3T3WA

Crystal structure of probable enoyl-coa hydratase from mycobacterium thermoresistibile
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
249
structure length
241
Chain Sequence
b'EMYIDYDVSDRIATITLNRPEAANAQNPELLDELDAAWTRAAEDNDVSVIVLRANGKHFSAGHDLRLTLEFIYAHESRRYLEYSLRWRNVPKPSIAAVQGRCISGGLLLCWPCDLIIAAEDALFSDPVVLMDIGGVEYHGHTWELGPRKAKEILFTGRAMTAEEVAQTGMVNRVVPRDRLDAETRALAGEIAKMPPFALRQAKRAVNQTLDVQGFYAAIQSVFDIHQTGHGNAMSVSGWPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-CoA hydratase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium thermoresistibile
molecule tags Lyase
total genus 104
structure length 241
sequence length 249
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3t3wA00
3DORA 1EF8A 4JYLA 3R9TA 2F9YA 2VSUC 2A7SA 5DU4A 3JU1A 3Q0GA 4I52A 1XX4A 2NP9A 2F6IA 4JYJA 4EMLA 4B3HA 4ZDDA 4OG1A 3KTIA 3GF3A 1J7XA 3TZ3A 2WTBA 4MOUA 3Q7HA 3WG5A 4QIJA 3SWXA 1N6EA 4B3JA 3QKAA 4JCRA 3LKEA 1NZYA 2EJ5A 2D3TA 2VX2A 1TYFA 2GTRA 3ST9A 5INFA 3H0SA 4JCTA 2PG8A 1WDKA 4GHNA 4U0GH 4WYOB 5G1SA 3IB9A 4WZ8B 1WDLA 4HC8A 4K3WA 2DUBA 1K39A 1XNVA 4U18A 1XNWA 4GM2A 5DTWA 3BPPA 3R9QA 3LAOA 1JXZA 3U9TB 4FNDA 4KNPA 3TV5A 5INGA 2J5GA 3OMEA 1FCFA 5FIFA 4K29A 3N6RB 3M6NA 4JOTA 2BZRA 4ELWA 4RYFH 3NJDA 5E0SA 3RSIA 4JWVA 2FZSA 4ZU2A 4Z0MA 3H0UA 5C9GA 1WZ8A 3T88A 3ZWBA 5C90A 4RCNA 3ZWAA 1SG4A 4IZCA 2PPYA 3H0QA 2X58A 2F6QA 4OLQA 2ZL2A 3U9SB 3P85A 3TT6A 3M6MA 4DI1A 3T3WA 3QREA 1VRGA 3T89A 1UYSA 4MXIA 5KJPA 4FNBA 4FJWD 3R6HA 3U9RB 2Q2XA 5MGBA 5DZKH 3QMJA 4ZDBA 1UIYA 2UZFA 2ZQQA 3GF7A 1K32A 4IZBA 3G64A 3QXIA 3PZKA 3QXZA 3QK8A 4JCSA 3MFMA 3QWDA 5DTPA 4ZDFA 3T8BA 3I47A 2ZL0A 1DUBA 3KQFA 4U0HA 5CTBA 3R0OA 3L3SA 3HE2A 5DU8A 3TLFA 1ON3A 4NEKA 1XO6A 3MT6A 4JJTA 3OT6A 5CTCA 1UYRA 1TG6A 3K8XA 3GLMA 2J5II 3H02A 1HNUA 2VSSF 2PBPA 2ZL3A 1MJ3A 1W2XA 4YLHA 3HLN1 4ELXA 2X24A 4MI2A 1Q52A 5G1QA 3OC7A 2J5IA 1UYVA 3NJBA 3P2LA 4FN8A 3MOYA 4KPKA 2Q34A 4L8KA 3HINA 5KDRA 4F47A 1EF9A 2CE3A 3FDUA 5INIA 3PEAA 3FF6A 3KTKA 4K2NA 4NNQA 1FC9A 1UYTA 4U0GA 3TVUA 3H0JA 3IAVA 3V5IA 2F9IA 1XNYA 3DJAA 4IZDA 3STAA 2W3PA 3TRRA 2VSSA 3BF0A 2FW2A 4QFEA 3T8AA 3GMAA 3BEZA 3RRVA 4RYFA 2J5SA 1Y7OA 3ZWCA 4B3IA 3Q1TA 3SLLA 1X0UA 4Q0GA 1HZDA 1ON9A 3K50A 2HW5A 2A81A 1FC6A 1WDMA 4EMMA 4ASIA 2ZL4A 1OD4A 5IKLB 2F9YB 3KTJA 1HNOA 1EY3A 3Q0JA 5JBWA 4JVTA 3RSTA 4U19A 4JCQA 4I42A 4FB8A 2C8TA 3MYBA 5JBXA 3PGQA 3ISAA 1RJNA 5DU6A 3IBBA 4L6WA 4ZDCA 5DZKA 5DUCA 2FBMA 3H81A 1O8UA 5DUFA 4KD6A 5G1RA 2VSUF 1RJMA 2QQ3A 3GKBA 2A7KA 2J5GD 4KWBA 4JFCA 5E0SH 4JSBA 3KTHA 4EMPA 5FUSA 1Q51A 1NZYB 5DKPA 2Q35A 3PE8A 3ZW8A 4ELSA 1OD2A 5DL1A 4WCZA 1PIXA 3P5MA 3HRXA 3R9SA 4QIIA 1YG6A 1N6DA 2DEOA 1SZOA 1FC7A 4LK5A 2J5IB 3QYRA 4G2RA 1PJHA 4U1AA 4FZWA 3KTGA 3TDCA 1YG8A 2ZQRA 4ZDEA 1N6FA 3VIVA 2VREA 5KDRB 1DCIA 4FN7A 4I4ZA 2CBYA 3HP0A 2IEXA 3V5EA 3TT7A 4Q1IA 4FZWC 4OMRA 2VSSE 4HNKA 5E0NX 3ZW9A 2VSUA 2F9IB 3TVWA 2VSUE
chains in the Genus database with same CATH superfamily
3DORA 1EF8A 4JYLA 3R9TA 2F9YA 2VSUC 2A7SA 5DU4A 3JU1A 3Q0GA 4I52A 1XX4A 2NP9A 2F6IA 4JYJA 4EMLA 4B3HA 4ZDDA 4OG1A 3KTIA 3GF3A 1J7XA 3TZ3A 2WTBA 4MOUA 3Q7HA 3WG5A 4QIJA 3SWXA 1N6EA 4B3JA 3QKAA 4JCRA 3LKEA 1NZYA 2YJGA 2EJ5A 2D3TA 2VX2A 1TYFA 2GTRA 3ST9A 5INFA 3H0SA 4JCTA 2PG8A 1WDKA 4GHNA 4U0GH 4WYOB 5G1SA 3IB9A 4WZ8B 1WDLA 4HC8A 4K3WA 2DUBA 1K39A 1XNVA 4U18A 1XNWA 4GM2A 5DTWA 3BPPA 3R9QA 3LAOA 1JXZA 3U9TB 4FNDA 4KNPA 3TV5A 5INGA 2J5GA 3OMEA 1FCFA 5FIFA 4K29A 3N6RB 3M6NA 4NARA 4JOTA 2BZRA 4ELWA 4RYFH 3NJDA 5E0SA 3RSIA 4JWVA 2FZSA 4ZU2A 4Z0MA 3H0UA 5C9GA 1WZ8A 3T88A 3ZWBA 5C90A 4RCNA 3ZWAA 1SG4A 4IZCA 2PPYA 3H0QA 2X58A 2F6QA 4OLQA 2ZL2A 3U9SB 3P85A 3TT6A 3M6MA 4DI1A 3T3WA 3QREA 1VRGA 3T89A 1UYSA 4MXIA 5KJPA 4FNBA 4FJWD 3R6HA 3BPTA 3U9RB 2Q2XA 5MGBA 5DZKH 3QMJA 4ZDBA 1UIYA 2UZFA 2ZQQA 3GF7A 1K32A 4IZBA 3G64A 3QXIA 3PZKA 3QXZA 3QK8A 4JCSA 3MFMA 3QWDA 5DTPA 4ZDFA 3T8BA 3I47A 2ZL0A 1DUBA 3KQFA 4U0HA 5CTBA 3R0OA 3L3SA 3HE2A 5DU8A 3TLFA 1ON3A 4NEKA 1XO6A 3MT6A 4JJTA 3OT6A 5CTCA 1UYRA 1TG6A 3K8XA 3GLMA 2J5II 3H02A 1HNUA 2VSSF 2PBPA 2ZL3A 1MJ3A 1W2XA 4YLHA 3HLN1 4ELXA 2X24A 4MI2A 1Q52A 5G1QA 3OC7A 2J5IA 1UYVA 3NJBA 3P2LA 4FN8A 3MOYA 4KPKA 2Q34A 4L8KA 3HINA 5KDRA 4F47A 1EF9A 2CE3A 3FDUA 5INIA 3PEAA 3FF6A 3KTKA 4K2NA 4NNQA 1FC9A 1UYTA 4U0GA 3TVUA 3H0JA 3IAVA 3V5IA 2F9IA 1XNYA 3DJAA 4IZDA 3STAA 2W3PA 3TRRA 2VSSA 3BF0A 2FW2A 4QFEA 3T8AA 3GMAA 3BEZA 3RRVA 4RYFA 2J5SA 1Y7OA 3ZWCA 4B3IA 3Q1TA 3SLLA 1X0UA 4Q0GA 1HZDA 1ON9A 3K50A 2HW5A 2A81A 1FC6A 1WDMA 4EMMA 4ASIA 4HDTA 2ZL4A 1OD4A 5IKLB 2F9YB 3KTJA 1HNOA 1EY3A 3Q0JA 5JBWA 4JVTA 3RSTA 4U19A 4JCQA 4I42A 4FB8A 2C8TA 3MYBA 5JBXA 3PGQA 3ISAA 1RJNA 5DU6A 3IBBA 4L6WA 4ZDCA 5DZKA 5DUCA 2FBMA 3H81A 1O8UA 5DUFA 4KD6A 5HUQA 5G1RA 2VSUF 1RJMA 2QQ3A 3GKBA 2A7KA 2J5GD 4KWBA 4JFCA 5E0SH 4JSBA 3KTHA 4EMPA 5FUSA 1Q51A 1NZYB 5DKPA 2Q35A 3PE8A 3ZW8A 4ELSA 1OD2A 5DL1A 4WCZA 1PIXA 3P5MA 3HRXA 3R9SA 4QIIA 1YG6A 1N6DA 2DEOA 1SZOA 1FC7A 4LK5A 2J5IB 3QYRA 4G2RA 1PJHA 4U1AA 4FZWA 3KTGA 3TDCA 1YG8A 2ZQRA 4ZDEA 1N6FA 3VIVA 2VREA 5KDRB 1DCIA 4FN7A 4I4ZA 2CBYA 3HP0A 2IEXA 3V5EA 3TT7A 4Q1IA 4FZWC 4OMRA 2VSSE 4HNKA 4J2UA 5E0NX 3ZW9A 2VSUA 2F9IB 3TVWA 2VSUE
chains in the Genus database with same CATH topology
3DORA 1EF8A 4JYLA 3R9TA 2F9YA 2VSUC 2A7SA 5DU4A 3JU1A 3Q0GA 4I52A 1XX4A 2NP9A 2F6IA 4JYJA 4EMLA 4B3HA 4ZDDA 4OG1A 3KTIA 3GF3A 1J7XA 3TZ3A 2WTBA 4MOUA 3Q7HA 3WG5A 4QIJA 3SWXA 1N6EA 4B3JA 3QKAA 4JCRA 3LKEA 1NZYA 2YJGA 2EJ5A 2D3TA 2VX2A 1TYFA 2GTRA 3ST9A 5INFA 3H0SA 4JCTA 2PG8A 1WDKA 4GHNA 4U0GH 4WYOB 5G1SA 3IB9A 4WZ8B 1WDLA 4HC8A 4K3WA 2DUBA 1K39A 1XNVA 4U18A 1XNWA 4GM2A 5DTWA 3BPPA 3R9QA 3LAOA 1JXZA 3U9TB 4FNDA 4KNPA 3TV5A 5INGA 2J5GA 3OMEA 1FCFA 5FIFA 4K29A 3N6RB 3M6NA 4NARA 4JOTA 2BZRA 4ELWA 4RYFH 3NJDA 5E0SA 3RSIA 4JWVA 2FZSA 4ZU2A 4Z0MA 3H0UA 5C9GA 1WZ8A 3T88A 3ZWBA 5C90A 4RCNA 3ZWAA 1SG4A 4IZCA 2PPYA 3H0QA 2X58A 2F6QA 4OLQA 2ZL2A 3U9SB 3P85A 3TT6A 3M6MA 4DI1A 3T3WA 3QREA 1VRGA 3T89A 1UYSA 4MXIA 5KJPA 4FNBA 4FJWD 3R6HA 3BPTA 3U9RB 2Q2XA 5MGBA 5DZKH 3QMJA 4ZDBA 1UIYA 2UZFA 2ZQQA 3GF7A 1K32A 4IZBA 3G64A 3QXIA 3PZKA 3QXZA 3QK8A 4JCSA 3MFMA 3QWDA 5DTPA 4ZDFA 3T8BA 3I47A 2ZL0A 1DUBA 3KQFA 4U0HA 5CTBA 3R0OA 3L3SA 3HE2A 5DU8A 3TLFA 1ON3A 4NEKA 1XO6A 3MT6A 4JJTA 3OT6A 5CTCA 1UYRA 1TG6A 3K8XA 3GLMA 2J5II 3H02A 1HNUA 2VSSF 2PBPA 2ZL3A 1MJ3A 1W2XA 4YLHA 3HLN1 4ELXA 2X24A 4MI2A 1Q52A 5G1QA 3OC7A 2J5IA 1UYVA 3NJBA 3P2LA 4FN8A 3MOYA 4KPKA 2Q34A 4L8KA 3HINA 5KDRA 4F47A 1EF9A 2CE3A 3FDUA 5INIA 3PEAA 3FF6A 3KTKA 4K2NA 4NNQA 1FC9A 1UYTA 4U0GA 3TVUA 3H0JA 3IAVA 3V5IA 2F9IA 1XNYA 3DJAA 4IZDA 3STAA 2W3PA 3TRRA 2VSSA 3BF0A 2FW2A 4QFEA 3T8AA 3GMAA 3BEZA 3RRVA 4RYFA 2J5SA 1Y7OA 3ZWCA 4B3IA 3Q1TA 3SLLA 1X0UA 4Q0GA 1HZDA 1ON9A 3K50A 2HW5A 2A81A 1FC6A 1WDMA 4EMMA 4ASIA 4HDTA 2ZL4A 1OD4A 5IKLB 2F9YB 3KTJA 1HNOA 1EY3A 3Q0JA 5JBWA 4JVTA 3RSTA 4U19A 4JCQA 4I42A 4FB8A 2C8TA 3MYBA 5JBXA 3PGQA 3ISAA 1RJNA 5DU6A 3IBBA 4L6WA 4ZDCA 5DZKA 5DUCA 2FBMA 3H81A 1O8UA 5DUFA 4KD6A 5HUQA 5G1RA 2VSUF 1RJMA 2QQ3A 3GKBA 2A7KA 2J5GD 4KWBA 4JFCA 5E0SH 4JSBA 3KTHA 4EMPA 5FUSA 1Q51A 1NZYB 5DKPA 2Q35A 3PE8A 3ZW8A 4ELSA 1OD2A 5DL1A 4WCZA 1PIXA 3P5MA 3HRXA 3R9SA 4QIIA 1YG6A 1N6DA 2DEOA 1SZOA 1FC7A 4LK5A 2J5IB 3QYRA 4G2RA 1PJHA 4U1AA 4FZWA 3KTGA 3TDCA 1YG8A 2ZQRA 4ZDEA 1N6FA 3VIVA 2VREA 5KDRB 1DCIA 4FN7A 4I4ZA 2CBYA 3HP0A 2IEXA 3V5EA 3TT7A 4Q1IA 4FZWC 4OMRA 2VSSE 4HNKA 4J2UA 5E0NX 3ZW9A 2VSUA 2F9IB 3TVWA 2VSUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DOR A;  1EF8 A;  4JYL A;  3R9T A;  2F9Y A;  2VSU C;  2A7S A;  5DU4 A;  3JU1 A;  3Q0G A;  4I52 A;  1XX4 A;  2NP9 A;  2F6I A;  4JYJ A;  4EML A;  4B3H A;  4ZDD A;  4OG1 A;  3KTI A;  3GF3 A;  1J7X A;  3TZ3 A;  2WTB A;  4MOU A;  3Q7H A;  3WG5 A;  4QIJ A;  3SWX A;  1N6E A;  4B3J A;  3QKA A;  4JCR A;  3LKE A;  1NZY A;  2EJ5 A;  2D3T A;  2VX2 A;  1TYF A;  2GTR A;  3ST9 A;  5INF A;  3H0S A;  4JCT A;  2PG8 A;  1WDK A;  4GHN A;  4U0G H;  4WYO B;  5G1S A;  3IB9 A;  4WZ8 B;  1WDL A;  4HC8 A;  4K3W A;  2DUB A;  1K39 A;  1XNV A;  4U18 A;  1XNW A;  4GM2 A;  5DTW A;  3BPP A;  3R9Q A;  3LAO A;  1JXZ A;  3U9T B;  4FND A;  4KNP A;  3TV5 A;  5ING A;  2J5G A;  3OME A;  1FCF A;  5FIF A;  4K29 A;  3N6R B;  3M6N A;  4JOT A;  2BZR A;  4ELW A;  4RYF H;  3NJD A;  5E0S A;  3RSI A;  4JWV A;  2FZS A;  4ZU2 A;  4Z0M A;  3H0U A;  5C9G A;  1WZ8 A;  3T88 A;  3ZWB A;  5C90 A;  4RCN A;  3ZWA A;  1SG4 A;  4IZC A;  2PPY A;  3H0Q A;  2X58 A;  2F6Q A;  4OLQ A;  2ZL2 A;  3U9S B;  3P85 A;  3TT6 A;  3M6M A;  4DI1 A;  3T3W A;  3QRE A;  1VRG A;  3T89 A;  1UYS A;  4MXI A;  5KJP A;  4FNB A;  4FJW D;  3R6H A;  3U9R B;  2Q2X A;  5MGB A;  5DZK H;  3QMJ A;  4ZDB A;  1UIY A;  2UZF A;  2ZQQ A;  3GF7 A;  1K32 A;  4IZB A;  3G64 A;  3QXI A;  3PZK A;  3QXZ A;  3QK8 A;  4JCS A;  3MFM A;  3QWD A;  5DTP A;  4ZDF A;  3T8B A;  3I47 A;  2ZL0 A;  1DUB A;  3KQF A;  4U0H A;  5CTB A;  3R0O A;  3L3S A;  3HE2 A;  5DU8 A;  3TLF A;  1ON3 A;  4NEK A;  1XO6 A;  3MT6 A;  4JJT A;  3OT6 A;  5CTC A;  1UYR A;  1TG6 A;  3K8X A;  3GLM A;  2J5I I;  3H02 A;  1HNU A;  2VSS F;  2PBP A;  2ZL3 A;  1MJ3 A;  1W2X A;  4YLH A;  3HLN 1;  4ELX A;  2X24 A;  4MI2 A;  1Q52 A;  5G1Q A;  3OC7 A;  2J5I A;  1UYV A;  3NJB A;  3P2L A;  4FN8 A;  3MOY A;  4KPK A;  2Q34 A;  4L8K A;  3HIN A;  5KDR A;  4F47 A;  1EF9 A;  2CE3 A;  3FDU A;  5INI A;  3PEA A;  3FF6 A;  3KTK A;  4K2N A;  4NNQ A;  1FC9 A;  1UYT A;  4U0G A;  3TVU A;  3H0J A;  3IAV A;  3V5I A;  2F9I A;  1XNY A;  3DJA A;  4IZD A;  3STA A;  2W3P A;  3TRR A;  2VSS A;  3BF0 A;  2FW2 A;  4QFE A;  3T8A A;  3GMA A;  3BEZ A;  3RRV A;  4RYF A;  2J5S A;  1Y7O A;  3ZWC A;  4B3I A;  3Q1T A;  3SLL A;  1X0U A;  4Q0G A;  1HZD A;  1ON9 A;  3K50 A;  2HW5 A;  2A81 A;  1FC6 A;  1WDM A;  4EMM A;  4ASI A;  2ZL4 A;  1OD4 A;  5IKL B;  2F9Y B;  3KTJ A;  1HNO A;  1EY3 A;  3Q0J A;  5JBW A;  4JVT A;  3RST A;  4U19 A;  4JCQ A;  4I42 A;  4FB8 A;  2C8T A;  3MYB A;  5JBX A;  3PGQ A;  3ISA A;  1RJN A;  5DU6 A;  3IBB A;  4L6W A;  4ZDC A;  5DZK A;  5DUC A;  2FBM A;  3H81 A;  1O8U A;  5DUF A;  4KD6 A;  5G1R A;  2VSU F;  1RJM A;  2QQ3 A;  3GKB A;  2A7K A;  2J5G D;  4KWB A;  4JFC A;  5E0S H;  4JSB A;  3KTH A;  4EMP A;  5FUS A;  1Q51 A;  1NZY B;  5DKP A;  2Q35 A;  3PE8 A;  3ZW8 A;  4ELS A;  1OD2 A;  5DL1 A;  4WCZ A;  1PIX A;  3P5M A;  3HRX A;  3R9S A;  4QII A;  1YG6 A;  1N6D A;  2DEO A;  1SZO A;  1FC7 A;  4LK5 A;  2J5I B;  3QYR A;  4G2R A;  1PJH A;  4U1A A;  4FZW A;  3KTG A;  3TDC A;  1YG8 A;  2ZQR A;  4ZDE A;  1N6F A;  3VIV A;  2VRE A;  5KDR B;  1DCI A;  4FN7 A;  4I4Z A;  2CBY A;  3HP0 A;  2IEX A;  3V5E A;  3TT7 A;  4Q1I A;  4FZW C;  4OMR A;  2VSS E;  4HNK A;  5E0N X;  3ZW9 A;  2VSU A;  2F9I B;  3TVW A;  2VSU E; 
#chains in the Genus database with same CATH topology
 3DOR A;  1EF8 A;  4JYL A;  3R9T A;  2F9Y A;  2VSU C;  2A7S A;  5DU4 A;  3JU1 A;  3Q0G A;  4I52 A;  1XX4 A;  2NP9 A;  2F6I A;  4JYJ A;  4EML A;  4B3H A;  4ZDD A;  4OG1 A;  3KTI A;  3GF3 A;  1J7X A;  3TZ3 A;  2WTB A;  4MOU A;  3Q7H A;  3WG5 A;  4QIJ A;  3SWX A;  1N6E A;  4B3J A;  3QKA A;  4JCR A;  3LKE A;  1NZY A;  2YJG A;  2EJ5 A;  2D3T A;  2VX2 A;  1TYF A;  2GTR A;  3ST9 A;  5INF A;  3H0S A;  4JCT A;  2PG8 A;  1WDK A;  4GHN A;  4U0G H;  4WYO B;  5G1S A;  3IB9 A;  4WZ8 B;  1WDL A;  4HC8 A;  4K3W A;  2DUB A;  1K39 A;  1XNV A;  4U18 A;  1XNW A;  4GM2 A;  5DTW A;  3BPP A;  3R9Q A;  3LAO A;  1JXZ A;  3U9T B;  4FND A;  4KNP A;  3TV5 A;  5ING A;  2J5G A;  3OME A;  1FCF A;  5FIF A;  4K29 A;  3N6R B;  3M6N A;  4NAR A;  4JOT A;  2BZR A;  4ELW A;  4RYF H;  3NJD A;  5E0S A;  3RSI A;  4JWV A;  2FZS A;  4ZU2 A;  4Z0M A;  3H0U A;  5C9G A;  1WZ8 A;  3T88 A;  3ZWB A;  5C90 A;  4RCN A;  3ZWA A;  1SG4 A;  4IZC A;  2PPY A;  3H0Q A;  2X58 A;  2F6Q A;  4OLQ A;  2ZL2 A;  3U9S B;  3P85 A;  3TT6 A;  3M6M A;  4DI1 A;  3T3W A;  3QRE A;  1VRG A;  3T89 A;  1UYS A;  4MXI A;  5KJP A;  4FNB A;  4FJW D;  3R6H A;  3BPT A;  3U9R B;  2Q2X A;  5MGB A;  5DZK H;  3QMJ A;  4ZDB A;  1UIY A;  2UZF A;  2ZQQ A;  3GF7 A;  1K32 A;  4IZB A;  3G64 A;  3QXI A;  3PZK A;  3QXZ A;  3QK8 A;  4JCS A;  3MFM A;  3QWD A;  5DTP A;  4ZDF A;  3T8B A;  3I47 A;  2ZL0 A;  1DUB A;  3KQF A;  4U0H A;  5CTB A;  3R0O A;  3L3S A;  3HE2 A;  5DU8 A;  3TLF A;  1ON3 A;  4NEK A;  1XO6 A;  3MT6 A;  4JJT A;  3OT6 A;  5CTC A;  1UYR A;  1TG6 A;  3K8X A;  3GLM A;  2J5I I;  3H02 A;  1HNU A;  2VSS F;  2PBP A;  2ZL3 A;  1MJ3 A;  1W2X A;  4YLH A;  3HLN 1;  4ELX A;  2X24 A;  4MI2 A;  1Q52 A;  5G1Q A;  3OC7 A;  2J5I A;  1UYV A;  3NJB A;  3P2L A;  4FN8 A;  3MOY A;  4KPK A;  2Q34 A;  4L8K A;  3HIN A;  5KDR A;  4F47 A;  1EF9 A;  2CE3 A;  3FDU A;  5INI A;  3PEA A;  3FF6 A;  3KTK A;  4K2N A;  4NNQ A;  1FC9 A;  1UYT A;  4U0G A;  3TVU A;  3H0J A;  3IAV A;  3V5I A;  2F9I A;  1XNY A;  3DJA A;  4IZD A;  3STA A;  2W3P A;  3TRR A;  2VSS A;  3BF0 A;  2FW2 A;  4QFE A;  3T8A A;  3GMA A;  3BEZ A;  3RRV A;  4RYF A;  2J5S A;  1Y7O A;  3ZWC A;  4B3I A;  3Q1T A;  3SLL A;  1X0U A;  4Q0G A;  1HZD A;  1ON9 A;  3K50 A;  2HW5 A;  2A81 A;  1FC6 A;  1WDM A;  4EMM A;  4ASI A;  4HDT A;  2ZL4 A;  1OD4 A;  5IKL B;  2F9Y B;  3KTJ A;  1HNO A;  1EY3 A;  3Q0J A;  5JBW A;  4JVT A;  3RST A;  4U19 A;  4JCQ A;  4I42 A;  4FB8 A;  2C8T A;  3MYB A;  5JBX A;  3PGQ A;  3ISA A;  1RJN A;  5DU6 A;  3IBB A;  4L6W A;  4ZDC A;  5DZK A;  5DUC A;  2FBM A;  3H81 A;  1O8U A;  5DUF A;  4KD6 A;  5HUQ A;  5G1R A;  2VSU F;  1RJM A;  2QQ3 A;  3GKB A;  2A7K A;  2J5G D;  4KWB A;  4JFC A;  5E0S H;  4JSB A;  3KTH A;  4EMP A;  5FUS A;  1Q51 A;  1NZY B;  5DKP A;  2Q35 A;  3PE8 A;  3ZW8 A;  4ELS A;  1OD2 A;  5DL1 A;  4WCZ A;  1PIX A;  3P5M A;  3HRX A;  3R9S A;  4QII A;  1YG6 A;  1N6D A;  2DEO A;  1SZO A;  1FC7 A;  4LK5 A;  2J5I B;  3QYR A;  4G2R A;  1PJH A;  4U1A A;  4FZW A;  3KTG A;  3TDC A;  1YG8 A;  2ZQR A;  4ZDE A;  1N6F A;  3VIV A;  2VRE A;  5KDR B;  1DCI A;  4FN7 A;  4I4Z A;  2CBY A;  3HP0 A;  2IEX A;  3V5E A;  3TT7 A;  4Q1I A;  4FZW C;  4OMR A;  2VSS E;  4HNK A;  4J2U A;  5E0N X;  3ZW9 A;  2VSU A;  2F9I B;  3TVW A;  2VSU E; 
#chains in the Genus database with same CATH homology
 3DOR A;  1EF8 A;  4JYL A;  3R9T A;  2F9Y A;  2VSU C;  2A7S A;  5DU4 A;  3JU1 A;  3Q0G A;  4I52 A;  1XX4 A;  2NP9 A;  2F6I A;  4JYJ A;  4EML A;  4B3H A;  4ZDD A;  4OG1 A;  3KTI A;  3GF3 A;  1J7X A;  3TZ3 A;  2WTB A;  4MOU A;  3Q7H A;  3WG5 A;  4QIJ A;  3SWX A;  1N6E A;  4B3J A;  3QKA A;  4JCR A;  3LKE A;  1NZY A;  2YJG A;  2EJ5 A;  2D3T A;  2VX2 A;  1TYF A;  2GTR A;  3ST9 A;  5INF A;  3H0S A;  4JCT A;  2PG8 A;  1WDK A;  4GHN A;  4U0G H;  4WYO B;  5G1S A;  3IB9 A;  4WZ8 B;  1WDL A;  4HC8 A;  4K3W A;  2DUB A;  1K39 A;  1XNV A;  4U18 A;  1XNW A;  4GM2 A;  5DTW A;  3BPP A;  3R9Q A;  3LAO A;  1JXZ A;  3U9T B;  4FND A;  4KNP A;  3TV5 A;  5ING A;  2J5G A;  3OME A;  1FCF A;  5FIF A;  4K29 A;  3N6R B;  3M6N A;  4NAR A;  4JOT A;  2BZR A;  4ELW A;  4RYF H;  3NJD A;  5E0S A;  3RSI A;  4JWV A;  2FZS A;  4ZU2 A;  4Z0M A;  3H0U A;  5C9G A;  1WZ8 A;  3T88 A;  3ZWB A;  5C90 A;  4RCN A;  3ZWA A;  1SG4 A;  4IZC A;  2PPY A;  3H0Q A;  2X58 A;  2F6Q A;  4OLQ A;  2ZL2 A;  3U9S B;  3P85 A;  3TT6 A;  3M6M A;  4DI1 A;  3T3W A;  3QRE A;  1VRG A;  3T89 A;  1UYS A;  4MXI A;  5KJP A;  4FNB A;  4FJW D;  3R6H A;  3BPT A;  3U9R B;  2Q2X A;  5MGB A;  5DZK H;  3QMJ A;  4ZDB A;  1UIY A;  2UZF A;  2ZQQ A;  3GF7 A;  1K32 A;  4IZB A;  3G64 A;  3QXI A;  3PZK A;  3QXZ A;  3QK8 A;  4JCS A;  3MFM A;  3QWD A;  5DTP A;  4ZDF A;  3T8B A;  3I47 A;  2ZL0 A;  1DUB A;  3KQF A;  4U0H A;  5CTB A;  3R0O A;  3L3S A;  3HE2 A;  5DU8 A;  3TLF A;  1ON3 A;  4NEK A;  1XO6 A;  3MT6 A;  4JJT A;  3OT6 A;  5CTC A;  1UYR A;  1TG6 A;  3K8X A;  3GLM A;  2J5I I;  3H02 A;  1HNU A;  2VSS F;  2PBP A;  2ZL3 A;  1MJ3 A;  1W2X A;  4YLH A;  3HLN 1;  4ELX A;  2X24 A;  4MI2 A;  1Q52 A;  5G1Q A;  3OC7 A;  2J5I A;  1UYV A;  3NJB A;  3P2L A;  4FN8 A;  3MOY A;  4KPK A;  2Q34 A;  4L8K A;  3HIN A;  5KDR A;  4F47 A;  1EF9 A;  2CE3 A;  3FDU A;  5INI A;  3PEA A;  3FF6 A;  3KTK A;  4K2N A;  4NNQ A;  1FC9 A;  1UYT A;  4U0G A;  3TVU A;  3H0J A;  3IAV A;  3V5I A;  2F9I A;  1XNY A;  3DJA A;  4IZD A;  3STA A;  2W3P A;  3TRR A;  2VSS A;  3BF0 A;  2FW2 A;  4QFE A;  3T8A A;  3GMA A;  3BEZ A;  3RRV A;  4RYF A;  2J5S A;  1Y7O A;  3ZWC A;  4B3I A;  3Q1T A;  3SLL A;  1X0U A;  4Q0G A;  1HZD A;  1ON9 A;  3K50 A;  2HW5 A;  2A81 A;  1FC6 A;  1WDM A;  4EMM A;  4ASI A;  4HDT A;  2ZL4 A;  1OD4 A;  5IKL B;  2F9Y B;  3KTJ A;  1HNO A;  1EY3 A;  3Q0J A;  5JBW A;  4JVT A;  3RST A;  4U19 A;  4JCQ A;  4I42 A;  4FB8 A;  2C8T A;  3MYB A;  5JBX A;  3PGQ A;  3ISA A;  1RJN A;  5DU6 A;  3IBB A;  4L6W A;  4ZDC A;  5DZK A;  5DUC A;  2FBM A;  3H81 A;  1O8U A;  5DUF A;  4KD6 A;  5HUQ A;  5G1R A;  2VSU F;  1RJM A;  2QQ3 A;  3GKB A;  2A7K A;  2J5G D;  4KWB A;  4JFC A;  5E0S H;  4JSB A;  3KTH A;  4EMP A;  5FUS A;  1Q51 A;  1NZY B;  5DKP A;  2Q35 A;  3PE8 A;  3ZW8 A;  4ELS A;  1OD2 A;  5DL1 A;  4WCZ A;  1PIX A;  3P5M A;  3HRX A;  3R9S A;  4QII A;  1YG6 A;  1N6D A;  2DEO A;  1SZO A;  1FC7 A;  4LK5 A;  2J5I B;  3QYR A;  4G2R A;  1PJH A;  4U1A A;  4FZW A;  3KTG A;  3TDC A;  1YG8 A;  2ZQR A;  4ZDE A;  1N6F A;  3VIV A;  2VRE A;  5KDR B;  1DCI A;  4FN7 A;  4I4Z A;  2CBY A;  3HP0 A;  2IEX A;  3V5E A;  3TT7 A;  4Q1I A;  4FZW C;  4OMR A;  2VSS E;  4HNK A;  4J2U A;  5E0N X;  3ZW9 A;  2VSU A;  2F9I B;  3TVW A;  2VSU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...