3T3NA

Molecular basis for the recognition and cleavage of rna (uuccgu) by the bifunctional 5'-3' exo/endoribonuclease rnase j
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
550
structure length
550
Chain Sequence
b'GPQDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGAEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Metal dependent hydrolase
publication title Molecular Basis for the Recognition and Cleavage of RNA by the Bifunctional 5'-3' Exo/Endoribonuclease RNase J.
pubmed doi rcsb
source organism Thermus thermophilus hb27
molecule tags Hydrolase/rna
total genus 160
structure length 550
sequence length 550
ec nomenclature ec 3.-.-.-:
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3t3nA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 3t3nA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3t3nA01
2HB9A 2YNVA 1DD6A 2DOOA 5AYAA 3ZQ4A 4HL2A 4C1HA 1L9YA 4HKYA 4ZO3A 4D1WA 3H3EA 4AX0B 1JT1A 2Q9UA 5EWAA 2I7XA 3IOGA 4NQ2A 3I13A 4J5HA 3SRXA 1X8HA 4NQ6A 4AWYB 2XF4A 2YNVB 1YCGA 1MQOA 3AF5A 3IE0A 5ACWA 3I14A 3SPUA 5AEBA 2P4ZA 4GYQA 2ZWRA 4EFZA 4FEKA 3TP9A 4EYFA 3BC2A 2NYPA 4C1GA 2ZO4A 5AXOA 1A8TA 2BG8B 2YZ3A 4NQ4A 3I15A 2WYLA 2ZNBA 3IE1A 1KO3A 2AIOA 4ZNBA 4KEPA 5K4NA 2A7MA 3X2ZA 3PG4A 5LS3A 3DHAA 3R2UA 4AD9A 4TZEA 2BMIA 4GCWA 3IEKA 5LM6A 1WRAA 5ACQA 5IQKA 4F6ZA 2AZ4A 3IDZA 5DPXA 2QJSA 3KNSA 2ZZIA 4XWWA 2BC2A 3P2UA 4HL1A 3PY5A 5EH9A 5HH6A 5EVKA 2BIBA 3I11A 1DXKA 4RM5A 4YSBA 2BFLA 3ZWFA 2OHIA 1QH3A 4Z5ZA 5FQBA 2QEDA 2BG7A 1WW1A 3T3NA 3SBLA 2BFZA 1XM8A 1BC2A 5KILA 3RPCA 2WHGA 2QDSA 2BFKA 5EVBA 1YCFA 3WXCA 4C1EA 2BG2A 2GKLA 5A0TA 2Y8AA 1BVTA 4LE6A 5LSCA 4XUKA 4FSBA 3MD7A 4UBQA 5FQAA 2UYXA 2BG8A 1ZTCA 5EVDA 4O98A 4Z5YA 4F6HA 5ACRA 2I7VA 4PVOA 3DHCA 3RKJA 5EW0A 2P97A 2BFZB 2YNTB 5LLDA 4V0HA 1HLKA 4RAMA 4Z6XA 2Q0IA 4ZO2A 1VMEA 4TYFA 5ACXA 2BR6A 3T9MA 3RKKA 1ZNBA 4TZFA 5HISA 4DIKA 3ZNBA 2GCUA 5B15A 5ACPA 5K0WA 4EYLA 5HH5A 1VJNA 3ZR9A 4D1TA 3IEMA 3IELA 2FHXB 5FQCA 5AXRA 5HH4A 3KL7A 2GFJA 2OHJA 4FR7A 4XWTA 1E5DA 2NZFA 1ZKPA 1KR3A 4TZ9A 2BGAA 2FM6A 3IOFA 4ZEJA 3X30A 2Y8BA 3BV6A 2VW8A 4Z60A 4UA4A 4GYUA 4P62A 2BG6A 2M5CA 2FU7A 4RL0A 4D02A 4J5FA 2GMNA 3SFPA 1VGNA 4YSKA 2NZEA 2YNUA 4PVTA 3X2YA 5KIKA 2GFKA 3F9OA 2R2DA 3AF6A 5EV6A 3IE2A 2BTNA 3Q6VA 4H0DA 2YNTA 4BP0A 5LCAA 3FAIA 1P9EA 4TZBA 1X8GA 1WUPA 5HIPA 3X2XA 4AWZA 1JJEA 1SMLA 3A4YA 3LVZA 2FU9A 3DHBA 2I7TA 2H6AA 5EHTA 4C1DA 1DDKA 2P1EA 3T3OA 4UAMA 2FHXA 2CBNA 5LMCA 5ACVA 4EY2A 5EV8A 2E7YA 3AJ3A 1KO2A 3SW3A 2Q0JA 5K4KA 5LE1A 1Y44A 2QDTA 2WYMA 2M5DA 5A0VA 2YCBA 3VPEA 4Z7RA 4EXYA 5A87A 4D1VA 5A5ZA 3FCZA 2QINA 2XR1A 3I0VA 4WD6A 4D1UA 3KNRA 4BZ3A 3G1PA 1K07A 5LCHA 4C1FA 3ESHA 2NXAA 4AX1B 3PY6A 4UWPB 3JXPA 3S0ZA 4KEQA 5B1UA 2FU8A 3BK2A 2Y87A 4C09A 2WRSA 4B87A 5K4MA 4NQ5A 5AHRA 4Z67A 4U4LA 3BK1A 1YCHA 4CHLA 4EXSA 4TYTA 1M2XA 2WYMC 5HIQA 4DILA 2P18A 4UWRB 2YNWA 1WUOA 2FU6A 3ADRA 4RL2A 5ACSA 2OHHA 4YSLA 1BMCA 3SD9A 4RAWA 3VQZA 5LCFA 5AHOA 1A7TA 4EYBA 2FK6A 1QH5A 5ACTA 2DKFA 1XTOA 1X8IA 5B3RA 3DH8A 1JJTA 4RBSA 4UWOB 3L6NA 4UWSB 4C1CA 5ACUA 2Q42A 4JO0A 3QH8A 5HIOA
chains in the Genus database with same CATH superfamily
4UASA 1ZNWA 3TE6A 5A4AA 1J9EA 1CZLA 4JHLA 1NR5A 1JDPA 1CX9B 3ZXSA 2MSNA 3IHLA 4JQCA 3V6MA 1CNMA 3B3AA 3PDUA 1WXAA 3IIJA 4S24A 1P1RA 4F0JA 4PIVA 4JI8B 3KV3O 4BVKA 3AJAA 1V5EA 2UUOA 4CL8A 5UKDA 3QE3A 1AGXA 4HN9A 2WMYA 4LDQA 1LI4A 5IRCD 3HC7A 2HK6A 2P78A 2JPDA 1PUIA 2GRJA 2X5JO 3RVOA 4Q4CA 2IS1A 3APDA 4RK4A 2C83A 1MRZA 2FZVA 3FE2A 3VHLB 1CR4A 4RHEA 2FRDC 4HOYA 3PHWB 3CVUA 4ZRMA 4JVLA 3I6QA 4EF5A 4IDCA 2CHGA 4FS8A 4K6GA 1JI0A 1YRWA 3FCEA 3N5CA 4HI0E 2DBRA 1P45A 1FTGA 1A5AB 1DKPA 4R81A 4DQLA 4MR8A 5BWCA 3PDJA 5EZSA 1RWQA 4MW7A 3H18A 3S27A 4ASUD 5IO9A 5KNLA 4WZAB 4LNOA 3X3HA 4TVKA 1YDHA 4WZBA 1TUGA 2QQEA 2KDFB 3RRFA 2DGDA 1BUIC 3LT2A 5KOJB 3HRHA 3VOSA 5G4LA 3P96A 3FNBA 3GQBA 4IH9A 1U4SA 3ROMA 4GYWA 5KTTA 1AUPA 4DLTA 1WXIA 1QTRA 2KFKA 4KNYA 4AJ1A 2IIQA 1E7VA 5E3IA 3UY4A 2LCQA 4XPIA 4UVGA 3E2IA 1GL6A 3CLUC 2J0VA 3K70B 2CXSA 2FW8A 3B3GA 1QH8B 2NLOA 1KSHA 1W19A 4ENVA 2QUHA 3I58A 5JNRA 4I4LA 1J09A 3KBBA 3QMVA 4TT3D 5HFJA 5CK4A 1KAMA 4RS3A 2PW9A 3JQAB 2Q1WA 1VLZA 3K0FA 4FN4A 5AJXA 2QV7A 3AI7A 5LA6A 1JFFA 4R8MA 1ZUHA 4IM3A 2LVQA 2XYVA 1V80A 5TGDA 4KODA 4S1PA 3UWSA 4PCLA 5G0UA 1GT91 4TQ0A 4D26A 3OECA 3BYYB 4M98A 2X77A 3ZV7A 1PLJA 1ZGJA 3ZC3A 3OESA 3PIIA 1D03A 1P18A 4AOFA 4XDZA 2ZI5A 4DLVA 3U4IA 4FYVA 3WMXA 1TA0A 4OHPA 2FG5A 4Q1FA 3X2XA 3ZYYX 3HI6A 1J8MF 4JCCA 4P0TA 3N2GB 3OIDA 1WUHS 2KXJA 3TZQA 2W54A 1ZESA 2ZI9A 1DDKA 2P1EA 2L17A 4DJ5X 3WOHA 4HGPA 3D7RA 3PRKE 3DPDA 1LVGA 3AU9A 3IAEA 2QDKA 5IC4A 3JQRA 2BKXA 3B85A 2GTPA 1E4EB 1P0RA 1WYWB 5L3QB 4IDOA 1ZX1A 4O29A 2C7NB 1AHPA 5AM2A 2P1DA 1ZM4A 3IMCA 1YVEI 1V1JA 4KDRA 3TZ6A 1L5VA 4JC8A 1V3TA 3QF7A 2OENG 4MVJD 1B6SA 1GAXA 1M2NA 1V8OA 4F85A 2PTLA 1XVTA 2RKOA 3QU4A 4NG4A 4BGVA 1P1KA 2D4HA 4KVZA 2D07B 2P9HA 4NAMA 1ZU5A 3FJYA 2IDYA 1JDSA 2HA4A 1LBIA 1GQQA 5KHAA 13PKA 2W42A 5JSFA 4WT7A 4NMHA 1LI5A 1FY2A 1P62B 5JAIA 4LWZA 1H8ED 5FOUA 3O3MB 1A98A 3OPYB 3WCQA 1I0LA 1ZJ5A 4G67A 3M63B 5HF8A 4D8TA 2D0OB 1UKAA 5I3CA 3BA1A 3Q3HA 4L85A 3R2JA 1S6YA 4FMDF 1TQ4A 1YR7A 1QR6A 2H2IA 4YYZA 3LPLA 1J24A 1J5PA 3A9TA 2JW5A 4QGFA 4HN2A 1CUCA 1E7PB 1BH6A 4G4SP 4C78A 4ZYUA 4NJEB 5HF6A 4BP8A 2XOEA 5MN6A 1IXKA 1BE1A 1UFQA 3FYDA 1RTKA 1HYEA 3Q10A 4A2QA 4B46A 3M4ZA 1M7GA 4M1YA 4GPAA 3T9AA 5EJ5A 4HSEA 3KJZA 1P72A 3FUTA 4E1VA 3BXZA 5F4ZA 5BW8A 2JIZD 1OTYA 3EZXA 2WDPA 1UIRA 1RZRA 5EGNA 1HY3A 3OU2A 4HX2A 5KQMA 5JPIA 5JO0A 3M3JA 5HIAA 5LM6A 1XJ5A 4RSRA 1XEWX 1J4AA 5ITSA 4AURA 4XIJA 5DPSA 4G85A 3U4HA 1HMPA 4MVJF 2BBWA 1ZMRA 3JW0X 5M34A 5GONF 3BN3A 4K87A 2MJ3A 1IY8A 1BC2A 4FZ3A 3K3PA 3EQ9A 1KJ9A 3F5SA 2PVCA 5DTMA 5KNDD 4FHZA 2GCOA 3BCUA 2B21A 5JROA 5ALTA 1P4RA 3KYJB 3ZD8A 4JCOA 4WW0A 4RYLA 2VVTA 1K4YA 2E2WA 4IJ5A 3AHGA 4QNNA 1G8SA 5FK9C 4HWTA 4D43A 2GJSA 1YJQA 2IDJA 4S05A 2ODQA 4Y0NA 4K88A 4Y6GB 4WI1A 5HVNA 2R751 2DBZA 3UGJA 3N2ZB 4WX2B 4OEHA 4BRUA 5CA0F 2WIJA 3A32A 1E6EA 3AB5A 4F86A 5D3IB 4FJVB 1MC5A 1QS0B 3AY7A 1XMIA 4D74A 3JQ6A 3ORHA 2J9XB 4GXRA 4TTQA 4QDXA 3RNGC 1AQ6A 5JRJA 4WAAA 3QVJA 2WXFA 2P1ZA 2NZFA 4YDHB 1PP4A 1VE5A 3EEBA 2AC2A 4HUJA 1XB2A 3ZYZA 3GEBA 4D8YA 4ARUA 1K6IA 1SU6A 2OLKA 1M34E 1J8VA 1YJCA 2C77A 3PQFA 2ZCJA 1CUUA 1F8GA 1G7CA 4MKRA 1DVRA 1GRNA 2GOYA 4US8A 2C3YA 2ZWMA 3IE2A 3CF6R 5AW9A 3PCTA 4AJEA 2C0PA 5DCYA 3Q7RA 3KOMA 1B3BA 3H8HA 2WDTB 3G02A 4BEJA 4WDRA 4ICUA 2KJHB 2DXIA 4L07A 4Y18A 1D4BA 3OVMA 4GKVA 4R0MA 1Y8AA 3MXTA 5LSAA 4Z7OB 2G9ZA 4K1XA 3AR6A 1WIAA 2DF8A 2R68A 1I4GA 5FB3A 4F4UA 4IINA 5BSHA 4C1BA 3IQXA 4MI9A 3NORA 3NBXX 4UUPA 2LE0A 4EXYA 1PZNA 3I0VA 2A35A 4KO2S 2L42A 4JY7A 3MMXA 1J33A 3IAUA 3V9PA 1TUEA 3DXXA 3T7RA 3TR6A 1OT3A 2LXAA 3ADBA 3F71A 3LSYA 4K9RA 2NU7A 4TTAA 3TTVA 3L7JA 4A0QA 2R8ZA 1EUDB 1NBMA 3VDRA 1OZFA 2UUAB 3P2EA 1ZS9A 4FKBA 2L18A 2NSLA 2XBLA 1K52A 5KQRA 1Y7TA 3TOVA 2HR1A 3RPEA 4G81A 2W8BA 1WKVA 1EFPA 3VZSA 1W6UA 1LS1A 3II6X 4A0GA 4DNXA 3T61A 1R9GA 2XF8A 5BWLA 3WLMA 4DIDA 1RHMA 4GO1A 4RJLA 4EKEA 1QH5A 5LJIA 3CLVA 3H1PA 4RJJA 4XWGA 2LUEA 3C3YA 3SNHA 4B83A 3EZ2A 1P74A 1K2VN 2MSLA 1QJCA 3A6EA 3D2BA 2GXQA 3C0KA 3VUYA 1U1EA 3L6BA 2M6LA 1Y9EA 2Y93A 3DSRA 4J29A 1J42A 2MQJA 2RHRA 3L8DA 2YXBA 2AS0A 1TTHA 1BMDA 2CUKA 5JAMA 1TEZA 1GTSA 5DSTA 1LBQA 1AKWA 1MQAA 1TUBB 2BJWA 4CI9A 1A4UA 1L4GA 1XRLA 2C8JA 1RVDA 3TGLA 2QNIA 1H2YA 4B7CA 4GOKA 4HRSA 3KHKA 2MBHA 2N7DA 2PZLA 1SH7A 1KGDA 5HQTA 3NEJA 1Z63A 2WTXA 3ZIAD 2VH1A 3UGKA 4BOYA 3IC5A 1E79A 2HRQA 1KO3A 4WFQA 1D2NA 1I3LA 2OD9A 5K4NA 2CXHA 5IBRA 2R44A 1QKKA 4PQRA 3I45A 2IPLA 1NSFA 1VP3A 5ALVA 4G07A 1Z74A 1A7JA 3OX4A 4XIYA 4F45A 4NDNE 4EKIA 4LXQA 1EDBA 4L28A 5EJ9A 3OJXA 2ZW9A 3AHJA 5IJ0B 1QG0A 3DLPX 4BDTA 2IUUA 4MUAA 4OXQA 3LQRA 4BMOB 3OE7A 3BF7A 5JMTA 1EEHA 1Y9AA 2QDSA 3GLVA 4JMLA 4RM8A 1U0GA 3MTBA 1N1EA 1DNPA 2ZJFA 1T6BY 4HPPA 1I1NA 5JR3A 1DJOA 3A6ZA 3RIHA 1I2CA 2ZIXB 5DASA 6ABPA 3PTAA 2MINA 4IIGA 2DWQA 1ZD9A 1Z2MA 3DQVA 4OLFA 1X15A 3UT5B 5B5SA 3OOWA 4E2FA 1P60A 4ESOA 4GRDA 3ZNQA 1SXJB 5I4KA 1YZFA 3DG9A 4NBKA 3NHJA 4JQSA 3WV4A 4FUTA 1WX8A 2FDRA 5FV4A 4REOA 1J2UA 3IUMA 1C4KA 3DAYA 2HDHA 2VAMA 3AN1A 2NUTB 2NV0A 1U9CA 1JL3A 1IBSA 4B3GA 5KOJA 4MH8A 3LIPA 3OZFA 2QI9F 4YO7A 1P2TA 1UMCB 3DKKA 3DQPA 5CYOA 4JLDA 4PE5B 4CMEC 1FTWA 1VCMA 5EQJB 1V1MA 4WWNA 1ZUNA 2ZIZA 5TQVA 2OOBB 4OJKA 3KAQA 1ZMOA 1GUFA 5FRDA 4D9GA 2P41A 3HO8A 1CZOA 4PO8A 1RCTE 1TJPB 3H5WA 4WRRA 4A4DA 2HW8A 3VYSB 3IIIA 4OA8A 4JITA 3EGIA 2BR3A 4MWCA 3I4FA 4I08A 2V97A 3A4YA 2RHTA 2I2XB 2NBUA 4KQJA 3JQAA 2FZGA 1QQ6A 1EI9A 4LGVA 1I2MA 1FNVA 3MMSA 4K26A 2QL6A 3OIGA 4QVGA 5HZGA 3CRRA 4URZR 4EW1A 3NUQA 4W9RA 3A1WA 3IT1A 4GOXA 1UMBA 2BQQA 1T1GA 3U52E 2PBZA 3DZJA 1BXRB 2PRYA 3KVYA 4DT1B 3DLCA 1OAAA 3JWIA 1ESNA 2B5OA 4GLFA 2JL1A 4RY2A 3STVA 3HFJA 1MO2A 5FEMA 3RC2A 5KIAA 1V35A 5A7HA 1JKFA 4Y2RA 2OCAA 2J3DA 2PZMA 2VZKD 1E1MA 3D4NA 1I8TA 3N2GA 1HNNA 2OC9A 2OCIA 4KSBA 1SG6A 1JMVA 3CLUD 2CHZA 4UNIA 2CF5A 2GBLA 1NXTA 1KF0A 1QAOA 2WHPB 3N6RA 3ZZNA 2JZZA 3C4VA 3LV8A 1FUUA 4FNMA 4V0OA 2HI0A 2PIDA 5PGMA 1KJYA 2BMVA 3UQZA 2XMZA 3E0QA 1KJNA 3UICA 1TT7A 1GQOA 4WIAA 4KL8S 4C76A 1GIAA 4Y9SA 4AKSA 5K9ZA 3IR5A 2HWYA 3FPFA 3JR7A 5CG1A 4AY3A 1E9SA 1TQ6A 1H4RA 1KQNA 2CSUA 3DFMA 1L9KA 4LRYA 5D87A 4DWFA 3SX4A 4EY5A 4RIHA 5CHVC 1I4RA 4M1WA 1Z06A 3R6GA 2WD7A 2QTNA 5DCNA 4DMCA 3G2PA 2PCLA 4XGKA 1N2HA 4YJGA 3MQ4A 1NBFC 4Q4HB 2AH5A 2JLCA 4XFJA 1NENB 1L5KA 3AM4A 3OEEA 3DHAA 2CGEA 1MHPA 3KHUA 2CMDA 4LVUA 3SDLC 3E1GA 5ES3A 3DF9A 3DBOB 2D2IA 3P2UA 2HA2A 2AR7A 2PS3A 1PS8A 2IRWA 1Q6YA 4ZU3A 2IT1A 4TMXA 2G1UA 2WA1A 5K05A 3LXXA 4KQKA 3A1SA 2L76A 4W9NA 3DE5X 1IWBB 3M1LA 3LHDA 4NJEA 1PIWA 5DLDA 3HYSA 4LF4B 4ZYVA 1I0IA 4G50A 1LBEA 5FFNA 2GKLA 3LA8A 5AI0A 1ABBA 2Y8AA 4E3CA 4XTRA 4KHZA 5I9TA 3VGPA 3OFKA 4OK3A 4EKDA 1WUTA 2BIFA 2VRRB 1KIFA 3VTKA 2QHXA 2HD4A 1I9GA 3RKJA 2O3QA 4IVRA 3JTEA 3OZCA 3QLEA 5AK6A 1RM4A 1VSUA 4KQ6A 4GX5A 2DLCX 5EKDA 4FA6A 5CVDA 4JQWC 3RKKA 1JHYA 2EX0A 3HVKA 4OMFG 3NVYA 1X70A 3FZQA 2DZJA 4S1TA 1AK1A 3LVRE 4W7SA 1U8TA 3QTBA 2PJDA 3RC8A 3EWIA 2QR5A 2MA9B 3ZDEA 1G64A 2P9QA 2MYTA 2KVRA 5F3DA 4BO9A 4BUZA 1PFVA 3Q8KA 1V47A 1SZPA 4TZ9A 3I09A 1VRAB 1FK8A 2YASA 2C20A 1L7OA 2BKUA 4FBMA 1QZZA 2PV7A 2CFUA 3A7DA 1U81A 4E5PA 1KOTA 4AP6A 4Q3KA 1TYEB 1T2CA 2R4QA 1SVNA 2GEVA 2BFBA 4MQMA 4NY1A 4PZAA 1BJKA 2Y5CA 2ZJOA 4HQNA 1NN3A 1V1OA 2VPQA 5HIPA 3KAJA 2EW1A 3DV0B 1ULUA 4DIUA 3GJ3A 4FHDA 3OTOB 1DRUA 4CW7A 2G36A 4FDVA 2FWMX 3K1JA 2X7JA 4RHXA 5IFKA 2AGVA 1Y5MA 3IQEA 4ZZ2A 1QS0A 1YHYA 1EP1B 1Y8QB 3O1LA 5AVYA 1SU7A 1JFLA 2Q4OA 1RWXA 3TBHA 3LHSA 1N8NA 2Q5CA 1FU8A 1N2XA 3K16A 1E1RD 2AEJA 2CYAA 5IJZA 4YCAA 2AQIA 4ZO7A 2HHJA 5HJ5A 1OGJA 2QD2A 3ZIMA 1JIQA 2R47A 2CE7A 3G23A 3CUUA 1T10A 3C4JA 3DZFA 4CIBA 5AUOB 5E1BA 2RE8A 5IUJC 2WWWA 3K9CA 4QARA 3EVTA 3G2QA 2YDXA 5LWQA 3K73O 4CTJA 4LRUA 4ETWA 2ON8A 3WHPA 3OWEB 1O6GA 1SKYB 1ZQ1A 1VI6A 2SBTA 1NQXA 3A3KA 1PYOA 4NEQA 4AJHA 2XODA 4GI1A 3JRWA 5CHYA 3MHSD 4ZAGA 4Z86A 2B4QA 3UWDA 3Q1LA 2VG8A 1YMVA 2ZR8A 2XQKA 3NHAA 4OATA 2CBZA 3U13A 5JS6A 5LCFA 2FJPA 2Q7XA 4WJZA 1N9GA 1IY0A 4WXPA 5JIBA 1F5NA 1T3GA 1H9CA 2WWXA 4CLXA 2P9TA 3LI2A 1C29B 2WHYA 4R3WA 1C77A 1HPLA 1FCJA 1ONPA 3QQ5A 3PJGA 3CEHA 4B8ZA 5ED4A 2YFHA 4OP2A 2K8CA 2DAPA 2Y1LA 5ARCA 3OFVA 1C0EA 4O1IA 2I3ZA 5HHTA 2PZEA 5EE5B 1ID1A 2HFKA 1K6MA 5IKPA 1YIDA 4WXMA 2JLQA 2C04A 1E0SA 5A4FS 2Q2VA 4KN8A 3N1ZC 2EVWX 1EUVB 1KHTA 1QNLA 2P5YA 1GV1A 3KOYA 4HWGA 1ORHA 2AOUB 3AVUA 4PN3A 3LF1A 4NOLA 3R9XB 1Q2XA 1BSVA 3GVIA 2LR0A 1Q16A 4ESEA 5IJXA 4KJXA 4DZTA 2NYPA 4UBKA 3RTGA 3VUXA 1Z6AA 4UHJA 1GKKA 2R7NA 3AR2A 1WVIA 3NBQA 1SBTA 4JBLA 4LTUA 1RWSA 3N30A 5C5EA 3U44B 3C5EA 5B3JA 1KL7A 2IOHA 3IP1A 4ISBA 2PWBA 4WKPA 2VDKB 4D46A 2QBYB 4L5IA 3L79A 1V2YA 1FDVA 1DZ3A 2BTEA 1MB0A 4CEJA 3HNPA 5DHUA 1T91A 5GM2A 4BLOA 4L51A 3RT3B 3NHUA 1IZYA 3PCRB 2PLPA 3E4CA 3R8CA 1EH5A 1UF0A 1TUBA 1ZD2P 1G21E 1PFYA 4DBZA 3RS8A 3FBTA 4CT4B 2DUMA 1BE6A 4AWAA 2XWQA 2JXXA 4OHJA 4L8LA 3C4QA 4WN9B 5JZ9A 1ZC4A 4YAJA 1GJRA 2G17A 2DYBA 3H04A 3EPRA 2JJ2A 5AW0A 4LPSA 4NHEA 1PYWD 5CUQA 3BKWA 1O7JA 5J18A 2D0DA 3C3WA 4KQ1A 1E7YA 3DMTC 1AK9A 4BMVA 1QOZA 5ALQA 4E5NA 4ZVOA 3NS1A 3WSVA 2UUPA 1EXWA 1FDOA 3OHSX 4F9GA 4Z4EA 3HBMA 2O5RA 3PUYA 4QC2A 1ZNXA 3T5CA 4NE7A 1IOWA 3AF4A 5FQNA 4UTVA 3LQKA 3M4NA 3TM4A 1ZINA 3PX3A 3E5NA 2VRBA 1DT5A 3P4PB 5JS8A 4P58A 2HCJB 2AN9A 1THZA 4I9FA 1FFVA 3TLYA 5IJ0A 2VTVA 1Y8RC 2FZLA 1XD8A 4BN0A 3Q8XB 2OHFA 1P9NA 1V3QE 5CA1B 3TRJA 4PCAA 1ORDA 2FQ1A 2ZJZA 2Q5LA 5J1TB 1J8DA 3DFKA 1QC5B 1QHHB 1CR2A 2O2DA 2ZIXA 3TD6A 4JYCA 2C95A 1VGNA 5DSXA 3M5WA 3QBJA 2PKQP 1XZ8A 1XCOA 2DWPA 1V3VA 3WLRA 5B7GA 5EV6A 2H52A 3UT5A 3L8CA 1S1QB 3E6AA 2W7TA 1SU8A 1GZ5A 4YXDB 1SJ9A 4TZBA 1W5TA 2A1IA 1XQ9A 4GMGA 5ERYA 2E89A 2J0MA 1PT5A 1D2AA 4M87A 2HHLA 3PGMA 3I72A 1B42A 4FGLA 1Y4AE 3MS7A 3P2JA 5CM8B 2WSYB 3PJFA 2YQZA 3W7VA 3V7FA 4C6HA 4ZVMA 2Q1SA 2JBAB 3HADA 4MV7A 1N2GA 3R3JA 4JOBA 1SUIA 3THXA 2B2XA 2AXNA 1L8AA 1FVHA 1L0BA 5D8DA 1PR2A 3R76A 5LUBA 3G0OA 1U3GA 4BKOA 4ABYA 2IYNA 5DGDA 1BWPA 3F97A 2W6ID 1WF6A 5JLAA 2A0FA 3GAZA 2WHQA 3ALBA 4YC7A 5EXXA 3ZKAA 2XUZA 2JLVA 4H2AA 4IM2A 2VYNA 2FUNB 1XZAA 5H02A 4Y7DA 1QVAA 2WDVB 1DEKA 3G3EA 4NU8X 2KS6A 5E3HA 3H05A 1S2NA 2EZ4A 4UUMA 3RJZA 4P35A 5HP4A 3EGDA 3Q8AA 2FSVA 1E0ZA 2I65A 1MG4A 1FXAA 3FR8A 3PHJA 2VYVD 1TY2A 1P7CA 5A06A 4MMZB 4DGQA 4FE7A 1RAAA 3TPFA 4PWZA 2H4YA 3RYCB 5LQUA 1E60A 5TMEA 4JI4B 1NMSA 5B12A 1IHUA 3R2TA 1CZRA 3PNQA 4KBGA 3S81A 4KCGA 4PEVA 5K8LA 1EFKA 3FJOA 2FJ0A 5FD8A 4MUYA 1YB7A 3IESA 1OYOA 1QYVA 1MJGM 2N42A 1BXRA 2NVUI 3VDMA 4B2IA 2DOOA 2XB6A 4NDAA 5FPQA 4ZYYA 3PTZA 4DT1A 2EKZA 2OT3B 4KREA 2E0IA 4ZZ3A 3KOWA 4RDXA 4IXWA 1GNSA 3PYMA 1YDMA 2FUEA 2KWDA 2H16A 2AX3A 3S2FA 1IP9A 4DB4A 1IQUA 4L9WA 2X1HA 3Q6MA 2WXJA 4A1FA 1IXSB 5BN5A 4LRTB 1YZGA 2MCFA 3LDHA 4QUBA 3I9OA 1XLTA 2C4KA 2I33A 1GGHA 3F49S 4CTOA 1LPBB 4GF5A 1XTIA 3SPUA 3JZAA 1WDTA 3VMMA 4HDOB 5JXGA 4WLVA 3EIOA 3P2BA 1T2EA 4FEKA 1D8TA 4QSHA 2WHPA 2FSIA 2O8EA 1NONA 4NCKA 2ZI4A 3T9CA 3JZFA 4FD2A 3R4VA 3HP7A 1PUXA 4XPZA 2K7ZA 4OHCA 3P9XA 3NDBB 1HQYE 1DHTA 2CNOA 2PMEA 1O96B 4B3TB 3UMJA 2V7UA 3SI7A 2CMHA 4RL6A 5GMOA 3PHBE 3GB9A 3CE6A 1V4BA 1X7DA 2KWIA 3ADCA 2GHTA 4DLAA 1J25A 1GPNA 3ESZA 2LFIA 4OZAA 1N6HA 2GYUA 3I04M 3MCVA 1FNMA 4KH1A 1I35A 1HGXA 5KOHA 2A94A 4JC5A 1WCV1 3LAWA 1GKIA 2FI1A 5JATA 2VDWB 4RD1A 4QAJA 1JROA 1HFJA 1YCFA 4G0PA 4PDXA 3JZMA 1GZHB 5TSDA 3FUVA 3DGEC 4MQLA 2Q07A 1HL3A 2NSJA 1XZPA 2Y92A 2DOKA 1DBWA 5FUYA 3DKIA 3QVWA 3B7PA 5ILQA 1PDWA 2PRZA 1I6LA 5LCXA 4RHYA 3O47A 3PEYA 1JKJA 3MOSA 1Q1BA 3DS8A 4R1SA 3IT6B 1EAMA 4P4TA 2HOQA 1PFKA 1NI4A 1JQDA 3B9PA 5BSEA 1CZKA 4S17A 4TV9F 5HH5A 1MX3A 1E0JA 2XTAA 1SBBB 1WXHA 5ANRB 1M6VB 4MVJH 5KYXB 3H8SA 3Q4GA 5K0BA 4IBOA 4WJLA 3TF5A 4PLZA 4P3OA 2ZS7A 4DR7B 2ACVA 1VL6A 5H92C 4Z1MD 4KYIB 2C2WA 4M0MA 2FNJB 2FN3A 3B5IA 4YDSA 5HKLA 5F76A 1X6VA 1ONNA 3QKTA 4NH0A 2IE8A 1YX6B 2QT9A 2YTZA 3IQGX 3PZDA 2Q2WA 4RIFA 4KRFA 4XR9A 5CG2A 1XVAA 4D9HA 2XIQA 1NUQA 4GM4A 3C3PA 4QG3A 3LB8C 2HDWA 4B81A 4NZ9A 4L78A 1UPXA 3I73A 4QDKA 5CTJA 1NW9B 4CJXA 1PRYA 2XGMA 2IK8A 5ACVA 1M6EX 3I34X 3VNAA 4D9EA 1QQBA 3S8MA 1KVRA 1ULBA 3ITEA 5E2AA 2W6CX 4MPJA 5TS2A 4CNQA 2O5EA 3W1WA 3ILHA 3QJ5A 2ZBQA 1HKUA 4FZRA 1VP9A 4TMAB 4PAQA 1SUWA 3BFJA 3A36A 2PGLA 4ZVNA 4FR2A 4CMGA 4OHVA 3U3MA 1XOIA 1KIMA 5I9IA 3VH4B 5ADHA 3O91A 4DADA 1KZ7B 1KYIA 3OTQA 1G5QA 3CJTA 1RKVA 4W9FA 1Y5NA 3FILB 3R9KA 2RH5A 4UM9D 1SVOA 4N39A 4NBNA 1PW5A 3DV0A 2VOJA 3B20A 1BKYA 4FOOA 1MABB 4X5OA 2ONZA 1KSJA 1SCQA 2X1LA 5BYQA 1BZYA 4MEMA 2OB1A 2ORVA 3LKZA 1Y8QA 4DV7B 4DLNA 1P2DA 3I3OA 1T5LA 1RLJA 5CXSA 5TEVA 4JHXA 3G1UA 2J6IA 4DCCA 2I54A 3E8SA 2ERXA 2Z57A 4ZTBA 3HTXA 3HBJA 1SUDA 1NXQA 4X57B 2C7HA 1B15A 1HXHA 4J07A 3UJ3X 3OO1A 3CSSA 1CBUA 4PWYA 1YO6A 5KNDH 2IDKA 4LE2A 4YV0A 2PZFA 1ZL2A 1HEYA 1O95A 1GARA 4AUQC 3H7SA 4EX6A 4A5SA 3AEZA 4P08A 2ORWA 4I1RA 4OV6B 3DQZA 1F2RI 2O2ZA 1LB1B 2C1EA 4FFWA 5HBRA 4B0OA 1JA1A 4XI9A 4JLUA 3E23A 3U3XA 5DEIA 1E59A 1BOFA 2GPJA 2YMMA 4I4TF 3NYIA 3AY0A 3ZHBA 5CVTA 4J3OD 1IGDA 4E07A 4LGMA 4D4IA 5DP2A 5DGIA 2V7VA 4FOSA 3CNEA 1AMUA 1EB9A 5A7GA 3ZHRA 4GI7A 2L00B 1WZNA 2YXPX 1P29A 2VQ3A 1I80A 5BN4B 3EUWA 4NMMA 1T2NA 2QJRA 4CEHB 4DVGA 2QIOA 2WGSA 5EWJB 1WXFA 4RF0A 4YPFA 4C7XA 2DJ5A 3UA4A 2JJQA 4XB6B 1RYBA 1IN7A 3OTHA 3DO8A 1WMHB 1NNLA 3LG2A 4E33A 2NYRA 4KQIA 3IG3A 2C5GA 1W5AA 1DHRA 2HMVA 2RDBC 2WJYA 1GPWB 2FPIA 1MJNA 2QAIA 5L4LA 3TJPA 1S3FA 3IUBA 1XO3A 2MIIA 4IHJF 3KTFA 2ZAOA 4LNUB 5DLQC 3DMYA 4F4IA 5YASA 2AZDA 5E0KB 3QKRB 2LV8A 1G9SA 3LGAA 1Y1SA 4KGTA 3HWRA 3LECA 4R1MA 3IH5A 1RZUA 3U44A 3U7FB 4FGWA 3ZKWA 3DLHA 2XV1A 3PFGA 3AE6B 2IV7A 3JR3A 1O5OA 4EABA 5HF9A 3EX7C 2QBYA 1QFZA 1NXPA 3ZTCA 3D3NA 1V5IA 1XEXB 3EB9A 3ZCQA 2A9VA 4YMLA 3Q2IA 1KTIA 4BO7A 2K39A 1OH8A 2PT5A 3DR3A 1HO3A 1ZW1A 4YRSA 4FLHA 3LK6A 4WN9A 3ZNOA 4KNVA 2CU1A 3BUSA 2H11A 1IVNA 4KFRA 3ROQA 2KFJA 3N0WA 1CJTC 3MS4A 2AG1A 3AUXA 4LHWA 3RVBA 4OI0A 4LOIA 1O4WA 3CTPA 2GSWA 4I9HA 4G6ZA 4MWDA 2BTOA 3AF0A 3EGCA 2REXB 4PVTA 1WSAA 1Y5RA 3ICOA 1W29A 1QSGA 4FGKA 3F9OA 3MTAA 3QVLA 2INPE 5CT5A 5BYSA 1ISGA 4ETNA 3GFBA 1LFAA 2ZWAA 4MV5A 1NTRA 2RCNA 1OWNA 1UMDA 3CXUA 1NQUA 5C51B 1TC1A 3DNFA 4YRDA 2CBNA 3ZEAA 4YBZA 4A3OA 2E7YA 4UE2A 4F3YA 5C52B 1CFJA 4JGIA 4BLSA 2M5DA 2VBFA 1ULSA 2QINA 3ORYA 3RFXA 4GOCA 1QHHA 1VE1A 4UUQA 1M1UA 1XMVA 4R9RA 2V7TA 4ZU1X 3GXBA 3PQ6A 3ZEIA 3Q8LA 5HRAA 1VCHA 3U37A 1MQ8B 3TRFA 3BRWA 1M8FA 3LQQA 2PKRA 5FWYA 1L5SA 1FTYA 4URKA 3B1JA 3GZ4A 2EFEB 2FMKA 3T52A 2QUIA 1HG1A 1K63A 5BO4B 1VCIA 5IC6A 2AXEA 2AF3C 1H05A 1OPRA 1VIDA 1H8HA 2QR2A 3FUUA 2CNWA 2QD1A 1NRWA 2VHZA 3I1IA 4C30A 3UW1A 1P33A 3VR6A 2BGIA 4H6XA 3OD1A 1ZBQA 3VC2A 1TADA 3N8HA 1AMOA 2H29A 1T0UA 1OW3B 4WGGA 2G76A 4P83A 3SHWA 4LF8B 2TS1A 3AETB 5ER6A 1U28C 3HDTA 3J9CA 2HF9A 3BS4A 3DMFA 4NYJR 3L6DA 1XEAA 2CK3A 3D3JA 3K5WA 1E2HA 2NUAB 5DXFA 4X7PA 3CPJB 2Y5BB 2RHBA 1VA4A 1S4QA 4P7BA 1GPKA 2XXAA 2RD0A 1A27A 3ENVA 4RETA 3O2JA 4LXUA 1QLBB 1KFCB 4R8RA 1ZGZA 3AK4A 3AULA 2ZJ6A 3PHGA 4NOJA 5LQMA 2VUIB 3RK4A 1N5JA 1DB3A 4RK6A 4KBYA 3OT1A 5H4GA 3AJDA 4HB0A 5DI3B 1T0PA 3C6QA 1M6NA 4YQZA 1R8SA 3O4IA 2AUMA 3AJRA 3FMFA 2Y0BA 4DA0A 3RYCA 3SC2B 1FVFA 1U8XX 1RC0A 2RC5A 2QUBA 1XCTL 2JKVA 4HQLA 1N3IA 1VLVA 3W7BA 5GXGB 2P9JA 4GSYA 5CEJA 4TSRA 4RH3A 2PT6A 5DRYA 2HSZA 4BUJA 5KJFA 1RXWA 3D6HA 2WXQA 3WLPA 1U7OA 4YCLA 2FG6C 2QUAA 2D11A 4XQ9A 2C4NA 4TXMA 4O4HF 4AWBA 3O2QB 3BQ9A 3CO5A 4BNFA 1EVQA 2J31A 3T8YA 4HQFA 1FEHA 4ZPXA 3X1ZA 1SOUA 3IOYA 2OGUA 2JHGA 4N3AA 2DY1A 1Z9BA 4C7OB 1JCKB 3FTNA 3RSFA 3JSAA 2JCSA 4C08A 4X24A 1Y5IA 4KIKA 1XHEA 1K7EB 2VA9A 3N2KA 5B7PA 2YJZA 1F12A 1DRKA 2R2OA 1YFLA 5B7QA 4DBLC 4OHFA 3RVQA 4HDOA 4YGXB 2O7QA 4CQMB 3HXMA 2V65A 1IVYA 3G2LA 4CLOB 3VU3A 3ANSA 3GPDG 4GUAA 2A84A 2X40A 1SQGA 1ZH0A 4H6VA 4M8MA 4JDUA 1L4MA 5KYWB 2I3AA 1BS9A 2Q8NA 4PQGA 1UUFA 3U1BA 3EECA 1O96A 2VPPA 3IR7A 1EDOA 2XYQA 1E69A 4IKEA 2WUFA 5K0GA 5A6SA 1H9AA 4B6JA 1HYHA 2GK7A 4J0DA 3HB0A 3S44A 4R1PA 1MI0A 2C7OA 5IM5A 4R1NA 2ERYA 1EXVA 4QRDA 2XMPA 1BG6A 3G8AA 1ONOA 2W2LA 5HQ3A 1WXWA 2FLKA 2P6PA 1UL1X 1S4MA 2QM0A 2ODPA 3MMZA 3V4RA 2MYPA 2IEYA 2BM8A 2FTKE 1AKYA 3RVDA 4F5YA 3QC8B 3NUHB 2Y8BA 4B40A 1V7ZA 3R5JA 3EISA 1QIFA 3T6KA 5LXTF 1HEUA 2WYUA 2YWGA 1GOZA 3U62A 1VE7A 4I0WB 4HK2A 1DG1G 5KSZA 3I57A 3TIFA 2JUOA 3VAWA 1PJCA 2BLNA 2FSSA 2O06A 3B6JA 1P9EA 2YHSA 1L6UA 3EWSA 3MJFA 1JJBA 1H93A 1NVEA 4MRNA 1QYWA 2JB9A 4DQ0A 3M34A 1R27A 1MA0A 4ZHOA 4UTOA 4ROTA 5KX5A 1N6IA 1M6VA 3GR6A 5KYXA 5IDYA 3SC6A 4LC1A 4GMXA 4YACA 4FZ5A 2FPKA 1K7YA 2I4TA 1H94A 4KAXA 4B7AA 2KN5A 2LIVA 1O97C 2PFGA 4P16A 3MG9A 2YZ2A 5D51S 4P7FA 4AZVA 2BSAA 5ALFA 4CODB 2RPVA 1LJ8A 4HEHA 2IP1A 3N6XA 4QEKA 4R2WA 2X86A 5CTAA 1L4FA 3EBPA 4X61A 3RASA 2ZIWB 4QT0A 3G79A 2VP4A 1KOGA 4OXYA 5EIAA 2ZYIA 2M6KA 4XX0A 2UXCB 1BGVA 4KBFA 1ISHA 4DCJA 2FEMA 1YJ8A 2WC1A 3E3NA 2ZQZA 3LO5A 1I7QB 5FTLA 2ZUCA 4MUBA 3KKEA 1NT2A 3QFRA 4JL5A 5G40A 3A05A 2ATXA 4J2HA 3AESB 5K3OA 4U2EA 2XE7A 1QIDA 3FHOA 3HCOA 1QLWA 1H23A 3L6NA 1NV8A 3RCBA 5J3JA 1X74A 3LY9A 3QH8A 3L77A 4FFLA 2PT9A 3PE4A 3UOWA 4HPJB 3H1FA 2OCYC 1A9YA 1EK2A 1NAHA 1MO3A 4L08A 4KSCA 3OAAD 1YQXA 2B3TA 3JQ9A 3FILA 4FC7A 1Y1QA 4RD6A 1PNVA 2I87A 2DZMA 4X3CA 2X2PA 4B34A 1EDZA 4BMZA 1KO7A 4RFLA 2KANA 4AFNA 5FBRB 1MABA 3NUZA 4FB4A 1IXZA 4OAQA 3N1XC 5IAAC 2I3BA 3RABA 1F48A 2BL4A 3R75A 4ITKA 5K99A 2CSXA 2QM3A 2XWPA 3I1JA 2W93A 3QLTA 4JGHB 2IHUA 3RHSA 3ACDA 3VH3A 1YK0A 4PSCA 4BBZA 4BNKA 2X0IA 2OCXA 2O7RA 3GNQA 3I6ZA 4PF1A 1MGOA 3I0ZA 1W30A 3HIZA 5AJUA 4MV3A 5E4TA 1IBMB 2BC9A 1MJHA 2DKOA 3PJRA 1QZUA 4AWJA 3IAM6 1YHZA 1P1FA 4TKUB 5AJWA 5FYQA 4AICA 3EQ6A 1VPTA 4QYSA 1V5TA 1U8ZA 3U1TA 1CEXA 4BGIA 1G8KA 2O57A 1WW1A 3GE3C 1EP9A 1GCIA 3KJHA 5DM0A 1CUAA 2BGTA 3FOFC 2BZGA 2AYXA 2OFXA 4H6PA 4RENA 2A9JA 1ZSYA 3DC7A 2BYFA 2FUG6 2ZW1A 2G4LA 2MLBA 4L4RA 1U65A 3VYVA 1YDGA 3BYTB 1GL7A 3SP1A 4QYIB 5I7FA 2L69A 3NHZA 2YMPA 2JARA 3DO5A 2ZI7A 3CRNA 1TF7A 4CEHA 4PSUA 3LFTA 3GVHA 2QY9A 1UDWA 1E20A 2VAWA 1NWHA 1WMHA 3TTUA 1GU0A 5LMNB 3IO3A 4OGKA 4EI9A 3ZZ1A 1NVFA 3LP8A 5JZEB 5A2QA 1P1IA 3CVWA 4P4GA 4ID9A 4DDGD 2C4UA 5GTDA 5KTNA 3PKJA 3L08A 4LMBA 3N8DA 3NPAA 5BMHA 4TXJA 2GAJA 3T95A 2JY6A 4P6VF 1YV9A 4OI4A 4ZT3A 1K4MA 3B36A 4HAUA 4LNUA 1OR8A 3HU3A 1ET6A 4RPLA 1XEWY 4RL0A 3ANYB 4ZTZB 1R8YA 2XMSA 3L05A 3IP5A 4DF3A 4I6PA 1K9SA 3QFCA 3CUWA 1DIAA 3DPIA 4Q66C 1CVIA 1GV0A 1SR8A 3A27A 4B82A 4GOLD 4OQPA 4PPYA 3I83A 4BNDB 1V41E 3BJZA 1LU9A 1S89A 3W5UB 4BNYA 1Y1KE 1XEXA 1JA0A 4PINA 4EF6A 4X94A 3HE3A 2IHKA 2WWHA 1E0AA 5CITA 2H6AA 4MGYR 1PQYA 5DCLA 1W8DA 3V9AA 1QOPB 4RADA 4C2UA 1BKSB 1X87A 4YCDA 1OVGA 3AHIA 5JNSA 4DXHA 1QVVA 2A5UA 1JR3A 4IHAA 1JW9D 4LC0A 4C43A 4TRJA 3LX8A 4URVR 5EJ7A 1VHTA 4PLTA 2V74B 4OG2A 2AOTB 4GI3A 1V7PC 1R4NB 2JFOA 1Q5PA 1FZQA 3PXXA 3INRA 2REXA 1X8JA 1IULA 3NASA 5LIRA 1QZ3A 2VP6A 2NWQA 1K8RB 2KT7A 2BT6A 4R2XA 1ODJA 4ND8B 1CNEA 1PK7A 3L7YA 3G85A 1RYEA 5JCZA 5M5BA 1DARA 1RM6C 1II9A 4I5GA 2DLDA 3WTCA 5D6NA 3CB2A 5DXAA 3Q3NC 1VHWA 1RKQA 3N0XA 5K5EA 4WXEA 2W3RA 4XUGB 2Z1NA 5EERA 2C7QA 2Y0DA 3MMNA 3O1JC 4BU0A 5FR6A 2AC7A 1W5BA 4HLDA 1A9RA 3L01A 1FBTA 4RDIA 4CHTA 4B32A 3BK7A 1YQTA 1PWZA 3TMYA 1TGYA 4B43A 4CIVA 1M6YA 1XAJA 7GPBA 3H8JA 5E8JA 5ESXA 3K0EA 2QJTA 3CZMA 2RHGB 1R18A 4MS4B 2A0UA 2RGDA 2W6JA 4P5DA 4LMRA 1DQSA 3R2IA 1GCUA 1PWYE 1WSDA 1X19A 1KLGD 2IXGA 4FFPA 1T9KA 4AX4A 5AM4A 4YRNA 3H2BA 4M7RA 3GD5A 3ZCTA 3DHYA 1PJLA 3N76A 2A88A 1QMPA 2JGJA 1YCGA 5DBHX 1M73E 4PZZA 4MRRA 1P9DU 2KPOA 4ZCRA 4C1GA 1I6MA 1CUXA 3TIVA 5U1PA 1C4WA 5CVEA 4WZAA 4BNXA 4MEBA 4PW0A 3AETA 1ZN9A 1XRSB 2YBDA 3R7WB 5JFGA 2GJ8A 2WXGA 4ZVKA 3H2YA 2CB9A 2C9MA 1TZ1A 1KI7A 1GN9A 2HPZA 4NQZA 1HRKA 4K7SA 2EFCB 4PRKA 1MRNA 2PX2A 1DLIA 3WA0A 2X5NA 4MS3B 2CZGA 3EA6A 1XKQA 4BE4A 1EQ2A 4CTKA 3P9YA 1L4ZB 2EZ9A 1SBNE 1QH8A 3H3XA 1BVTA 4G23A 4R0NA 4M83A 3GDOA 3WADA 3B9QA 1VB5A 3UK0A 2LGXA 3FZEA 1RQLA 5I9NA 5BQPA 2P62A 5KDDA 4H1HA 4HDNB 1YRBA 2YWRA 2BVNA 3A2LA 2JI9A 1AQUA 2QEJC 1SIUA 4IG4A 1WWTA 3A06A 1NF9A 5CEFA 3OF3A 2CYCA 4DFDA 1A9SA 1YRYE 4FZJA 4C2BA 3C5WP 4D9FA 1FP2A 2RG1A 3U3OA 3RIEA 4RS4A 2D74A 4C7OA 1TMOA 2IC5A 1M67A 2X8LA 3WLAA 3T5TA 2OPHA 3VO1A 2CDNA 3IQDB 3G2JA 4N03A 1ZA1A 4G26A 2EEZA 5J58A 3RVLA 4DHZE 2YWDA 4D0GA 2IV2X 5C2JB 4X0EA 1NSYA 1XQXA 3PNBA 1U7XA 1J22A 4RZQA 4ZI5A 4GLJA 8ABPA 5KYWA 4D57A 3Q9LA 4O59O 4LSWA 1BT0A 5FUMA 2NTJA 1NQAO 3PHCA 4M01A 1F52A 4DWVA 4IMPA 2JHAA 1Z0IA 3UV6A 2NUPB 3V7UA 4BGDA 1FUIA 5DN9A 3T3GA 1FUKA 1SM4A 1B0UA 5DX1A 4EHKA 1E4EA 5L3QA 3KOUA 3LYAA 3HH8A 3JYPA 3CR8A 3T9FA 5JRDS 1FSPA 4JBXA 1KE2A 3ZJYA 3GW8A 2BS4B 4ASWC 5H68A 3AR5A 3HSYA 1UBQA 5EV8A 3QW4B 3OQ1A 4XFDA 4B3RB 2X9LA 1FMFA 2PXXA 4HXGA 2VQDA 3EHVA 1NUPA 4A0FA 3OZDA 4PPFA 3UPDA 3VRHA 4X8MA 3SN6A 3PG5A 2V7QA 4RAQA 4MYSA 2Q2OA 3RUCA 1R4ZA 4OQXA 1RXCA 1T9BA 4ND2A 1A95A 4EJFA 3I1FA 1UF9A 1ZKMA 1RBMA 1EWYC 4BKGA 3W04A 3PRPB 3JXPA 3EXHC 5JG7A 4B79A 5KYUB 1P7PA 4NOMA 4G5YA 2FEPA 1G3UA 4MUXA 4AG6A 5F7ZA 3DCIA 1D4ZA 2H17A 1FDTA 3OPYA 4CG0A 1C1YB 2BWFA 3C7KA 1VGVA 4R1TA 2O7VA 3QKUA 3T1YB 2XVAA 2I2AA 2HLNA 2H5JA 4PG4A 2J07A 5BNTA 3PPVA 1ZN8A 5H3LA 4EJMA 5K03A 2XMDA 4WBNF 4S12A 1I30A 3ROZA 3LDUA 2PY6A 3BGIA 4QICA 4DBVO 5IMBA 1DTSA 4IUYA 3VI3B 1BXTA 3O31A 1Z8DA 5IASA 3IOCA 4D5EA 4MO2A 3ET5A 2HB9A 1JALA 1DX6A 2QRZA 1CLUA 1RM0A 1VHLA 4B3DA 5TV2A 4HV4A 4MW1A 2X8XX 3WNBA 4TYNA 3OX1A 1L9YA 1KP2A 2CHWA 3QYFA 1Z5NA 3SE0A 1SO8A 4M8NE 1L4LA 5B30A 5C37A 4KOEC 3MHPA 2DFNA 1TM3E 2R85A 1R10A 3WYBA 4AWYB 4CLDA 5E6RB 1TLFA 4ZRIA 1IWOA 1UNSA 2F7SA 5TPWB 3NM5A 5MN5A 3R24A 2QA5A 1Z12A 1AUQA 3L1IA 3F78A 1US8B 3TQIA 3A58B 4TS1A 3AESA 1A5ZA 2PLRA 3RD5A 5E4FA 1ZD3A 2B7BA 5H3CA 4G0XA 1WM2A 5KTMA 1GEEA 3K09A 1TVKB 1EESA 3CO0S 3IDQA 3O9MA 3K1TA 3EVNA 3TFQA 4EGFA 1XPRA 1HTQA 3TQSA 3FIJA 5F5LA 1O97D 5HS4A 4XVUA 3ITKA 4AAYA 2QTHA 1VL0A 2I8LA 4TLEA 4MWSA 4IEIA 4NCAA 5IMSA 1NVTA 3Q0EA 4PG7A 5HTOA 3QI7A 1TO6A 4BOZB 5K2OA 3HDGA 2QENA 3P4XA 5I45A 2PE9A 1UK8A 2EL9A 2VDJA 3IP8A 3L5KA 4QBGB 3BWXA 3UTDA 3RH0A 4DIBA 1OTHA 4S1WA 3T4XA 1KQGA 3WAMA 2QRMA 1O94C 4XAQA 2D8AA 4QTTB 4TKUA 4BRZA 3ZNBA 2J9YB 4LJOB 2C7GA 1Z2DA 2Q3LA 4DKJA 2C4VA 1OXXK 4KYVA 4TLDA 5DTIA 1JH9A 3QPVA 4K86A 4YECA 4H4CA 1D5CA 2GR9A 1AA6A 5D94A 2YC4C 3D5EA 3WI7A 4TQGA 4LHZA 2QG9A 4A7PA 2EERA 4C29A 3RVNA 2QVLA 3DOFA 1RZVA 4FP9A 2GZSA 5HCIA 3OE4A 5EPOA 3IUEA 3MCZA 3FM9A 4KGZA 2IZOA 3GEMA 3P63A 3S29A 5JZVA 4KKIA 2NO9A 1NBIA 2ATVA 1DOYA 4ZU6X 3T3MB 5AMXA 1XCMA 2IZ5A 4U8GA 1CU1A 1K86A 4JT8A 1N2OA 1Z5SB 4QYIA 5JPDA 5T8KA 4YPVA 3KQVA 4V39A 4NKRA 4RPHA 2HRRA 1PJQA 4EG3A 1UEJA 3TLXA 3VSCA 1USKA 3KPJA 3LP5A 5B58T 4F7ZA 2QX7A 2QOEA 4ZTUB 2PG3A 3RF6A 2WNMA 3O8RA 4Y9TA 3BJEA 2IPMA 3AU5A 1EUDA 1Z5VA 3T7CA 1U4OA 5DP1A 4L9RA 1MB9A 4GYKA 3LE8A 1RFAA 1NBMD 1CF9A 2B9EA 1ZDXA 3SSMA 3IPRA 4CEIB 4QRHA 4EOYA 1PJ3A 2G09A 3UAVA 4EB0A 1EZ1A 4O6VA 2QEQA 2FW6A 2VBCA 2NV2B 3SYNA 2N1BA 3ZNNA 2OBLA 2R11A 4BNDA 2R5NA 3W5UA 1JIUA 3QYAA 2QQFA 2OBXA 4DDUA 3UT0A 2CJXA 3ELBA 4ZCIA 4Y2TA 1BROA 2IYZA 1PL6A 4BYMA 1C80A 4ZYSA 2OSVA 3QWAA 3R8FA 1TX4B 1X13A 1AKVA 4B6RA 2NTTA 3A2KA 1QLHA 1IUEA 3LVQE 2QYTA 1EM7A 4JMPA 2ACEA 3RIMA 3U7IA 4C1CA 3NY5A 1H5UA 2AOTA 2NO6A 2Z08A 3B78A 1R4NA 1A50B 1Q7RA 1K4KA 4BRWA 1WDMA 1IIRA 3PENA 3BGSA 3SSAA 1XMQB 5AJLA 4ARAA 4YT8A 1K8RA 1MFPA 4G56A 2AKYA 1N0VC 2P9EA 4HVCA 1I2BA 1MPTA 4UDUC 4R41A 1EPUA 3FVRA 3PBKA 3Q3GE 3VPDA 2B37A 3KXLA 4G0NB 4MRMB 3P0IA 5T5QA 4RKYA 3MNFA 2D2EA 1M33A 3ZGLA 1N4DA 2PR2A 3PIDA 1GAEO 4B17A 2V7EA 4KGDA 1OAOA 2FH5B 1CC1S 3G5MA 5FOXA 1J2JA 2Q0SA 3MWDB 2VDRB 4CI0B 3WLSA 3VC7A 2CYBA 2NQ8A 2YN4A 2AYYA 1V8DA 4TROA 3KVNA 1P5ZB 2HFJA 1XC7A 3HVJA 1ULAA 3I9MA 4AIRA 4JP3A 2RMMA 1SQ6A 3WISA 3RNEC 4QFBA 4N47A 2GEJA 4HP8A 3TDNA 2A1TS 4D92A 1Z5GA 2QKYA 4MS4A 1ZN7A 1K88A 2NM0A 4PHFA 2JH3A 1TF5A 3PU6A 5G0SA 4C4AA 2IH2A 2ZSFA 2GZ3A 3T41A 4EITA 2PUCA 3OZAA 4ROSA 4FYJA 4LGCA 3A6GA 4IGFA 2D1TA 1IOVA 1LZLA 2ZUVA 5ESDA 3T7DA 1SXJA 3HM3A 2J67A 1J7CA 2FEAA 2VP9A 4LDRA 1JEOA 3CLKA 3CG4A 5F23A 3Q85A 5HF5A 1VHDA 4JVMA 1CV2A 3C8HA 4EKUA 2NUTA 3QPUA 3KKLA 4YXWD 2X9VA 4Y2PA 5T64A 1PZHA 2IHJA 4DVJA 2QNRA 1OEYJ 2AOWA 2SCUB 4B95A 3SFZA 3ZLZA 1UMCA 3A1TA 4HLCA 3O82A 2IFTA 1MBZA 2ZB8A 4FFRA 1PJ2A 1EFHA 4D96A 3STTA 2H4JA 2O14A 3DYIA 3N9IA 3IAHA 3WMEA 2DUNA 2GXAA 1KBOA 1VLBA 5EKTA 5CLFA 1CRWG 5ALDA 4ME6A 1X14A 3AUKA 2WFMA 1XLTC 2F3PA 1NBOA 3IAXA 3FDJA 3LXRA 5LQAA 4RZ2A 1Q50A 3P9SA 1E99A 1U6IA 4ZKEA 3NH6A 3TO5A 2BG6A 3I5AA 4U1RA 5I47A 5EJ6A 5A71A 4M53A 4EX7A 1UKCA 1K6XA 1YKGA 5DHAA 2XITA 4HAVA 5G5HA 3NWJA 2NMVA 1VC2A 2ZAIA 2ZDQA 4H0DA 5LQJA 1YHNA 4MOWA 1UFOA 3REGA 4ITRC 2HU2A 5DN6A 1TTPB 4I36A 2IHBA 5SV2A 1L1QA 1KIAA 2WP8J 1W4AA 5C1PA 1T5IA 3FSGD 4QTUB 5B2FA 5H7XA 3HGMA 1ZRNA 1XLUA 1ZRHA 2H7CA 4XWAA 3M83A 4E08A 2ZZKA 2XQFA 2FPGB 2X4IA 5JVDB 3WL4A 4GYJA 2J52A 2CHUA 4RNDB 3SYMA 3PRYA 3ETCA 5AW5A 3OZIA 2WS3B 4HY3A 3LZCA 1OHHD 4R1UA 4B4OA 3GT4A 2YFYA 3TL2A 3THWB 2Z6QA 4K3VA 3U6BA 2NP6A 3B3JA 4RYDA 1C8BA 3MJTA 4B87A 2G08A 2CHXA 4GN1A 1ARZA 3VDQA 4Z67A 4RHTA 1PUTA 3M6XA 2HY7A 2DQYA 4OHWA 4Y2SA 3V7NA 3GA7A 1KA9H 2BAGA 4AY4A 3DDSA 5HI1A 1JWAD 3P97A 1HSZA 4J4HA 4MQEB 3GVXA 4RVUA 3IT2A 3GA0A 1PNOA 5JD3A 4JFRA 4QJIA 5IAEA 4BFUA 4YASA 2IPKD 4Q47A 2MDTA 2H4ZA 1ZMBA 4U0KA 5E6NA 4RGVA 2JVCA 4Q3LA 4JV5B 1YMHE 4GPIB 2R84A 4G5QA 3BCRA 4HKZE 4EDHA 4PHCA 3QU7A 4R0VA 3F4LA 3UJDA 1W4LA 4KUEA 1KVQA 3PVSA 4MW9A 1N4AA 3CUTA 4X7BA 1S9DA 3DL7A 3H6HA 5EWMB 4B09A 5JAZA 1X1MA 3AMVA 1KY5A 1L5PA 2IO3B 2QGNA 5IN7A 2WSSD 4FLEA 2WF9A 2G9NA 2IW3A 4BFZA 3G0BA 4Y2YA 2ZCVA 5KYUA 2EFJA 1DBVO 4AX0B 4Q4HA 2Q9UA 5EWAA 4DHJB 5BQ5A 1LTKA 3IERA 4IUCS 1GILA 1JDJA 2FDCA 1HLPA 4NU6A 2WRZA 3OEED 3GUUA 3G6WA 5ERXA 4HVLA 2OD7A 4EMTA 1D2RA 3W6UA 2I38A 1G42A 3WB0A 3VMFA 4ZDJA 3NHBA 2EOAA 5JJCA 2O05A 1P91A 5ALKA 1GPBA 3KSAC 1BOOA 3V80A 1RAFA 4XCVA 2B82A 4UCWA 4GUDA 4BAXA 5HE9A 3ZXVA 4F8CB 3QYJA 3KB6A 2ECQA 4B73A 2ZKLA 5KZMB 4QVIA 4XZ3A 1O3YA 2O9JA 4XVRA 4FR5A 4OJMX 3SF8B 5A1JA 1ES9A 4DDHA 4MGKE 5F4BA 4H15A 7YASA 3EOAI 1V11B 4GD3Q 4QGGA 1PDVA 3AEKB 3QI2A 4Q0MA 3PPXA 1XVIA 1E8NA 2Q8PA 4LXIA 4KMRA 4I1PA 1US8A 1IWPB 3GJ4A 3QOYA 2EX1A 4RF4A 4DYHA 4R1QA 2ZT6A 4PVOA 1T3QA 3ITNA 1E6UA 4GU5A 3LD9A 3S4YA 5LLDA 2HCFA 6GPBA 3SVZA 2GN2A 2VRCD 2JGEA 1QPZA 5JDIA 3WL6A 1ZGGA 4DARA 1PS0A 4ND3A 1CJEA 1FTQA 3DWGC 3FG9A 2WP9B 3HYRA 3AG6A 2FZ4A 2CG3A 2HNAA 3WBFA 3HUIA 2AUNA 3I4LA 1NMZA 3SICE 4B45A 3CKLA 3TOZA 1KMIY 5EA2A 2RGWA 2I1VB 2C4MA 1E3SA 2O54A 3L8HA 2Q29A 4O4LB 3R66C 4DXAB 1A7UA 2W4QA 5FWXB 4WPGA 3KYBA 2WU1A 3K8QA 2XVXA 4UEJA 4CHGA 3EFOB 4R1LA 4WWPA 1ZM7A 4ZOAA 2M6RA 2WQYB 1O4VA 4MQUA 1ESZA 1TF2A 2IY7A 4XW2A 2IBSA 1EFCA 1EWTA 1B9RA 4JOSA 1F9JA 4KXLA 1GQFA 1WGHA 1UC8A 5EPUA 2F8SA 1DE0A 3SD7A 2PSJA 5ER9A 3GS2A 2SHKA 5AHXA 4DMMA 2C98A 3INNA 3V48A 5LMUB 3OCUA 3C16C 3JWGA 2X6RA 2BW0A 3QWBA 5TMPA 4DWJA 1DXYA 3DNPA 3PFFA 5GGXA 1QR2A 5KCZA 3QVTA 4B2PA 1LZKA 1H4VB 4BVGA 3R20A 1Y80A 1OU4A 3RN9C 2X0FA 4EHAA 3LC0A 4B2LA 3B8HA 4RKWA 4M8LA 1B4DA 1VSQA 1YCHA 3IP6A 4ZCPA 1PEDA 3LX4A 5BR8B 5EJFA 4J3NA 4UBMA 3H2HA 4ZEXA 1O8CA 4AD8A 3BWVA 2ZJ4A 1W73A 4A8TA 2XK5B 3ZUNA 2DB3A 1HTBA 1U2QA 1MAWA 2CFIA 4EB6B 4OIFA 1Z39A 5AR1A 4YMVA 4OGWA 4KUHA 1O94D 2XUDA 1PI3A 3O7MA 1COWD 2P0YA 4GDMA 1KEUA 5SZIA 5ACUA 3GP8A 3AH8A 5HIOA 2AOUA 3IYLW 3R9XA 3KVVA 3CNOA 4ANUA 2IBMA 2H5EA 2IGTA 4LQCA 4C5CA 3CUYA 1YR2A 1E5QA 4UXJA 1CVRA 4L15A 3CPEA 3PLVA 3NJRA 1VYUA 2QRLA 1K7SN 1K08A 3PFCA 3A9KB 2C3OA 5HHDG 1WUJS 4EECA 1KPGA 3WX0A 4M1TA 4HCPB 3UNXA 2XE6A 1GNLA 1KFBB 4US1R 1KR5A 4K9PA 2V1XA 3AP1A 4J1TA 4I8DA 4Y9DA 3WGVA 2VDLB 3R7QA 3GLGE 2EJBA 4EW2A 3W3AA 1FNWA 3HUFA 3Q7IA 2NN3C 4G0YA 4EYEA 3LPNA 5BXYA 4NMWA 3QMWA 4DUGA 2X14A 4IIEA 3B6MA 1A8TA 3NAZA 2WYLA 1E9MA 3WIOA 1O5IA 1F1HA 2G9UA 4W1QA 3T5AA 3ZD7A 1LNQA 2ZR7A 4QVKA 1TIFA 3IXSA 2NVUB 2WDZA 3L7AA 4N3BA 4ALNA 1TK2A 5AW4A 2G1KA 2VR1A 2O3JA 4MUHA 4REMA 1XA3A 4V3BA 1NVBA 4RFVA 5KI6A 2GXSA 4Q21A 3KUXA 5K3BA 3SFVA 1GA4A 4G0NA 2JLAA 2EP5A 4MRMA 5AW3A 3R6WA 5BYRA 2BMFA 4CF6A 5LLTA 1U7DA 3UHJA 2Q3EA 5LB2A 5LB4A 5AYVA 2X2EA 4U0JA 1AHHA 1IFXA 3W2HA 1U2DA 2JLYA 3MWYW 2HQ1A 4YJ3B 4OH7A 3F6RA 1FFBA 2ZSDA 4G1CA 1Z38A 2ZK7A 2R8PA 3M9WA 4E46A 2ZREA 1L4EA 3K96A 2ZVNA 3ETJA 1CUFA 1CUYA 4L8VA 5JBNA 3HU1A 3R23A 5LNK1 4J0CA 1KZYC 2OM2A 3TEWA 1OIXA 3SX0A 5CA1A 4P22A 5IXJA 1DAEA 4K0RA 1QU3A 4TTPA 1RQPA 4EHJA 4MGEA 2GETA 5EHZA 4MIEA 4YRAA 1QC5A 3CPSA 1B73A 2VF8A 5JD5A 4EYLA 1ZHHA 4IIUA 5E7MA 1CQWA 5DZSA 2ZUUA 5K0ZA 2XTJA 3OJ0A 1Z07A 1KP3A 3WKEA 2F1HA 2XB9A 3NX4A 3VPSA 4BVFA 4E30A 4O08A 1ZAKA 2ODWA 3TEXA 3U4QB 4EGSA 3Q3IA 3LBHA 4LF7B 1JJFA 1WVMA 2J4DA 2GH1A 2WP0A 3DVLA 3HR7A 3QXGA 4E14A 4LVOA 2YOFA 1FMAD 4NABA 3WGIA 4N7MA 4WXHA 3C7CB 1OXBB 2JBAA 1KMHB 6NULA 3FXAA 2C00A 2PZAA 1YH3A 4AXBA 5LCAA 4Q34A 3KZNA 4A6PA 2XZTA 3BZWA 1QHYA 4M0WB 3LX5A 5BUZA 1QP4A 4KXYA 1SXIA 3ED1A 5AXCA 3NVVA 1ZK2A 1NF2A 4NICA 4C7JA 1OOEA 2GI4A 3GU3A 2P91A 3DVRX 4CLHA 4DQVA 2XMBA 3WNCA 2D2XA 4DMKA 1HA5A 1HC7A 4CPDA 1NX6A 2BGWA 4WNCA 5DBGA 1IBCA 4GQIA 3V60A 4JLAA 4NX2A 3UJHA 5C8YB 1D09A 1JQBA 3WGYA 2RKWA 4K9NA 2CJOA 2VDOB 4O2BF 3OQIB 3GJ5A 5EXPA 2GEKA 1WNFA 2QRQA 3L16A 2DR3A 3NDRA 3ABZA 1J21A 3UQYS 4Z9XA 2DPXA 2ZUTA 5EIWA 5FPTA 3JALB 3VTWA 2BD0A 2QN9A 1T29A 2YVAA 2WJGA 5KMGB 1GNPA 1X7GA 4HUQB 5SICE 1U99A 3SQNA 2QDXA 1U7UA 2PEYA 4MVYA 5LXIB 3FTDA 5IFLA 5JD4A 4YSLA 5FOQA 3M81A 1HE3A 4FADA 4I9NA 1IPEA 2FPGA 1MXHA 3GFQA 5C31A 2MX2A 3VU8A 5AKKA 5EZ5A 1ZKHA 1Z0FA 4UMDA 3W6NA 1GCAA 5C4GB 2ONKA 2RAPA 2COUA 1EE2A 4Y1FA 3UJPA 2YFQA 1N7HA 3HSKA 3CISA 3THWA 1EVJA 3F98A 1PFGA 2Q21A 5LBUA 4UHEA 1DIOB 1EKXA 1ORVA 1YBAA 1DWQA 3KXIA 2ET6A 2V9ZA 4RSGA 1Q7CA 2HJSA 3EIQA 1WABA 3GCWA 4NQ2A 3BL8A 3ACBA 5HCNA 4FB5A 4EGCB 1D5ZC 1V5WA 5A9TA 4MQEA 4CFSA 2M6SA 3I14A 5IM4F 3NWOA 3BX1A 4UBNA 1OFIA 3DLTA 4M8SA 5FJJA 2IVZA 4EFKA 1E3MA 4BWYA 2PH5A 3DBHI 4J6IA 4TMTA 2CLFB 1YDWA 4JUIA 2VDWA 2FW1A 2QP4A 5E6SB 3KSUA 1Q15A 1AOXA 5AI6A 1ZWKA 1GLGA 3PEFA 1VSVA 1ZIXA 4FFNA 1NJ8A 4CDRA 3ZWCA 1GM5A 3IDZA 5KNCA 1QF9A 2E3JA 2ZZIA 3BQMB 2WSMA 5K6RA 4N82A 1ZA2A 2HSEA 1H0KA 2J4FA 3C6MA 1GKUB 1XM8A 3G9TA 1YS4A 3FPAA 2PPVA 3WDSA 3D6MA 3H9UA 2M19A 4PYMA 2HYIC 4D25A 2XTNA 1RAXA 3CRW1 2VHEA 4CM9D 2HA0A 4N01A 3KT3A 3M9LA 5FBHA 3TXAA 4AY6A 3REFA 4IG9A 2QXTA 2QTCA 3OAWA 1ADCA 3QUBA 5K7SA 3TG2A 2NT4A 1FSFA 2MCNB 4L74A 3K9OB 4HL6A 5JCJD 1E6KA 5H83A 1ZJZA 2ZWIA 2VYQA 3B2NA 4B44A 1NE2A 4M1QA 3QOWA 1UIMA 3R7LA 1A7AA 4BFSA 2QIEB 1NDUA 1T5XD 3J81k 3I9NA 4GZ5A 1X1CA 1WMSA 4RJ2A 5ACPA 4R9SA 2FMIA 3SF8A 3ZR9A 3SQMA 2UYZB 1SC9A 4AKEA 2FV8A 2QU8A 3VO9A 1E1KA 3IXLA 1BAPA 1P9RA 2PX6A 4AZWA 2WG1A 5K8VA 1CHDA 2OHJA 1V97A 2ZXUA 2EZ8A 5BMVF 4LV6A 3AEKA 2WPNA 5LBIA 2Y1GA 3RUHA 1P19A 1TZMA 1L4UA 1QE0A 4TTVA 1T24A 2VW8A 4Z60A 1DAOA 1WB5A 4OF4A 2CCGA 3LT0A 4ZO8A 3MTDA 5JC8A 1OJ7A 4MAAA 4RHUA 3VPCA 1YASA 4JEHA 4D9IA 1KI9A 5AKZA 4JJ8A 4XTCS 5FNVB 1XZDA 4FFBB 3S2GA 2GCNA 4ZK2A 1ECGA 3FF4A 2G1JA 1ZEJA 4GB9A 3ORQA 2XOKA 1B6RA 1VE6A 3A11A 3PSAA 4K7JA 2C7VA 2VCEA 5BSFA 3PHXB 3F9CA 3W2EA 2L8JA 2O8BB 2WT4A 3OIYA 3U5TA 1BMQA 5DCWA 4JBIA 1Q77A 3VH4A 2O2EA 4FMCB 3WL8A 2I78A 1VIMA 1ZMTA 3GOQA 4R9UC 2ATIA 3SEAA 2V3CC 1QYDA 1U9JA 1IU9A 5AJVB 4DXAA 3RNLA 2WXLA 5FWXA 3UM9A 3M5CA 4Q5IA 2IHTA 4ARIA 2CD9A 4LZOA 3IAFA 4C05A 1O9GA 2LRUA 2Z2YA 1FQWA 4ZRNA 4IC7B 1D4FA 4Y6QA 1I6KA 3HDHA 1PJTA 4E5VA 4RWZA 2FFQA 1OWPA 3AVQA 5CXQA 1F6BA 4WK4B 3FD8A 4BB6A 5KSPA 3V4OA 4BYGA 2VDNB 4QEZA 5C3MA 1VI5A 4BFRA 4AG3A 1F0YA 3V1NA 1M83A 1ZU4A 2J0UB 2G8NA 3ER8A 3QX9A 6PFKA 1Z34A 2XGJA 1S2LA 3LPDA 3R44A 1MZPA 3SXPA 4YNBA 2JVIA 1BA3A 4DNQA 5DX0A 1H1DA 4MWEA 4IWNA 3O5AA 3UMCA 1XLPA 4ZDVA 1FFCA 1H2FA 3U4GA 1V48A 2ZSUA 1FXWF 3QP9A 1S3SA 4DN6A 4GP6A 3BH6A 4HNUA 3MCUA 3I01A 1TXGA 4G36A 4OKSA 4NCHA 1BJRE 3GLIB 2VT6A 1QHGA 4CIAA 4YRZA 1QKZA 2QE7D 3M3PA 5CLHA 1M1YB 5BN4A 4Y2HA 4OSEA 1O54A 2W3SA 2P90A 4ND5A 4BASA 5EWJA 3DE6X 1M54A 1V25A 1CDEA 4CFYA 1CUHA 3DOEA 4K5QA 4EB6A 2W48A 5AIBA 4F38A 3PD0A 3SOZA 2BUBA 3VYWA 3PFNA 3E9CA 2C94A 5FJIA 1MHTA 5D01A 3W5AA 2L52A 4GW3A 3U9SA 4DPMA 3SZ3A 3AHFA 1WEHA 2C9CA 2I8CA 5BV0A 2KLCA 4FE4A 3R2UA 1UKEA 5HKOA 1NI2A 2RB5A 4GCWA 4CCWA 4DAEA 4WLEA 3CB4A 2YJ3A 5IS2A 1WZ3A 4I1VA 2KX3A 4I55B 4EW3A 5FI0B 1NX9A 3QKRA 5KC9A 2L32A 3SOPA 4JEUA 1E2LA 4XLZA 1N8SA 5CBPB 5L6MB 5FUBA 4M8IA 3DOUA 3IAS1 5ELXA 3N3AC 4DMUB 4JKYA 3O3OB 4OBBA 1MOZA 3U4AA 1AUXA 2F3SA 5KCMA 3HP1A 4NXNB 3L5OA 3AUTA 5CDGA 1L2NA 4ND1A 1SOMA 2EBHX 5A5VA 2I7VA 2ROQA 1SAYA 1U9IA 1UJMA 4QM6A 4LY0A 3R3HA 1QRRA 5KVSA 2F8TA 3CSTA 4B6OA 5E3JA 1X1DA 4IP0A 3CONA 4GX1A 2QZJA 2QWXA 1G5IA 1SKBA 3IPLA 3HGTA 1KAGA 2QQ0A 4XR4A 2A8YA 5L7TA 1AF7A 1XVVA 1FW6A 3L0YA 3FN4A 4UVDA 4DG8A 1VKHA 4CUZA 2BW2A 1UK7A 2I6FA 5BV2P 3K0KA 3S68A 1TQ2A 1WRIA 4FR7A 4B35A 4U9HS 4MYRA 5JAOA 3A0UA 5KQGA 4RIIA 4H7IA 4MV8A 4YJ3A 5JBIA 1GQRA 2M5CA 3HCPA 2NZJA 1E7UA 3UMSA 2RK4A 1GG8A 1OYWA 4BO2A 3QJYA 4Q1BA 4DLLA 1Y9ZA 1LSOA 4DCVA 1E3JA 2GCGA 5BN3B 4LEIA 2HPHA 2CJPA 3GI1A 4IIXA 4IH4A 4KGRA 1XZIA 3SXJA 3G8YA 1KI8A 4LYDA 3ZQ6A 3NG1A 1NLMA 1H85A 4CM4B 1K8QA 2ST1A 3Q8FA 3WOVA 4U6QA 4G0WA 2VA8A 4JX8A 4JA2A 3RFTA 4IJQA 3F96A 1C14A 1PEKE 5D1NA 4HWOA 3U4QA 5KAPA 1X9IA 1CETA 2XR1A 5DGHA 4QFMA 4B0EA 3FMOB 2C3PA 1GFWA 4XKJA 4OK5A 4MIKA 1GQ2A 1YAHA 1KO4A 1Z22A 3MT0A 4NBLA 3K9BA 5JAPA 5EVJA 2FU8A 2AL7A 1E9RA 5EKXA 5CK5A 1H8HD 5FR2A 1EGMB 1CJCA 4C56C 1XQ6A 1QIKA 1YNTE 1CUIA 4NZNA 5LBTA 1W0KA 2FRVA 1S3SG 2DUJA 2G71A 5ALNA 4WKGA 3SM3A 2NUAA 3JARB 4N0PA 1TCVA 3K2IA 4CU5A 1NRJB 3CX4A 1IPGA 4ZHQB 2CWDA 1EK6A 3R4CA 2YHAA 5C8YA 2FW7A 4F60A 1RDFA 3S55A 1FLNA 5INTA 2XBBC 4II3B 1EAYA 4UEKA 1XEEA 3A4RA 1A8PA 5DI3A 3NM4A 1LDGA 2WJJA 3ZI7A 3ON5A 3B1WA 4LA4A 3JALA 4JJFA 1QOGA 1U3VA 3SC2A 1M0WA 2W83A 4G63A 5KMGA 2GBLC 2Y1OA 1NYRA 4HUQA 4YB8A 1LK0A 3FI9A 4OHUA 1KDRA 4MM3B 4KAFA 3OLZA 1GADO 2JJ1A 2ZTVA 3IJ5A 2YNVB 1QGOA 1A5BB 1QCYA 2QD5A 4DC1A 3VR2A 2ZIEA 3I5UA 2D5GA 1BHJA 3CH5A 4UFNA 2D2QA 4GH5A 3AYZB 4PTLA 1IHYA 2G0TA 3EC8A 3V1UA 4OI1A 2FVYA 2WK1A 2Q0HA 4DHWA 4KDFA 3URMA 1ULTA 3CZ9A 3JSVB 3H2KA 4OUKX 2CFCA 2SKCA 3D1JA 1K0FA 1WSWA 2O8FB 3CEPB 3FY4A 4CQMA 3T7JA 2DFTA 3N3BC 4KQMA 4RESA 5EHQA 3Q5GA 2IWRA 4MHOA 3CM0A 4CLOA 1F9AA 3H6KA 3IL2A 3MM4A 3KQWA 4LX0A 2JLZA 3OJCA 1YSCA 2JHCA 2RGXA 2Z43A 4KRGA 4L3WA 3WWOA 2HXGA 3U3DA 4GKAA 2PKWA 3RTCA 2ZT7A 1RM3A 2OBMA 2NACA 3BWYA 3W78A 4PS3A 4DCMA 1W4ZA 3F8TA 3O73A 2R65A 3ZW3A 4U7DA 3LFUA 3IBSA 4W9NC 3B2QA 5E6SA 1GO2A 1R50A 2YXNA 5HE8A 3GZNI 5JLJA 3OJWA 3KD2A 2FZEA 3KWJA 3THSA 3AR4A 3A70A 4BQNA 2PD3A 4RVNA 3LHIA 3SLKA 2E4XA 4KXFB 5CT4A 1C1XB 3LSTA 2OEDA 2FHXB 1KQPA 2LDBA 4DLZA 2P9BA 4JI5B 4OQNA 2PLFA 4LRWA 1T0YA 5HUJA 4RHFA 3O4RA 1RBZA 1WXVA 3GQVA 3E9EA 1H2BA 3ZBUA 1SXHA 2DTDA 1D3AA 1E7SA 1NIJA 3IMFA 1ZNQO 1NIPA 5ERGB 3FWZA 3NHEB 2A78A 2OG1A 2XUFA 1XUOA 4IKPA 3RJTA 3KAPA 1PDOA 3HU5A 3CIRB 3K1AB 4GQAA 1XJWA 5AK5A 1TM2A 4MTLA 4L8YA 4EG0A 1JB9A 4K7UA 3AP3A 3OFNA 2J45A 1ZK1A 1DLJA 1TS3A 3HUEA 2FSUA 3RJ9A 4F2GA 2OHXA 3TFOA 2FPMA 1U0NA 4JXZA 2O52A 4AECA 1YKSA 2OAGA 3IKVA 4Z7NB 3U9TA 1DDOA 5JQGB 4G37A 3GLUA 2H3EA 5IW8A 4IQ0A 4ZK6A 4GR5A 2IUTA 4LOHA 3W2GA 1ZEMA 4UM5A 1G38A 4WVFA 4YTEA 3KX2A 1Z47A 3V34A 5EE0A 1A8HA 2WTUA 3U09A 2UYOA 4A8JB 2G5TA 1C30B 4UUBA 1Q95A 4PK1A 3EIUA 4KWEA 1RPAA 3TUOA 3SF0A 2BEJA 2H2WA 4FQ8A 4P3XA 2HU8A 4FWBA 4LFCB 1D1PA 2H1SA 1RZRD 5DGXA 2FN8A 2ZIVB 5H0IA 3WFIA 1KAOA 5DM60 1ODLA 1EU3A 5FNVA 4A0SA 5BUSA 4FFBA 3KKPA 3HVIA 5DM2A 3Q3VA 1SXGA 2A14A 4F2PA 2AK3A 1K98A 2XQVA 4KO8A 3ZG6A 2P18A 2GBCA 4TZ0A 4EFLA 1T8RA 4L02A 2H3HA 2QM7A 3PWSA 3L40A 4H77A 4KFSA 2DKNA 3GRUA 1P7VA 2O8BA 3UUFA 2YWHA 1UKYA 5JT1A 4RVGA 2J3MA 5AHWA 1TMYA 1MV8A 1KH3A 4NH4A 1X1TA 3PS6A 3ESYA 2X4LA 4DPLA 4UAVA 4L5JA 4R2IA 1U63A 3JD0A 4C14A 1IG0A 3BZUA 4X1KB 1SQFA 4P36A 9LDTA 4QOFA 3D0OA 4FONA 1GUAB 2ZDHA 1E3LA 3UJNA 3CT6A 1RMQA 3RW9A 4BLUA 2W0MA 3X2FA 2GZAA 2PZJA 4Y30A 2AFVA 2BY4A 4QQ8A 4QPPA 1HYQA 1ZPDA 1ADFA 3AF5A 5AVRA 2PVPA 3C1AA 5A02A 4LAFA 1LGRA 2A3RA 3L1VA 3TLZA 1E9CA 3C5HA 3LUBA 2NSHA 4CMCA 2JLRA 4PANA 2PR7A 3I15A 1V96A 4PG6A 1DPFA 2LXNA 3NZEA 4Q3OA 4BX0A 1KY3A 1K6EA 4HLUA 4HDSB 3OT5A 2QTWB 1SG9A 1YZKA 4L7QA 3LHFA 4R83A 4G4SO 4FLMA 1X7HA 1C3EA 1NJ2A 2Q3CA 3EDYA 3QQ8B 4W9MC 2ZRDA 3ND7A 2FN7A 4RGMA 2EELA 2KMCA 3D4IA 1PT8A 5HGJA 2P2DA 1NVKA 3MELA 5JHAA 3QPAA 1T3SA 4UTXA 2K6DB 1SB8A 1A7KA 1FD6A 2QLTA 5B3JC 5SYMA 3P32A 1L4HA 1W581 2HIMA 1T1RA 3PL5A 2HT6A 4QX6A 2F2TA 3NALA 1TLLA 4YYEA 4BFLA 3WAOA 3VBEA 4ED9A 3IOBA 3K35A 4Q24A 1V1RB 1A71A 1J5XA 2R6FA 5JCOA 1IN4A 1G16A 2LJIA 1QTQA 2OCKA 1VJ5A 3ZXRA 2UVPB 2I4LA 3JZDA 3A1EA 3J7AC 3MWEB 3NRZA 1XMOB 5KWSA 4NS4A 4CIYA 5CLGA 3GRKA 1I94B 5L3VA 1BD4A 4RKQA 4K3UA 2IYPA 3H9GA 1PSZA 5T7BA 3SHQA 1IB6A 2KM1A 5A4JA 2OHGA 4ZXFA 2IE0A 4ZANA 1OV4A 2Z2KA 3HA2A 1KH1A 5CBPA 3L1KA 5AJTA 4L8GA 5LQNA 4A23A 1OAOC 2ZAMA 1HNXB 3NAGA 4BQIA 3L8ZA 3E7PA 1I7HA 5ITVA 4CR8A 4IDEA 3TTYA 3EEIA 2PCJA 4LHEA 1NRXA 3EUAA 3EUB2 5FAKA 1CQJB 3GJRA 3IJPA 4U2CA 2XIJA 3DT6A 5G02A 4G24A 4Q37A 3WBBA 1AB5A 1QKIA 1PGPA 3M1IA 5CHEA 2YNMA 5BSTA 4YMUA 1ATIA 3O9ZA 4Y1EA 4KPYA 4KNWA 5F1OA 1T0RC 1WX9A 1BX1A 2ZTUA 2EF0A 4A20A 5JW6A 4Z8YA 2Z8LA 1TYDE 3WAPA 4QBHA 2HREA 2PA3A 3DE1X 5FL3A 4MI3A 2F3QA 1BE0A 2C07A 3P1JA 5EUQB 1LFDB 4NP6A 4M0CA 1N36B 4ND8A 3RS0A 2L0FA 1NJSA 1JEAA 4GMFA 3ZJTA 3ZJ4A 3K9PB 2B4RO 3WWZA 5HKAA 3A7EA 3DHWC 1R9NA 4F4CA 2CLCX 1YJIA 4QELA 4GC9A 1ONBA 2DEUA 4H0NA 3JD4A 3UIOB 1D1TA 1E79D 2G28A 1WEKA 3UGBB 3K6RA 2Y6UA 2G25A 4AX1B 4EJSB 3FWKA 1CDZA 5J2RA 4NARA 5BN3A 3CZCA 1RE1A 1KU0A 2BFWA 1BDHA 1U8AA 1L5FA 2GAAA 1WH3A 5T3UA 3KZCA 5AKHA 2XWJI 2CXTA 3QHQA 4FTWA 2I6XA 1MG8A 4W7IA 5E6OA 1BMCA 1O03A 4NONA 4GBED 1L7EA 3OE7D 2JD0A 4K28A 5CBKA 2FN9A 2L1AA 4F3RA 2MWSB 2OAEA 3AF1A 2I4IA 2PXAA 4AMYA 1RHRA 3FNHA 2JZPA 4RLSA 2P8JA 1U1GA 1QE3A 3TLEA 4K9SA 2I2BA 1JHMA 4KQCA 2FSVC 4NE2A 4J0HA 2WTBA 3L0BA 3RANA 2RC6A 2H1HA 4AVYA 2XUKA 5JADA 3UKJA 1HTWA 2YKGA 3GMIA 4XYLA 4Z6KA 1KDTA 2Z0MA 2ES4A 2IF2A 3IUSA 3ZZTA 4IDAA 4OXRA 1CY7A 1B8NA 1O6CA 2G77B 5HMMA 3AQIA 2AFHB 4OB6A 3I8SA 3KQ4A 3RQSA 1ISJA 3R7WA 2BZ0A 4D6PA 3Q3EA 3Q98A 3V6CB 5FPYA 2G5GX 2HO5A 5EUCA 1NZDA 3ZCXA 2ZO4A 3HWSA 1UODA