3T3NA

Molecular basis for the recognition and cleavage of rna (uuccgu) by the bifunctional 5'-3' exo/endoribonuclease rnase j
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
550
structure length
550
Chain Sequence
GPQDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGAEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Basis for the Recognition and Cleavage of RNA by the Bifunctional 5'-3' Exo/Endoribonuclease RNase J.
pubmed doi rcsb
source organism Thermus thermophilus hb27
molecule tags Hydrolase/rna
molecule keywords Metal dependent hydrolase
total genus 160
structure length 550
sequence length 550
ec nomenclature ec 3.-.-.-:
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3t3nA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 3t3nA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3t3nA01
5A87A 4EYBA 4TYFA 4TZ9A 3X2YA 4EYLA 3DHBA 1VJNA 1SMLA 3MD7A 3SPUA 5LSCA 3S0ZA 5FQAA 4O98A 2BFKA 2I7TA 2I7VA 4J5HA 4C09A 1JJTA 4C1CA 5HH5A 4EYFA 2DKFA 2BG8B 4B87A 2YNTB 4FSBA 4RAWA 2ZNBA 5HIPA 4F6HA 5ACQA 4XWWA 5ACPA 2GFKA 4Z60A 3PG4A 5AHOA 3VPEA 3JXPA 5FQCA 2OHJA 1QH3A 4HL1A 1DD6A 2ZWRA 1DDKA 4C1GA 3I15A 4NQ4A 4FEKA 3X30A 4P62A 4AD9A 1X8IA 2ZO4A 4Z6XA 3RPCA 3AF5A 5ACVA 2BG8A 4BZ3A 1QH5A 1BC2A 1YCFA 2FU9A 4TZEA 3KL7A 2Y8AA 5AHRA 5EVKA 2FU8A 4C1FA 5EVBA 1X8GA 4FR7A 3PY5A 5AXRA 4NQ2A 1WW1A 5HIOA 2Y8BA 4TZBA 1A7TA 5K0WA 2YNTA 5EH9A 2FU6A 4Z7RA 2M5CA 3R2UA 1XM8A 4RBSA 1WRAA 5K4KA 4J5FA 3IDZA 4PVTA 3KNSA 2UYXA 1ZNBA 2BGAA 2WYLA 2YZ3A 1JT1A 1BMCA 2GFJA 2FHXB 3A4YA 1E5DA 3QH8A 5ACWA 2NYPA 4C1EA 3RKJA 3ADRA 5LLDA 4AX0B 4V0HA 3SFPA 3BK2A 2H6AA 4Z5YA 4AWZA 2YNVB 4CHLA 2YCBA 3I11A 4U4LA 3ZNBA 3IEMA 5LMCA 3WXCA 5FQBA 4LE6A 4D1WA 3SW3A 1A8TA 3IOGA 4ZNBA 5EV6A 5KIKA 3T3NA 2QINA 3SD9A 5EVDA 4YSKA 2BMIA 4BP0A 3ZR9A 4D1TA 2BIBA 5B1UA 5ACUA 2FU7A 1WUPA 4HKYA 2NXAA 3PY6A 4RAMA 4PVOA 1P9EA 4UWRB 3I13A 1VMEA 3IOFA 2Q42A 2FHXA 4AWYB 4GYUA 1X8HA 4KEPA 4D1UA 5K4MA 2WYMA 4GCWA 5A0TA 4HL2A 2NZEA 1MQOA 1KO3A 2AZ4A 1K07A 1L9YA 3RKKA 1Y44A 2QDSA 4WD6A 5AYAA 1YCGA 2QEDA 5EWAA 3P2UA 3BV6A 5HIQA 5ACRA 4EXSA 4XWTA 1YCHA 5AEBA 2BFZA 5EW0A 2QJSA 3FCZA 4Z67A 2HB9A 3IEKA 4TYTA 5B3RA 3VQZA 2P97A 2Q0IA 3SBLA 2GKLA 4RL2A 5LE1A 3X2ZA 4RM5A 4TZFA 3T3OA 2AIOA 2OHIA 2WYMC 3Q6VA 2CBNA 3LVZA 1ZTCA 2BR6A 3IE0A 4C1DA 2GCUA 4YSBA 3L6NA 5K4NA 5LCFA 5HH4A 5LCHA 5IQKA 4NQ6A 4XUKA 4EY2A 1JJEA 2YNVA 1XTOA 5ACXA 5B15A 3BK1A 2GMNA 3IE1A 4UBQA 3ZWFA 4C1HA 3X2XA 2E7YA 5HH6A 5HISA 2QDTA 2P1EA 2BTNA 5DPXA 4YSLA 3DHAA 4JO0A 2FM6A 5ACTA 1ZKPA 2BG6A 3AF6A 3T9MA 2WHGA 3SRXA 2Q0JA 2XR1A 4AX1B 4EFZA 2YNWA 4EXYA 5LM6A 2XF4A 4RL0A 1KO2A 4DIKA 2I7XA 3TP9A 2ZZIA 2BC2A 2VW8A 1BVTA 2Y87A 4DILA 3DH8A 4UAMA 2YNUA 3IE2A 5AXOA 3DHCA 4ZO2A 5A0VA 3G1PA 3ZQ4A 4F6ZA 4NQ5A 5EV8A 2P18A 3AJ3A 4D02A 1DXKA 3BC2A 4ZO3A 4ZEJA 4Z5ZA 5A5ZA 2NZFA 3ESHA 4UWPB 5LCAA 1WUOA 1VGNA 2BG2A 3FAIA 2A7MA 4D1VA 4KEQA 3I0VA 4H0DA 1M2XA 3KNRA 5EHTA 3H3EA 3IELA 3F9OA 5ACSA 2Q9UA 1KR3A 5KILA 4UA4A 2BG7A 4UWOB 2WRSA 5LS3A 2M5DA 4UWSB 2FK6A 2BFLA 2OHHA 1HLKA 2P4ZA 2DOOA 3I14A 2R2DA 2BFZB 4GYQA
chains in the Genus database with same CATH superfamily
4Q3OA 3KQLA 4K86A 1CUSA 1UXKA 4ZRDA 3RJTA 4LK2A 1IDN1 1KLVA 1AKTA 2Z43A 4N39A 3ZH9B 3TQSA 3L8CA 2GPBA 2O0LA 3CH6A 3MCAA 2UZ1A 2KWCA 4G5SA 1YNSA 3RVOA 5BV7A 1V4BA 3R9XB 1ATIA 3E5RA 3LJKA 4BQFA 1MUUA 2FCAA 1TTTA 3TR6A 3M6IA 1CS0A 4ND8B 3Q41A 2CWWA 3LGSA 5D5PA 2NU6B 2Y71A 3AEDB 3DHHC 4AJWA 1M2VB 1R0SA 3FN4A 3DFMA 4KQWA 4U2EA 3F71A 2GNAA 1PAUA 4H7EA 1N4DA 4UUOA 2I9KA 4C1CA 4MACA 2YNTB 4M8IA 1I33A 1R0LA 2EATA 4BN5A 2YZ7A 2VQ3A 1LVUA 3GK3A 3NBZC 4DQKA 5JSUA 3NOOA 3AIOA 4UDYX 5DGTA 4WN9B 5H1YA 3GX1A 4MQEA 4I6LB 1JKFA 1GLGA 3OIVA 3VM6A 4JWTA 1TNDA 4XFKA 3SEFA 1G6JA 1CCWA 3D2LA 3RS7A 1JHQA 2N9UA 3BB1A 3EAGA 3QKWA 4Z9AA 5CA0A 2VH5R 2FPGA 4C22A 4XWWA 1RJFA 4QLAA 1YFLA 2Z1NA 1K9SA 2F8MA 3DVAB 4NNPA 4KFCA 1OLSA 1T3TA 4OHWA 4ALKA 1XJQA 1VGQA 4O5AA 5A23A 3OM0A 1TKEA 3CUSA 1ZD3A 3M2TA 2RB5A 2ZYVX 4HUQA 3RWOA 2VDVE 2R84A 3IP1A 3HG7A 4DLWA 4FT2A 3TAHA 3Q3CA 3F6EX 3MN1A 4MQFA 1YN5A 1J7AA 3R7QA 1K4YA 1Y1KE 2YDYA 5EPOA 1UMDB 2WVHA 4OHVA 1QP7A 3DC2A 2LIPA 4YQZA 4HL1A 5CT8A 3RF6A 2WSIA 4M0FA 2XYQA 3TBFA 2EBUA 3FVQA 1RYNA 3I01A 1N2IA 1DV1A 3H84A 2YHEA 4CFZA 4AJIA 4P62A 2J5RA 4N0QA 1N62A 4LTNA 4KACA 1CP3A 4YUZA 2EHJA 2WNHA 2TS1A 1GD1O 4Y18A 4MWTA 3RFVA 4F2WA 3Q85A 1O6ZA 3O8DA 3O8QA 3PJRA 2D5CA 1P7WA 2C7PA 3RYHA 2A8YA 2PX6A 4UBLA 1JMYA 4LWPA 1W2HA 2DULA 4XUDA 3V8QA 3SN6A 4A1OA 4B4WA 3L7LA 1ZVVA 5MHTA 1IB6A 5DPRA 4DABA 4GQIA 1QRUA 2JFBA 3E7DA 1C2TA 3HUTA 3PQCA 4MI3A 3G8YA 4XJVA 1PR1A 1ZK4A 3EAFA 2HDEA 3TTUA 2QNIA 3A1QA 2BFBA 2I0FA 1XX6A 4AS3A 4ESEA 2YIJA 4KREA 1LK7A 4FDAA 3I39X 1QZEA 4RXUA 2ZAYA 2EFHB 1W85B 2P2DA 3HN7A 3ZJYA 4MYCA 4CDRA 3WMXA 4XSHA 3F46A 3SOZA 3C15C 5BW6B 4P83A 3FC4A 2JRHA 3PZ8A 2H48A 2YZ2A 1SB3C 4MW0A 4Q24A 4RETA 2PSJA 1YKSA 3VHQA 1Y80A 3THRA 1E60A 2EARA 5JAOA 1BVTA 4L5JA 3ST7A 3CS3A 1Y8RA 1G17A 2IO0B 1UFRA 2Q28A 1N1DA 2E21A 3H04A 3RROA 1UBUS 1I10A 2MSWA 3SC3A 3VNBA 3N8IA 1DP4A 3ZHSA 4LY6A 3TSAA 5EHNA 3PQFA 4X0EA 3U2SC 5L4NA 3D6MA 1OHHD 1O2DA 1QIMA 2DF8A 2FSSA 2X9LA 3D3JA 4TM8A 3O8CA 2GK4A 2EWVA 5GONA 3D6HA 5FUXA 4FC7A 5ARCA 3TB4A 3AEGB 3H1EA 5FJJA 2X13A 3RREA 3X1MA 1NP3A 5FUYA 4TZBA 3OWOA 1X3SA 2P5TB 3RMKC 3ONSA 2QSUA 4M49A 2BYFA 1FDOA 2OCXA 2WF5A 3FDZA 2LCQA 1Z2EA 3C1AA 1NF3A 3U39A 5L40A 4AQ7A 2SBTA 3I04A 1A96A 3Q88A 3KQOA 2WU1A 3A4RA 1JVBA 3N70A 3ASUA 4PTYA 1K8YB 3RVDA 1U3FA 4XAQA 2GRAA 5JLAA 1DIOB 4TL8A 3TNFA 3A4IA 1ST3A 1NF8A 3QA3E 3R3YA 3R5FA 4CM8A 3PHHA 3JVEA 4YAJA 4D9CA 3AY7A 2TSSA 1E58A 2JWUA 1H2YA 1T4MA 3A2LA 1QOBA 3C2QA 3OLYA 4CXMA 2ECKA 3HRDD 4IIJF 4KAJA 3KHTA 5AW7A 3MILA 5I7OA 3DAHA 2WVGA 3CRQA 4XX0B 3AEZA 2QIEB 2A58A 2PL1A 2VEDA 3E5NA 3E9MA 4LDQA 5T57A 2PVCA 3I0NA 3RVMA 1CZLA 2XUFA 4MSUA 4MR8B 4NL4H 1SAYA 5DPWA 2CLLB 3PIDA 2PW9A 4YVFA 4TRMA 3PICA 3LOPA 3RC7A 4HRAA 1F9AA 4UD6A 4IP0A 1K5HA 3EC2A 3FF4A 3KLOA 4DCMA 4DSZA 3WYCA 5KYWB 1PL6A 1YR7A 2HL6A 4HKZE 3B5JA 4WAUA 1SBNE 3OE7A 1SHJA 3IT1A 1NUPA 1QC5B 1GPAA 3AFOA 3K2BA 5DP2A 5J5CA 3ZWAA 1FSFA 1MG0A 5CEFA 2RHRA 1QQTA 5KNBD 2WWXA 3BSWA 5IXJA 2K87A 5IWAB 4H0CA 2LIVA 3GNSA 3UGKA 1B1ZA 4W9FA 1LCIA 2PZLA 1SSNA 4P35A 1HK7A 3KHSA 4EK9A 2ZJ1A 2C8VA 2KOXA 3N32A 3G6WA 1J1IA 3B1WA 3HY4A 2GYYA 5LLSA 4AN1A 4B9AA 3RYCA 1J1ZA 1U0LA 1HDGO 4ISBA 2DP4E 1HO3A 4RTQA 5IZCA 3K0SA 5EWLB 2J33A 3SZOA 3UXMA 2N47A 3COVA 3EG5A 1MV5A 1NUUA 3X1YA 4O25A 1VG8A 1DXHA 2DQSA 3B3AA 4JX8A 4ZOLF 4BVLA 1YJ8A 2V7EA 3HJCA 1VG9B 3PKJA 3IQHX 2X58A 2M1ZA 2K8BA 2SNIE 1I1QB 3HFRA 4N59A 3B60A 3LUPA 3RRZA 5IS2A 1E7QA 1CRPA 2AZTA 2ZUCA 2XNHA 1V7PC 2XQGA 2Z5GA 3OU2A 5AW0A 1MVKA 2XLCA 4KO4S 3TQTA 5CYGA 2CNKA 4FQ8A 2XB4A 3MXOA 3ZEIA 4CW7A 2RH8A 4MVJP 5ALKA 4EG1A 5EVDA 4GPZA 1SVKA 1TJ4A 2YXLA 3AOGA 3BIOA 4C4ZA 1WBDA 2FPSA 1WZ0A 1KOTA 1FFXA 1X1BA 4EJFA 4EYKA 2VAPA 4RBNA 3IQGX 5KX5A 2HI0A 1ZK3A 4MVJH 1EESA 3WK5A 4NYIR 4MW4A 4HDSB 4GE3A 2B4AA 4YAUA 2IHNA 1WUPA 4RF3A 3WGJA 2HBZA 4YAWA 2C3UA 1E61A 5AHWA 3INTA 2LNDA 5HKKD 2BY4A 4NP6A 3TYXA 1BHJA 3UXHA 4CQNA 4FDLA 4C4YA 3DZFA 2AEHA 4PRLA 1P81A 1YAHA 3N58A 2ZSDA 1V9SA 4YMUA 4GMDA 2YHUA 5TMDA 1UJBA 2BTQA 3NGLA 4K9KA 5CH8A 3WBJA 2G80A 2NNLD 4YJGA 3ZI4A 3R40A 1CERA 4TTTS 4CM9D 4DCNA 1GNUA 1XQVA 2PUTA 2AOTA 2NZEA 5KBYA 1T6BX 1M1UA 1FJGB 4BYMA 2ZTHA 2OBNA 1E5VA 4BWGA 1SUFA 1HKUA 4FFBA 1Y8RC 4O5OA 1KPHA 1K7SN 3MTEA 4U7PB 2Z4TA 1ULAA 4IOIE 1AKEA 3F4LA 3ICCA 4UCWA 5DXFA 4KVAA 3P9IA 5CLHA 1AYFA 2HSZA 3OETA 1YS7A 4YRDA 3H2IA 4AY3A 3SD5A 1WRDB 1EM6A 4ZI2A 1LFDB 4CZ2A 5TGZA 4AMUA 4WXEA 2O59A 2YTZA 1UAYA 3M3HA 5G0UA 1XALA 4K3BA 3IS3A 1QGOA 3E9RA 3N9IA 4FZRA 4PHHA 4YTEA 5IC6A 3WNDA 3SIRA 3R9IA 1D1PA 1GUBA 1VKZA 2FQQA 4RNCA 1BA2A 2W43A 3PQ3A 4G65A 2O8CB 4G86A 4IOKA 4EHIA 1GGVA 3D2AA 4U5XA 3EYWA 3QMPA 4R84A 2AOWA 3TW0A 4JZYA 4XM2A 2POQX 5E3HA 3L05A 3VNRA 1YCHA 2HYDA 1N2CB 3BS4A 4GL4A 3GLIB 4PT5A 1UBHS 2YHAA 3MINB 3NHAA 3ZCUA 4Z1OA 3JAWA 3OTOB 1MEJA 4URFA 1MJFA 1ET9A 1W85A 3BRCA 4PC1A 3F6PA 1OH6A 2RHTA 1V3VA 2X9GA 5IVIA 4CDNA 1USVA 1Z74A 1K89A 3JQRA 4MVXA 4B8WA 4YR7A 1EX6A 2ZE7A 2WUEA 4WDQA 2DPMA 1XRQA 1I24A 1QCCA 4MCIA 3QVMA 1QDLB 3QBEA 4BMYA 2P27A 4TUYF 3AI1A 1X19A 4WFJA 1Z0ZA 3PC8A 2DG2A 4P7FA 5E4TA 4ZD6A 4ER6A 3UYKA 1K7XB 4EHHA 5LLTA 1V3TA 2WAOA 4IZIA 2QE6A 3KJZA 1JE0A 3X2ZA 2C8LA 4EG5A 2HWUA 1BROA 4IWXA 1X94A 2NLOA 2QD1A 1CE8A 3K73O 5LU9A 3Q7RA 3QVTA 3PXUA 3PRKE 4UVHA 5H70A 1E18A 1DSSG 4M0LA 4EOGA 3NOQA 1LDYA 3F9RA 3TQRA 4LSMA 5L3QB 1BQEA 3A2KA 3O8NA 4E32A 1CW2B 3M6LA 1FRDA 5HKAA 3HL0A 1SEBD 2Q5WD 2JJ8A 3MJWA 3BL5A 3U4CA 3ZOZA 5JV5A 4HNSA 3PWTA 2COEA 3P42A 1J70A 4MR9B 3VOAA 2IU3A 3B9QA 3NAQA 2I4OA 1IZ9A 4HSGA 4CNQA 4TYPA 4QRIA 4WLEA 4M7WA 4K9SA 3LVRE 5ALEA 1KO5A 4RD2A 4KR6A 2M98A 4LY9A 4R5HA 4B84A 2B35A 1A9PA 2GJ9A 4XARA 3IT6B 3GJXC 1YS4A 1JMVA 4DW8A 5KPDA 5KQGA 1QF9A 4EB6A 2JD2A 5CT5A 2AF3C 4G5OA 1ZX1A 3N28A 4O4JB 1BMTA 2FMKA 3ECCA 3IODA 3ZTWA 2CXUA 2XB6A 1ORDA 5JD3A 3SZGA 3OLQA 1NNUA 2IOYA 4ZDVA 3EHVA 2BPSA 1QR2A 1SR8A 1YZ3A 2DLDA 2JGMA 1WNFA 2W2OA 4XLLA 1VI2A 5G4KA 1A1VA 4C7OB 2QDTA 4GL2A 3IEUA 1Q6ZA 3DHAA 3OC0A 3FX2A 3W77A 4ARIA 2GWHA 4YJ2F 5BYBA 4RTMA 4Y2YA 2FM6A 2ZYDA 3MNFA 4BU0A 3WA7A 3DL2A 2PS1A 5ACTA 2VN8A 3TLKA 2KHZA 2P0EA 2WFAA 2XXAB 1NOKA 2YCLA 2PKOA 1TM4E 1SKMA 4H77A 4ZAFA 4WERA 5KU1A 3D7MA 5SYAA 5JPIA 1UFOA 1Q1BA 2Y1EA 3N8DA 4K03A 3UHPA 1C7FA 3E3MA 2PUFA 4KBGA 4PO9A 4IZ6A 1II8A 1NVGA 1VM6A 2XRMA 4WK6A 3WTBA 4BLPA 2W22A 4FR2A 1GRVA 3BGOS 1NG9A 4F9EA 2BZGA 1I7LA 5ALNA 3HDVA 2RG1A 3HU5A 3HZZA 4RJTA 1IGCA 3FGOA 3RVNA 2VDWB 5ER6A 1KZ1A 1C81A 1SQGA 1TK2A 2J3DA 5CDFE 2KFJA 4QARA 5CVJA 2HNBA 5IJ0B 1L5PA 4B5KA 4JR2A 2OBLA 1YJQA 3AF0A 4N1AA 4HZUA 4DA9A 1FDVA 2Y5PA 1RMYA 1UINA 3GLSA 2J3IA 1VYVA 1XFAA 2GUWA 3Q7PA 2AFRA 2FQXA 1OLXB 4HN4B 1HLGA 1V3UA 4M98A 3U9TA 4AZ0A 4O4HB 2R6JA 5LQKA 1VLZA 1WUTA 4IWOA 1Y8RB 2FX5A 3TKAA 3DHWC 3WYGA 1U1GA 1ULSA 2Y6UA 1WJ4A 2PXHA 4YTMB 1DTWB 2FCRA 3CX7A 3VHLB 3N0RA 1ADYA 3P4YA 4IWYA 1KDRA 1E9CA 1DUSA 1TAGA 1C3XA 3JVVA 2C82A 4NBUA 4Y2XA 3MMZA 1JIKA 3ZX4A 3BTSA 4NQ5A 3LCJA 4MRNA 4PWZA 2BFEB 5U9CA 5A0FA 4HYYA 2FK7A 1V39A 1AW7A 3BKXA 2KI5A 1E2LA 1YGYA 2RBGA 4IX1A 1Z17A 4XXHA 5GGYA 1CFJA 5IP5A 1GN9A 5G1NA 1C1DA 1HG1A 3HYRA 2IH2A 3B7WA 2WP9B 4KTVE 1GQOA 1DGQA 4NYIQ 1OR8A 3B78A 4DHJB 2EW1A 4MA5A 2QTZA 1OKKD 1T5SA 3L8ZA 3V46A 4WNIA 2AXNA 3ESHA 1JWBD 2LHDA 4C0HA 2E0IA 3I1IA 4XUEA 1P3DA 3KR9A 3JSXA 4L4UA 3HUDA 2CCKA 2G67A 4RULA 3DYVA 2VWPA 1GV0A 2A0FA 5CURA 5B2FA 1H65A 3FPCA 3C3MA 2J7KA 3R4VA 3UEOA 5CXUA 5BUQA 5JPCA 1I1OA 1G3RA 1NPYA 3OZSA 4GH5A 4CI0B 1JS1X 1GGHA 4IM3A 1QZZA 4QXQA 1U0OC 5D3IB 2QZ4A 4L6CA 2POCA 3ROTA 4DG9A 4YAIA 2PKQP 2XCIA 2PZBA 4NJMB 1PQSA 1GRCA 3BTUA 4TKVB 3U52E 2UZ4A 2N9EB 1UBGA 2C5LC 2RI6A 5K2MA 4RKQA 5KSYA 4LHXA 1N32B 5LZ7A 5DTMA 4QUIA 3H9QA 4NRDA 4M7PA 3PNKA 1P6XA 4F3KA 3R1IA 2GZHA 2QBYA 1YUMA 4NENA 3S7TA 4C0KA 1VR9A 3EY9A 1I4OA 2ZRAA 1YMQA 3HTXA 3DP7A 1YL7A 4KLAA 4ZC8A 4J6IA 4JP1A 5IM5A 3VTVA 1J42A 1VB3A 4M9ZA 3IDAA 4F1JA 1SCIA 1W0KD 1BN7A 3UNXA 4DR4B 2YMMA 1ISFA 4BP8A 4W8GA 3W2EA 4YMIA 1JHVA 1SELA 5KNLA 2HQSA 2ZZMA 2AQIA 3JQ6A 4LZAA 1EA5A 3NKVA 1W36D 4J0FA 5FD8A 2AC2A 4GZ3A 4N3NA 1M72A 3QWIA 3ANYB 2HQOA 3PR3A 3H0CA 1EUDA 1ZPDA 2H7YA 4IDCA 4NPCA 4BTLA 2X3YA 3V1KA 5JNVA 2WM8A 3PX3A 1M33A 1SKYB 4JCOA 4RZHA 4Y7CA 3TF5A 1LB1B 2L05A 1H8ED 2H0QA 4FR5A 4LVCA 5FWXA 5IT0A 4JI2B 1ONSA 4MJSB 1W9MA 1D5MC 3BILA 4S1NA 2QD3A 3AI2A 1QH8B 2BM9A 2O8NA 2XMSA 4QJ4A 3WYNA 5EPEA 4JJFA 4HNTA 3ZWWA 1OWPA 4I6JA 1W0CA 2IKSA 3F5FA 1BIFA 3HU3A 3I53A 4GNRA 4W6QA 5EYPA 4D3YA 1IU9A 3OTHA 4YH1A 2WTXA 4J16C 5I9BA 4TQ1A 5K3CA 4NF2A 5KYUA 3DLTA 5FAXA 1UIRA 1E6EB 1T2AA 4Z8YA 3D32A 4IM2A 2I7TA 4KDIC 4UM9D 3O65B 1A04A 1Z45A 2FKNA 2VDUE 4TKLA 3SGLA 3T7RA 3TTTA 3FKYA 5A71A 2GBLC 1JJTA 5A5GA 1BN6A 1RMQA 2Z04A 1XLTC 4CG3A 4ZOAA 4N0MA 1TL7C 2VI5A 2DFLA 5EHIA 2PYZA 3W1WA 3PQDA 3L1VA 1Z38A 2JIBA 4I9FA 3SJ7A 5HJ5A 1PUTA 1DJNA 3CIRB 3RW9A 1K3UB 4KV2A 4M0WA 2QRQA 2JLYA 1HZZC 1ODJA 2OAQ1 5DYWA 4ZOEA 2NP6A 2ASVA 2CMDA 1I4PA 1OAAA 1AMOA 4ZI3A 2K7ZA 3FCOA 1X14A 1CLEA 3GD7A 1URPA 1RAEA 4AZ3B 3DKIA 4HOYA 1AQNA 4C7YA 1V6EA 5JS1A 4X6UA 5GADl 5E6RA 1V2YA 3SM3A 1TYGB 3TMPB 3EE6A 4Z60A 3UJ3X 3WJ1A 1IM8A 3ADKA 2OKCA 2I3DA 3DBRB 2P6OA 1WGRA 3OLMD 1T5BA 4RGYA 3E22B 2BHSA 5IUNC 2AFVA 3EPJA 3WK8A 1VL6A 2CLDX 2H3EA 1NI5A 1RXIA 2VT3A 4G4GA 3DEHA 5JXGA 2ZIAA 4J7AA 1XTBA 4IO1A 3NTRA 2JCGA 3GR6A 1S96A 4PPNA 5G2OA 4DB4A 4RTJA 2ZRQA 3DBLI 4EPXA 1DEKA 4X1YA 1RYMA 4PG4A 3KJXA 1FSZA 1S2DA 2IYFA 3STWA 1QF6A 1QOFA 1XVUA 3WKEA 4LNIA 2JFVA 2MJDA 2Q1TA 1MJDA 3CWQA 4JLKA 1IULA 1T4GA 2JI7A 4MIOA 1WHSA 1GVNB 3ABZA 1MH9A 3DZ8A 3H9GA 4KK3A 1MDFA 4KQXA 2P1DA 4P3KA 1SOMA 2FFHA 2WT8A 1SVUA 2HC9A 5G02A 4W8OA 5JSFA 2AD1A 1BWSA 2CFCA 3WLTA 3A32A 3G0BA 2DY1A 3KQ4A 3L77A 1VLMA 2MSNA 1X80B 2IVZA 4NDNE 2JXTA 2BFMA 2CFTA 2QMYA 3CVYA 1JAYA 4PBSA 1IY1A 4MRAA 7YASA 1ODTC 2P9ZA 2WVJA 1XCPA 4Q66C 1WM1A 1X1QA 3DWGA 4IH4A 2X41A 4I5IA 4IC7B 2JLVA 3LUKA 2HSWA 4R9NA 1WSWA 3RZWC 3NNDA 4B74A 3BCUA 1NURA 2A5DA 3LYUA 2HT6A 3FFBA 4G1CA 4B75A 3X1XA 1B1CA 3RRFA 1PGBA 1KEPA 3EOAI 4C4RA 2PZAA 2QMHA 1QSGA 2X76A 4K9OA 4LQCA 3Q3FA 4NBRA 4PWYA 4U5QA 5B12A 2WVAA 5KC9A 3ZVNA 3RGGA 1QRSA 2ECFA 3LUCA 4DLSA 4Q7EA 2X0EA 2KYRA 4JX9A 2VBFA 1SXJD 5CMLA 4EEXA 5AVXA 5ALVA 1RRMA 1RDFA 2QGZA 5JARA 3LRTA 5BQFA 3PLAE 4GOJA 2XTMA 3HKEB 4GHWA 4YRAA 4OXQA 4FNAA 4S1VA 4LNNA 2WD9A 4TRRA 3V8RA 3I3OA 3A4SC 3DTVD 5EHZA 4DEYA 3K1TA 1LS6A 3FZNA 3SLRA 1G2PA 3FUXA 3Q8EA 4UEOA 5K0WA 4AJLA 3WMRA 1IHOA 2N42A 1M6WA 2OV4A 3C1UA 5CVEA 3J81A 1FDIA 2M5CA 2AFHB 4ZCTA 1NIJA 2F62A 2Q5HA 4IOJA 3IVMA 1LZLA 2FZWA 4A4DA 2O2YA 2LHEA 4RYLA 4YP1A 2VRRB 3PZDA 2GCOA 2NYRA 4X3PA 5E7JA 4O0MA 3VO1A 1ISGA 4UREA 1XM8A 1XMPA 1A1SA 1F5SA 1HYQA 2I6TA 3DTVB 1E9BA 3FNHA 3REOA 6Q21A 1WRAA 4PVTA 2WAYA 4YJGB 3ESYA 3KUZA 3DUFA 1Y6QA 4HAWA 5CX4A 5D87A 5MN5A 3K70D 1SVMA 2B4QA 3ZW7A 4AMYA 1ESZA 4URHA 2GN6A 2PBFA 3WIOA 3ENZA 2NQTA 3IAEA 2DH6A 2V6GA 1XLTA 4B35A 5FA6A 3ET5A 3M6FA 2CL7X 5TJHA 2QBYB 2AUMA 1B43A 5EE3A 1SZJG 3N53A 1DAGA 5EIBD 3DOUA 1YL6A 3C8UA 5KJFA 3UAZA 3NFYA 4G0UA 2ZS9A 3KELA 5HVNA 1P2BA 4JBGA 1VPLA 1GZHB 1DAHA 5TB5A 4ANXA 1Q7RA 2OO3A 4HEHA 4CT0A 3OTGA 4E6PA 3B6KA 3BXEA 1OD6A 4ITKA 2JG3A 1YI1A 2HJGA 3TI7A 4YP5A 1GZSA 2J3JA 3EEQA 2HF7A 1FFXB 4QUKA 5B3JC 1F48A 2V7WA 3GG2A 3RPEA 4Z4HA 4MDKE 1PNRA 2WYHA 5DK6A 1HSZA 1RM3A 3D4IA 2Y99A 4IJKA 3KAQA 1LK0A 4QHTA 4OF4A 4OXXA 3AERB 4Y2VA 2NUTA 4RFVA 1VZ6A 1PT9A 2LWPA 1Z0FA 2Q8PA 2QSYA 1J33A 4LWOA 5D01A 2R79A 2OSBA 3SEAA 4NULA 1JAHA 1N2OA 2FPIA 2W0MA 3A3NA 3PA6A 4D4IA 4D0GA 3JD1A 3MWDA 4F04A 4TT3A 1KOLA 1NBME 1VJDA 1M8GA 2D7DA 4RH0A 1DAIA 5THQA 5HEKA 2XKBA 2KB0A 2R87A 4WZAB 1PDOA 3SHWA 2A92A 4ZIRB 1C8LA 2QT1A 2JZNA 1N2JA 2REQA 2ZDHA 2VATA 2NPIA 2CU1A 2EKBA 2M0AA 3EW9A 4NJMA 4YBZA 3C70A 4FDUA 4JXKA 5MDHA 3B8HA 3MIZA 4ZICA 3U3KA 2EEZA 3NIBA 4RCYA 2EP5A 1TKBA 1T9BA 1R4MI 1JYEA 1T1EA 4N0EA 5HOEA 5HRUA 2BMIA 1BOOA 2JHAA 2BIBA 2FW0A 1OQRA 3H3JA 3O1IC 4X95A 3W7VA 4PX3A 4MP6A 3MGKA 4L4ZA 5B1UA 1X0XA 4MV9A 4WCFB 5EEGA 1M2GA 1P18A 2PSFA 3WGVA 2NXAA 5FXMA 2HSJA 4HRVA 1YZFA 3HRKA 2E4XA 5BOVA 1NXXA 3KR1A 2YASA 1VBMA 3CF6R 4FGJA 4OQNA 3MSXA 4RWEA 5FPQA 1RYDA 2FBWB 4BBPA 4BQEA 5CAEB 2QD4A 1KIFA 1PFKA 1L2NA 1O58A 3H11A 5IDWA 4MV3A 3WWEA 2WTUA 4QQFA 2YFHA 1A70A 4II2B 2GZ1A 3P71T 4ETWA 3RVJA 3BB4A 3H8HA 2DZMA 1YHYA 2H52A 3GMTA 3CVXA 5ALFA 3PO0A 3R5TA 1F9EA 2PLAA 4UUPA 1H85A 3MF4A 4YRBA 2NPTA 1AKQA 1DU4A 2Y2UA 3EXIA 4H4EA 5BN3A 3CX3A 5K8UA 2DUUA 2IX3A 2C7RA 2EZ4A 5IKOA 2G9QA 1KO3A 3GW8A 1QFZA 3QYAA 4OGLA 5KVAA 4E15A 2Y1OA 4YUXA 5HQJA 4JP3A 1SXHA 1P9LA 3CW9A 1HEZE 1SD1A 1Y9JA 4GVLA 3W5IA 5K0NA 2BKAA 4DM7A 1W5SA 2H88B 1VHLA 5AZFA 2XSZD 4E33A 3FUVA 4YA6A 1I4TD 1J99A 5C80A 2XZOA 5LXIB 1CWUA 1QQBA 2ZRKA 2F2TA 3PXBA 3NRJA 1N63A 1FOEB 2FFBA 3Q12A 4LZJA 1E2JA 2WM2A 1C3TA 3PNLA 1H2ZA 2FPKA 2VK4A 3VRAB 4FMCB 3D3WA 3SK0A 4I4IA 4Q5IA 3PUZA 3LC2O 4PANA 3UCXA 4DIFA 1I5EA 2RB4A 2QTGA 3DTTA 4V0QA 1VCMA 3D8SA 5EE5B 4EXSA 1ZSVA 1RWMA 1ZYUA 3M5DA 2V03A 1OI3A 2GVNA 4US8A 1Z7YA 4Q4AB 4ZDKA 4TXMA 2H2GA 3B70A 3U7GA 1X7DA 2VDWA 2YV5A 6YASA 4YL8A 2OP0A 1Z4PX 3R0ZA 3ZK9A 2O7RA 3BREA 5T8KC 1CJVC 1H1LA 1N6KA 2QVZX 5L7YA 3R3JA 2IU0A 2JIZD 5JQWA 2YJ4A 4HFJA 5E95A 4RPCA 5JADA 4W9NC 2AK3A 1BKDR 1PD1A 1RWVA 2IL1A 1YB2A 3RYFB 1IXSB 4W1PA 4PYJA 4DHJD 1FK8A 2A1UB 5FBHA 2JH3A 1MP0A 5IF9A 3ETJA 1Z5PA 3OCWA 1HTQA 2BJVA 2E3JA 1U8TA 1ACJA 5CX3A 4L28A 6ADHA 1Y5NA 1RMTA 5DCUA 4DAOA 1S6YA 5H59A 2BGFA 1NU8A 1U2ZA 3V4PB 1IBMB 2ATVA 3CKMA 4FOTA 4JS0A 4ND1A 4B6OA 1KERA 3SHFA 3M1IA 2Z57A 3OJCA 4XE5A 1M2JA 3VJKA 1U3VA 4X8MA 3F73A 4EUKA 1ZO8A 3PJDA 1EMDA 1H9AA 3FBWA 1W1WA 2IZOA 5CCBA 3DPUA 5LCFA 4B0PA 4YDSA 3A1VA 5I7UA 2JRLA 4KOEC 3PVSA 3OWEB 1GQSA 4GI7A 3ZI0A 3OX2A 5LZ4A 3SBXA 3GGCA 3TK1A 1NUQA 1US8A 4QVIA 1WXWA 3EIXA 3UPUA 2IH4A 1V41E 2Z5LA 3I6YA 2VG8A 1X74A 3QI7A 1XA4A 2WXJA 1WNTA 4M1ZA 5A4AA 3M5PA 3LO8A 3AEQA 3G9QA 3HKCB 4C4PA 1KU0A 1Z6AA 1U2TA 4B4VA 2Y8EA 3C3KA 4ZAVA 3U44A 4KSCA 3CONA 1OLSB 2V5UA 3AY6A 2YWRA 4PSCA 2ZBFA 4OB8A 3TBKA 4HX9A 1E62A 2M32A 2MINB 3FUCA 1FCCC 1P1BA 2EJUA 1P4HA 5E1OA 3T9CA 2IUTA 2AT1A 1QAMA 2ESRA 3S27A 4E7PA 1IXZA 2PO5A 1Z37A 3C6QA 1XPOA 3BTOA 1HV8A 1C79A 1QIDA 4OKNA 1Z6ZA 4JELA 4PAQA 4PQGA 3O8OB 1AQUA 1E4OA 1Z2OX 3PGKA 2AC4A 1MTZA 1D6MA 2QVCA 4CFSA 2G0TA 4M9RA 4C3ZA 3BMQB 4OAPA 1MQAA 2HH9A 5HFAA 1N33B 2PSHA 3BGVA 1SOAA 1S8OA 3FSGA 3EYAA 1PJSA 2DM6A 1Z63A 2HX1A 4PF1A 4IFBA 4WN3A 3SPXA 3EAQA 3I5XA 3IBEA 4M89A 4EI2A 1EJBA 1D5XC 3BWUD 2BHLA 1KTVA 5EJMA 5JEEA 3HN2A 1CUFA 3RBZA 1ZIOA 2EAUA 4HYTA 4CU5A 5BYAA 4RMAA 4NARA 5BV2P 1D8AA 1OVMA 1U3UA 2A35A 3GBPA 3UIOB 4EKGA 2FSGA 4IH1A 2F3PA 3EIWA 1QX4A 3T35A 1KTKA 3PR1A 5ER9A 5L53A 3EXFB 2NSHA 4PZYA 4RL4A 4TPKA 3O84A 3ZDAA 5LP6C 4ALIA 1KZYC 2VA9A 4O4IF 4TTPA 3OJ3A 2G4VA 3OLWA 4UM9B 2GD0A 1BH6A 4DCVA 3HM9A 3NKFA 4Z5XA 1MRNA 2X1HA 1U1CA 2GMIC 1J22A 1W4LA 2VW8A 1AH2A 2B20A 1RXUA 1E8ZA 1T34A 2Q3FA 3CN9A 4XVRA 3HY6A 1SVSA 3MIIA 5ALJA 2WIDA 4NJOA 2GM9A 3ZK8A 4OKSA 1ES9A 2J0UB 2A0XA 3HXPA 2RK4A 4XD7A 5K4GA 2YNUA 3QPAA 5IG2A 3OIDA 4HQFA 3FG9A 3IOYA 4FOSA 3JASA 3W2IA 3M4JA 3QLUC 5JAZA 1TQHA 3JALB 1OC4A 4MZDA 2FZ4A 3G1PA 4YQYA 1Y34E 5HGXA 2JASA 3VDZA 2QM7A 2ZR8A 4XM0A 2IUUA 2BELA 1G1MA 3KD3A 4ER5A 3FJYA 2Q1UA 1OBOA 4PHCA 1OPRA 4F84A 4MDEA 2VDLB 3W6NA 4D02A 2JJMA 3WK9A 1EFPB 2HWXA 3KFXA 1KAEA 2I1LA 3CSUA 4NZZA 2Z95A 3CRVA 4IIHA 2GD1O 1DARA 2IPLA 3VR4A 2DPXA 3JRNA 4NJ6A 1WHSB 2IYWA 3R7BA 4EW3A 2PUAA 2X8XX 3DMTC 1YE3A 1MA3A 1PK7A 1M34B 3LDZE 1RC0A 2O54A 1USWA 3LFUA 2DX7A 1PLLA 1YFJA 1WE6A 3FE2A 3OX4A 1NSFA 3FOEC 4AI6A 1CY8A 1E8NA 3EUFA 1A8QA 3OQMA 2ATEA 4COOA 2IITA 4E2ZA 1PFGA 2RC6A 4YMHA 3N87A 3KZNA 3SWWA 2CDRA 1VBFA 4NZ9A 1MC1A 1USKA 4TXLA 1DCFA 3QEOA 3Q7EA 1GILA 2A7MA 4XWAA 3I1FA 4LDTD 3F67A 1R8JA 2DCMA 4WVFA 3IAHA 4RM2A 4H1WA 1E1RA 1ILWA 1EH5A 3E9YA 5KYVA 4RFBA 2JIQA 4AG3A 1GDDA 4UNRA 3F7TA 3V97A 4K7SA 1NIPA 3EVNA 3E23A 3KLBA 4HFMA 1ADBA 1TZKA 5CD1A 1NVUQ 3L13A 2QXYA 3DFZA 2KO3A 3ANTA 4ZP1A 3IAFA 4AIRA 1MHTA 2CFZA 2C7NB 1DFGA 2J3QA 1NBHA 4Z4QA 3ZV5A 4RCZA 3U9SA 3EZFA 4DXDA 5LZ2A 2JRCA 3OZGA 2ZB2A 4MRSA 3CEMA 1DJLA 1VIMA 4XLZA 1QGED 2WOOA 3RH0A 4B79A 1B8OA 1U8XX 4GXTA 4UHBA 5B4UA 1P39A 1K2WA 3MMXA 1N57A 3EZ7A 3OEHD 3Q6NA 1MJGA 2IP1A 3W05A 5CB8A 5KVVA 4TV8A 3K1AA 4BVFA 1NN3A 4HR7A 4RF4A 2B61A 5AKHA 1O0BA 1UKEA 1U2EA 5DFAA 1K68A 3W5UB 5HW0A 4Y9SA 1V5OA 3ZZUA 2BG7A 3L10B 4GDMA 4GMKA 1YAJA 2Y0PA 4RUKA 3G2LA 2A1UA 2RJOA 1E8XA 3AERA 5B58T 1E9SA 2QZJA 4E7OA 2BEUA 2O6HA 3RI3A 2XGOA 2X4DA 5GJWC 2GHTA 5CLJA 5JISA 3S70A 3T3IA 5I9SA 3RFTA 4ZT2A 5ECWA 5GVSA 1GM5A 2QTTA 2Q8QA 1KVUA 4PYUA 1TA9A 4D9IA 5FL7A 3RNAC 2QU7A 2W2VA 1VL2A 5B1DA 4QXOA 3GVXA 3C5VA 2FV8A 3LPNA 1WU7A 3QTLA 1V1PB 4ND7A 5HNKA 2GEBA 2H9AA 1SCJA 2ZW9A 2QG4A 2AG8A 1NE7A 5JZMA 3B7PA 3G2HA 4BO2A 4EDHA 1T8YA 1Z12A 2C95A 3DA8A 4PS7A 4X63A 1K5PA 2PWPA 3MCZA 4WBXC 1JLKA 1SMLA 1AY0A 2A5JA 2HLDD 1UPFA 1O97D 2QQFA 3FM9A 3GMSA 3L7AA 4P0TA 4P86A 4IM7A 2Q1SA 1K4KA 4W5JA 5DW0A 5I5EA 4EI9A 4GM4A 1QGDA 1F2UA 4GPD1 1M75A 5C7YA 4RPHA 3VPCA 2CLCX 2FR8A 1IM5A 1R6DA 1C30B 2X2EA 3FMIA 3PLNA 1V9LA 1N0WA 3JSAA 2X8WA 4ID9A 5F77A 3VTWA 3ZH2A 3RC2A 1V8FA 3TLJA 4C87A 4JUFA 5AUOB 4YCLA 4KH1A 4PG5A 3DUWA 2J4CA 1WWTA 4H2AA 1DWQA 4AF7A 3FWNA 3KYCD 2HFJA 3S28A 3WLPA 3LCUA 3LC1O 1ZDMA 2C9MA 2J31A 2Z2ZA 3BXFA 4XVHA 3VYUB 4OHKA 5GPBA 2WC1A 3PE4A 5IK2A 2FCMA 2QTNA 4KKIA 3H1UA 2NR2A 3OE5A 4X3OA 1IWPB 4M1QA 4A6EA 1XPRA 4Z4GA 1Y8CA 2H1FA 1J09A 5IVDA 2RD2A 2VJNA 3MMPA 3NJ4A 5I8PA 1QZUA 3IAS1 1YI0A 1UUPA 2ZVJA 4HB2A 2WICA 1PK9A 4FZ5A 2KQUA 2W6JD 4BWYA 5HUQA 3F8SA 4TS1A 3GARA 3HDYA 4C1NA 2PS0A 3OBBA 2R6DA 1XA3A 3BD9A 4H3KB 3DO6A 5KIAA 1TEVA 1BWPA 2DAFA 2J59A 2JLCA 3QKTA 4GRIA 1QKJA 4MW2A 1G21B 3DM9B 3H8WA 5BRAA 1CTQA 5I4IA 3LF1A 3BMNA 5E7QA 2BWES 1ZNXA 3BE5A 4YT0B 3SXUB 2JLZA 3VTAA 3CR7A 1OFTA 4BFYA 4F72A 1BXGA 3O5AA 2XUPA 1NULA 1AUQA 5FUBA 1K5GA 1QKIA 1ZMRA 3FMVA 3GH3A 3L4SO 4GD3Q 5LBIA 4AJ9A 1GAEO 4F4FA 2CXNA 2Q2NA 4AWBA 3W5CA 4TM7A 2LGXA 3I0MA 2Q5OA 4FE7A 1HDCA 3A3OA 4JJ7A 3FSRA 5F2EA 3W1VA 4FEKA 1ECFA 1KZGB 4JZKA 4WASA 4EG0A 2AX4A 3TBLD 1VPEA 2HUPA 4PTZA 1CEXA 2MBBB 2GBPA 4MS4B 2PH1A 4NBSA 4OFWA 4ZDWA 4BV8A 4NCAA 2VF4X 5CLGA 3DULA 5L3QA 4AD9A 2WLBA 2NZYA 3OKAA 1YB7A 2XI4A 4C3UA 1KH1A 1U04A 5A5FA 3VGJA 4GOMD 1KJTA 3TZEA 4CLHA 4LF7B 4AZWA 4ENRA 1C0EA 2G8NA 1RQGA 5T6MA 1QORA 1YB1A 3GFPA 3GFVA 2GARA 3S1AB 4CN8A 4EG6A 4LFCB 4OXRA 2VAXA 2CBGA 3MGGA 2G1AA 4EGFA 1M1YB 2QLTA 4LZOA 4XI9A 2NTVA 1F51E 2FUNB 3CPJB 4BRZA 1VHDA 2Y1GA 3EWSA 3ISJA 1K97A 2IP2A 5HISA 2JJ2D 1UOEA 1GT91 1S9DA 3GN1A 4KLNA 2GK6A 3WFZA 1SBIA 4Q01A 1YCFA 5DWVA 1W4AA 1Z5SB 3LCMA 4OFXA 1UJ5A 3WXMA 3ZXSA 2R61A 1GPNA 3VOBA 2IXDA 1YQ9A 3GBSA 5DF1A 2NV2B 4LI0A 5JWRA 3GOHA 1S8AA 2X77A 3VH4B 2QQGA 2XCLA 3ERCA 1X8IA 5E1MA 4C1FA 1Q74A 1ULBA 4KI7A 4BMZA 2EW8A 1DBPA 1KEZA 1NR5A 4PXSA 1T5XD 1AKMA 1KEVA 1QRTA 2IUYA 1H6CA 2O6LA 2I3AA 2FSUA 3QE2A 4OB6A 4FOLA 4X1KB 3WGTA 5BSFA 1RWNA 1FXUA 1SVNA 1NVEA 3L3BA 3DCJA 4RORA 4DSNA 3ZDXB 4EYGA 1VG0B 3JZFA 2CDAA 3HGTA 4HS9A 1RWXA 5B36A 2RG7A 1DINA 2VJYA 3BMCB 1IN4A 3IYLW 2QDFA 3L7IA 4PYLA 5FV7A 4BFLA 1KOFA 1NVDA 1ZGJA 1NP7A 3VR4H 3CRNA 4Z4IA 3NHLA 1QU2A 5JD6A 1K86A 3A3PA 3TINA 3DE7X 3KV1A 1XD2A 4PZCA 3IAUA 4UE2A 3ZHTA 2ID4A 1SVOA 4H1HA 2JLWA 1IJEA 1F6WA 1U81A 1CUBA 4J1TC 1ZGGA 2EOAA 1GXSB 2OTCA 3HWSA 4QRDA 4LOLA 5LC1A 3KWFA 4D45A 2B1IA 4EWLA 3S8YA 1ZDVA 4G4SO 3AIKA 4QUJA 3FDFA 2OOKA 1BT0A 2WJJA 1GQ2A 2HRRA 4RVHA 4D7AA 4BEWA 2OJRA 1IJKA 4XZ4A 4BGDA 3IPRA 4F96A 4M9SA 4Z51A 2WP8J 3U3ZA 4DRYA 2ZJAA 1AHPA 2DBZA 2CV2A 1T1IA 1TK9A 2JT4B 3ADRA 3IBCA 2TYSB 4HQNA 4JP8A 4XJSA 4UU0A 4M1WA 4I50B 4PAGA 4TLDA 4FI3C 2B1JA 3LSTA 2XNJA 3KC2A 5BR1A 4W9LA 3W1SA 4RVFA 2Y0BA 4LOHA 3T5GA 2ODEA 5D5QA 3IQXA 3AQIA 4NFLA 3RVPA 4P33A 3SI7A 1U7DA 3BVZA 4C0QC 4CN9A 3IQEA 4UTNA 2HRZA 2RGBA 5A3RA 2VDRB 2EGGA 1JRPA 1MH1A 2HB6A 1JKIA 3BDIA 3JARA 2NZJA 3PHLA 3OA0A 4FWBA 1FXIA 3TB6A 4ETMA 2WZBA 2NZ8A 1MX3A 4BHTA 4HVLA 4L2YA 1FRZA 3I09A 2Z2YA 3HH8A 4N76A 1RWPA 2DT8A 4AWXA 4LOAA 2XDQB 1Z8HA 4AKEA 3D3QA 2C7GA 4LRXA 1XO3A 4MGKR 5F3DA 2GAOA 2IXAA 3D7LA 4OMFG 2ZYHA 3LBHA 5DM2A 3AVTA 2H29A 2X2FA 5KWIA 3QQPA 1LPMA 3O9VA 4QNNA 1KBZA 3WLAA 4Z99A 2ACZB 4G26A 1P9NA 3MD7A 5F7XA 1ZZEA 4FM9A 4OOFA 4WMLA 2F3UA 1E98A 3KWLA 4EMBA 1ZA1A 3ASVA 4AJYB 2B25A 2ZUSA 2XW6A 2FW1A 3CC8A 4K3VA 3G79A 1E6UA 1R4MA 2CD7A 3EOZA 4FFNA 1A5SB 4LRQA 1DEXA 2WLTA 1C4CA 3O13A 1WZ2A 1M2HA 3BGIA 3LMKA 1T1RA 1NKSA 4N8DA 1GL9B 3EGDA 5LBUA 4E5MA 2P2SA 1BSVA 2XA9A 2YWXA 5GMOA 1JG7A 3BF7A 3ZR9A 2WQYB 2RKWA 3EZNA 2B6NA 4XCXA 4BB6A 2FWJA 4EATA 7GPBA 5JAIA 5HTOA 3QU4A 3FY4A 3G5TA 3T41A 2XLBA 5EZYA 4RDCA 4E94A 2BEJA 3PY6A 2O3TA 2CHFA 2FE1A 3KU4A 2RHWA 1SUSA 1VLVA 3HHEA 3RI7C 1Z15A 5LNK6 3I01M 4BNIA 3PHXB 2BT4A 1UBEA 4V0RA 4EGSA 1WMEA 4R2LA 3ZV7A 4LECA 1NVWQ 1SKAA 5CDFA 1RYFA 3S68A 1VE9A 4JUIA 2V4LA 2FPOA 3LM8A 3SR3A 1NQ5A 1UF9A 5K0LA 1QQ6A 1F60A 1E66A 3ZLZA 3AJ8A 4TKMA 3EW7A 3S99A 2FHPA 4S05A 2B2NA 2HHCA 2P6MA 1MC5A 4EHJA 1U9ZA 2JGNA 3FHJA 4GCWA 5C31A 3V2UA 5CVCA 1ULTA 1YD7A 1KZ6A 1ORWA 1FY2A 3A9WA 2IWHA 2WSBA 2L18A 1N7JA 4QT0A 3GFFA 5EVCA 2KFKA 4DKJA 4X90A 3NHJA 4NPNA 2HJ8A 3PSEB 3REQB 1U3DA 1D9ZA 4WZBB 4FOOA 3MGAA 1NMQA 2KANA 1CQIB 1DRWA 2XQJA 2F55A 1TAQA 1C30A 2HF8A 4OA8A 4JP2A 3OFND 3ZD8A 2BB5A 5B4VA 4M60A 1R9NA 5C23A 3UOGA 2CMKA 4NSNA 1OXVA 3MOIA 1YZNA 1INLA 3L16A 1ORRA 4M1OA 1PW7A 2I22A 3T3MB 3ZU4A 3D3WB 1GPLA 3BXZA 2EJBA 4R9VA 2ECOA 5DEIA 4BP1A 4FXCA 1F0NA 2IDKA 3EK2A 4FFSA 1CUGA 1MHXA 3GOEA 3WA0A 1Z39A 3AUTA 3CF2A 3G5MA 4HY3A 4IHJA 4R81A 4EBBA 4DM4A 3MLEA 1UBJS 4TLAA 3UWDA 4TVOA 3WMWA 4CF4A 4QATA 2C0CA 1YN3A 3HKDB 1QOQB 3GP3A 3CWCA 1E4EA 1FL9A 1AXGA 2G70A 2GB4A 2NVOA 4IDHA 5FNVB 4BFXA 2QGFA 3CFYA 3URMA 3SRXA 2WINI 4L8FA 1NGSA 1R00A 3R7DA 3GRRA 4EYQA 1SE2A 1OBHA 4Z67A 1MW9X 2XDWA 3ML9A 1OLUB 1WX1A 4P92A 3C74A 2A5UA 1H23A 2RIRA 4G9EA 1OFGA 4UAUA 1CQWA 2JATA 1WXGA 5DGIA 4YMLA 4P0PB 1DAEA 1N6IA 2C4VA 3COZA 4RL2A 1F8UA 3M83A 3MLBA 3X1ZA 4CCAA 3WL6A 3JD0A 3GD5A 2CMHA 3S2GA 1PN3A 2D2IA 3H5OA 4CU2A 2OZLB 2VF8A 4KXLA 1FUKA 3K20A 4GLSC 2AJCA 4IDPA 3IBFA 4J3JA 4UPEA 2I2BA 3E9ZA 1HNWB 2NBUA 1T3HA 5A4KA 3LXXA 4TS3A 4DOMA 1NUHA 1WCIA 1E5WA 3VTKA 3IP6A 4N7RA 3SMQA 3C3AA 3C45A 1J2TA 2I2CA 2QT0A 3CE9A 4CRWB 4FGSA 4MS3A 3NH6A 4G8BA 4DDTA 3OJWA 1OFUA 4MW1A 5KJCA 1FYDA 2PYIA 3ZI7A 3FBGA 4X93A 5AWFC 4XRRA 4DQVA 4WKOA 3QE9Y 2OYSA 3I1YA 3G5LA 1TT5B 3B2GA 3DGFC 3LQ1A 2FCNA 3CUYA 2NS5A 3GRZA 1GTVA 2IY0B 4KPUB 4OP3A 3QLVC 3WHIA 1NNI1 1QG0A 3ZKJC 5GV8A 3LUDA 1GG9A 2QVXX 3ZVVA 1Z2NX 1Z0UA 2EVWX 2KMLA 3PHCA 1XXHB 5F1OA 3SZ3A 3TR0A 4BC0A 4E4RA 2E7YA 1KIAA 2APJA 2FPPA 2WNIA 4I50A 3VI4B 1V45E 1DLJA 3LP8A 1W581 5K99A 2DR3A 3HCBA 3LPDA 4FLFA 3UOWA 4BNDB 4KL8S 3KJQA 1MC8A 4GI1A 3ZZTA 3Q10A 3NVZA 2AV6A 4MJ7A 1L3CA 1CRQA 1HM5A 2CYAA 2F9MA 1V37A 2V5VA 2C31A 3BC1A 3JQEA 2H07A 1VLQA 1GRNA 4K3UA 4X20B 5G3YA 5HILA 4XQEA 4E1BA 1ZKPA 2XCQA 4MR7A 5AQEA 1UMCA 4FHJA 4R3WA 3W9YA 2ZCUA 2NP7A 1E9RA 2M1MA 4DQLA 2XMPA 3KYDB 1VJCA 3IXLA 1YQXA 4I66A 4JB0A 2XAUA 2XR1A 3B36A 4DZRA 4NOMA 3AEXA 3D3EA 2DB3A 1SEVA 2ILTA 3CY6A 4LJLA 3SZUA 3ZXXA 3MBKA 4C4VA 5K8TA 5T4HA 3FTEA 3J7AC 5JHGB 2CJYA 3C85A 1WXQA 3LDGA 4DHWA 4NYMQ 4OK3A 5D8DA 4YONB 4W9MC 5C1ZA 4IUMB 4G56A 4HK4A 4MS1A 1M54A 2J52A 4DPLA 1JWLA 4PZDA 4CL0A 2G6TA 1NYRA 5CBKA 3C3PA 1MV8A 2FWPA 4HZUB 1J4AA 2HSGA 3AJEA 4DIKA 1KO2A 3OVMA 3PXDA 3LYLA 2W00A 3PNOA 1RWWA 2HJ9A 2D5GA 3VAZA 4PO1A 1S2LA 4ZOLB 4U4LA 3A05A 3AMZA 1KO8A 3PFGA 2A0KA 5AKIA 5JBIA 3G82C 2VNSA 1FP7A 2CU3A 4MKFA 4QX6A 3O74A 2Z9DA 4C0BA 3GJSA 3LP5A 1IBCA 5DN9A 1YFZA 1GARA 2WV7A 5SY6A 3VH4A 4YHBA 3DQPA 4ARSA 1QAQA 3CJQA 3RWMB 3VR1A 4EDFA 3SS9X 4K0KB 2RSLA 3AVVA 2G1JA 1XN1A 1ZJ4A 2CG2A 2Q7DA 5A0VA 4N7JA 5FOTA 1D4BA 4BL5A 1L7VC 1UXGA 1D09A 4B4DA 2HTME 4OAQA 1L1EA 4FHDA 3EF0A 3QXGA 4PGHA 4IKOA 1WW2A 2MU1A 4EJSC 4EI8A 2V59A 2O8EB 1Z3CA 5KTPA 2NO1A 4FHCA 4LF5B 3EDMA 2JPDA 1BW9A 1T0HB 1I3LA 1TA0A 4NU5A 2ZQZA 1VE1A 1I35A 4PZEA 2LGJA 4YAOA 4IV0A 4O2AB 4F2GA 3FWZA 1NVBA 1A5TA 3LWZA 3GT4A 4BLRA 4FFDA 5CB4A 3W7AA 2FF5A 5BRJA 1G8SA 3ETLA 3G7NA 3OPQA 5EJ7A 1DEAA 2C92A 3WISA 4OK6A 2HIHA 2F43B 4MS4A 3EX7C 3U30A 4V03A 3CB2A 1PP4A 5NULA 3RVSA 1J23A 1VLHA 1E0KA 1GADO 4KXWA 2E1RA 2Y1CA 4N3AA 2ZIFA 3JVUA 3WL3A 4M21A 1EBUA 2RK6A 3WALA 3IIJA 3FAIA 3T06B 3RS8A 2J7PA 4CUKA 4DNFA 5JZVA 3PLRA 5AK5A 2O8DB 3A9JB 4KEQA 1C80A 2KLHA 4KNWA 4O4JF 4M2LA 4BQQA 1P7CA 5T4FA 3P9PA 2F00A 3G2JA 3EMDA 3LT1A 5A3VA 7ADHA 4Z2AA 5K0SA 2AEFA 5I51A 4DWVA 1N9KA 1RP1A 2RGYA 1YR1A 4FJ0A 4M36A 1Y3HA 3TAXA 4CMAA 4ZRIA 1BX0A 3R8BA 1OWLA 1VKOA 2WYUA 2M56B 4UBOA 4NMXB 3IELA 2WLSA 6GPBA 1E3MA 3KUKA 5IMBA 1D2MA 1PGOA 3FYSA 3TAUA 4P1CC 3WLSA 2C5LA 2AN5A 2IGDA 2P91A 4YACA 1A4XA 4CBVA 1NW3A 4IVPA 3A3YA 3V4LA 1ZL0A 3BSYA 1XKTA 3VO8A 4CM5A 3FNRA 2QVBA 2L2QA 4QELA 3G17A 5BWOA 4IXTA 2KJ6A 1DWPA 1U0NA 3D64A 4GIVA 3GWZA 3KXKA 2W82A 3EGOA 3A2NA 3OO1A 4BV2A 5JYBA 4MPRA 2SKEA 3RQSA 3CF4A 5TMPA 3U62A 3MAAC 3R6TA 4L0CA 5ITWA 4A8JC 4MRMA 1ZXHA 2ZLBA 1GU0A 5I7EA 1P4JA 2YVUA 3ZLJA 1XQXA 5TQ2A 4LOJA 4QGGA 1DJMA 1N7IA 3DZBA 1PSDA 1FXAA 3OF5A 2FZEA 2C2BA 5F78A 5FKJA 2HA7A 2KWUB 1TYDE 3OOHA 4QOEA 4DGQA 2KPOA 2ZRNA 3BY4B 3JWPA 5ALXA 3WO1A 4MUBA 4DUYB 5K4HA 2QRGA 1WVMA 2HXYA 3RFZB 1P6UA 2WPDA 3ETGA 2O06A 3L6RA 4QGFA 1GA1A 1DG1G 2B4TO 5J63A 4YRSA 3FCCA 1OTRB 2NOAA 2ZRPA 1NJSA 1GZVA 2X9QA 3Q87B 4M87A 3NIGB 4MVJA 4QOSA 5JEDA 4W5RA 1C5KA 4C20A 3PFCA 6LDHA 1U5BA 1WM3A 4KQMA 3V6LA 4G5QA 4M1MA 1HEUA 2BCGY 3KSDO 5BYKA 2EIXA 2QTRA 2R1TA 2QTVB 5DLEA 1K7YA 1Q95A 3GXOA 1DYQA 4YRGA 1N5LA 1FLNA 4K5QA 2OXEA 4F8CB 2GCOB 1M2XA 1VA5A 1PLJA 1X8LA 3SU8A 2I4LA 4MB0A 3PDIB 5T8KA 4MQLA 4DR7B 2Z09A 2EQ5A 2PQ6A 2DPGA 3GFBA 4RIGA 3FPBA 4MXDA 2G9NA 5JQGB 2QAGA 1T25A 4EUFA 4ZPJA 5A1JA 2C83A 5C1BA 3HDJA 5K6AA 4ANVA 3NWPA 4CI9A 2I3BA 3M70A 2ZATA 4RENA 3VUEA 1E3WA 4PGFA 2WQ6A 5KJEA 3O7WA 5LOVB 1OU0A 3NTVA 1XTUA 2NYAA 1RM5A 3PR2B 1TE2A 4G97A 1V8ZA 1Y63A 3IO3A 2DQYA 1X2EA 2NO9A 2HEGA 3VGPA 2D06A 4MI9A 3T7KA 2E4UA 3BJIC 2UUCB 4OIFA 3T0GA 1A95A 1N34B 1VRCA 3IT4B 2AEJA 4F6HA 1KO1A 4O4LB 1W29A 3MJ5A 2AFIE 4LMRA 1JHOA 3A4MA 2CHUA 2GOYA 3RRBA 3TOVA 4ARZA 1UK6A 3NBXX 1JDPA 1N9GA 1CVRA 3N05A 3D0RA 4WWPA 3AR5A 4ENQA 2W2QA 1M83A 3PLVA 1L5KA 3KWMA 4KZKA 4OHOA 4NICA 1FFYA 4RZ3A 4M8SA 5I4BA 3KLNA 1O96A 1E2HA 2R4TA 4MYTA 2YFYA 3M6AA 2F6RA 2YUIA 3G5AA 3IURA 4UBJA 2OHJA 1W0JD 3AONB 2VYVD 4YJHB 5L4LA 5FBQB 1VTKA 4I1SA 1AQ6A 4ZVSA 3DWMA 2PA3A 3WSWA 2KE5A 3HJGA 4WXPA 4Q4JB 2DHDA 4HDNB 3U4QA 2ZT6A 4UM8B 3STVA 3WGKA 1KJQA 3K5IA 5IXSA 1RZRD 2ICIA 3L7YA 4QLOA 4AAYA 2FY8A 4HFRA 1N5OX 3O21A 2BKLA 4DMMA 1ZD9A 2XF8A 4RLFA 1N25A 4BXOA 3ADDA 4MUXA 3E56A 1BXKA 5JAPA 3ETRA 3U0BA 2QN1A 1PO7A 5CHYA 4D80A 4HNUA 1FO4A 1TW2A 4RCOA 2QKYA 3U4MA 1LQUA 9MHTA 3FB4A 3R3SA 1OEYJ 3ZCTA 5AVOA 2ID8A 2YWFA 4ICVA 2O0HA 5ADHA 1HRKA 2GEFA 3HCNA 2CJNA 4RMHA 4BV3A 4LX0A 7MDHA 5JW6A 3MJHA 2FSVC 4EZJA 5JIBA 4N9F4 1UDBA 1DC6A 1DQZA 3DPIA 2WJZB 3OH8A 3V9PA 1P45A 1LFAA 1KO4A 5K0CA 2EYQA 2XTAA 4P80A 4UTXA 2AHRA 2VYCA 4B32A 4QJBA 3AR9A 4IPTA 3BD7A 3QPBA 3LK7A 2BP7B 5K0TA 2G1PA 3ONEA 1SJHD 5DYNA 4RF1A 3ZHBA 4MRRA 1VHWA 4ZEXA 1U1EA 3VUFA 4O8CA 2LVQA 3UH0A 3WRYA 4DWWA 4X64B 4JEMA 1PL7A 2IPXA 2GAFA 1M6VB 3O90A 3QK7A 4UNIA 4XWKA 5F7OA 3G8BA 1CUZA 1REQA 2NYUA 4A23A 4F2PA 5B64A 1PKXA 4J4BA 2J42A 5H3LA 1ZWLA 3ANSA 3USES 1C0LA 1RAXA 4C6RA 5A5DA 3Q8KA 2CLMB 1V7QA 1FIUA 4TV9A 3IKJA 3WZMA 5FBVB 3QHPA 4KQHA 2G09A 5H92C 1GKYA 2WDQB 2VAVA 3G2OA 4GXBA 1WKVA 1CNEA 1CQJA 3VJMA 3ZGOA 4ZDIA 5BVHA 5JDIA 4B8ZA 3DVLA 4GDFA 1GTMA 5B1EA 4XIJA 3RM3A 3FOWA 3W34A 1E0AA 4TMVA 4J90A 1VC2A 3UK6A 4WAFA 5IAOA 1FTSA 3KNSA 2XCUA 2XNCA 4ISCA 1ZNBA 1BE1A 5G1PA 4P9NA 4L02A 3ZWNA 2PUGA 1V16B 3NWOA 3K05A 4CKBB 5K6AC 1T0UA 3MJEA 2G4SA 2F1JA 2JIRA 1TGZB 3VTFA 3U1BA 3KLPX 5ACWA 3C0RB 3KPUA 3PF9A 4QFBA 3I4LA 4K6GA 1RM4A 1XNHA 4O2AF 1G7CA 2C2ZA 4L9AA 3HXOA 1P1JA 4IWPA 2YX1A 1CUCA 1MJNA 4KB5A 1G38A 2Z98A 1XGKA 4J3OD 3AVOA 1N6PA 2M4NA 4ZJPA 2QD5A 3GJ7A 1RFGE 3GJYA 3KOMA 1UPTA 5B30A 1AJEA 1L5SA 5K4AA 1EGQA 4E12A 4AWZA 3QKRB 1VE6A 5AI8A 4TT8A 3KB1A 5LPNA 1QQAA 3D5QA 3LLVA 3CPSA 3OLVA 4UCQA 5KQRA 4G09A 1PWYE 4NEQA 5TS3A 3D2BA 3UK1A 3PWKA 1KA9H 4PVDA 1XVVA 3BJEA 2FRDA 4W9IA 1RACA 2AXPA 1WB4A 2FN4A 4RIFA 2XD4A 1XYGA 3TEXA 1LQBA 2JFQA 2X23A 1TCCA 4XGQA 5CJPA 4G5YA 4ZPXA 3F7NA 2GTHA 2F1HA 2HUNA 4OV6B 3ZGVA 3P7MA 4BAZA 4CLDA 1V8OA 5HX7A 3O8QB 1W4CA 2KLCA 1RZRA 3S1SA 3OLCX 4LYEA 3HFJA 3PDJA 2YWJA 3ON5A 4X85A 1TT7A 5G40A 1NQOA 3I62A 3UMFA 1ATZA 1C14A 1B4DA 3E9QA 4R1QA 3NDRA 4YCAA 5KHAA 1GEEA 4P98A 3SJUA 2CJOA 1B15A 1BA3A 3SSAA 3VZSA 3P2BA 3H19A 1FPYA 2FAXA 3CPEA 4FXPA 3WWDA 2D1TA 4YSKA 3WL5A 5IABA 4S2EA 3AJRA 5LU8A 4S04A 3N2GB 3MT7A 5FPYA 3T52A 4ZCPA 4D9EA 5KOHB 2GPTA 1QLJA 1XZDA 1Z4KA 2I80A 1F0YA 1JJIA 1P33A 2I2DA 1AOXA 4PLWA 3SQLA 4B2YA 2G9ZA 4NCXA 4RIEA 2P3SA 2XKJE 2PX8A 3QY9A 1H1LB 1KVTA 2A67A 4YUWA 5EJ8A 3QEKA 3C24A 1Z0JA 4KAFA 4DA6A 1VMEA 1ZMOA 3IOFA 3FVTA 2VXCA 1DCMA 4MYSA 2A57A 2DEUA 1VRWA 2OO5C 3WADA 1F2RC 1CC1S 4BMCA 2C29D 4DUZB 3PTFC 3WX0A 1TZ2A 1Y3AA 3HYNA 3IDQA 4ZVNA 5FV4A 1KYZA 2L7RA 3GJRA 3GL9A 4G37A 4KKXB 4MP3A 1SBHA 2PK3A 4XW2A 1XRJA 3Q14C 1D2HA 1YHZA 5FR1A 3WA6A 4D96A 4US0R 3TCKA 3W6UA 4AY2A 2MOKA 5ALIA 5I7HA 3TGLA 2WTEA 1E3IA 2AWOA 5K3AA 2DC1A 4BE7B 4DJEC 1LF5A 5JXIA 5LXTB 1E3LA 1CJSA 4EVRA 4I9UA 1M1YE 5HFYA 3P2MA 1MX1A 1GGJA 4AF8A 1T24A 3TPCA 1TQ2A 3RU3A 7REQA 3WYEA 4RU1A 1LPPA 3UJDA 1G9SA 3H1GA 4HDRA 1E9FA 4AN4A 2JFYA 1NNEA 3PGJA 1BG6A 3KAPA 1VCHA 2W2KB 2WNSA 3ZY4A 1D2AA 3DOWA 4B6JA 2AKEA 1II0A 3GA7A 1UBMS 1V86A 1UBRS 2O1SA 3K0FB 2H7XA 5EESA 3RE1A 1QZXA 2QOEA 1PIWA 3T9EA 5FBRB 3PCXA 2KM1A 2CK3D 4LNOA 2XMRA 1DRVA 2JLQA 2WJWA 1CR2A 3AWDA 3H11B 3ESAA 1ABBA 2MINA 3BGDA 1WF3A 3FCYA 3ZZ1A 1VSTA 5LVAA 1DKOA 1KGSA 2UYQA 3K6KA 4IIJA 4DQ0A 1W96A 4OAOA 1E1DA 4MMXB 4F5YA 4G25A 2VK8A 4JB8A 1AZWA 3V1YA 4PZPA 1BX3A 4JSRA 5HKHA 1QHGA 2G17A 4JVLA 1HDOA 4OATA 4R9SA 1S9HA 2XEWA 1UC4B 3NT4A 3ZVKA 2F4NA 2NNWB 2QW1A 4A92A 3BIJA 3V32A 3GQVA 2FW9A 2VQEB 4J0IA 3I2JA 4U3JA 2OHGA 3TW6A 3K2EA 3WRWA 3QU9A 2OC9A 1OGYA 1G8MA 1F1JA 2DBVO 2ZPAA 5A2QA 2CGEA 1JX6A 2PRYA 2YWEA 3A27A 4DC9A 1NBWB 1A3CA 2R1VA 3AI5A 2Y1WA 5BSVA 2CMFA 4E30A 1WYGA 5H8YE 2J3LA 4PHTA 2GJAA 2BR3A 3V2HA 4N03A 1KE1A 1XD3B 3I9V1 1UJ6A 2AN4A 4O4JA 3ZWPA 2P67A 5EE1A 5AMXA 2Z6VA 5FWNA 1P74A 2XF2A 1CULC 1IYFA 2JJ1A 4YO7A 3FNQA 5AM2A 2GXQA 2ONQA 3PNQA 5K4NA 1MB0A 3G68A 3RKSA 3RUHA 1HRDA 4WD3A 5A4FS 5ESWA 4AMBA 1RBZA 1H1DA 2FFRA 1NBEA 2C9CA 3LLCA 5G5HA 3VNQA 4MNTA 2UXCB 2RGRA 5KTMA 6AT1A 1E2FA 4JLAA 3WB2A 4LJPB 4XSGA 4HAZA 3CSTA 1AF4A 1V11A 5B53A 2D6FA 2WXHA 2FQWA 3ZWXA 2W90A 1L5LA 3TZLA 5BNWA 3KKQA 3U31A 4LC0A 3PLUA 2ODWA 2Y66A 1UFVA 3FBTA 2KVZA 4N9QA 5J2UB 4BFVA 1DIHA 1EDBA 4JWUC 1UZMA 1BDMA 2PUWA 3H99A 2ORIA 3TUZC 1FE8A 5EMLA 1X15A 2XECA 3KEFA 4AKHA 1XCJA 2BSAA 3LAWA 3LL4A 2WOJA 2JYEA 1L5MA 3TIXA 2VQ6A 3GRFA 2ZDGA 1HGXA 1ZUIA 3HSYA 4LW8A 4ZYVA 5L7WA 3DHCA 1K27A 3E27A 3HN6A 4UDOA 3TDKA 1EHYA 1WOYA 1Z29A 1V7ZA 3IUMA 3R5HA 1Q0WB 1XXLA 3WFIA 4JO0A 2VNIA 1IM2A 2VDJA 2CHVA 1MLDA 4GVPA 2B92A 2VZKD 2G88A 2ZR7A 2QX9A 3NQ41 1CQXA 2E4VA 1JTFA 4LJYA 2GOWA 1E7UA 3ZIMA 2YFQA 3MMNA 3VYTB 5A9SB 2JIOA 2BC9A 2WA2A 3L4JA 2WJHA 4CEIA 2WG2A 4BQOA 5KJ6A 1Q5WB 1NMYA 4WL0A 4B0OA 3UM9A 5AW3A 1Z9BA 3ETEA 4IAOA 4QBKA 3PZ7A 3ZGLA 4Q4HA 3EEOA 3P9NA 4NZLB 2R8ZA 3C87A 3D1LA 5AZGA 1H69A 4R31A 2V58A 3GRCA 4R68A 5LM6A 5LA6F 2PE9A 3OZAA 3KPJA 1I80A 3FILB 2QLFA 3I42A 1G41A 1LLQA 1RS0A 1XPJA 2Q1XA 1XROA 2YVAA 3CRMA 3MXTA 2C97A 4M9CA 5EY5B 4D2IA 1O6FA 1JJAA 1E1QD 4YHHB 5F52A 3ZJ4A 3QFCA 2RHJA 1W73A 1W25A 2HR1A 3KR0A 2ZETA 2JEZA 3THYB 4TYYA 2IO1B 4C5BA 1OBVA 5D2MB 2Y87A 1CT9A 2OBBA 3ZNPA 4FLHA 3C3WA 2CDCA 1ZITA 4IDDA 3EQ7A 1OILA 2L76A 3I64A 4ZAGA 3THXA 4F5EA 5LQAA 2PD4A 2GF2A 2QMUA 3AXSA 4JL6A 3EFHA 3KKZA 2BTEA 1KJJA 4LCJA 3I8OA 3W8FA 5KNCD 3G9UA 1NBMD 4N49A 1Y1PA 4N12A 5ALMA 3VR4D 3OCVA 2G71A 3FLEA 1GGFA 4EZBA 2P18A 1XWWA 1GHTA 2I87A 3ZE7A 1ZIXA 3ONWA 1REQB 2Z6UA 4O1NA 4BLWA 1WY5A 2B0JA 2CXHA 4U7TB 4JVSB 1I14A 5HYVA 2W6MA 1KS2A 2JI4A 4J03A 4RK6A 1TCBA 4A90A 1XAGA 2RH5A 3QVOA 4G5RA 4INOA 4Q6BA 3AF2A 4M0EA 2B0CA 3LX5A 3TSZA 3M33A 4LJAA 4DQDA 4ENUA 2ZNVC 1RC8A 1AS3A 3UY4A 2FTKE 3A0UA 2EKDA 3VZCA 1ZD2P 3OZBA 1E2DA 2OCIA 1UM9A 4FGZA 1LDMA 1YZYA 3V1NA 1EDOA 4PDXA 1CQZA 3IBSA 5HUHA 1JU9A 3LFTA 3O75A 4ZHQB 3COYA 3RTGA 1A9SA 1G2QA 3RUCA 2I8AA 1NQTA 1WUHS 1WUOA 3GN2A 4CMJA 1GPMA 4XDHA 4CTNA 1EAMA 1QF7A 3LU1A 4CKWA 1IEWA 2ODNA 4S1TA 3H65A 4BKGA 5I9TA 2O2GA 2P3QA 1I7HA 4CO7A 3W2DA 3N2GA 3GJ5A 4JQSA 4KU4A 1XRSB 3EVCA 4YIKA 2ZT8A 4H0DA 2FSVA 3LKZA 3VR2A 1OYVA 1R8SA 3LL7A 5JSZB 2P9HA 1DOAA 1KQ3A 4XGRA 1T3SA 5EXDA 1CDOA 4MUAA 2G07A 3H3EA 2WF8A 1U4AA 2KXJA 4H7PA 5TS2A 5JH7A 4F3CA 1B6GA 3DFFA 4DCJA 3U7FB 2QCZA 3UB3A 2NADA 2EELA 5LUBA 4Y2GA 3F90A 3LUBA 3T0IA 1L0XB 5KINB 3E84A 4P32A 1LH0A 3GJ0A 3DDNA 4WJLA 1T5IA 2EX1A 3N74A 3BPSA 3WQRA 1XKQA 2ZBGA 1D03A 3FSGD 4ZO9A 5HHDG 3EDRA 5EUQB 4ZCSA 4ZZ2A 4CDMA 3N7TA 1KRWA 1LDNA 3OUUA 5F2OA 2UWQA 1GXSA 1DKMA 4NONA 3S2ZA 1SY7A 5JH5C 2PMCA 4DLXA 5I4DA 4F5DA 1L6RA 3WJAA 3ZDZB 4FW9A 3ZWVA 2FQ1A 1Y42X 3JALA 5DNUA 5JRJA 3PRZA 3TZKA 1HSOA 3AYXB 4X7PA 3VDRA 3IVFA 1PE0A 2C04A 2EKQA 4Z0HO 4AZSA 5KOHA 2JHCA 1TVEA 3R75A 5IZCC 1BFUA 1J7JA 1F2UB 1MEOA 1WMSA 3GH1A 2IDMA 3L5KA 4NZNA 4A36A 2Y2VA 3COSA 4TV9B 2LZ6A 4JHXA 2XA1A 4L74A 3LW7A 4QE3A 1P2GA 4ENTA 2VUTA 3PUXA 4HWKA 5TRTA 1FYXA 3K6SB 2O2XA 3HCCA 3ZV3A 4LDTB 1NJ8A 1P2DA 2NSYA 2QW8A 4BX2A 4ZZIA 4EYBA 4B3FX 1OY1A 2B1RA 3UAWA 4AG5A 3F5QA 2KACA 4LNFA 3TLXA 1VJGA 1EU3A 2WEKA 2XPCA 3BGWA 5EWMB 2J4FA 5HP4A 3V8BA 3ZXUB 4BTEA 1SCUA 3O31A 5KU7A 4I4TB 1PSZA 4KXUA 2JJ1D 1SIOA 2ASEA 4B6PA 1CVLA 5JWOA 1VQ1A 4XIIA 3T5BA 4WQOB 3RUPA 3AU4A 4FFVA 3FVVA 4AUKA 2L42A 3L01A 1NP6A 2INDC 2XTJA 3B2QA 1JLRA 4FIZA 2H5JA 1MZPA 4FZJA 1HMYA 1KRHA 2RHBA 5DPSA 2G76A 1J07A 4EYFA 1ODFA 4K6KA 2FN9A 1GQYA 2WKSA 2DKFA 3P9ZA 4DHZB 4FSDA 4M9XA 2QR3A 4WWHA 4EPTA 1QK5A 5IAGA 2MSCB 3LD9A 4RJKA 2XHEA 4OGWA 1I2MA 3PSAA 4L8LA 4RV9A 1QIGA 1A71A 2ZBRA 2KTRA 1WUJS 3DDWA 1LQTA 3CKKA 5CH3A 3HXMA 3U48A 1GC7A 2FFAA 2VJCA 2CNLA 1RKXA 1FNCA 1X80A 2ZR9A 4L76A 2YWGA 3DM5A 3OPNA 4G0XA 1ENZA 2JIZA 3CX8A 3ZGNA 4C4XA 3BAZA 5G55A 3PRPB 4AT1A 1RFKA 2LVOA 3K8ZA 1UM8A 3MJFA 4QDKA 4TQAA 1EBBA 3ENWA 1P2VA 1MABA 3PG4A 2GNOA 4R1NA 1I4HA 3MAGA 4B71A 4GU2A 1E1YA 5AHOA 3GG9A 4C76A 1AKNA 1C7QA 1KVRA 1ORHA 2QRJA 1RYZA 2HA3A 2FYTA 3IR5A 4IIFA 4YJ3F 1JLMA 4F6RB 1FBTA 1XP5A 4FTWA 3P4PB 2FETA 4CIDA 3LB8C 3F2IA 3H9UA 5ALQA 3GLFA 3DBSA 4Q2JA 3MWEB 1NSYA 2FW8A 4BRWA 3NYIA 2E4ZA 1WGKA 4WIAA 1KDTA 3AE9B 4H18A 2LXAA 3QX1A 1XQ9A 4JLDA 3X30A 2ZTMA 4NZPA 3NHFA 1T2CA 3N2LA 4UMEA 2IOFK 4A2CA 4BTVA 3WIDA 1SD2A 3N2YA 3RABA 4AVYA 2HD4A 1MENA 5I3ZA 5IJWA 3NV7A 3RSOA 4DMFA 4YMTA 3HFSA 3UI3A 1NXOA 1Z8FA 2CL5A 3R8FA 2GVDC 3A4NA 5D3QA 4EM6A 1OIXA 3KB8A 1V4VA 4HRXA 4G9GA 1LSUA 2QLBA 3G9ZA 4IFIA 3NXSA 1DIAA 4KIGA 1M0EA 1QM5A 1EZ4A 3EA4A 5DBIA 4R5MA 5GMVA 1K6EA 5HF5A 5JS8A 3V4RA 3N1YC 1ISMA 3OA2A 2BFEA 3L07A 5EZ5A 2MYPA 1Q1AA 1EFDN 1QRAA 3AEUB 5K8VA 1GEGA 2WHEA 3EHDA 1FTWA 3F6CA 5E6PA 2K6QA 4EE2A 2VTEA 2WFZA 2C5AA 2YVKA 3EQ6A 3G0GA 2CUTA 5JAQA 3PVLA 2WU8A 3V8VA 3PUHA 4XDDA 3I76A 1Q91A 1M7HA 3NH9A 1UMBA 2UKDA 2GBCA 5FHQA 3WB1A 3I2GA 4GQAA 4BN0A 2V1UA 2P8JA 2WFMA 3PKIA 3R6DA 4W7IA 4C21A 2Q3BA 1W0KA 1FVOA 1G5FA 1P9WA 3JQDA 3LS2A 4MS1B 3B3GA 4EFMA 5ESDA 1RAFA 3HK0A 1JPUA 3L8EA 1KJWA 4OU5A 5L7TA 2G45B 4ARUA 4LMAA 5BN5B 1CJBA 1SO8A 1A7TA 2E89A 4U7HA 5AIAA 4II3B 2FUG6 4K28A 5AT1A 3R8XA 1ULUA 5JCZA 2IW3A 2AQ2B 4RD1A 1ESEA 3KYDA 4Y6RA 5FO0A 2FU6A 2B4KA 2R6CA 4QVKA 1EM7A 1NXPA 2PWYA 5GVRA 1JDVA 3LW8A 3NT5A 5D7BA 1B6SA 1I4XA 3NBYC 1IZ7A 1HE2A 2I6SA 4WN9A 4OZAA 1EINA 1M73E 1U2PA 2D2XA 2DTEA 1EU4A 2JVJA 4YJFA 4ZI5A 3THXB 3OM1A 4R83A 2E7ZA 1IYZA 3S40A 1VP3A 2WIAA 5C52B 2H8KA 4B95A 1ESNA 1ISNA 5AKJA 3WP1B 4QGAA 3IR7A 3SM9A 5CDSA 2OZKA 1P5RA 3DZCA 2XMGA 3L82B 4MQ5A 5BW5A 2YZ3A 5CFMA 1YRAA 2YYZA 3ETNA 2GFJA 3ME5A 4FOPA 1OQQA 4MEAA 2GCGA 3O4IA 3IT0A 4CLRA 1IOZA 1TUEA 3HJUA 4E21A 3T9FA 2OLJA 2QYHA 2VJPA 1O0CA 4KRYA 5DOZA 3SYTA 4C1EA 1WZUA 4JB2A 1YONA 2HJ1A 3ZCSA 3HCPA 4OXIA 4BNNA 3PDHA 4OCZA 5JVDB 4WBNB 1G5QA 3LIIA 5AVQA 1ZCJA 3L0ZA 5DHQA 4PYQA 4A8HA 4UOZA 4IRMA 1EFAA 1LTHR 2OKGA 2WU2B 2R4QA 3ZBPA 1PSWA 2JWZA 1H9BA 3AR6A 1ZRHA 4HDQB 4MGZE 2LGIA 4IMRA 4MV8A 2QZZA 2I6XA 4L5AA 1E2MA 2YNVB 2ZJ8A 1XA0A 2AYYA 3C4JA 2OGTA 4K81A 2UVPB 4OFZA 3ZWMA 2GO7A 2PV0A 4LJ5A 4AMZA 5B6JA 1PGQA 2OV6A 2PXAA 3ZNBA 1P17A 2LE0A 2IF2A 2UU9B 3KM0A 4AP5A 3HU2A 2R96A 3RARA 2WTAA 3B52X 3HO6A 2MSKA 4HTFB 4JT2A 2VDPB 4P4SB 2WV9A 3NZ3A 3ROGA 4BLVA 1NI4A 2I54A 3UQBA 5REQA 3TCNA 4B6QA 1S4MA 4RADA 3NRZA 1WFYA 2WQZA 1FNWA 2EDCA 4UHDA 3J9CA 2CB9A 2ZTSA 3ZZNA 4MM3A 1UBKS 2GJ8A 5ADWA 4RMNA 3BAFA 2CNNA 5DT2A 1Y33E 1SXJE 3O91A 5K3FA 4B7XA 2WWGA 2EG9A 3SW3A 3CZ5A 4PSVA 4BZQA 4AJ2A 2HDNB 5IUJC 1ML4A 4ML3A 3OJLA 1WR6E 2PMVA 1JQAA 1MQ8B 5K3OA 4EB3A 2QMZA 4TMTA 4NCHA 1HR0B 2AGVA 2JHGA 1F8FA 4W9DA 1UDAA 3O3CA 3LCCA 5CGZA 1LQ2A 4MT5A 1BJTA 4FYPA 4EPYA 5C1OA 1TEZA 4EENA 1A2QA 4D6PA 4ZYXA 4D1TA 2ZWPA 1KSGA 2HLHA 3BIID 4B40A 5AM5A 5BYSA 1ML3A 1RHKA 2W6PA 4N54A 5BR7A 1B8NA 2VHJA 3NPAA 4F8YA 4QBFA 3MHZA 2BF8B 4HKYA 1EK5A 3L7MA 3KDPA 2C84A 4L07A 4EZKA 1OROA 4MV7A 4PO3X 2O14A 4ZEOA 2CW5A 3CW2A 4OX9Y 4E5DA 4PSAA 1FLVA 5IAJA 3ROEA 3WLNA 3WSVA 1ENFA 3ZWKA 4AWYB 5KSZA 1BYUA 2C00A 2JZOA 1FQJA 1GDTA 5DP1A 2ANBA 3Q4GA 3HVUA 4J2HA 3B3QA 4M37A 1GSOA 1K98A 3E3AA 5K4MA 3AC0A 3KQMA 1KHTA 4I3GA 3ORFA 1BKSB 1SXJB 4EFKA 4G41A 3KVVA 1E1KA 2B82A 2HO5A 3LYHA 3O7MA 2VSNA 4DE5A 2EP8A 3EJ6A 5LQCA 1ZW6A 2E3TA 2EL9A 5LQMA 1Q0TA 4NG5A 3KSBC 1EXNA 1AURA 1Y5RA 4R9RA 1LI7A 2W6OA 5C7IO 2W42A 1G5PA 1HDZA 1QXSA 3RDPA 3GE3C 1FSGA 2C5GA 3C0KA 4L85A 4MPDA 4QBTA 2DJIA 1KBOA 4I14A 4BLUA 2DPHA 1UFKA 2CFUA 3PEYA 3WYDA 4WD6A 3EXEB 1GFWA 1L8QA 2I33A 2JGAA 3ZE9A 2FN3A 1YDGA 5JNWA 4KZPA 2OGZA 4MZXA 5DLYA 5TV2A 5KDOA 1LBIA 3M34A 3VU1A 2FG5A 3LA8A 3V7YA 4L72A 5BSGA 4A15A 1MO2A