY 2NTNA 3AV0B 3KOUA 2BGWA 2DTXA 3UJ9A 1QPZA 4Q1EA 1SQ5A 1G98A 2WIFA 1EFPB 3AEYA 4HKYA 3BYYB 3CJQA 3ELYA 1FUEA 1GTG1 4ZD6A 5AUQA 5GPBA 1L8LA 4R8MA 2GETA 3R2IA 3L0SA 4G1VA 4LWQA 4OJMX 1KM7A 3E5HA 4F4DA 2PUAA 3BFPA 2BHLA 3B1XA 3CO5A 1J8YF 2ECPA 4NQRA 5GZ6A 5JPIA 4CQLA 2R0QC 5FLKA 1D2CA 5TPZD 3VR2A 3UATA 3QVKA 1YKSA 2LVQA 1B6GA 1KP9A 1DARA 3C3EA 3C45A 1MQ9A 4QHSA 4B3SB 1P9DU 3H84A 5AVXA 3SD5A 4U7HA 2YWXA 3ZGOA 4E5SA 1ZXIA 4E46A 2VTBB 1P3JA 1PYGA 1V45E 2BGNA 1TM5E 2ECOA 4GBED 3A1QB 3LT2A 4ZO4A 3TEFA 2R87A 5TR5A 1CE8B 1IUPA 2YDYA 3JQ8B 3OD1A 1ZGJA 1I4TD 5EWLA 4DWWA 3NV9A 5KQGA 4JP2A 1ORRA 2YR0A 4X92A 1RI1A 1V7ZA 3AE4B 2V6FA 3ICWA 3TQSA 3JW8A 3NOXA 3EXFA 3WGUA 1DDOA 3F46A 3NOOA 3R2UA 3FTFA 1V5OA 4ATNA 2GHRA 3C70A 1UBUS 1UT5A 3KQOA 1A7JA 4BFLA 5KQLA 5LVAA 3V42A 4N6GA 4JY7A 3MS4A 2QSJA 4G5RA 4TM8A 1TKRA 4ILEA 5L95C 2QJWA 1UFVA 1YZHA 1KBQA 2DVMA 4K03A 3HV2A 4EHLA 3HJBA 4CLXA 4FB4A 4L22A 1A5TA 4AJLA 4WW0A 3JQFC 2D0OB 3P2BA 1SVNA 2GKSA 2HSWA 1AM4D 3U52E 5D51S 4HN9A 1ZD2P 4BQOA 4CZ2A 2QINA 2DHCA 3V60A 3F3MA 4MV3A 5ALLA 9LDTA 1V2GA 1O5TA 4O2RA 4C0HA 3W6OA 1IQRA 1F2UB 1LLQA 1SIUA 4IJMA 3UGTA 3RC8A 3N32A 3GDFA 3TCNA 4C30A 4KHPB 3FSEA 4BNDB 1FDOA 2YJGA 2UZ3A 2PEZA 3H17A 3J81k 4DV6B 3QEBZ 3VTUA 2GMWA 1CNMA 4OVZA 1M1YA 2ZUTA 1IM5A 3VR3D 4OATA 4A8JC 4GI5A 3SPXA 1VR9A 2VPXA 2GVDC 3LFHA 1RLFA 3UQAA 4MQFA 1VYTA 3E9QA 1HLFA 1EX9A 4X7BA 4CQMA 1WXWA 3AGQA 1ADYA 1TJYA 1JQ5A 2GRJA 2JGIA 3G6KA 3EG5A 5A9SA 5BMVB 4TL6A 3ML8A 3RVBA 5A3JA 5C81A 3DMTC 4HOYA 3QVLA 2QVLA 3CH5A 4L2IB 4AJYB 1B8OA 2X1HA 1FNUA 3S7TA 4KODA 4OB8A 2NVBA 4P1ZA 1ULTA 5FNZA 1VHLA 2CHQA 2F48A 3AR7A 1YJCA 1FZQA 1C3TA 1FVFA 2NXCA 4EI8A 4H6VA 5LMUB 3TUOA 3M6LA 5CB0A 3HI6A 1B0PA 2BFDB 2J5QA 3UMBA 1IY9A 3T9CA 1ZIXA 2UDPA 3B2QA 2CNOA 3KD2A 4O3FA 1HYEA 3PA8A 5AOBA 4OH1A 5B7QA 4KK4A 1TM2A 1HC7A 3RTCA 1ENOA 1V25A 4G5FA 2FK7A 3DM9B 3QWZB 2QRVB 4H18A 5DGIA 3QVVA 1PF7E 3MTIA 1OGWA 3O74A 3TD9A 4DDGD 4BBNF 3QF7A 3T5AA 1XDUA 4FS3A 3TPZA 3WBJA 3GCDA 4KQ9A 4QJBA 4B3JA 4YR7A 3AEEB 1E7UA 4J0GA 3ZNQA 5ALOA 4KDFA 2QORA 2WJYA 2G36A 3VYSB 5A03A 5LQKA 1ZVQA 2RAFA 1NP7A 1UBNA 3DS8A 3OUUA 4YAKA 2B30A 4KQCA 1KSHA 3ROXA 4LFBB 1FDWA 2QUBA 4HPPA 2WMYA 2YHAA 3P1MA 3IS3A 2YWJA 3KKKA 4BVGA 1OJLA 4NBTA 1OLOA 2JLXA 2WNMA 4B84A 2CU3A 4ZCQA 2V4LA 1UCFA 4KLCA 5EW0A 2PPLA 3W2DA 2W6CX 4ICUA 3BQ9A 4I55F 2IEZA 4YUWA 1T4GA 1DWPA 5CUQA 3P4RB 2HA6A 5EXDA 4B33A 4CW7A 1L5MA 1YJBA 5M34A 5GADl 5UKDA 2OZEA 3LPCA 3OP1A 1R12A 2R8RA 3DE4X 3U4QB 4INPA 3RJ5A 3WDKA 1K7CA 1PNTA 4URWR 4IXMA 1LPNA 3KXIA 2VRCD 3EX7C 1E59A 2GZAA 5FULA 1N5KA 3M49A 2IS4A 3UC9A 1RKVA 5KX5F 1XAIA 2R66A 3ZCSA 3L0YA 4KBGA 1FO4A 3D0QA 2D3WA 2QVYX 4XGKA 2QTHA 5C1PA 1A9ZA 4LJLA 3BQMB 4I9GA 1PE0A 3CSTA 2O7RA 3L6DA 1QH1B 1VCIA 1UF0A 5KSOA 5LXTF 1EP2B 2OAP1 1V81A 2YXDA 1CF2O 2ICIA 3R3WA 2VYVD 4ITRC 2PH1A 4IY1A 1N0UA 2QYSA 3ZI7A 3DF7A 4WNCA 3UMCA 3L7YA 4OP2A 2A9OA 1M2GA 2ERYA 3NUGA 3RAEC 4A15A 3Q41A 4ASWC 2PPHA 3GB1A 1OIXA 5I47A 2QPAA 5JHGB 3FZNA 3L7BA 4D99A 5AXOA 5K6AA 2CF5A 3HFGA 2HU8A 4PC6A 1E9CA 3Q11A 4Q34A 3DLPX 4E51A 3M81A 4MGYR 1MB0A 1S5PA 3EIHA 2TRSB 2D2VA 2HX1A 3C6BA 2WXGA 1JECA 2TSYB 4MI3A 4RHUA 1PJTA 3L1KA 5IJWA 1F6DA 4KYUA 2BBSA 3WSTA 3S1AB 1UBHS 1WUTA 2IPOA 1EE1A 3DVGY 4UCXA 1WSPA 4EB6A 1RJGA 3M1AA 1EWCA 2BT6A 3OTQA 5AM1A 1DIRA 1GY8A 1GCOA 3AUYA 3KOYA 3H8HA 2HIAA 3REQA 3CW2A 2XUJA 4MKGA 5LQSA 3AI3A 4D1WA 3FR8A 4EZLA 1YHYA 4B48A 1A8IA 5MGNA 4RTKA 2A94A 2XB2A 2WDPA 1RWNA 4HFRA 3HZHA 1Q0HA 4R5HA 5KHAA 2J4FA 2C7MB 4MKFA 4EE2A 2ERCA 4LTDA 4KL8S 1IWOA 1TNDA 4ZMSA 4GO1A 4ZVKA 4ZEXA 5EE3A 3R7NA 5FHQA 3T1HB 4BBZA 4PPGA 3L8FA 3SSMA 1EWQA 2DZMA 4OB7A 2BPOA 2WQZA 2BEUB 3U1TA 4M9UA 5AQ1A 4JI4B 3GVHA 4M0KA 3W5IA 2OQIA 5FNVA 4B81A 3VPDA 1NSFA 4O2AA 3ZIAD 1BW9B 1HE5A 4KV7A 4QJ3A 1T8SA 4MIYA 3DZDA 1QIDA 3GJ4A 5DYNA 3SWWA 4HYYA 3IJ5A 1Z2DA 5BQPA 5I7OA 1PGJA 1TY2A 2HXSA 1VG8A 2BW0A 3EXIB 1E2QA 1LDEA 1N7JA 3M4ZA 4H1TA 2C5LC 4YT5A 1GR1A 1XA3A 3AY6A 3IB6A 2ZYAA 2CNBA 2DYOA 2ZSHA 1ND6A 1KMQA 3H7PA 2C54A 1Z22A 3FSGD 4WNAB 4V0RA 3BJRA 2D7CA 3FFTA 3ON5A 4IHQA 3H7AA 3QKSA 3VR6A 3RN9C 1Y5LA 3LYUA 3A1QA 1J49A 2O0MA 4PN7A 4WIPA 4BVUC 2FX5A 2ZKIA 1TKYA 3A3KA 4BGEA 1RXIA 4LLGM 1MJGA 4UATA 4C4RA 2H59A 3WWDA 3NS8A 1BCSA 5KOYA 3NOBA 4AV7A 3LLVA 4IEEA 4QDXA 4E5DA 5JAZA 5E9AA 4DJEC 1JQ4A 3IX7A 1JA1A 5IN4A 4C7BA 3IVAA 2V03A 4CN8A 1MAUA 3GLUA 4WAFA 1ECFA 3SS8A 3I9KA 5ALWA 2EGHA 3VU3A 4M3NA 5GWXA 4DCSA 4DSNA 2K8HA 2F1KA 4TT3D 4FQ5A 5FHRA 3AP1A 2FU5C 2VRWA 1IZYA 3B1VA 1ODKA 3DMTA 3FJYA 2DUJA 3AOEC 2WQYB 3PGA1 2AUMA 4H7PA 4N0MA 5FFMA 1PJAA 2NPTA 3I9V1 3WLAA 4EYSA 4JITA 3HBNA 2ZZNA 5EIBC 2FKAA 3DVLA 5F33A 4BJ1A 1YFJA 1CNEA 1EG2A 2O8VA 1R66A 2ZYRA 1UFOA 1T5XD 1H65A 3A6EA 3LKZA 4MQLA 2WJZB 4G1CA 1UPBA 1ZIOA 2X7XA 3CLRD 4GX0A 4ENTA 2E4UA 9ATCA 1LNZA 4XX5A 1YFZA 5H4HA 4DCGA 4BLOA 5CA1F 5MN5A 1NI4A 1W5AA 1TF7A 1RWKA