3T3WA

Crystal structure of probable enoyl-coa hydratase from mycobacterium thermoresistibile
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
249
structure length
241
Chain Sequence
EMYIDYDVSDRIATITLNRPEAANAQNPELLDELDAAWTRAAEDNDVSVIVLRANGKHFSAGHDLRLTLEFIYAHESRRYLEYSLRWRNVPKPSIAAVQGRCISGGLLLCWPCDLIIAAEDALFSDPVVLMDIGGVEYHGHTWELGPRKAKEILFTGRAMTAEEVAQTGMVNRVVPRDRLDAETRALAGEIAKMPPFALRQAKRAVNQTLDVQGFYAAIQSVFDIHQTGHGNAMSVSGWPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium thermoresistibile
molecule tags Lyase
molecule keywords Enoyl-CoA hydratase
total genus 104
structure length 241
sequence length 249
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3t3wA00
2J5GD 3QK8A 4WCZA 5DU4A 3QXZA 3LAOA 5G1QA 1FC7A 4RCNA 4ZDFA 3KTGA 4L8KA 3M6MA 1K39A 3P2LA 1K32A 2C8TA 3NJDA 1TG6A 2ZL3A 3RSIA 3P85A 4QFEA 1DUBA 3R6HA 4EMLA 3STAA 4U0GH 3QKAA 5DZKA 2X58A 1SG4A 3QMJA 4WZ8B 4NNQA 3KTIA 4JFCA 2VSUE 3SLLA 4HC8A 2J5SA 3QXIA 4JVTA 4FN8A 4G2RA 2DEOA 3P5MA 3IBBA 3T89A 3H02A 3K8XA 1Y7OA 4U1AA 5E0NX 1O8UA 4FZWC 3I47A 3G64A 4ZU2A 3HRXA 1TYFA 3MOYA 4JOTA 5MGBA 5JBXA 3KQFA 4EMPA 1UYRA 3RRVA 2Q34A 1WDKA 4JCRA 4LK5A 2X24A 4U0HA 3OC7A 3JU1A 3V5EA 3HP0A 2WTBA 1EF8A 4RYFA 2VSUC 1W2XA 4JCTA 1ON9A 2NP9A 2A7KA 1X0UA 3TLFA 5DU6A 5G1SA 2J5IA 5KJPA 1Q51A 2FZSA 4B3HA 3H0QA 1NZYA 1EF9A 3FF6A 2GTRA 4RYFH 3GKBA 3ZWCA 3QWDA 3R9QA 5DZKH 4JYJA 5C90A 4Q1IA 3H0SA 2BZRA 3GF7A 4DI1A 1UYVA 4JCSA 2VSSF 4FNBA 3QREA 5FUSA 4JJTA 4K29A 2ZL2A 3IB9A 3QYRA 1JXZA 4EMMA 4QIIA 3VIVA 5E0SH 4KNPA 2FW2A 2A81A 1ON3A 4MOUA 3ST9A 4JWVA 2Q35A 2VX2A 2IEXA 2PPYA 1FC9A 1HZDA 4KPKA 1XNVA 3MT6A 3PE8A 5DKPA 2A7SA 5INGA 4MI2A 3RSTA 2PBPA 3H81A 2J5II 1YG6A 4OG1A 4JSBA 4KD6A 3TVUA 1XNYA 2FBMA 1SZOA 4FB8A 5DUCA 4ELXA 1WZ8A 4WYOB 3TT6A 3GLMA 3HLN1 3ISAA 5DL1A 2CBYA 2ZL0A 4HNKA 1UYTA 4B3JA 5JBWA 3TDCA 1MJ3A 3R9TA 4MXIA 4IZCA 4JCQA 3PZKA 2F9YA 2Q2XA 2VSSE 4FJWD 4I42A 3TVWA 2F6QA 2DUBA 3U9SB 4B3IA 1NZYB 2F9IA 1EY3A 4Z0MA 3KTKA 2VSUF 3U9RB 3TRRA 3T3WA 1Q52A 1J7XA 3TT7A 1N6FA 1DCIA 3SWXA 2J5GA 3TZ3A 2ZQRA 3ZWBA 3Q7HA 1XNWA 1OD4A 2D3TA 5KDRB 4OMRA 3L3SA 3MFMA 3OT6A 3TV5A 3KTJA 1XO6A 2ZQQA 2EJ5A 5DTWA 1OD2A 2QQ3A 3BF0A 1PJHA 3ZW8A 5KDRA 3R9SA 3M6NA 4ZDCA 4ZDEA 4Q0GA 4ZDDA 2F6IA 3DORA 5INIA 1FC6A 4NEKA 3BEZA 4JYLA 4FZWA 4F47A 4YLHA 4IZBA 4U19A 4KWBA 3WG5A 3H0UA 4QIJA 5IKLB 2PG8A 1XX4A 1UYSA 5G1RA 3T8AA 3DJAA 3KTHA 2W3PA 5CTCA 2F9YB 3ZW9A 3OMEA 1N6DA 1PIXA 3Q0GA 1WDMA 3MYBA 3BPPA 3PEAA 4OLQA 5INFA 4ZDBA 4U0GA 4FNDA 1RJMA 3GF3A 2VREA 1WDLA 1FCFA 4GHNA 1VRGA 4ASIA 1RJNA 4K2NA 3HINA 2F9IB 3U9TB 1HNOA 1UIYA 4GM2A 3N6RB 2J5IB 4I4ZA 3ZWAA 2CE3A 3GMAA 4ELSA 3LKEA 5DU8A 2VSUA 4I52A 4FN7A 2HW5A 5E0SA 2UZFA 3T8BA 4U18A 1HNUA 4ELWA 2ZL4A 5DUFA 5C9GA 3Q0JA 5DTPA 1YG8A 4K3WA 3R0OA 3NJBA 4L6WA 5CTBA 3Q1TA 3H0JA 3HE2A 3IAVA 3PGQA 3T88A 2VSSA 3K50A 4IZDA 3V5IA 5FIFA 3FDUA 1N6EA
chains in the Genus database with same CATH superfamily
2J5GD 3QK8A 4WCZA 5DU4A 3QXZA 3LAOA 5G1QA 1FC7A 4RCNA 4ZDFA 3KTGA 4L8KA 3M6MA 1K39A 3P2LA 1K32A 2C8TA 3NJDA 1TG6A 2ZL3A 3RSIA 3P85A 4QFEA 1DUBA 3R6HA 4EMLA 3STAA 4U0GH 3QKAA 5DZKA 2X58A 1SG4A 3QMJA 4WZ8B 4NNQA 3KTIA 4JFCA 2VSUE 3SLLA 4HC8A 2J5SA 3QXIA 4JVTA 4FN8A 4G2RA 2DEOA 3P5MA 3IBBA 3T89A 3H02A 3K8XA 1Y7OA 4U1AA 5E0NX 1O8UA 4FZWC 3I47A 3G64A 4ZU2A 3HRXA 1TYFA 3MOYA 4JOTA 5MGBA 5JBXA 3KQFA 4EMPA 1UYRA 3RRVA 2Q34A 1WDKA 4JCRA 4LK5A 2X24A 4U0HA 3OC7A 3JU1A 3V5EA 3HP0A 2WTBA 1EF8A 4RYFA 2VSUC 1W2XA 4JCTA 1ON9A 2NP9A 5HUQA 2A7KA 1X0UA 3TLFA 5DU6A 5G1SA 2J5IA 5KJPA 1Q51A 2FZSA 4B3HA 3H0QA 1NZYA 1EF9A 3FF6A 2GTRA 4RYFH 3GKBA 3ZWCA 3QWDA 3R9QA 5DZKH 4JYJA 5C90A 4Q1IA 3H0SA 2BZRA 3GF7A 3BPTA 4DI1A 1UYVA 4JCSA 2VSSF 4FNBA 3QREA 5FUSA 4JJTA 4K29A 2ZL2A 3IB9A 3QYRA 1JXZA 4EMMA 4QIIA 3VIVA 5E0SH 4KNPA 2FW2A 2A81A 1ON3A 4MOUA 3ST9A 4JWVA 2Q35A 2VX2A 2IEXA 2PPYA 1FC9A 1HZDA 4KPKA 1XNVA 3MT6A 3PE8A 5DKPA 2A7SA 4HDTA 5INGA 4MI2A 3RSTA 2PBPA 3H81A 2J5II 1YG6A 4OG1A 4JSBA 4KD6A 3TVUA 1XNYA 2FBMA 1SZOA 4FB8A 5DUCA 4ELXA 1WZ8A 4WYOB 3TT6A 3GLMA 3HLN1 3ISAA 5DL1A 2CBYA 2ZL0A 4HNKA 1UYTA 4B3JA 5JBWA 3TDCA 1MJ3A 3R9TA 4MXIA 4IZCA 4JCQA 3PZKA 2F9YA 2Q2XA 2VSSE 4NARA 4FJWD 4I42A 3TVWA 2F6QA 2DUBA 3U9SB 4B3IA 1NZYB 2F9IA 1EY3A 4Z0MA 3KTKA 2VSUF 3U9RB 3TRRA 3T3WA 1Q52A 1J7XA 3TT7A 1N6FA 1DCIA 3SWXA 2J5GA 3TZ3A 2ZQRA 3ZWBA 3Q7HA 1XNWA 1OD4A 2D3TA 5KDRB 4OMRA 3L3SA 3MFMA 3OT6A 3TV5A 3KTJA 2YJGA 1XO6A 2ZQQA 2EJ5A 5DTWA 1OD2A 2QQ3A 3BF0A 1PJHA 3ZW8A 5KDRA 3R9SA 3M6NA 4ZDCA 4ZDEA 4Q0GA 4ZDDA 2F6IA 3DORA 5INIA 1FC6A 4NEKA 3BEZA 4JYLA 4FZWA 4F47A 4YLHA 4IZBA 4U19A 4KWBA 3WG5A 3H0UA 4QIJA 5IKLB 2PG8A 1XX4A 1UYSA 5G1RA 3T8AA 3DJAA 3KTHA 2W3PA 5CTCA 2F9YB 3ZW9A 3OMEA 1N6DA 1PIXA 3Q0GA 1WDMA 3MYBA 3BPPA 3PEAA 4OLQA 5INFA 4ZDBA 4U0GA 4FNDA 1RJMA 3GF3A 2VREA 1WDLA 1FCFA 4GHNA 1VRGA 4ASIA 1RJNA 4K2NA 3HINA 4J2UA 2F9IB 3U9TB 1HNOA 1UIYA 4GM2A 3N6RB 2J5IB 4I4ZA 3ZWAA 2CE3A 3GMAA 4ELSA 3LKEA 5DU8A 2VSUA 4I52A 4FN7A 2HW5A 5E0SA 2UZFA 3T8BA 4U18A 1HNUA 4ELWA 2ZL4A 5DUFA 5C9GA 3Q0JA 5DTPA 1YG8A 4K3WA 3R0OA 3NJBA 4L6WA 5CTBA 3Q1TA 3H0JA 3HE2A 3IAVA 3PGQA 3T88A 2VSSA 3K50A 4IZDA 3V5IA 5FIFA 3FDUA 1N6EA
chains in the Genus database with same CATH topology
2J5GD 3QK8A 4WCZA 5DU4A 3QXZA 3LAOA 5G1QA 1FC7A 4RCNA 4ZDFA 3KTGA 4L8KA 3M6MA 1K39A 3P2LA 1K32A 2C8TA 3NJDA 1TG6A 2ZL3A 3RSIA 3P85A 4QFEA 1DUBA 3R6HA 4EMLA 3STAA 4U0GH 3QKAA 5DZKA 2X58A 1SG4A 3QMJA 4WZ8B 4NNQA 3KTIA 4JFCA 2VSUE 3SLLA 4HC8A 2J5SA 3QXIA 4JVTA 4FN8A 4G2RA 2DEOA 3P5MA 3IBBA 3T89A 3H02A 3K8XA 1Y7OA 4U1AA 5E0NX 1O8UA 4FZWC 3I47A 3G64A 4ZU2A 3HRXA 1TYFA 3MOYA 4JOTA 5MGBA 5JBXA 3KQFA 4EMPA 1UYRA 3RRVA 2Q34A 1WDKA 4JCRA 4LK5A 2X24A 4U0HA 3OC7A 3JU1A 3V5EA 3HP0A 2WTBA 1EF8A 4RYFA 2VSUC 1W2XA 4JCTA 1ON9A 2NP9A 5HUQA 2A7KA 1X0UA 3TLFA 5DU6A 5G1SA 2J5IA 5KJPA 1Q51A 2FZSA 4B3HA 3H0QA 1NZYA 1EF9A 3FF6A 2GTRA 4RYFH 3GKBA 3ZWCA 3QWDA 3R9QA 5DZKH 4JYJA 5C90A 4Q1IA 3H0SA 2BZRA 3GF7A 3BPTA 4DI1A 1UYVA 4JCSA 2VSSF 4FNBA 3QREA 5FUSA 4JJTA 4K29A 2ZL2A 3IB9A 3QYRA 1JXZA 4EMMA 4QIIA 3VIVA 5E0SH 4KNPA 2FW2A 2A81A 1ON3A 4MOUA 3ST9A 4JWVA 2Q35A 2VX2A 2IEXA 2PPYA 1FC9A 1HZDA 4KPKA 1XNVA 3MT6A 3PE8A 5DKPA 2A7SA 4HDTA 5INGA 4MI2A 3RSTA 2PBPA 3H81A 2J5II 1YG6A 4OG1A 4JSBA 4KD6A 3TVUA 1XNYA 2FBMA 1SZOA 4FB8A 5DUCA 4ELXA 1WZ8A 4WYOB 3TT6A 3GLMA 3HLN1 3ISAA 5DL1A 2CBYA 2ZL0A 4HNKA 1UYTA 4B3JA 5JBWA 3TDCA 1MJ3A 3R9TA 4MXIA 4IZCA 4JCQA 3PZKA 2F9YA 2Q2XA 2VSSE 4NARA 4FJWD 4I42A 3TVWA 2F6QA 2DUBA 3U9SB 4B3IA 1NZYB 2F9IA 1EY3A 4Z0MA 3KTKA 2VSUF 3U9RB 3TRRA 3T3WA 1Q52A 1J7XA 3TT7A 1N6FA 1DCIA 3SWXA 2J5GA 3TZ3A 2ZQRA 3ZWBA 3Q7HA 1XNWA 1OD4A 2D3TA 5KDRB 4OMRA 3L3SA 3MFMA 3OT6A 3TV5A 3KTJA 2YJGA 1XO6A 2ZQQA 2EJ5A 5DTWA 1OD2A 2QQ3A 3BF0A 1PJHA 3ZW8A 5KDRA 3R9SA 3M6NA 4ZDCA 4ZDEA 4Q0GA 4ZDDA 2F6IA 3DORA 5INIA 1FC6A 4NEKA 3BEZA 4JYLA 4FZWA 4F47A 4YLHA 4IZBA 4U19A 4KWBA 3WG5A 3H0UA 4QIJA 5IKLB 2PG8A 1XX4A 1UYSA 5G1RA 3T8AA 3DJAA 3KTHA 2W3PA 5CTCA 2F9YB 3ZW9A 3OMEA 1N6DA 1PIXA 3Q0GA 1WDMA 3MYBA 3BPPA 3PEAA 4OLQA 5INFA 4ZDBA 4U0GA 4FNDA 1RJMA 3GF3A 2VREA 1WDLA 1FCFA 4GHNA 1VRGA 4ASIA 1RJNA 4K2NA 3HINA 4J2UA 2F9IB 3U9TB 1HNOA 1UIYA 4GM2A 3N6RB 2J5IB 4I4ZA 3ZWAA 2CE3A 3GMAA 4ELSA 3LKEA 5DU8A 2VSUA 4I52A 4FN7A 2HW5A 5E0SA 2UZFA 3T8BA 4U18A 1HNUA 4ELWA 2ZL4A 5DUFA 5C9GA 3Q0JA 5DTPA 1YG8A 4K3WA 3R0OA 3NJBA 4L6WA 5CTBA 3Q1TA 3H0JA 3HE2A 3IAVA 3PGQA 3T88A 2VSSA 3K50A 4IZDA 3V5IA 5FIFA 3FDUA 1N6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J5G D;  3QK8 A;  4WCZ A;  5DU4 A;  3QXZ A;  3LAO A;  5G1Q A;  1FC7 A;  4RCN A;  4ZDF A;  3KTG A;  4L8K A;  3M6M A;  1K39 A;  3P2L A;  1K32 A;  2C8T A;  3NJD A;  1TG6 A;  2ZL3 A;  3RSI A;  3P85 A;  4QFE A;  1DUB A;  3R6H A;  4EML A;  3STA A;  4U0G H;  3QKA A;  5DZK A;  2X58 A;  1SG4 A;  3QMJ A;  4WZ8 B;  4NNQ A;  3KTI A;  4JFC A;  2VSU E;  3SLL A;  4HC8 A;  2J5S A;  3QXI A;  4JVT A;  4FN8 A;  4G2R A;  2DEO A;  3P5M A;  3IBB A;  3T89 A;  3H02 A;  3K8X A;  1Y7O A;  4U1A A;  5E0N X;  1O8U A;  4FZW C;  3I47 A;  3G64 A;  4ZU2 A;  3HRX A;  1TYF A;  3MOY A;  4JOT A;  5MGB A;  5JBX A;  3KQF A;  4EMP A;  1UYR A;  3RRV A;  2Q34 A;  1WDK A;  4JCR A;  4LK5 A;  2X24 A;  4U0H A;  3OC7 A;  3JU1 A;  3V5E A;  3HP0 A;  2WTB A;  1EF8 A;  4RYF A;  2VSU C;  1W2X A;  4JCT A;  1ON9 A;  2NP9 A;  2A7K A;  1X0U A;  3TLF A;  5DU6 A;  5G1S A;  2J5I A;  5KJP A;  1Q51 A;  2FZS A;  4B3H A;  3H0Q A;  1NZY A;  1EF9 A;  3FF6 A;  2GTR A;  4RYF H;  3GKB A;  3ZWC A;  3QWD A;  3R9Q A;  5DZK H;  4JYJ A;  5C90 A;  4Q1I A;  3H0S A;  2BZR A;  3GF7 A;  4DI1 A;  1UYV A;  4JCS A;  2VSS F;  4FNB A;  3QRE A;  5FUS A;  4JJT A;  4K29 A;  2ZL2 A;  3IB9 A;  3QYR A;  1JXZ A;  4EMM A;  4QII A;  3VIV A;  5E0S H;  4KNP A;  2FW2 A;  2A81 A;  1ON3 A;  4MOU A;  3ST9 A;  4JWV A;  2Q35 A;  2VX2 A;  2IEX A;  2PPY A;  1FC9 A;  1HZD A;  4KPK A;  1XNV A;  3MT6 A;  3PE8 A;  5DKP A;  2A7S A;  5ING A;  4MI2 A;  3RST A;  2PBP A;  3H81 A;  2J5I I;  1YG6 A;  4OG1 A;  4JSB A;  4KD6 A;  3TVU A;  1XNY A;  2FBM A;  1SZO A;  4FB8 A;  5DUC A;  4ELX A;  1WZ8 A;  4WYO B;  3TT6 A;  3GLM A;  3HLN 1;  3ISA A;  5DL1 A;  2CBY A;  2ZL0 A;  4HNK A;  1UYT A;  4B3J A;  5JBW A;  3TDC A;  1MJ3 A;  3R9T A;  4MXI A;  4IZC A;  4JCQ A;  3PZK A;  2F9Y A;  2Q2X A;  2VSS E;  4FJW D;  4I42 A;  3TVW A;  2F6Q A;  2DUB A;  3U9S B;  4B3I A;  1NZY B;  2F9I A;  1EY3 A;  4Z0M A;  3KTK A;  2VSU F;  3U9R B;  3TRR A;  3T3W A;  1Q52 A;  1J7X A;  3TT7 A;  1N6F A;  1DCI A;  3SWX A;  2J5G A;  3TZ3 A;  2ZQR A;  3ZWB A;  3Q7H A;  1XNW A;  1OD4 A;  2D3T A;  5KDR B;  4OMR A;  3L3S A;  3MFM A;  3OT6 A;  3TV5 A;  3KTJ A;  1XO6 A;  2ZQQ A;  2EJ5 A;  5DTW A;  1OD2 A;  2QQ3 A;  3BF0 A;  1PJH A;  3ZW8 A;  5KDR A;  3R9S A;  3M6N A;  4ZDC A;  4ZDE A;  4Q0G A;  4ZDD A;  2F6I A;  3DOR A;  5INI A;  1FC6 A;  4NEK A;  3BEZ A;  4JYL A;  4FZW A;  4F47 A;  4YLH A;  4IZB A;  4U19 A;  4KWB A;  3WG5 A;  3H0U A;  4QIJ A;  5IKL B;  2PG8 A;  1XX4 A;  1UYS A;  5G1R A;  3T8A A;  3DJA A;  3KTH A;  2W3P A;  5CTC A;  2F9Y B;  3ZW9 A;  3OME A;  1N6D A;  1PIX A;  3Q0G A;  1WDM A;  3MYB A;  3BPP A;  3PEA A;  4OLQ A;  5INF A;  4ZDB A;  4U0G A;  4FND A;  1RJM A;  3GF3 A;  2VRE A;  1WDL A;  1FCF A;  4GHN A;  1VRG A;  4ASI A;  1RJN A;  4K2N A;  3HIN A;  2F9I B;  3U9T B;  1HNO A;  1UIY A;  4GM2 A;  3N6R B;  2J5I B;  4I4Z A;  3ZWA A;  2CE3 A;  3GMA A;  4ELS A;  3LKE A;  5DU8 A;  2VSU A;  4I52 A;  4FN7 A;  2HW5 A;  5E0S A;  2UZF A;  3T8B A;  4U18 A;  1HNU A;  4ELW A;  2ZL4 A;  5DUF A;  5C9G A;  3Q0J A;  5DTP A;  1YG8 A;  4K3W A;  3R0O A;  3NJB A;  4L6W A;  5CTB A;  3Q1T A;  3H0J A;  3HE2 A;  3IAV A;  3PGQ A;  3T88 A;  2VSS A;  3K50 A;  4IZD A;  3V5I A;  5FIF A;  3FDU A;  1N6E A; 
#chains in the Genus database with same CATH topology
 2J5G D;  3QK8 A;  4WCZ A;  5DU4 A;  3QXZ A;  3LAO A;  5G1Q A;  1FC7 A;  4RCN A;  4ZDF A;  3KTG A;  4L8K A;  3M6M A;  1K39 A;  3P2L A;  1K32 A;  2C8T A;  3NJD A;  1TG6 A;  2ZL3 A;  3RSI A;  3P85 A;  4QFE A;  1DUB A;  3R6H A;  4EML A;  3STA A;  4U0G H;  3QKA A;  5DZK A;  2X58 A;  1SG4 A;  3QMJ A;  4WZ8 B;  4NNQ A;  3KTI A;  4JFC A;  2VSU E;  3SLL A;  4HC8 A;  2J5S A;  3QXI A;  4JVT A;  4FN8 A;  4G2R A;  2DEO A;  3P5M A;  3IBB A;  3T89 A;  3H02 A;  3K8X A;  1Y7O A;  4U1A A;  5E0N X;  1O8U A;  4FZW C;  3I47 A;  3G64 A;  4ZU2 A;  3HRX A;  1TYF A;  3MOY A;  4JOT A;  5MGB A;  5JBX A;  3KQF A;  4EMP A;  1UYR A;  3RRV A;  2Q34 A;  1WDK A;  4JCR A;  4LK5 A;  2X24 A;  4U0H A;  3OC7 A;  3JU1 A;  3V5E A;  3HP0 A;  2WTB A;  1EF8 A;  4RYF A;  2VSU C;  1W2X A;  4JCT A;  1ON9 A;  2NP9 A;  5HUQ A;  2A7K A;  1X0U A;  3TLF A;  5DU6 A;  5G1S A;  2J5I A;  5KJP A;  1Q51 A;  2FZS A;  4B3H A;  3H0Q A;  1NZY A;  1EF9 A;  3FF6 A;  2GTR A;  4RYF H;  3GKB A;  3ZWC A;  3QWD A;  3R9Q A;  5DZK H;  4JYJ A;  5C90 A;  4Q1I A;  3H0S A;  2BZR A;  3GF7 A;  3BPT A;  4DI1 A;  1UYV A;  4JCS A;  2VSS F;  4FNB A;  3QRE A;  5FUS A;  4JJT A;  4K29 A;  2ZL2 A;  3IB9 A;  3QYR A;  1JXZ A;  4EMM A;  4QII A;  3VIV A;  5E0S H;  4KNP A;  2FW2 A;  2A81 A;  1ON3 A;  4MOU A;  3ST9 A;  4JWV A;  2Q35 A;  2VX2 A;  2IEX A;  2PPY A;  1FC9 A;  1HZD A;  4KPK A;  1XNV A;  3MT6 A;  3PE8 A;  5DKP A;  2A7S A;  4HDT A;  5ING A;  4MI2 A;  3RST A;  2PBP A;  3H81 A;  2J5I I;  1YG6 A;  4OG1 A;  4JSB A;  4KD6 A;  3TVU A;  1XNY A;  2FBM A;  1SZO A;  4FB8 A;  5DUC A;  4ELX A;  1WZ8 A;  4WYO B;  3TT6 A;  3GLM A;  3HLN 1;  3ISA A;  5DL1 A;  2CBY A;  2ZL0 A;  4HNK A;  1UYT A;  4B3J A;  5JBW A;  3TDC A;  1MJ3 A;  3R9T A;  4MXI A;  4IZC A;  4JCQ A;  3PZK A;  2F9Y A;  2Q2X A;  2VSS E;  4NAR A;  4FJW D;  4I42 A;  3TVW A;  2F6Q A;  2DUB A;  3U9S B;  4B3I A;  1NZY B;  2F9I A;  1EY3 A;  4Z0M A;  3KTK A;  2VSU F;  3U9R B;  3TRR A;  3T3W A;  1Q52 A;  1J7X A;  3TT7 A;  1N6F A;  1DCI A;  3SWX A;  2J5G A;  3TZ3 A;  2ZQR A;  3ZWB A;  3Q7H A;  1XNW A;  1OD4 A;  2D3T A;  5KDR B;  4OMR A;  3L3S A;  3MFM A;  3OT6 A;  3TV5 A;  3KTJ A;  2YJG A;  1XO6 A;  2ZQQ A;  2EJ5 A;  5DTW A;  1OD2 A;  2QQ3 A;  3BF0 A;  1PJH A;  3ZW8 A;  5KDR A;  3R9S A;  3M6N A;  4ZDC A;  4ZDE A;  4Q0G A;  4ZDD A;  2F6I A;  3DOR A;  5INI A;  1FC6 A;  4NEK A;  3BEZ A;  4JYL A;  4FZW A;  4F47 A;  4YLH A;  4IZB A;  4U19 A;  4KWB A;  3WG5 A;  3H0U A;  4QIJ A;  5IKL B;  2PG8 A;  1XX4 A;  1UYS A;  5G1R A;  3T8A A;  3DJA A;  3KTH A;  2W3P A;  5CTC A;  2F9Y B;  3ZW9 A;  3OME A;  1N6D A;  1PIX A;  3Q0G A;  1WDM A;  3MYB A;  3BPP A;  3PEA A;  4OLQ A;  5INF A;  4ZDB A;  4U0G A;  4FND A;  1RJM A;  3GF3 A;  2VRE A;  1WDL A;  1FCF A;  4GHN A;  1VRG A;  4ASI A;  1RJN A;  4K2N A;  3HIN A;  4J2U A;  2F9I B;  3U9T B;  1HNO A;  1UIY A;  4GM2 A;  3N6R B;  2J5I B;  4I4Z A;  3ZWA A;  2CE3 A;  3GMA A;  4ELS A;  3LKE A;  5DU8 A;  2VSU A;  4I52 A;  4FN7 A;  2HW5 A;  5E0S A;  2UZF A;  3T8B A;  4U18 A;  1HNU A;  4ELW A;  2ZL4 A;  5DUF A;  5C9G A;  3Q0J A;  5DTP A;  1YG8 A;  4K3W A;  3R0O A;  3NJB A;  4L6W A;  5CTB A;  3Q1T A;  3H0J A;  3HE2 A;  3IAV A;  3PGQ A;  3T88 A;  2VSS A;  3K50 A;  4IZD A;  3V5I A;  5FIF A;  3FDU A;  1N6E A; 
#chains in the Genus database with same CATH homology
 2J5G D;  3QK8 A;  4WCZ A;  5DU4 A;  3QXZ A;  3LAO A;  5G1Q A;  1FC7 A;  4RCN A;  4ZDF A;  3KTG A;  4L8K A;  3M6M A;  1K39 A;  3P2L A;  1K32 A;  2C8T A;  3NJD A;  1TG6 A;  2ZL3 A;  3RSI A;  3P85 A;  4QFE A;  1DUB A;  3R6H A;  4EML A;  3STA A;  4U0G H;  3QKA A;  5DZK A;  2X58 A;  1SG4 A;  3QMJ A;  4WZ8 B;  4NNQ A;  3KTI A;  4JFC A;  2VSU E;  3SLL A;  4HC8 A;  2J5S A;  3QXI A;  4JVT A;  4FN8 A;  4G2R A;  2DEO A;  3P5M A;  3IBB A;  3T89 A;  3H02 A;  3K8X A;  1Y7O A;  4U1A A;  5E0N X;  1O8U A;  4FZW C;  3I47 A;  3G64 A;  4ZU2 A;  3HRX A;  1TYF A;  3MOY A;  4JOT A;  5MGB A;  5JBX A;  3KQF A;  4EMP A;  1UYR A;  3RRV A;  2Q34 A;  1WDK A;  4JCR A;  4LK5 A;  2X24 A;  4U0H A;  3OC7 A;  3JU1 A;  3V5E A;  3HP0 A;  2WTB A;  1EF8 A;  4RYF A;  2VSU C;  1W2X A;  4JCT A;  1ON9 A;  2NP9 A;  5HUQ A;  2A7K A;  1X0U A;  3TLF A;  5DU6 A;  5G1S A;  2J5I A;  5KJP A;  1Q51 A;  2FZS A;  4B3H A;  3H0Q A;  1NZY A;  1EF9 A;  3FF6 A;  2GTR A;  4RYF H;  3GKB A;  3ZWC A;  3QWD A;  3R9Q A;  5DZK H;  4JYJ A;  5C90 A;  4Q1I A;  3H0S A;  2BZR A;  3GF7 A;  3BPT A;  4DI1 A;  1UYV A;  4JCS A;  2VSS F;  4FNB A;  3QRE A;  5FUS A;  4JJT A;  4K29 A;  2ZL2 A;  3IB9 A;  3QYR A;  1JXZ A;  4EMM A;  4QII A;  3VIV A;  5E0S H;  4KNP A;  2FW2 A;  2A81 A;  1ON3 A;  4MOU A;  3ST9 A;  4JWV A;  2Q35 A;  2VX2 A;  2IEX A;  2PPY A;  1FC9 A;  1HZD A;  4KPK A;  1XNV A;  3MT6 A;  3PE8 A;  5DKP A;  2A7S A;  4HDT A;  5ING A;  4MI2 A;  3RST A;  2PBP A;  3H81 A;  2J5I I;  1YG6 A;  4OG1 A;  4JSB A;  4KD6 A;  3TVU A;  1XNY A;  2FBM A;  1SZO A;  4FB8 A;  5DUC A;  4ELX A;  1WZ8 A;  4WYO B;  3TT6 A;  3GLM A;  3HLN 1;  3ISA A;  5DL1 A;  2CBY A;  2ZL0 A;  4HNK A;  1UYT A;  4B3J A;  5JBW A;  3TDC A;  1MJ3 A;  3R9T A;  4MXI A;  4IZC A;  4JCQ A;  3PZK A;  2F9Y A;  2Q2X A;  2VSS E;  4NAR A;  4FJW D;  4I42 A;  3TVW A;  2F6Q A;  2DUB A;  3U9S B;  4B3I A;  1NZY B;  2F9I A;  1EY3 A;  4Z0M A;  3KTK A;  2VSU F;  3U9R B;  3TRR A;  3T3W A;  1Q52 A;  1J7X A;  3TT7 A;  1N6F A;  1DCI A;  3SWX A;  2J5G A;  3TZ3 A;  2ZQR A;  3ZWB A;  3Q7H A;  1XNW A;  1OD4 A;  2D3T A;  5KDR B;  4OMR A;  3L3S A;  3MFM A;  3OT6 A;  3TV5 A;  3KTJ A;  2YJG A;  1XO6 A;  2ZQQ A;  2EJ5 A;  5DTW A;  1OD2 A;  2QQ3 A;  3BF0 A;  1PJH A;  3ZW8 A;  5KDR A;  3R9S A;  3M6N A;  4ZDC A;  4ZDE A;  4Q0G A;  4ZDD A;  2F6I A;  3DOR A;  5INI A;  1FC6 A;  4NEK A;  3BEZ A;  4JYL A;  4FZW A;  4F47 A;  4YLH A;  4IZB A;  4U19 A;  4KWB A;  3WG5 A;  3H0U A;  4QIJ A;  5IKL B;  2PG8 A;  1XX4 A;  1UYS A;  5G1R A;  3T8A A;  3DJA A;  3KTH A;  2W3P A;  5CTC A;  2F9Y B;  3ZW9 A;  3OME A;  1N6D A;  1PIX A;  3Q0G A;  1WDM A;  3MYB A;  3BPP A;  3PEA A;  4OLQ A;  5INF A;  4ZDB A;  4U0G A;  4FND A;  1RJM A;  3GF3 A;  2VRE A;  1WDL A;  1FCF A;  4GHN A;  1VRG A;  4ASI A;  1RJN A;  4K2N A;  3HIN A;  4J2U A;  2F9I B;  3U9T B;  1HNO A;  1UIY A;  4GM2 A;  3N6R B;  2J5I B;  4I4Z A;  3ZWA A;  2CE3 A;  3GMA A;  4ELS A;  3LKE A;  5DU8 A;  2VSU A;  4I52 A;  4FN7 A;  2HW5 A;  5E0S A;  2UZF A;  3T8B A;  4U18 A;  1HNU A;  4ELW A;  2ZL4 A;  5DUF A;  5C9G A;  3Q0J A;  5DTP A;  1YG8 A;  4K3W A;  3R0O A;  3NJB A;  4L6W A;  5CTB A;  3Q1T A;  3H0J A;  3HE2 A;  3IAV A;  3PGQ A;  3T88 A;  2VSS A;  3K50 A;  4IZD A;  3V5I A;  5FIF A;  3FDU A;  1N6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...