3T3NA

Molecular basis for the recognition and cleavage of rna (uuccgu) by the bifunctional 5'-3' exo/endoribonuclease rnase j
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
550
structure length
550
Chain Sequence
b'GPQDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGAEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Metal dependent hydrolase
publication title Molecular Basis for the Recognition and Cleavage of RNA by the Bifunctional 5'-3' Exo/Endoribonuclease RNase J.
pubmed doi rcsb
source organism Thermus thermophilus hb27
molecule tags Hydrolase/rna
total genus 160
structure length 550
sequence length 550
ec nomenclature ec 3.-.-.-:
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3t3nA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 3t3nA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3t3nA01
3BC2A 4NQ6A 2ZNBA 1JJTA 2YNWA 5AXRA 4C1HA 3SFPA 2ZO4A 2P1EA 3ZNBA 3TP9A 2WHGA 3G1PA 2FM6A 3FAIA 4XWWA 2A7MA 5EWAA 1ZTCA 4C1EA 4KEPA 4V0HA 2NZFA 1A8TA 2H6AA 2QDSA 3PY5A 2WYMC 5LCHA 4NQ4A 4JO0A 4EYFA 5B1UA 4AWZA 4CHLA 2AZ4A 2FU7A 3BK1A 2XR1A 3X2XA 4FR7A 4TZBA 3WXCA 2CBNA 4ZO3A 1VMEA 5K4MA 4PVOA 3Q6VA 4AX1B 2GKLA 4RL2A 4EXSA 4Z5ZA 4NQ5A 1YCHA 4UBQA 5ACXA 3IOGA 5EV6A 5EVDA 2OHHA 3IOFA 4GYUA 1HLKA 1SMLA 4RAWA 5AHOA 4D1WA 3VQZA 4NQ2A 1DDKA 4AX0B 3I13A 2I7XA 5LS3A 2Q42A 4YSBA 5B15A 3KL7A 5K4NA 1X8IA 4D1VA 5ACQA 5AYAA 3ZR9A 2BC2A 1VGNA 1BMCA 1WUOA 3R2UA 4TZEA 4D1UA 2AIOA 2VW8A 3T3NA 5LCAA 3T9MA 5HIPA 5HIQA 2YNTB 2Y8AA 3PY6A 1YCFA 3SRXA 3SW3A 3DHCA 4YSKA 3AF5A 3AF6A 4GCWA 3KNRA 3IELA 4RL0A 2NYPA 5ACSA 2BG6A 3A4YA 3ZQ4A 4AD9A 2BGAA 3IDZA 4KEQA 1ZNBA 3ESHA 4RM5A 2I7TA 5IQKA 4WD6A 3IE1A 1MQOA 1X8GA 2YNVB 3X2ZA 4TZFA 3QH8A 5EVBA 1M2XA 3I0VA 2XF4A 3DHBA 2YNTA 2QDTA 5A0VA 2P4ZA 5DPXA 4FEKA 4AWYB 3SBLA 1VJNA 1YCGA 4FSBA 4UA4A 2BFLA 4UAMA 2BG8A 2Q0IA 1BVTA 5HIOA 4GYQA 4BP0A 5KILA 3SPUA 5A87A 5HH6A 5ACRA 3LVZA 5EVKA 5LM6A 1Y44A 3AJ3A 5KIKA 4XUKA 4EXYA 1KO2A 2GMNA 2YNVA 5EH9A 2Y87A 5ACPA 4Z5YA 4TYFA 3I15A 3S0ZA 2BIBA 4H0DA 4C1FA 2FK6A 4J5HA 4RBSA 1WW1A 3IEKA 4C1GA 4F6HA 2GFJA 4D02A 1P9EA 2WYLA 2GFKA 1DD6A 1XM8A 2E7YA 3L6NA 2OHIA 3MD7A 3RKKA 4U4LA 2HB9A 5LE1A 5FQCA 5EW0A 2WYMA 2BR6A 4F6ZA 3X30A 1X8HA 4EY2A 3VPEA 2YCBA 1XTOA 3IEMA 5AXOA 5AEBA 3RKJA 1QH5A 3KNSA 2YZ3A 4J5FA 2BG8B 4D1TA 1K07A 2I7VA 2P97A 5ACTA 2YNUA 2M5CA 4EYBA 5ACUA 4ZEJA 5A0TA 4PVTA 2QINA 3ZWFA 3I14A 4Z67A 2FU6A 2ZWRA 2FU9A 4Z7RA 4C1CA 4UWSB 2WRSA 3SD9A 5K0WA 1KO3A 2BMIA 2FU8A 2QEDA 1JJEA 5ACWA 4EFZA 5LLDA 3BV6A 5HISA 3BK2A 1JT1A 2P18A 5FQAA 5EV8A 2NXAA 4HKYA 4RAMA 3X2YA 4DILA 3DHAA 4UWPB 3T3OA 1A7TA 5LMCA 4ZO2A 3H3EA 3RPCA 4TYTA 3JXPA 2R2DA 2DOOA 4O98A 1KR3A 2NZEA 2GCUA 2FHXB 2OHJA 2BG7A 4EYLA 4BZ3A 2Q0JA 5LCFA 5LSCA 5HH4A 2BFZB 2Q9UA 5AHRA 3FCZA 4UWOB 1ZKPA 1E5DA 2ZZIA 2M5DA 5B3RA 4C09A 2BTNA 3PG4A 5FQBA 3IE0A 4LE6A 4P62A 4TZ9A 4Z6XA 5HH5A 3DH8A 2Y8BA 4UWRB 5A5ZA 2DKFA 2UYXA 5ACVA 5EHTA 4DIKA 2BFKA 4YSLA 3P2UA 4B87A 3I11A 3IE2A 3F9OA 2BG2A 3ADRA 4XWTA 4ZNBA 2FHXA 5K4KA 4C1DA 1QH3A 2QJSA 1L9YA 1WUPA 2BFZA 1WRAA 4HL1A 4HL2A 1DXKA 1BC2A 4Z60A
chains in the Genus database with same CATH superfamily
1JJTA 3NIBA 3SFPA 2RAVA 4PPGA 1XB2A 1GZ3A 4QGSA 1U31A 2ZW9A 2PEYA 1C3EA 3SZOA 2IP1A 4KVGB 2HADA 1OI4A 1RI4A 3QVMA 2C9OA 2EBWA 2VP5A 3ICPA 4NYIR 2GD6A 3X2XA 4UMFA 3MWLA 1JX6A 1UPUA 4BMCA 4MVCA 2H1FA 4D4JA 3SM3A 1TM2A 1LDMA 4LNUA 3TEJA 5EVDA 2QT0A 1WPQA 4OCZA 4EATA 2ZE8A 5M7EA 5KMGB 4JY7A 2RC5A 3FILB 3VVBA 3HHPA 5AT1A 3W5AA 1OASA 4TLBA 1VSBA 4JVNA 2VXOA 3ADBA 1QILA 2PZJA 4E03A 3J7TA 3MJTA 5DSZA 1GILA 1DMSA 1HNNA 2JLSA 4R2IA 3MUFA 4ENSA 4NU0A 2CFRA 1DJPA 4QDUA 3LP5A 4RY9A 4CTNA 2JRLA 2IUTA 1MN6A 1Q1GA 3R76A 1N7HA 3DDNA 1P81A 4DR7B 3SXUB 1A1SA 4BFUA 4WASA 4J76A 5EE9A 1C8LA 1UGJA 1X9HA 4Z86A 3ANSA 5B2EA 4AD9A 3NOXA 1SAYA 1N5LA 1FRFS 1NNLA 2L7RA 4GVLA 3SWWA 5DCNA 3DV0A 1NVBA 3WHKA 2C9YA 3O6VA 1Z0DA 2X0NA 3PQ3A 3UOAB 5JSYA 3NBUA 1D5CA 3C6YA 2FUEA 5EZYA 3JQEA 2HJ1A 4X1YA 4X6XA 4WAAA 2WP8J 1RRFA 4DCVA 4EPVA 4GKJB 3OM1A 2XCRB 3W5VB 5AJXA 4A8PA 3QWZB 3KQNA 4F5ZA 1E99A 4B84A 3NBYC 5ALFA 3QY9A 3RVNA 1K0FA 2XRZA 2ZT7A 3CLRC 2WNMA 1RYFA 3NMUF 4J94A 1O97C 1M8PA 5GV8A 1BXGA 2Q46A 2BP7B 4C1GA 4JU9A 3VR0A 1J7BA 1QKIA 2CFSA 1HLFA 4A6EA 5CTRC 4O5AA 2XSZD 2ZZNA 4QJ5A 5HXAA 3P0RA 1N61A 4ND4A 4EO7A 2B82A 3L13A 1XU7A 3C41J 3QXGA 1FFUA 3AR7A 3G5LA 1JA0A 2XRMA 4GECA 3EBPA 5KHAA 1X0XA 4MQUA 3DZDA 1VA5A 1XF5L 3C7TA 13PKA 4Q12A 2VNJA 1IRXA 1K4KA 3N8IA 2GZAA 3I14A 5A3JA 1G8KA 1JBKA 1NFRA 3PGKA 3N8GA 2OAEA 8MHTA 3HYRA 5L3SB 4FTWA 1SJED 5C8VA 4RSRA 4RK1A 3GDWA 2J48A 3BZUA 4URHA 2QW0X 5THKA 3TBKA 1BHSA 3HVIA 1ZY2A 4OMCA 1Q7GA 2IZ7A 2FI1A 3A3PA 3ASZA 3D6AA 4PM4A 3UAVA 3L7MA 4BNTA 1QU2A 2NT4A 3SK0A 1GP2A 4X00A 1E7WA 4DA9A 2O2XA 2BG7A 3JQ7A 2YWHA 1PKEA 4G9BA 1OILA 5LZ8A 2LZ6A 3SD5A 2MBHA 1I35A 4B44A 1N36B 2XBMA 1E3JA 4R2JA 3HUUA 2YWBA 1GV0A 2Z2KA 4FN4A 3X1MA 1S7GA 1RXIA 1SVLA 2DLBA 3NHRA 4OHVA 2PGLA 1V5IA 4F4DA 3OEWA 4R3WA 4JSRA 1MVOA 3HPRA 3ICEA 2MOKA 4DZTA 2RGEA 1E9FA 3VNRA 3D4IA 5EFOA 3S2YA 2RIPA 1RYHA 4DNOA 1KETA 2YICA 5F73A 1QGED 3HGMA 2HQSA 1UFRA 4CV1A 1KDPA 4DSTA 2WHGA 1AK9A 4PHCA 5LXHA 1ST2A 5CK5A 4LNUB 1ET6A 4ZZ1A 1WSAA 2G17A 4V0HA 1G21B 3UUEA 3MXOA 3HA5A 2EFYA 2WDZA 3AE8B 3D4PA 5ALIA 3IDOA 4OBEA 4E70A 2I3DA 1FO4A 2MJDA 3ZO5B 5C5DA 2B61A 2XR1A 2DY1A 5JISA 3E8XA 1JHMA 4F4FA 4HG2A 3HXPA 4AO6A 3B6ZA 1NX9A 3BE5A 2IELA 1LNQA 3Q6VA 1DOHA 4TTSA 4U8HA 3BGOS 1G3RA 1DAFA 3NUZA 3QUBA 1PDVA 3IJPA 3GRUA 1NP3A 1HYBA 1KH0A 4YONB 1SU8A 1EP3B 4I08A 1PJ8A 2CMFA 3JARA 5E8RA 1CUYA 4HNTA 4KSBA 3PDJA 4FB4A 1PSZA 2XAUA 3ZCQA 4X8LA 3QVJA 4QX6A 4GLJA 4BNWA 1X8IA 1KVTA 3CW8X 3DV0B 2L05A 1MC1A 1EZZA 4ZGGA 3HMKA 2K6GA 1SCIA 8GPBA 2EZ4A 2AFIA 2A0WA 1XJ5A 3FLAA 3R75A 4QYXA 2CFIA 5HCIA 5EZYB 4X1YB 1KYZA 2XXJA 4BFZA 3WYDA 1W85A 1HWYA 1I3LA 3AVYA 1Y3HA 2Q3HA 1MX3A 2C07A 4ZEMA 4EB6A 1EUVB 2E21A 4PQEA 2YYYA 2QUJA 1KI3A 3NHWA 1GLNA 4XXHA 2E0IA 2QYTA 1ZKDA 1B8PA 4R8SA 4C2UA 3O82A 5DTRA 1ZG3A 4O2AA 3TPFA 1SXJC 2HIGA 4PSKA 1GKKA 1EUCA 3UOWA 4DF3A 3BTSA 2FPGA 1BXGB 5IANA 4QUGA 1DJMA 2P4ZA 4GX2A 4GGOA 2C3PA 1J1UA 3PQEA 4D9HA 4FDAA 1TDJA 3KTOA 2FVXA 3D32A 3OTOB 2FEWB 4ZGWA 1HZJA 1MFZA 2VHXA 2A9PA 2P6OA 4PT5A 1YC5A 4IVRA 1ZD2P 1XWFA 4BE9A 1KO2A 5F3WB 1QWSA 4OVUA 3EVGA 2R751 4C43A 4ZA2A 2IO2B 3SCZA 5MGBA 1IN7A 1D6SA 2JLZA 4AJHA 3JW8A 3G7NA 3WSWA 3NJTA 3VHTC 4ZRQA 2V1YA 3EBOA 3QVXA 1ADFA 3RF7A 1JTEA 5E1OA 4F6ZA 5I8WA 1Q6ZA 2WM3A 1EWVA 1TI7A 4BZZA 3HL4A 2Y1XA 3TE7A 1E59A 1NC1A 5AHXA 2CMDA 3AXTA 4P9NA 1QH5A 2C8JA 1RWVA 1R0KA 2WAAA 3CE9A 3PYLA 2ZWRA 3R7BA 3JQ7B 3Q8WA 4TTJA 1T8RA 4EA6A 2V7GA 3P4SB 4WCFA 3M4JA 3M0EA 5E6SB 3SQDA 4ZPJA 4JBHA 1ESZA 3PTZA 2F55A 3K0BA 4OMUA 1L9KA 5HQ3B 1WLSA 1B15A 3K15A 3GAZA 4INJA 3OC6A 1R50A 1A2BA 5AUPB 1L6VA 3GAAA 2WF8A 3WK7A 3FPLA 2QRHA 5EGNA 1B93A 3EGIA 3UO8B 2KMAA 3GP7A 3TECE 1KZHA 3VO1A 2VBGA 1FUYB 4HFMA 3PFFA 2A5LA 3QHTA 4N40A 1L5HB 1BQ3A 4FOOA 1GLGA 3VR6D 5JRDS 4IJWA 2IUYA 2J53A 5B2FA 4XIGS 4QTUB 3K8ZA 1GJZA 4CQNA 3HCWA 5BOSA 2HWKA 3EUWA 1ZJ6A 1OWNA 1RWKA 2H2HA 1WSBA 2ZSFA 1Z15A 4DLWA 2ODNA 1EGAA 4W9CA 3B6MA 1E9SA 3CSTA 4DDWA 3K16A 2FHXA 1L5LA 3DOIA 3AYXB 4ZOHC 1EVQA 2G9ZA 2H2IA 1P29A 2OV1A 4FYIA 2M2IA 4CLHA 1ZOOA 1P61B 1KZ9A 3W4IA 4HQLA 4QRDA 4YV0A 3ZDFA 3BB1A 2EG9A 1H2BA 2QX4A 3L93A 3OEYA 2P1EA 2WTAA 3NKFA 3VI3B 1ZSVA 5CURA 4JI1B 3AC0A 4C80A 1GQ2A 3X2FA 4H4EA 4H31A 1NA5A 4K03A 3JARB 1A97A 1U0OC 3ZHCA 4PLPA 4YASA 2QRZA 4NZZA 1ML3A 5K99A 1P2FA 1XMIA 1ZK4A 3EZ7A 2LI5A 2ZU0C 3ZVKA 1V35A 1M67A 3TKLA 2LWIA 1C7ZA 2O14A 4ZO3A 3MRVA 1LSOA 3VNAA 4MRRA 1M0WA 4A82A 3STXA 2HSEA 4USAA 2AFIB 4EG0A 4R1NA 2FSIA 4OAOA 3JWGA 2NUTA 1A5TA 4MUXA 3FWPA 1E8WA 4F86A 5ITWA 5I9NA 1SCBA 3MQFA 1W85B 2XJ9A 2VT3A 1AKNA 2W7TA 2B1QA 2ZJ4A 2BB5A 1GTL1 2D1SA 4QAQA 1UP6A 4EB6B 2CC2A 3BBLA 3HKDA 2Q3BA 3NHAA 5AW0A 4QYMA 3L4BA 3C2QA 4A92A 4Z8XA 4O2AB 3FGNA 1EUCB 4W1PA 3BWUD 2Z30A 2G09A 3DMTC 3SJAA 1ATIA 1KGSA 2WKPA 3KV3O 3PR1A 5JHHB 4YCSA 4QDOA 5DSXA 2AHOA 3CXUA 3A4YA 5C3JB 3JS5A 1T0HB 2F6RA 1ZU4A 1O89A 3I72A 1Z28A 1R4MA 3QVOA 3VAWA 1A9PA 4O4LF 3QY0A 3S5JA 4KHPB 2KN5A 4HVLA 1H85A 1F8UA 3FMIA 4LRWA 4YBZA 1WTCA 1OAOA 1K5DA 2JSVX 2A14A 4OGLA 2W3SA 3HDQA 5DGHA 1XU4A 1V11A 3QF7A 1GYRA 3RC1A 5KX5F 1UBEA 3IP1A 4RLHA 5ED4A 4WKGA 2VN8A 4P2BA 2QQ0A 1P1JA 4EJSC 3VUFA 4BMDA 3WZLA 1Y0BA 2UXBB 2O3TA 1UBHS 1BKSB 3NVKI 3IPXA 1DIHA 4G9EA 2DVMA 2RHHA 3ISTA 3QF4A 2J42A 2AQIA 4UZFA 2BUAA 1ND5A 4HGRA 3VZPA 1G4HA 5HF5A 3ZUPA 2CR5A 4S17A 3IEKA 4JUAA 5CDFE 4CL8A 5A05A 1L9XA 1XZ8A 2H2WA 3VTAA 3U62A 5AD1A 5E3HA 2A59A 2IZ5A 4MMYB 1E7PB 1SVNA 3PQ4A 2BR6A 2YQ5A 4BJ6A 5IAKA 3Q5DA 2Q3FA 3J81k 3RNOA 5H70A 2GXSA 1JIKA 3W6OA 2YZKA 2P79A 4Y1GA 4CT4B 1EBFA 2MJ3A 3P2MA 1UAGA 4ZJYA 3CJTA 4JGBA 3JQ6A 1NVEA 1SZCA 1KR2A 2VKQA 4LPSA 1SBZA 4ZYXA 3NOOA 1DDOA 4XVCA 3L6RA 5CLHA 5CHVC 3RBZA 5DM70 3VYWA 1BU8A 3VU3A 1E2GA 2QXYA 1GV1A 1NNSA 1H5QA 4K3UA 3PT5A 2B34A 1MJHA 5HHTA 3ZI7A 2KT7A 3PRPB 5BOSB 4EZJA 1YIAA 2PL3A 5FL7A 1OAKA 1XTRA 4HN9A 4RAQA 1DL5A 1YS9A 1Q20A 1UPBA 5D87A 1Z7GA 3AHJA 3W1WA 4OBWA 2FHXB 3ZGOA 3ZXXA 3NIWA 1NIJA 2VWHA 3OPNA 2L3ZA 2XYGA 2QD4A 3EG9B 4WKOA 5BMOA 2DR2A 1CX9B 4L4SA 1P5HA 1ISNA 1ZN8A 3V4PB 4ZU3A 2MINB 3UXEA 4LE6A 4C2AA 4PBSA 5AM4A 1U9YA 3VNQA 3L0BA 1RJWA 1V2HE 4UD6A 1ONPA 5FUQA 1PUXA 2FFBA 2O06A 2C77A 4B76A 1GITA 1T5XD 4PC7A 4HLUC 5BQPA 3IUPA 2IEZA 3C48A 1I3NA 1JZSA 4FNGA 1M6WA 4NXNB 3LBYA 2I8LA 3AUKA 4MDFA 1BMTA 3V8RA 1JKIA 2DWCA 1G42A 5F7XA 2V7EA 3GLSA 4CMIA 2I80A 3G1PA 5FNVB 2NPFA 3AEZA 2WEKA 1R00A 1VXRA 4XIJA 4R40A 2NZUG 4ZVSA 3ZD8A 2NUTB 3GI1A 4Y6LA 1L1QA 1YI0A 3I8OA 2RJ3A 4KIUA 1JLLA 3TW8B 1B9RA 3MHPA 1C8KA 2W2KB 1TMKA 3DVGX 3OC0A 5I7AA 3KX2A 4XB1A 4L4YA 1JG2A 2PEZA 2YIDA 2ACEA 3LRTA 4MH0E 2VHCA 1L5VA 4PNZA 5I9IA 4YDRA 4C9BA 5JU6A 4XVHA 1E5LA 4C4YA 4OZBA 5GJBA 4G0QA 4EVQA 3HWWA 3KC2A 2R6JA 2PX4A 2PVPA 4W9IA 1PT5A 2IJGX 1VMAA 4NENB 3AP2A 1J5XA 4PAQA 3SC6A 4RJTA 2JPHA 5BSVA 5IZCC 4PTLA 3IXLA 3G13A 1F2VA 5CITA 1XZEA 5KSYA 5A62A 4C1BA 4CF3A 3U3MA 2JQRB 1C9JA 2XOXA 1WXAA 4FFNA 2C2HA 4OL0A 3C5CA 4XOUA 3JAWA 1R4MB 1DIBA 2V6IA 1GVHA 3ZBPA 2I4LA 3V2GA 3L8YA 1F3LA 3OQBA 2KDMA 3T7RA 3DL0A 4O2LA 3M82A 1V41E 4EYEA 4BB9A 4D9CA 1F2DA 2XDWA 2UU9B 3AF6A 3IAUA 5CFRA 3TLEA 3LW7A 3T7DA 3VU1A 2C1XA 4RY8A 4UHBA 3QBJA 1KA9H 5FUXA 3E15A 5BYKA 5BNIA 3HRIA 3HZHA 2W0MA 4D9EA 3MAJA 4J1NA 2WVHA 4HB3A 5GJVC 3MT7A 1PQ4A 2A5JA 3S29A 3K5HA 5A1JA 4S1OA 4L4UA 3QPVA 2GZ3A 1I5OA 1WPGA 4P35A 1TGZB 3CIFA 1V9CA 3INTA 1IEWA 4MI9A 1YUMA 2E4AA 3Q41A 4KBFA 1GA4A 4MIYA 3C3AA 3PNPA 1L3IA 3V4OA 1CR4A 3IPRA 2PZAA 3SKYA 3H75A 3QOYA 2DZDA 1YVDA 3LFUA 3WQBA 1K52A 2C84A 3D54D 2PMWB 1URPA 4Q93A 4WVLA 2WXHA 3BRWA 5ACPA 3N0XA 5DM0A 1W94A 2H6EA 4B32A 1E3MA 3W1YA 1YL5A 3RHTA 1GYPA 4UQPA 3GLRA 4BQEA 4R8KA 3OX2A 2GJKA 1RC1A 1I6KA 5ERGB 3FNEA 1O4VA 4IFBA 4MVJE 1CY1A 5EZQA 2IW1A 1MV5A 1A4RA 5BQOA 1XXHA 2JI6A 1ZZGA 4ZV9A 5HE8A 4BO6A 1Y7LA 2OE2A 2HZ7A 4MQ4A 3HE3A 1ARZA 2QNRA 1BOOA 3RFTA 2JVIA 2Q4RA 3GRRA 2J4XA 2DPYA 4O4IF 4IDCA 5CM2Z 4M76B 1JUDA 1I7PA 1OJLA 2ABWA 1ZJ4A 5I01A 1EM7A 1XDWA 3DXYA 5HZMA 2X0IA 4RNCA 2Q99A 1AGXA 1FRVA 2FZGA 4KX3A 2RH9B 4ZU1X 2J3MA 1QG4A 4D1YA 3H2ZA 1XAIA 5BR1A 1YRWA 4BAZA 4QG7A 2AL3A 5LCFA 4MRNA 5ALGA 3G9QA 2PJUA 1OVMA 2IF2A 4JXZA 2HDWA 4EMUA 3MMNA 1TNDA 4CNBA 3A37A 4CMIB 4NJEA 4B7AA 5CX3A 5I48A 2JIRA 3DH8A 1DU4A 2H9IA 3L6BA 3IQDB 3ZBUA 1ONBA 2BGJA 1U7ZA 2UYXA 2HIAA 4FDTA 1JLLB 2ZAMA 4ANFA 2IYRA 5ARBA 1C3XA 3HJBA 1UELA 4WE3A 4HJKA 1DKLA 2PZ8A 3FOFC 3WGJA 3PUIA 4C29A 2VPXA 1K06A 1FU4A 5JAOA 1XEWX 2LCFA 3V8PA 1WL8A 1IBLB 3C7AA 1E2FA 1L5FA 3TYXA 1WX7A 3T9CA 3OZIA 1LPNA 5EUBA 3LOQA 4JXJA 4KMRA 1WA5A 2CDAA 3BPSA 1V9JA 3OPMA 5L53A 5AO9A 1KDVA 1Y1LA 5IH7A 5BSGA 1OYWA 4UUQA 2X14A 1DRKA 2QE6A 3VSAA 3NXKA 2WR8A 4L2IA 1MOPA 3ND5A 2FVYA 2DT8A 1JWAB 1F20A 4MJLA 2HY7A 5FFFA 2O6VA 2H4WA 3EARA 4ZXFA 2ATIA 1S8FA 3Q8XB 1VECA 5IH3A 1FDIA 3MAGA 3G9ZA 2D5LA 2RGXA 1JE1A 4KAFA 4LOKA 2VYNA 2OBLA 4UVDA 2C59A 3EGOA 4E88A 2XUZA 4YACA 2Z59B 2XUPA 3R3ZA 4D6XA 1ENPA 2BM9A 1Q14A 3VQZA 1DZIA 2H2GA 3AFNA 3BE8A 3R1IA 4TV8F 4J3FA 3BXZA 1G0NA 4KKVA 2QD1A 4PR3A 1WZ0A 1EQ2A 1TFRA 3HJNA 4ZU6X 5DTQA 2ECOA 1SUEA 2GPTA 3DCGA 1E5TA 3IV7A 5AVTA 1DKPA 2KYWA 3H2JA 4YEDA 1DCTA 1X1BA 2Z2ZA 3MTQA 5DDIP 1EDBA 2FY8A 1M5TA 1JR3A 2OESA 2YWFA 4GKAA 1G63A 2NT3A 2P8SA 5F3DA 3C6QA 1CQIB 5HJEA 3NVZA 4U9UA 3PS9A 3VOTA 5F76A 3TAXA 3I57A 4DZRA 3A9WA 2G0TA 2JHGA 1LEHA 5EKTA 5FTMA 4HPXB 3EK2A 3HN7A 1U80A 5KWEA 3D6MA 2ATVA 4BCBA 1BDMA 2B76B 2F3PA 5FI0B 4GOXA 3UAWA 1GEGA 2FEOA 1QRUA 2MBQA 5TE9A 4W9HA 4RPJA 5G55A 4XSGA 3ZVNA 3U7ZA 4EFDA 4WUVA 5P21A 1DC4A 2R84A 1SHZA 3JYHA 3V4RA 1NBEA 3BKWA 5JTUA 1QB7A 1XXHB 4UNSA 4ZCLA 2VXYA 4FYYA 5FTNA 4V0QA 1L4ZB 3Q98A 2YTZA 1CEXA 1OHHD 3JY6A 2Z3VA 3HA3A 3GJZA 1VL1A 2FUG6 1C29B 3USCS 3A9VA 1J2RA 2JLRA 4D6PA 4KNVA 2QC8A 3RFXA 5TR5A 2Y0BA 1Y4SA 3VHXA 4UBJA 2JYTA 2DLDA 2ZIWB 5IAAA 2PL1A 4KO8A 1DIGA 4NLLA 1F7VA 1Z16A 2QJLA 2FRXA 2XCLA 4E14A 3AB3A 3W9BA 3Q2AC 5J23A 5HGJA 4UTXA 1YQEA 3X30A 4N59A 3AHEA 1N60A 3MT0A 1RTKA 3UG7A 1O0BA 5BYJA 3SM9A 5B3LA 4Z3DA 1WX9A 1U94A 1NUHA 4MNTA 4XFJA 2OORC 3QXSA 3PKIA 4G5GA 4K7SA 2P2SA 4HPMB 1AX9A 1ZUD2 4ZV4A 3F9CA 4B73A 4ZOBA 3GDOA 4BDSA 4HKZE 3OCUA 4HNVA 4OGKA 3BDAA 2VQFB 5D01A 2JZZA 1E9DA 1D5WA 3JD4A 2ZUVA 5JLJA 1C0KA 3TS1A 1QX3A 4W63A 3A6KA 1X2EA 2ZWOA 3PE3A 4DDMA 1XL0A 2XE4A 2AX4A 3IP3A 1PVOA 4PO1A 1XMXA 2CD7A 3K9HA 2DERA 3ISVA 5HX7A 3VKUA 1CUSA 3OBIA 5KTRA 1I42A 1JEJA 2FRDC 3GFGA 1E5DA 4HDQA 1PFYA 3EYWA 4IM3A 3MA0A 3M9LA 4QHSA 3UMMA 3SHOA 3Q7TA 1WR8A 3VNVA 3BGDA 2FMUA 1P9OA 4B7UA 4WIPA 5KHLB 3E2IA 5A5DA 1BHQ1 3RSSA 3GLIE 1ZO8A 3OQJA 2PTLA 2D1FA 4ZO4A 1EE2A 4FHZA 4XGIA 1GLVA 4CYEA 1UPTA 4JROA 2HBZA 4LBWA 2RG7A 3H5OA 4U2EA 5C7LO 1FTSA 5EJAA 4HEA6 1SIBE 1EXDA 1GAJA 3D2LA 3S2UA 4LUCA 4MUJA 3EIFA 4KV2A 1N6IA 4RD1A 2RI6A 2W00A 1TYAE 4S1WA 3DVNU 3REOA 1IDOA 5KDOA 3OIGA 2NS5A 3PWTA 3RJ9A 4D82A 3HJGA 3BT7A 1AG9A 5L3QA 1I30A 2POQX 1RYNA 3W5CA 4EHAA 2G3YA 1B7GO 3AM9A 2NXNA 4RXUA 4M02A 4R9RA 4ZQHA 2P9JA 4FEEA 1P1IA 1C79A 2R2QA 2CHZA 2K8CA 4BE4A 2XECA 1XPOA 1G2QA 1HZZA 1ZK0A 1OOEA 2EERA 5G40A 2JFPA 4QREA 2OOKA 5J2TF 3T4UA 4CM1A 5KNCH 4B8ZA 3TSSA 1U3GA 5KQGA 4IEIA 3QV2A 4LMAA 4E2ZA 1PWZA 3ZGNA 4HK4A 3ZCRA 5AW7A 1TYBE 5I8ZA 4KQJA 5AXCA 3UGTA 2PFGA 4GWLA 3UMCA 4OA5A 4QC2A 3VC7A 3F5FA 1UC4B 2QTRA 1M34E 4QDJA 3RWMB 4BIMA 5CHYA 4FLMA 3PUJA 2OFPA 4HNHA 3L6OO 4LDJA 3HFSA 3AE1B 1GA6A 4DNFA 3KNRA 2OHXA 3NEYA 3E58A 1U3DA 5LM3A 2VF4X 1BFUA 4WKNA 1VHQA 1IIRA 2F1IA 5LZ5A 2FXVA 4KXWA 1KZ7B 4CZ2A 3AMVA 1P1HA 4R6XA 3DHBA 2CVZA 2Z0DB 5F3RA 2X0KA 3TE6A 1KAQA 1RQPA 3VHXB 3SLRA 1J33A 2GBCA 3SQWA 2PLWA 1KI2A 3VR4D 1W35A 4P5EA 3FF4A 3KQLA 2WVAA 4XYMA 7GPBA 4D4MA 4EF6A 3OHSX 4IZ6A 4F84A 5DH9A 4I1VA 3Q6IA 1AGNA 2O1SA 3L07A 5JG7A 1VLLA 3LV8A 3AV8A 2FRVA 3I15A 2NSLA 3A0RB 1NVKA 1X74A 3OFSA 1HF3A 3I73A 5AXAA 1RAXA 4MVJD 3GY0A 4M1WA 3KXIA 2YNMD 4BFSA 2J33A 4MVJG 4XDCA 1P1AA 3EDOA 3G0CA 3FHTA 1X7HA 2CBGA 3GEEA 3TLBA 4RGOS 1JWMD 3ANNA 1IUEA 1T1GA 2Y71A 5B4TA 1UINA 4MWCA 4E07A 5KNDA 3ZWYA 3AP3A 1HT3A 3GDGA 3WMRA 4P36A 2WTNA 2VT2A 3CLUD 2O8CB 5C3UA 5C4IA 3C4QA 4GMFA 4C21A 2IC5A 2QMEA 1KU0A 1WUIS 3EODA 2O8FA 3H9UA 1PWYE 4IDIA 4KG7A 1SQ5A 4ACAA 5GTDA 1OA1A 1B76A 1Z7WA 5K51A 1G6OA 2F90A 3AI7A 1JAIA 4C7MA 2GYYA 4HDQB 3BG5A 3U0BA 1C30A 2X6TA 5D3MA 1RQXA 5K8VA 1V3QE 4GLSC 3ZXSA 4HNUA 4OI4A 4E2WA 5JJBA 4ARCA 4WJOA 1P8AA 5AW5A 4R0VA 1AO3A 2OV2A 2VPTA 3VI4B 1H3EA 2P65A 1YVPA 3EDYA 1J0BA 3CKMA 4BNFA 1XKXA 3SX0A 3K70D 2GYVA 4BKSA 2H48A 1RM5A 2NR2A 5IMBA 2G36A 1CETA 4KKXB 2G77B 3C43A 3INNA 4KFCA 4KVGA 2ST1A 4TTPA 1EAYA 5FBRB 1YE8A 3GRCA 1GUYA 3HBAA 2VKTA 3ZHRA 4R4JA 3SC2B 4E08A 2J0MA 3CGWA 1O77A 1Y7HA 5HS6A 3TOSA 1FDSA 5H3CA 1SCKA 4L8GA 2VYVD 1CJUC 1VB5A 1BC2A 4R41A 3HEMA 1V1PA 3QTLA 3QNMA 1U8UA 1LBHA 2C5BA 5B1SA 2ERXA 1LM8B 3I4FA 3C8YA 3ADKA 5EWAA 5F21A 1I80A 1E90A 1ND6A 3AFHA 3T7CA 2RAPA 3BSFA 5IJ9A 4DMGA 1W36B 2KJ6A 4I19A 1FQWA 4K6OA 5G0VA 4B79A 4KREA 3TOCA 3AL2A 4EA8A 3A6JA 2ZUSA 4ZRMA 4YBRA 3BK1A 2WVJA 1NKTA 1EFAA 1N2XA 3U4QA 1G5RA 4OKNA 2UKDA 3UMVA 1CUAA 1E2LA 2XQJA 4UXIA 2BZGA 2GKLA 3VJLA 4UAJA 1XFAA 2HIHA 1ZVMA 1B2LA 3AIIA 2YH2A 5HNKA 2WRZA 5C8DA 2MU1A 2GK6A 3HYSA 2QVZX 1VSVA 5IVKA 2C7GA 5FNZA 1ZS9A 3N2NA 5LS3A 2IV3A 3QUQA 1K1EA 1JDUA 5L51A 1I2MA 2BL4A 1V1MA 3CR7A 2IEYA 5H16A 1KJ9A 5ITSA 3QBVA 5IDWA 2NLOA 4ZI7A 3W5VA 1K53A 5LCAA 2WTXA 4RZXA 3H6GA 4AMBA 3U1BA 1SA0A 4Z4HA 6YASA 2CNWD 4B4VA 1Q0UA 4WZBE 1SOWA 2DBYA 4RGBA 2PH1A 2JGRA 3IOBA 3A04A 4I4IA 1PJRA 2PUTA 2J3IA 2HMSA 1QPBA 4EFNA 4H15A 3ZV5A 1NJ1A 2VJKA 1NHWA 5LJIA 2D5AA 1QCZA 2YVLA 1L7VC 1XQWA 1HKHA 3EUFA 1TKRA 2EFHB 5GY7A 4PZ9A 3MJ4A 1S8OA 1YQXA 3GP5A 2XZDA 4KQWA 1I4TD 4FCVA 5BRJA 4HX5A 4YN3A 4J6FA 4IF4A 1IHXA 2JF0A 1I4HA 2P2ZA 1EVZA 2C29D 3NX4A 3N0TA 2JLVA 4R2XA 3RW9A 4LWQA 2E4XA 3GUZA 4RVHA 2VDWA 5FB3A 1ICIA 1SIWA 1IHYA 3LZDA 4D3DA 2HXGA 1RKQA 2WABA 1HFEL 1Q5WB 1EZ1A 2DTEA 3UYKA 2LMCA 4J0HA 1VLQA 4LDZA 2E4WA 2YJTD 2BHLA 4RZQA 4K3VA 2OMKA 3RPFC 1PDOA 1CT9A 2VRRB 1TXGA 2IPKD 1UM8A 1AHHA 1H4SA 4J16A 4L8FA 4XIYA 2JAPA 4RK7A 5J4HA 4DT1A 1MPTA 3SIPA 1WM2A 1PCXA 1ZDVA 4ENQA 4Z0HO 2R25B 3TLAA 2VDLB 3BA1A 1E0DA 3L8EA 1FQJA 4PO9A 3K1TA 4EPWA 3KJZA 1Y9JA 2UYOA 3IAAA 1WDTA 4LXUA 3QI7A 3PC8A 3JR7A 1HE8A 3M9XA 3ECIA 5DTIA 4HEJA 2BEKA 3OY7A 3DH0A 3L46A 2GF0A 3I2YX 2DX5B 1FSPA 3RRXA 4NAUA 4M7RA 2GZHA 1I4WA 2B3AA 3HY4A 1D4OA 2QM0A 3QHPA 4MKRA 4JQWC 4OATA 2YW2A 3FHJA 4QXMA 1YQDA 2GI9A 4KXFB 1NU8A 2WQ7A 3K2EA 2AC7A 4AW9A 1FFSA 4BN4A 4IMPA 2AN5A 4Y1EA 4ER6A 3IT4B 1M33A 2FWAA 4X63A 4P5DA 1G21A 6CHYA 2Y5CA 4PSUA 1E0JA 1V1PB 3O26A 4DLRA 4C09A 3A4TA 2IZ1A 1F48A 1PN3A 2F2TA 4A27A 5DXAA 4TLEA 5FRDA 4UWRB 1M66A 1ZGZA 4WNAA 4LHVA 1ZNWA 5IJ9B 2WUFA 3ZNOA 3TTVA 4B34A 1TCUA 2WLBA 2PYZA 1XDGA 3EZ9A 5B30A 5C1BA 2ADMA 3U4QB 1FX1A 4UPDA 4LSMA 2ZANA 3WISA 2ZRNA 2WJHA 5H9VA 2NXJA 3NTQA 4XYEA 2YN0A 1JAHA 3WAKA 3LUBA 4RV9A 4Z4EA 1J39A 4J07A 5JZOA 4KYTA 1CJEA 3KEQA 1A8TA 2ZS9A 4TYNA 2DFDA 3AOEC 1TIPA 1NBIA 4XTRA 1CVIA 4MPDA 3I04M 2QWXA 3NNDA 3AI5A 1KPHA 2Z43A 2P1DA 1V1MB 5TQVA 1AQJA 3ZNZB 3OOWA 2JBHA 1G5FA 4PVOA 3MB5A 1P6XA 4G1UC 3AR3A 1OLSA 3FTFA 2JLQA 1YR7A 4ZI7B 1CXZA 1DOYA 1SA0B 2PDAA 1WS6A 3GUCA 4V0MA 3OWEB 3CO5A 4ERNA 4LG1A 1XV5A 3W8RA 1U1GA 3AF4A 2LEKA 2HD5B 3IMCA 1Y3CE 4F4IA 1ZA2A 1OKKD 1QHXA 1TMYA 3T7TA 3PVLA 2NYUA 2JCBA 2QDFA 2F64A 3GDFA 4JN6B 2IBMA 3E3LA 3ZWVA 3UB4A 2WXPA 4N54A 4QYTA 3IODA 3PXGA 2PUJA 4EKDA 3IPAA 2LIPA 3MJCA 4RSHA 1AYFA 2Q8QA 4TQGA 1FXAA 4GPZA 3PJGA 1G9SA 2ZG6A 2HB6A 2PMBA 5A5VA 3NHUA 3S8MA 3WKCA 1XD3B 5D84A 3BWCA 1SQSA 2VDWB 5CR9A 3KUUA 2IYOA 3QLVA 1YVEI 2BM0A 5ED0A 3B6JA 1T34A 3ZWOA 1ZRSA 4I1UA 1EVIA 2O07A 4C4TA 1Y9ZA 4O1HA 1S4MA 3CPEA 3KB8A 2Y5BB 1VSQA 4EMTA 4CFSA 3BCHA 4NR0A 1UWXA 3VHLB 2WJPA 4EGCB 3SBLA 2QRNA 4HNRA 1ZW7A 4DT1B 4TXJA 3H8JA 2PRYA 1UAYA 4CBVA 3DWEX 4RXTA 4Y6PA 3RROA 4MA0A 4R2WA 1P4HA 2P78A 1NASA 5M5BA 4LY6A 3F8WA 1EUYA 5E6SA 4KXYA 4B3JA 3CZCA 3W6ZA 3BIWA 1HE8B 3MTGA 4FQ7A 1R8JA 4PG5A 3JQBC 1A4XA 5HQ3A 1YUBA 4XJSA 5IVIA 4KNYA 3A0UA 2FWRA 5H9WA 2TECE 3EAFA 3R8FA 3FJYA 2WAOA 3N9YC 4B31A 2RC6A 1GCIA 2KO3A 3GJQA 2DSNA 4ARSA 3QU9A 4O2BF 4OW0A 2ZI9A 1M0SA 3Q0IA 1RC0A 3LYYA 3FTNA 1RXWA 2YBEA 4DEXA 2DYMA 6AT1A 4HXDA 1L5HA 2I7VA 4J7XA 5LP6F 4RGQA 1HG0A 4HZGA 4XJXA 2H7YA 4TOIA 2J1LA 1YB5A 3O7WA 4QQKA 2R8XA 1J8QA 2PMKA 1NGSA 4HUQA 4MKXA 2X8AA 1E7YA 2YX1A 2ZP1A 1QVWA 3PCRB 1GPLA 5IABA 4GR9A 1DWUA 5EE3A 2DE0X 5ALKA 1YVUA 1UK6A 3TG2A 2IPMA 2WMNB 1CUGA 2QLLA 5EP4A 4WNAB 5AM3A 4W9FA 1C76A 3HPQA 4NZOA 3HS3A 4BQFA 3HR7A 3QVTA 4IDBA 4QFBA 5F5XA 3ZU6A 4L6CA 1CERA 1T4GA 3KPUA 2VJQA 1XQ1A 1JECA 1ORWA 1WNFA 4YRMA 1BEEA 2KJHB 1VE5A 3CVVA 3WO1A 2RGNA 5J63A 4TROA 4D3XA 1REQB 3NH6A 4ZVQA 1JE0A 1Y6GA 3GT7A 1GU1A 4Z8YA 4QOEA 5B3JA 4PG4A 1ORHA 3QPUA 1YE3A 3AILA 4YPOA 3AM3A 3N6RA 4AP4C 3C1AA 2EARA 4NCJA 3U4IA 1OLSB 2P9YA 1SD2A 4BVHA 3U9LA 2X22A 5AJYA 5GGXA 1L6IA 5LP6C 5JATA 5K4GA 1GU7A 1QBGA 4JBYA 5D86A 3OFND 4F21A 1KKUA 4BMYA 4TZTA 4XJTA 2NO5A 4Q37A 3BWDD 4PLFA 1NM5A 4D43A 5IULC 2ASQA 2KX7A 2J32A 3TNJA 2WT4A 5HTOA 1PQYA 4Q9KA 2KQUA 5C7IO 3KPYA 3MPOA 3M63B 3JD2A 5ALPA 2KLGA 4ZKEA 4URZR 2F8SA 1CNFA 2XHZA 3QU2A 5DHRA 3C98A 1PNTA 3IOFA 4QXQA 2XUGA 3QJZA 2OPHA 2COKA 3KYJB 2B69A 1TK9A 1GPWB 4IZOA 2GBFA 3ENWA 4CL3A 4AG6A 3LLMA 2IV7A 4F2DA 1TL7C 3KG2A 4S12A 5DNUA 4IQGA 4RKWA 4BP3A 5IJXA 2AFRA 1V25A 1G5QA 1M2VA 2CWWA 3Q69A 3A2KA 1T9KA 3U60B 5ELXA 2ZIZA 2J67A 4CO7A 5EMKA 3GNLA 4IXWA 1QG6A 2YIMA 1HDCA 2VW8A 5TR9A 1O95A 5LDDC 3WZ2A 3D59A 1OGYA 4PIMA 1VZ2A 1ZL0A 1IHUA 2ORYA 2FQWA 4RIGA 4M8MA 1V6AA 4EZEA 4HMOA 4YWHA 4A4DA 1DLJA 5EJGA 4V0NA 5KTSA 4ENTA 1Z83A 3W2TA 4CMEA 1RRPA 2X9QA 4TYPA 3ZE8A 3FVWA 4ZTUB 5JXGA 2JJ1A 2H0AA 5TMEA 1YDFA 5CGZA 2FWBA 1LBIA 3KR9A 2H08A 1YB4A 2GARA 3PRMB 1WMEA 2F8TA 1AY0A 4ALIA 2XYQA 1Z35A 5LR6A 2ODTX 1FOEB 2QK4A 5EEGA 2FSFA 2QUHA 3H99A 1PO7A 2ZXUA 1X92A 1A96A 4LX8A 1YL7A 3O0DA 3WMXA 4QJ3A 4PSCA 2H1HA 3TNDA 3ONVA 2Y93A 4G24A 1ODLA 1FD6A 1S3SA 3G5AA 2FAXA 2GEUA 4TKVB 4U7HA 1ZIPA 4A6XA 3A6LA 5LXIB 2D5IA 1YC2A 3CURA 1QOZA 4X8HA 2JFWA 3SFTA 1FJXA 2VI5A 2AZMA 2NQ2C 4B0OA 3WWEA 2HO4A 4YTNB 3IIIA 3ZZ0A 4WJLA 1G6Q1 1MENA 1Q17A 1RWMA 4KDFA 2FX3A 4XGNA 1YFLA 3SHVA 2I34A 1EX1A 2RH8A 4MUYA 1USWA 3R7WA 4DM4A 3F7MA 3ZI4A 1QQ6A 3Q3GE 3PNBA 2PWPA 1RMYA 2W6IA 4HUQB 3R5SA 4YCCA 3IKTA 4TRRA 1NT4A 1GUBA 4X1IB 1JQ4A 4QG3A 4PTZA 3D8BA 5JADA 1HGXA 2BS3B 2WUEA 2ZUUA 3UMGA 4L08A 3SI7A 3TMYA 3HXLA 3OQOA 4EY2A 4BRZA 5J2RA 1IUOA 4IAOA 3FA2A 3KKOA 1V5FA 2RDMA 3IT0A 4A5OA 4ML3A 3IILA 3DOWA 4DUGA 4WH0A 4ZVVA 3EG9A 2Q6OA 3PF9A 2BQQA 3DXXA 3D0KA 2FU9A 2MINA 3F2VA 1ODKA 4RORA 4TLCA 3SGLA 4DV4B 4WXPA 2IY8A 2HWYA 4MYSA 3NGMA 4KQXA 4MITA 1X1QA 3KQVA 4L9RA 3DEYX 3W5BA 5KSWB 1WJ6A 3O8OA 3LK6A 2CNKA 2IYEA 2R6CA 4J0JA 3SHQA 4UFOA 1N5XA 2OV6A 2DKNA 3PYXA 2O20A 2GYWA 4M0KA 1F2UA 2OQVA 2IHJA 4YDHB 1V4BA 4P0TA 1EYZA 5FOXA 4Q9JA 1WD7A 3NHJA 4DJAA 2WFAA 1ZP0B 4MVWA 5FNVA 5E8JA 2B4KA 3DFIA 1YJAA 2WZCA 4AO7A 1WOMA 4EX7A 3A1EA 1GD1O 4IX9A 3TD2A 2Q2OA 3VR1A 2G88A 3TW8A 2ZJ8A 4RL4A 1UMDA 1Q7BA 4M6WA 2CV2A 3U7QA 3KPVA 3DE3X 1XI2A 2W2KA 4RQUA 4KLCA 4F04A 2RG1A 2DKFA 1YU6A 1SCJA 4H1VA 2I2XB 3ZDXB 4G81A 3C0KA 2YXLA 5KVCA 3FTPA 3ZPXA 3KSZO 1CP2A 1MA0A 4KAJA 4Z0TA 1M8GA 2FNAA 4NENA 1ISRA 2FWJA 5GM2A 4AY4A 3ESRA 4UTVA 4FQ5A 1ROEA 4NQLB 1NAHA 1C9EA 3CO0S 2V9HA 1EM8A 1KJNA 5K0BA 2WWIA 1TTTA 1Q1QA 3INGA 5J59A 3D1VA 4QHTA 1HORA 3LC2O 1O5IA 1F12A 3BWMA 3HBMA 4C4RA 2VSYA 5EHXA 3BL5A 2BZ0A 2B25A 3R3WA 4I1PA 2Y0CA 3CKKA 1M94A 2Z4TA 2ZR0A 1CZNA 1M2VB 3T0IA 5D2MB 4BKGA 1VMEA 5DP1A 1YDMA 5DBEX 5IDXA 4LYYA 3ZYZA 3AOGA 2IYXA 2WYWA 3LX6A 2XOEA 4U5QA 1N2GA 2PRZA 5EQJB 1CFJA 1IK6A 2HRBA 2QJWA 1T43A 1OMOA 3ABIA 1UBGA 3NAGA 4AX0B 1Y5IA 1IY9A 3GL9A 2QAIA 4BO2A 3P20A 1JWUD 3UKDA 4AJLA 2IUFA 5FJIA 5EL0A 2CMKA 4PGHA 2HEGA 2O3UA 1ZE3D 3UV6A 5KYGA 3OG5A 2Z08A 4FT2A 1YR2A 2Q5JA 4R2LA 1X7ZA 3E7DA 4MA4A 3H5RA 3PE4A 5TY0A 2ZJ2A 2XEWA 4W8OA 3N0RA 4AMUA 2G08A 2OXRA 5E1DA 1SMKA 4TKLA 1RQ7A 5CVEA 2HFJA 2VDKB 5IJ0B 3CE6A 1EK6A 3RAFC 4NQZA 1WP9A 1Z0IA 1Z4QA 3WAMA 2KBEA 5A7HA 4BLSA 2IBSA 1B23P 2OZEA 4PZAA 4K3BA 3AR4A 3SSMA 4CV3A 4BU1A 1ZNXA 5E6NA 5JT1A 5B1DA 2OKGA 4TLLB 4DYDA 5SY4A 2YNTA 1QLHA 3R7WB 2ASVA 3P4PB 1GARA 1JXQA 2H2DA 3BHIA 1E1MA 3D6VA 3LDGA 2OO5A 1Z7EA 4BNLA 1HFKA 5EVKA 5C5EA 1C3JA 2AD1A 1Y44A 1E6EB 2JCVA 4D4HA 3SJZA 1L7BA 1R2QA 2P91A 5DMXA 2AEMA 1GUFA 3EVCA 3K2IA 2HDOA 4WV3A 1WW1A 5JECA 4EWLA 3SQOA 2Q27A 2QZJA 4NOMA 3I8XA 4DIDA 1AF4A 3CF6E 3DBRI 3QELA 4NJMA 2PUAA 4M9RA 1JDSA 3B3FA 4OZCA 4P3PA 4ZJPA 4B4DA 3HRHA 3FDFA 1D2CA 3O8OB 4BAUA 1VJ1A 1EVEA 3VVMA 3VO9A 3TLKA 4REZA 1MIHA 4IEFB 4BFRA 4C0KA 3OICA 3SSAA 1F2UB 5JALA 5TEVA 3KOMA 5DT2A 4QGAA 3L0DA 4LZOA 2I3BA 4MROA 1HTTA 1DGQA 1XZHA 4EELA 4XCXA 4B3FX 1BC5A 4YUYA 3P19A 3OZCA 1T8PA 2GZMA 4PAWA 2XF8A 2HZBA 5B3KA 3KE8A 1HA5A 3MFGA 1UMDB 4M6WB 3U7QB 4HH3C 2CDRA 3TJPA 4B3GA 4LMBA 5CA1A 1EQAA 2DSTA 5CHWA 4JEHA 3LHFA 2ZVQX 4RANA 4KQIA 2C8LA 4O0LA 3THSA 1JG6A 3U7IA 3RQSA 4YP6A 1UJCA 3RU3A 3N20C 2YZGA 3IHWA 4U0KA 3H1AA 1K8YB 5D85A 2WU8A 3U16A 5JTTA 3CIOA 3LJ3A 5ESDA 1V8CA 2PMEA 1Z2EA 3RIYA 4WH4A 2AJTA 3ZVLA 1EX6A 1EM8B 3OQ6A 1KK0A 1J8CA 4QOGA 2FCQA 5P8WA 3AJEA 5F98A 2CNLA 3NCHA 1G8MA 1J25A 2PUEA 1N5WA 2CNOA 1Z8NA 4G63A 3NHBA 4I9HA 3AFOA 3UMFA 4H7IA 3BXPA 3NLLA 4JSYA 4NY1A 2P0AA 3X1ZA 2GFQA 2POCA 1JG3A 5TXGA 1U8ZA 3UTCA 1OZGA 3I0ZA 3IV9A 4TL7A 1RWPA 3CBGA 3ETLA 4G0YA 3T3IA 3NRJA 1RBYA 3WLPA 3V97A 3KDSE 4AY3A 3FLEA 5SZKB 4IDDA 2LVQA 1R6UA 3PL5A 4FGZA 4WXMA 2N47A 2VLBA 4IMIB 3I8SA 1CQIA 4QIHA 5L9AA 2I65A 4ZHOA 3DNFA 1I5RA 1NBMA 4I99A 3TPCA 1X7ZB 1IJFA 4DJTA 2BKXA 3L02A 5EV6A 3AEAB 4KUGA 5A3QA 4DUZB 1JHZA 5DSTA 2JXXA 3U7EB 2VUIB 3LRPA 3WK9A 4GIVA 3PGEA 3MMSA 5CVJA 4RELA 4LC9A 2HJGA 2ONKA 4PYRA 8ADHA 1YRBA 3ORRA 1P3QU 2A0FA 4GDLA 1I7NA 2GPBA 1Z0UA 3K8YA 1W5EA 2GM9A 5K05A 2OHGA 2PLFA 4ZZ3A 2IHKA 4PVCA 1R37A 3G0GA 4JL9A 1YZUA 1CUEA 1BMCA 1N5KA 5DBIA 4ZCIA 1TB4A 3NU1A 1Z6TA 2D59A 4PZZA 3C8MA 1RAEA 4BX2A 2SKCA 2BV3A 4AN4A 3PUKA 3CF4A 3OQNA 2YNTB 3RU7A 2A35A 4JBLA 1MRZA 3RT7A 3A25A 3DAHA 1T5IA 1XZBA 3N30A 1RADA 4G6ZA 4BMSA 5KQSA 3KWLA 1JXAA 3N0WA 4NEGA 2IF0A 2F48A 1Y42X 3B85A 4OB6A 4L5IA 1VLVA 4JKOA 1ZK2A 2ZIEA 3LKVA 3ROKA 5HRCA 4RZIA 2I2BA 3QVGA 1V96A 1TOAA 1B8VA 1K66A 2BTQA 2XY4A 3R41A 1WKVA 4XKJA 1MX9A 3R66C 2XUHA 4RESA 4POAA 4ZYZA 2M98A 5AK3A 3IQHX 1ECCA 3QE2A 2O2CA 3TF5A 3QELB 4D3ZA 4NJMB 5MHTA 2EKIA 3A1CA 4CIXA 2NVWA 2QXUA 2H5EA 4GXTA 4JGGA 1PL7A 3L8MA 4PE5B 2GSWA 2I2CA 4Q00A 3PRJA 1ZMOA 3ER8A 3B7PA 5J3JA 2CVFA 1TEZA 2QVCA 3OFJA 1G20B 4WN9A 2R4TA 3CZRA 1Z73A 3QLTA 3ZHBA 3G0IA 1KKLA 3IIKA 5FR2A 1FXSA 2DQZA 1DNPA 3MELA 4OY3A 1FU8A 3NAMA 2XA9A 3AUJB 2W2QA 2WIDA 1TKCA 1SOAA 1MOZA 1L1FA 3VSCA 4OA8A 5CA1B 2WVGA 4IJVA 4PQFA 1W5SA 2I9PA 2FCNA 4UULA 2FPXA 3G85A 5DO9A 4DL9A 1KJ8A 1GG2A 2JFQA 4UWSB 5B5SA 5F1OA 1TYDE 3APDA 5FQNA 1WX1A 1C9KA 3CMMB 5CW1A 4ZQEA 4I50B 1TADA 2HLPA 5CDUA 3KSUA 2Z8ZA 4I1IA 4ZVRA 3TOZA 1EFCA 2CV1A 1FYDA 3BJMA 2B7CA 4IIXA 1NEKB 2KWCA 3DC2A 2DOOA 3A06A 4AZVA 4FBGA 4GI2A 4NU5A 1HDXA 4ZOAA 4IKOA 4UXJA 4D8UA 2IY7A 5K0JA 1XA4A 3HHEA 1U7TA 1GB4A 1KY4A 2EG5A 1PGBA 1PNQA 4JR0A 4N7RA 5K0LA 5BMVA 2PG3A 3CZPA 2Q2WA 4QQFA 1CUIA 1MCZA 2RGWA 3DP7A 3GVIA 1F52A 1K7CA 3QX1A 3C97A 1YR1A 1VD2A 1ZCJA 2HRDA 1Z4KA 4GLBA 3SFDB 2L19A 1QKZA 4AX4A 2I4RA 1Y48E 1CS0B 4TZ0A 5TIIA 3T35A 3A4VA 4P22A 1TQ4A 2PW9A 5TGTA 2M0XA 1Y3BE 1DOXA 2WM8A 1VCBA 1QSGA 4O1MA 4F11A 2CUTA 2QNBA 2VP2A 5AM2A 3Q40A 4UZSA 4PC6A 5D5PA 2NZFA 3KR0A 1OY1A 4TKNA 3I6MA 2PSJA 1NXVA 4YJHB 2RH4A 1DBWA 3DKRA 2OJRA 1CEYA 4J0QA 3NHYA 4GDLB 4EW3A 2OHOA 4F0JA 1E60A 2OG1A 1BVYF 1SU4A 2BKAA 3UQYS 1XVTA 1I24A 2C3YA 3LY5A 2AT1A 3R0QA 4EG8A 4OJQA 1V71A 3FDIA 4QFDA 1MHHE 3DBVO 3L7BA 2OXCA 1HTQA 2OSVA 4HWPA 2KX0A 2YLMA 2EF1A 5JCPA 3NGLA 1KEZA 1XK7A 3TIVA 1C14A 2C83A 4IJUA 4QJIA 2VP4A 2OXTA 1MJNA 4OOEA 4EYGA 1DTSA 1EZ4A 5C5CA 3V4ZA 2OB1A 1KBOA 3OQPA 1V39A 2D00A 3KVVA 1ZONA 1KK2A 4BB5A 4Q01A 3DTVA 1TF2A 3W9YA 1EEXB 3KAPA 2MT9A 3KLMX 1MXHA 3QVGB 2R47A 2BTQB 3F6CA 2DAJA 1UR5A 3IA2A 3FCYA 1JB9A 2YHBA 4GH5A 4KXXA 1F06A 2MTBA 5IUNC 1JLRA 2OP1A 3QJ5A 3HADA 1PUJA 4RTLA 4XD7A 5FUWA 1MVNA 2WWZA 4U7PB 4HRAA 2DMRA 2CSUA 3QFTA 2V7QD 4AKIA 4MTCA 3NWPA 5E9QA 3RTEA 1U4SA 1NY5A 1T26A 3P5SA 3ZDMC 4ASWC 1BUIC 4DW8A 4IUCS 4WN9B 2E6KA 4DQUA 3H8SA 4P86A 1E1QA 1K0UA 2B0CA 1KR5A 2X23A 1RCFA 4GXRA 2WP0A 1PJBA 3GB1A 1VJNA 4NBUA 2FQ1A 3Q2OA 2WIBA 2O8CA 5E2AA 4OXQA 5LA6F 2MSLA 3HVDA 1S9HA 5ACRA 3I5JC 3RODA 4C3ZA 3R7AA 3M4YA 1O7JA 3E1SA 3QVVA 3ZIMA 1GGEA 3ZCXA 2LIVA 1ZOLA 1D4ZA 1Y9EA 3Q0EA 5F51A 2YVAA 3EA0A 2FFAA 4Q1BA 4O1IA 3TZHA 3LHKA 1EDZA 4A03A 3R7DA 3VFKA 3WAOA 1E5WA 2L69A 1U8YA 2X1HA 1I2ZA 3G68A 1L5ZA 1CSEE 2X3UA 3Q14C 3HDVA 3MB8A 2DLNA 1D2RA 1U0LA 4BJ5A 2R5NA 4PYUA 5NLLA 1FTQA 2BBCA 1ZICA 5B6PA 4KWIA 1FNWA 5IWAB 3SC2A 4B6RA 3VPXA 5IN4A 5BMVB 4Q1DA 1WW8A 2XCOA 1VYVA 3EMDA 1XMOB 3N6VA 3OM9A 4C0HA 3C45A 4GSKA 4GNKA 3EZLA 1B8NA 2LJIA 5LDGA 4DCPA 2XUJA 4B8YA 3QTTA 2YS7A 4INPA 3IVCA 3SF8A 4YRTA 4GFDA 2HIMA 4XZ4A 3IP6A 4GUDA 3B2FA 2GAOA 4Z5XA 2BI7A 3UAOA 1K97A 2XDAA 1V4NA 4MK4A 3E3OA 2Y0DA 4K6CA 4YXFA 2YFHA 4YRCA 2A5FA 5HSGA 1RM0A 4QTXA 4MIEA 4P62A 1NYQA 3AVPA 4BYGA 3ELWA 3IR6A 2JFNA 3E53A 2P2CA 1ODFA 3KJEA 1QT9A 3VC3A 1IZ9A 2ZM5A 3R7NA 1GNLA 1X1SA 2VWPA 5AQEA 1WV1A 1E18A 4ZNBA 3L5KA 3K0HA 3ZJYA 4S1VA 4YJGA 2WF7A 1L0VB 4O4HF 3HU2A 1GN8A 2DR0A 3BJIC 4BMNA 3B9QA 1UBSB 1PR6A 5IM4F 5FEMA 1O57A 3MJFA 3LE8A 4ZDVA 5EJIA 2YNWA 5L4NA 3MMPA 3RS9A 2I7DA 3A6EA 1MF7A 2OG2A 1LSUA 1FW6A 4KR7A 3MWJA 3A10A 4DR3B 5F2OA 4E30A 2VF2A 3C3DA 5CCDA 5LKAA 4EHHA 1K8QA 1NW6A 4RVDA 1N2BA 4MUEA 2GPJA 1IUKA 2VH5R 1XCJA 1PQPA 3Q3VA 3VPAA 3ROMA 2WFZA 3DTVB 3QYJA 3IKLA 4OEHA 2ZSKA 2WU5B 1Y8RC 3KQOA 2ZAOA 5DW3A 4M9ZA 1P1BA 3B1XA 3NS7A 3DWGC 4V2IA 2CXSA 1ZUHA 1T4DA 2EBUA 1LV8A 2AJCA 3UKJA 3NT2A 4QLAA 2CDNA 5KYUA 3WRVA 2VFAA 1PK7A 3AUFA 3P7MA 4LY3A 4XH9B 3KCNA 3QKUA 3SQMA 5D6NA 2A9FA 3H19A 4EVRA 1ULSA 3QFCA 3RQIA 1SZDA 4JV5B 1ZI9A 1ZIOA 2Y1FA 1G7RA 2OUKA 1XROA 5IARA 2XH8A 2JY6A 1DUIA 3GUUA 1GCGA 4IXDA 3ETEA 3PFWO 3RSQA 3ZJ5A 1GAQB 3UC5A 1RXEA 2N1VA 1PR9A 3B1JA 5BV1A 4HWOA 1QTIA 5AHKA 3H04A 1GZDA 3M3JA 3ME5A 3THXA 4KKJA 2B8JA 1LLUA 3U44A 2VEOA 4MV7A 6LDHA 1EH5A 1IWPB 4QUIA 1XF9A 3VO2A 2ZFUA 4HC4A 2C9BA 5U9CA 3ZQ4A 5J5VA 1ZPSA 2FUG1 2Q3DA 3MC0B 3E9NA 3OJ3A 2DHZA 3I1FA 4RXMA 1EXWA 1PR5A 3BGVA 1IOVA 2CNNA 1XO3A 4C87A 2M8SA 5C1PA 2M9MA 5JAHA 2BRUA 2XTJA 4YI5A 3ELDA 2Q49A 4JOQA 4NBLA 4OJMX 4WWHA 5CBKA 4JJAA 4QDZA 5CG2A 2C4UA 4RFSA 5AOAA 3D2CA 2PS1A 3URKA 1R15A 2QL9A 5LPNA 4WXEA 3U1TA 1RTTA 3IXSA 7MDHA 5MDHA 3HO8A 5A87A 1DV2A 4DHJB 2XW6A 2DKOA 1EVYA 5JEDA 1CRPA 4MYRA 1ZJ5A 2EKZA 4RTPA 3T1QA 4F91B 1MLDA 4PHFA 5A2GA 2JK1A 3S6JA 3LUHA 1MG8A 3FPHA 3P2KA 1YI1A 1LS6A 2WNIA 3NRBA 3PFGA 2FR8C 5KTTA 2JB9A 3VMMA 2V5VA 4XTCS 4JVSB 1L5RA 2YYSA 3WWYA 2MR5A 1Y7IA 3PPAA 1A72A 5CLFA 4FFPA 3KM0A 1HYQA 1GRVA 5JNTA 4R2MA 5KHQA 3ZW7A 4UUPA 3VC1A 1GAEO 2NADA 3DHWC 5E7IA 3SF8B 4K81A 3TEFA 1KQFA 2QW1A 4XX5A 4LJ4A 2Z56A 5JXWA 1P17A 2KYRA 3C5HA 1XNGA 2MYTA 3NUQA 1V43A 4B6OA 1MB9A 2I78A 3N76A 4US2R 3K9LA 4L76A 1U0FA 2PEAA 2BH2A 1V95A 2J3KA 1R27A 3TEWA 2ZGVA 2IE0A 2I4IA 2HU7A 4MW9A 4LK3A 2P3SA 3X1KA 3AU5A 1TT5A 5U4QA 3VDQA 3AK4A 3I5AA 3K09C 4HEA1 4YJGB 2QRJA 1E2IA 1ULBA 1Y37A 2XCUA 2WAXA 3AE5B 4QYIA 1LTQA 3PNYA 2PIAA 3IHPC 3BEOA 2ZYIA 5JSKA 4BNYA 2GFHA 1IB0A 2FMIA 3FYTA 2Q2NA 5KVQA 1EF1A 3U49A 4HSEA 3EIXA 5A4IS 3EWAA 2Y3IA 1ZRNA 3QA9A 2ECQA 3CCCA 3O8BA 3LQKA 3DBOB 4GLFA 4KGZA 2H1LA 1WI0A 3BDVA 5G41A 3BF8A 3AHIA 1QH3A 5BP7A 1NBOA 1XVIA 2XD4A 1GPBA 2ZRBA 1CK4A 2D8MA 3LO5A 4X7MA 4RPLA 4JELA 4YMWA 2BYVE 1JQBA 2OPBA 3F7OA 3U5ZB 4GMKA 3QENA 4KHZA 1EG2A 5CH8A 1RQGA 2QP9X 1XTQA 5KYUB 3H8HA 3KXKA 2HXYA 1X3SA 4EE2A 3RD5A 2IGHA 4RADA 3VTVA 1LF0A 3RRNA 4AQYB 1M0EA 3JATA 2ZCVA 3LDZE 3TLZA 3SJBA 3QKIA 4AFNA 3U3KA 1JJVA 1ZW1A 3ZNHB 4DIBA 4GO1A 5EIBC 3UATA 2BE7A 2FP3A 4J1TC 1UP4A 3LYUA 4BLUA 4TM8A 2GBMA 3UN1A 1GG8A 2YWGA 2JFBA 3AI1A 2AOTA 1E2BA 2BFCB 3ND6A 2FB9A 4QATA 1AS2A 4Q39A 3THXB 3U44B 1YQ4B 2AA3A 3MTIA 3GPCA 3PU6A 1V5OA 1YBAA 2F9LA 4D1WA 2J0JA 3IIJA 1J0CA 5KPJA 3O38A 4ITUA 4F12A 2G5TA 2FXIA 4RS3A 1Y6QA 5D3ZA 4LOHA 3MJWA 3X0DA 2GKGA 4BP1A 2A5GA 3I5MA 1V8DA 4RTKA 5FOQA 1YZGA 1K63A 2OO3A 3JRWA 4PBRA 5I7EA 4BQIA 2AK2A 2OWEA 1HSZA 1EE9A 4RVOA 2RGCA 2W2XA 3IAM1 2BAGA 3SX2A 4RFSB 4HDOA 1GRCA 3CRRA 4M1EA 5EINA 1JFTA 1AKQA 1MZVA 1W4RA 1P75A 3IDZA 5E3JA 1EFRD 2NU8A 1OGIA 2AXPA 1H0RA 4G4IA 3MPUA 3P52A 1PGJA 4NBSA 2NW6A 4US1R 3AESA 3HXKA 5CVVA 2OEPA 3NHKA 3NHMA 3A33B 4ZCQA 4HQFA 1LPPA 1SUPA 1XQ6A 4GUAA 1QNLA 2NAPA 2HPZA 2EW8A 5L6LB 1MNAA 3EZYA 4L8YA 3VR2A 2B1IA 2P3LA 2WWTA 1MJ5A 3TMPB 3M1YA 3AH7A 2OBYA 4M54A 2FZVA 3V6MA 1OFVA 3ERCA 3HXOA 1MDFA 3WGYA 1NDDA 2Q5FA 5KYWA 4FYPA 4B6JA 5EJEA 3HXTA 4M1YA 1VLZA 4K81B 4PZYA 2L8JA 3TTYA 1H0HA 3GN1A 2CLSA 1YGYA 4EAAA 2DLCX 1N5JA 4LJRA 1UJBA 5JARA 1GQYA 3O3OB 3GOQA 1C9MA 4DWFA 4DB2A 1V3UA 4WSOA 3HNOA 4U5XA 1DAPA 3SBDA 1DX9A 2XKKA 1W2HA 2QRUA 3P9IA 1K07A 4B3HA 4NPAA 2FOLA 3G17A 1TT5B 1WBJB 3M6WA 4L27A 1KIFA 3GR6A 1GJRA 2R4QA 1HT0A 1E92A 4QYIB 1I4GA 4F7WA 3KFVA 3P0HA 2LE0A 4NCXA 5CLJA 1REQA 2NUBA 4F4CA 4PX5A 4FOPA 3L0ZA 2C5FA 2WJ6A 1K6XA 3VR3A 1QFJA 3WHIA 5JSUA 4XR9A 5NULA 5CDYA 2ZB8A 2J0UA 4RE5A 1SE2A 5AW2A 3BREA 1JIQA 4XLLA 4Z99A 4PGFA 3A6HA 4GEGA 2IHNA 5E38A 4RC9A 1DYQA 4DIMA 3VZQA 4ENRA 4D97A 5C46F 2A4ZA 1Q3HA 4UTRA 4U63A 1A8QA 1PRYA 2BFEB 2ZJ0A 4RBNA 4AVYA 4UBKA 4N47A 3EGDA 4OBBA 1XLQA 4HADA 2UUCB 1WXIA 3ISJA 2FW0A 3NONA 3ZX4A 5EHTA 1C4XA 2NYRA 4B45A 1FRZA 1JRPA 1BIFA 5CXXA 4LE1A 3D7RA 2EX4A 2KC2A 2X8BA 1MA3A 3BWXA 3JATB 4EG7A 3TGPA 5COBA 2BS2B 3KEOA 1Z6ZA 3A3OA 4D8TA 3DE7X 3M1LA 2F1KA 4XDZA 2ZEQA 1ZOPA 5FK9C 3JZFA 2AOTB 3QM1A 1Z13A 2CLCX 3CEPB 4KQMA 4V0KA 5C37A 3AG5A 3EE6A 4U2GA 1CUJA 3EXG1 4ONEA 5PNTA 3U80A 4ARAA 4MIKA 1SXQA 3R3MA 2JLBA 3RSGA 3KT0A 4FLFA 3P2IA 4Q3AA 2EW2A 1VJGA 3A4NA 5CYOA 5CFPA 3QU5A 4ZAFA 1YAHA 1U6IA 2ACWA 4HUJA 4H6PA 2R11A 4YRQA 5KSOA 4H1UA 2AVDA 1VDZA 3S55A 5JPCA 3ST7A 2Q3MA 1PYDA 1NR7A 3KD2A 2PPVA 1L7NA 1VL2A 2ECFA 4HDOB 4IKGA 1ZHFA 3E9RA 2R44A 4DGSA 2RFLA 3S2AA 4NE2A 1XLPA 1FZQA 1E1LA 4BVFA 2C9WB 1NWHA 2NU8B 2DEUA 2BC2A 2KMCA 5DU2A 2VUTA 4HBZA 2O48X 3OO1A 4NSNA 4DPKA 4N5MA 4NYIQ 2IP2A 5CRIA 3DVSX 4BVKA 3PREA 2Z1DA 4X94A 3AESB 1SVMA 1MP0A 4G0WA 2X1LA 1S2LA 2PQMA 4TKVA 1YZYA 1B6GA 4RL0A 3E70C 4DKJA 5F9FA 4EIWA 5F7OA 1LNSA 2GTIA 3PRHA 4KRXA 1LFDB 1H22A 5FYQA 1V45E 1JSRA 2KB0A 1MXFA 2DZJA 2WF6A 5JSQA 2WM9B 2IZOA 2NYVA 1X1EA 3GFFA 5KYWB 1R0WA 3V1KA 2PBRA 4X1IA 5JCJA 1D2MA 3VPBA 4EPTA 2D13A 2OEDA 4I4NA 3ECCA 3FKSA 1L4YA 1I4EB 3D3NA 3H8VA 3JQ9A 1XJQA 4KK4A 3T1OA 4U0JA 1ENYA 4OUDA 3HNRA 3TR0A 3K4HA 1Y1SA 4IEEA 5KIKA 5DX8A 1UBCA 3NR2A 2PKQO 4P0QB 2ANBA 4B9KA 4QNMA 4Z51A 3AL0C 2BT4A 1K7SN 2W9NA 2IQIA 4R8RA 4PG7A 2QSYA 2AI1A 4NYJR 2VK8A 3GFTA 4BGUA 3DZJA 2JJ2A 1GZ5A 2ZR9A 3NTVA 5LXTF 3ENKA 4W7IA 3VKFA 3BFPA 3DE5X 5K6AA 4FBJB 2J52A 4LQDA 3SDBA 3O47A 5JS6A 3IEMA 3ER9A 1IEVA 4FDLA 4XQGA 3UJHA 3L1JA 5SICE 2J0UB 3DJFA 4CI9A 4HAXA 1DQZA 5LMUB 5I7WA 3STUA 1MG4A 3DMGA 1PQWA 4W9KA 1KP2A 4XM1A 4ER0A 3OJ4B 5MN4A 2Z5VA 1YQTA 5EIHA 1ENOA 3EGDB 4LRQA 4D45A 2PAFA 5ALXA 1VG1A 1T2VA 1Z06A 1UXOA 1XP8A 2I4MA 4K7JA 1TFUA 1E4EA 1F0PA 2X4LA 2CHXA 2O0MA 4FUTA 2AWOA 3P2OA 3P9YA 1DMRA 3DVQX 3EC2A 2X3FA 5CJ2A 2R2GA 1NI3A 4OX9Y 1U4NA 2C57A 2DHEA 3OEEA 1VXOA 2G76A 1QHEA 3S3TA 3ZUGA 4J0DA 3F67A 2OFOA 1YJBA 2VTEA 3ONNA 1OPXA 4LJPB 2ZJ7A 2BJHA 4JQSA 1YMUA 3PVCA 5DN9A 2WOJA 4QUAA 1I1QB 3IUQA 5KINB 3PTAA 4B83A 4HWTA 1QQTA 2XOKD 1M2OA 2HK8A 1UKYA 1LLDA 3ZVMA 2FR1A 1DADA 2MA9B 1G5PA 4OP2A 4FD3A 1R9GA 3O84A 7AT1A 1DBSA 2ISCA 1AN9A 3W1EA 5IKXA 1RRKA 2NVBA 4Q1VA 2ICAA 1P7CA 5INTA 4QAYA 4FFLA 3NT4A 4RCYA 3BHJA 4PO8A 3N58A 3RRMA 2VDPB 3AU9A 2CLDX 3IVMA 4MH8A 1YBVA 2I3AA 3PLUA 4N9F4 4ADSG 3G49A 1YKGA 5HKAA 1JDVA 1AQLA 5FA6A 3UWMA 3ADCA 2AN3A 4D57A 4EPRA 2DGDA 3KZMA 3OU7A 5IJ0A 3M4ZA 2VAWA 3SDZA 3K6RA 2Z0EB 4UZEA 2QRVA 3IDFA 3LQRA 2VZEA 4XFDA 5FWYA 3IB6A 4Q4DA 5JNSA 4F4HA 4M0MA 1DX6A 1DAIA 2GEKA 2ZYVX 3SICE 3P4UA 4IXTA 2ON6A 1YDWA 3CUYA 2CDCA 1KMHA 1EFUA 1XDSA 1OI3A 3P32A 2DU8A 4NBNA 2H92A 1VLHA 4YAGA 2ICIA 3DMFA 3MCWA 4FOTA 2EVWX 2Z8LA 2FZKA 4QECA 1AK1A 4HWRA 2GNPA 1E62A 2O2DA 1E6EA 2QTLA 3V61A 2E4UA 4P4LA 4OREX 3COPA 2QM3A 3CT4A 4OUDB 5IK2D 4DR1B 1CR0A 3GGPA 2R00A 3EPLA 3RK0A 2UYQA 4FDMA 1OU4A 3QUAA 1IOWA 2VHVA 3RIGA 4BTEA 2SCUA 3QH8A 4JLOA 1J0AA 4CUKA 4RQAA 4YV7A 1RLIA 3LJKA 3RF6A 4MRSA 2IO3B 4FEKA 1XXHE 3EDRA 5JHGB 1V5WA 4PO3X 1IOZA 1WXFA 2L2QA 4Y7CA 1CCWA 2BBWA 1KBQA 3NZEA 3C3WA 4QASA 1IY0A 3EN0A 4PX9A 3TQHA 5B7NA 3CUVA 3I9JA 1LRJA 3CA8A 4JHXA 3B2NA 5HOQA 2QMZA 2C4VA 4QLBA 3BORA 3ZKAA 1HG1A 3ESCA 4RGNA 3LY9A 4LQCA 1RLJA 3OECA 1C4AA 5DHQA 1L4BA 5EUQB 4BKRA 1VCHA 2O5RA 1JKJA 1XLWA 2BONA 3AKYA 2UUBB 3HGTA 5FADA 2CKMA 4MDYA 3IG3A 1NBHA 1XTJA 2OCBA 5A7FA 2OHIA 4TRNA 5C2TB 2V3CC 2VDJA 1OTYA 4ENWA 1KQOA 3WAJA 2GHRA 2QMYA 4AJ1A 1WF9A 1U4OA 2XTZA 4RF0A 1WHTA 1JNYA 5L8VA 4ZYSA 4MW7A 3RBXA 1COZA 4W5OA 3ZQKA 5JRJA 1XQYA 3ITEA 1ZJJA 4U9IS 4PVTA 1W6UA 3WKAA 4PHHA 5K6TA 1KEEB 1E4EB 3FCCA 1VRWA 1P6UA 1Q3KA 3KJGA 2WRSA 1MNQA 4JGHB 2C99A 3T1VA 4MS1A 4K3CA 1H66A 3RTGA 3I01M 4AMGA 1UBRS 2ZDHA 4Q3NA 3A6FA 1SXPA 4KEAA 1UKCA 2QQEA 2VAMA 4B7CA 5GOTA 3TDKA 4Q3KA 5JXVA 3EDMA 4JDPA 2G9HD 2VYQA 2XCTB 5JFGA 3LXXA 3GJXC 1H1LA 1MB0A 4FFDA 5D1HA 2R6AA 3IAFA 1M2OB 1GNUA 3OO0A 4MPRA 1JHUA 2V0NA 1V16B 3LBIA 3RG2A 3PIDA 1XJCA 4FQ8A 2P77A 4MRVA 2OGZA 3MBIA 4RM2A 3TRJA 2IV2X 5ECYA 3TBLD 2PIDA 4W9GA 3F1KA 4W5JA 1A7KA 2ZK7A 3PPYA 3CW9A 3CLHA 2L0TA 4G5QA 1MX5A 4X5OA 4RD4A 1NRJB 3DEFA 1VP3A 4BLTA 3SBOA 3G2QA 1BN6A 4R3NA 4S3MA 1OIWA 1AA6A 1QLJA 2DCUA 4ARBA 1AZSC 1ZI8A 3MFYA 4JUIA 1S2IA 1I4DD 2P2YA 5L4LA 3DM5A 1XZJA 5LQKA 4H7EA 4MV1A 1W5TA 3TCNA 3IQGX 1U3VA 3Q85A 3WLMA 4PYKA 2P9QA 2EKEC 1CE8A 2QRVB 5B1UA 1GTSA 3W5IA 4K28A 1S89A 5FWYB 5JZBA 4OZAA 4B95A 3PQ5A 5DN6A 3WYAA 1JR3E 1F0YA 3KWJA 1TZMA 5LU8A 4PX3A 2TMYA 1SBCA 1KMHB 2EJBA 4PS3A 4D9NA 4ESVA 3IEXA 2NYAA 1CIJA 2FUNB 2I6SA 1FU7A 3CGGA 1OX6A 3F4KA 3RTCA 2YRFA 4FYHA 4E09A 4P92A 4UM9B 4BO8A 1OX4A 3HCFA 4TQ9A 1GT91 2UDPA 2GEJA 1DAOA 4MGZR 3QG1A 1KKMA 1N7JA 1LDGA 3RUIA 5KYKA 4ASUA 4YSBA 1W47A 4X3PA 5JI3E 2PQ0A 1UBKS 3KLNA 1KPIA 4LJ8A 2VNKA 4OGGA 5JLAA 2RCNA 1GNQA 1DXOA 3LYLA 4LRSB 2PSDA 1YSCA 4EY5A 1PFKA 2SCUB 3WYCA 2NXCA 4RIFA 4PPYA 1YIDA 1Y80A 3E05A 2ZBFA 1NQ5A 1HDOA 1WIWA 1S01A 3GMTA 3DE0X 4BQOA 2J9RA 1ORTA 4DCCA 3OTWA 1JHAA 4RLQA 1PI3A 3W2DA 4B8WA 5LZ2A 3ECSA 5JE8A 1E2UA 4EJ0A 1G20A 4EUEA 4OF4A 1U7UA 4B80A 4NAHA 1UWVA 1FMFA 3T7JA 2UUAB 1DZ3A 3KFXA 1TZ2A 5HKKD 1V6EA 3MWYW 2G07A 3WNCA 4BNVA 5IT5A 5F2EA 3BD8A 4TS9A 4WUTA 4KPGA 3FCOA 1NIPA 3ZVVA 1JKJB 5FBZA 4CG1A 4GI3A 1U7DA 1ISFA 2QR2A 2Y1WA 1TTHA 4FYJA 3N7TA 1P3DA 3TDNA 1HL7A 3KAQA 4GRAA 2KQ4X 4Q7JB 4AYXA 3C5VA 4BFXA 5JIBA 4F1SA 1LY1A 5HUQA 3D8RA 4I9NA 2C4KA 3TQCA 1FFGA 3T9BA 1WHTB 3NAQA 4L5CA 2H5JA 5AWFC 1V6CA 3VPGA 1DRWA 3SPXA 2ACZB 5KQRA 4MGIE 2PLRA 4WGFA 3CMMA 4I50A 3IT2A 4R51A 5ADUS 1MC8A 1W4ZA 3QRWA 3KT3A 2X6RA 4B3BA 4D02A 2E37A 5EJ7A 3VUYA 1UT8A 5CK4A 1WGGA 3PT9A 3GMSA 2O2YA 1NF2A 5FTLA 4MKHA 4MS1B 721PA 2ZWVA 3I6ZA 2DETA 3OZUA 1NURA 4JASB 4K7WA 1ULAA 5IOIA 2YCBA 5JH7F 2QEQA 2J41A 3RBAA 3NHFA 5A23A 3JWEA 3L7IA 4MSQB 3T1TA 4DWVA 5E6JA 2CXRA 2P97A 2JFHA 2AN4A 3A6GA 3V80A 1XOIA 1E96A 2X7HA 4F9FA 5F33A 3HM3A 1II0A 1H1LB 2Y92A 2CF5A 4MVYA 5AKXA 1GZ4A 5FLYA 4FE3A 1ECPA 3LL7A 1SIJA 3K72B 1WDMA 2KAJA 1DQPA 2FIFA 1QTNA 1T9BA 3GVXA 4K9PA 4DIFA 4DQVA 1CS0A 4NE7A 1Q91A 1QH0A 4O63O 2ZCCA 2I3GA 2GBLC 1STEA 3I37X 4D4KA 3E9CA 4NG5A 3GGJA 3ZDRA 5K3FA 4KRFA 2W6QA 2BMVA 2D7DA 4OL9A 3V55A 2JI8A 4O02B 2G06A 3IBSA 5K3OA 4FONA 3WA6A 3A9UA 4OM7A 2JIQA 4P32A 2QVGA 5EXTA 4IWPA 3EVDA 4LI3X 1TM7E 2F8LA 3OIFA 2WPDA 3A32A 4YJHA 3RRBA 4YRRA 1U7WA 4GBMA 1HX7A 1G41A 2Y8BA 2C8VA 3U13A 1EGHA 1XQQA 5CEJA 5G0SA 1JQ5A 1CE8B 5TSDA 1Y8CA 1A69A 4YXWA 3KTAA 3EFCA 2HLNA 2C7VA 4RD3A 1CW2B 4IFEA 1RHRA 3W2GA 5CPFA 3ZHQA 4MEBA 1ZGBA 1CNEA 3Q3IA 4N6GA 1ZGCA 3ED1A 2VRCA 4JA2A 3BCUA 4GRDA 5JSHA 2Y6UA 3BH0A 5A5GA 1QB8A 2E6UX 2A7MA 2D0PB 4FYWA 3TBHA 4A8TA 2KHWB 5IUKC 2Z9DA 1OX4B 4HS4A 1U2DC 4DBLE 4KITB 1Q0QA 3N7UA 1XLVA 3T0GA 3AERB 4N65A 3RUIB 4BLQA 3B2QA 2CYBA 4LMPA 1VFPA 1X42A 5LBIA 2JIBA 4DAOA 3Q8KA 1COWD 3OZGA 5B2ZA 2R6DA 5KTPA 2ZPAA 1PJCA 1UQTA 5CNJA 3UB2A 2PMFA 5EXPA 2E85A 1U3UA 3OCZA 3EW7A 1AJEA 1SB8A 2KVRA 3T9AA 1TBEA 1F7UA 1SJHD 1JEQB 4DRYA 5JNRA 4YRSA 1N0VC 4ZWNA 1Q7TA 3NI2A 4Z4QA 4ZT2A 3J80A 3DKVA 4C78A 4WD3A 2B83A 3HCNA 1XKLA 3TIGA 3LO8A 4E5DA 3BTOA 3G8CA 1H8CA 4Q3DA 3DHYA 4JCOA 1NQUA 2WD8A 3UIPB 2A9OA 4FU0A 1H2ZA 4AN1A 4I55F 5C8YA 4A1FA 1B0PA 2Y8AA 1DG3A 4AWBA 2WDRB 1MU0A 2H7XA 1TYEB 1Z2NX 1Y7PA 1FRRA 4GCWA 3RWBA 2WDQB 5BVHB 3RS5A 2QJRA 4D3SA 1EFLA 4FJ1A 1D1SA 3TAUA 3RAJA 2G1EA 5DE3A 1ZCBA 5LBTA 1WE7A 4RH0A 3VVWB 3KALA 1OXSC 5HWSA 3GAFA 3ETNA 2JZCA 2GHQA 2GF9A 2A30A 2C0QA 4TZFA 3U3ZA 4ND3A 4DG5A 3UQAA 3H8WA 1VGVA 2R6FA 1WY8A 3TTTA 4B09A 1G9TA 3HC7A 4G09A 2MWMA 2H7CA 5LLIA 2XUOA 2UWQA 1T91A 3HUEA 4EHKA 4BNMA 3GJ8A 4EI9A 3HN6A 4JU8A 3Q8AA 2V6MA 1CF9A 2GQ0A 2PANA 3VA7A 1O8BA 4EW6A 5BN5A 2RD0A 4MULA 4E7PA 3NDIA 2MMGA 3T7EA 1QIEA 4X97A 3TUOA 1VZ8A 3UVEA 1NXXA 3HZZA 4IDFA 5DBOA 3WICA 2RKBA 4B6SA 4MS3A 1HT2E 1PD1A 2A7XA 4X7BA 5LP1A 1ZM9A 1C7RA 1JDNA 1FCJA 3L79A 1JAYA 2VNAA 3RUCA 2ZJ5A 3Q8BA 2FCRA 3KHUA 4BNKA 3GRZA 4PGGA 3Q8MA 3V2UA 4YXDB 4OFXA 3VYSB 1EWYC 5I3ZA 1EVLA 2PNJA 4XDGA 4E1BA 2YRWA 1V37A 4HAUA 4BO7A 1TQ6A 2ACKA 4CQMD 4DGQA 2WWYA 3D64A 1NMZA 2Q3CA 1WZNA 5K3FB 2NBUA 3KJNA 1K8RA 4TMXA 2P9BA 3UEOA 4A2WA 2GB1A 5JWOA 1RWXA 4GBJA 1FXWF 4DR5B 3ET5A 1IUPA 3K1AA 4JP8A 3F5MA 4M9SA 4I9FA 1WABA 4PR0A 5ACWA 2V4ZA 3ZCUA 2ZBEA 1JJFA 1PJ4A 2XDQA 3KTDA 2C00A 1NRXA 2GPNA 5FQAA 3HV2A 1SQFA 2OYCA 4MR8A 4G07A 2HE7A 3OOYA 3MWEB 2ORED 2J4FA 1L7AA 1RW4A 3DAGA 4NP6A 3LMKA 4HTFB 4ZVOA 2QV0A 4DXAA 3KTAB 4F8YA 3AXCA 3VQTA 4TL8A 1NVID 4CN9A 2K4MA 4II7A 1YKSA 5T8KA 1DRVA 3A26A 1EJ0A 5H68A 3PG4A 3WOHA 1HM5A 1JDBC 3JTEA 1X80B 2O52A 5BT9A 1VB3A 4JYZA 3I5XA 1XQXA