3T3WA

Crystal structure of probable enoyl-coa hydratase from mycobacterium thermoresistibile
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
249
structure length
241
Chain Sequence
EMYIDYDVSDRIATITLNRPEAANAQNPELLDELDAAWTRAAEDNDVSVIVLRANGKHFSAGHDLRLTLEFIYAHESRRYLEYSLRWRNVPKPSIAAVQGRCISGGLLLCWPCDLIIAAEDALFSDPVVLMDIGGVEYHGHTWELGPRKAKEILFTGRAMTAEEVAQTGMVNRVVPRDRLDAETRALAGEIAKMPPFALRQAKRAVNQTLDVQGFYAAIQSVFDIHQTGHGNAMSVSGWPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium thermoresistibile
molecule tags Lyase
molecule keywords Enoyl-CoA hydratase
total genus 104
structure length 241
sequence length 249
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3t3wA00
3ISAA 4K29A 4WZ8B 4RCNA 4DI1A 1DUBA 2DUBA 1RJMA 4FNBA 2GTRA 2F9IB 2VREA 2J5GA 3TVWA 5DL1A 3OT6A 3PZKA 3ZWAA 2J5II 3U9TB 1HZDA 4JCRA 3ST9A 1HNUA 4JYJA 5FUSA 4B3JA 5INGA 1WDMA 3QXIA 4ELWA 1PIXA 3RSIA 5DTPA 1ON9A 2Q2XA 4ZU2A 5CTCA 3ZWCA 3H81A 2DEOA 2QQ3A 3GF7A 1FC6A 4JCSA 2ZL0A 3R9SA 1ON3A 4IZDA 4Q1IA 1N6EA 1UYSA 2FBMA 3V5IA 4KNPA 1Q51A 1W2XA 4MOUA 4FZWA 4RYFH 2VSSF 1XX4A 4FJWD 1HNOA 3R0OA 3TV5A 3P85A 3HRXA 1UYVA 5DU8A 3KTKA 3SWXA 2A7KA 3Q7HA 1OD4A 4EMLA 2PBPA 3LKEA 5DU6A 3H0SA 4OLQA 1N6FA 3P2LA 1UIYA 2HW5A 1RJNA 4FB8A 2ZL3A 3Q1TA 4WYOB 2VSSE 4JOTA 3OC7A 4U1AA 3IBBA 3IAVA 1NZYB 3HP0A 4LK5A 3TT6A 2VSSA 3QK8A 2C8TA 4ZDFA 2PG8A 2VSUF 4I52A 4Q0GA 5E0SH 4ZDEA 2J5IB 2F6QA 5G1SA 3JU1A 3BEZA 2J5SA 3M6NA 2VSUC 1XNWA 5JBXA 2ZQRA 2VSUE 3DJAA 2F9YB 3DORA 1Y7OA 2F6IA 4U0GH 4KWBA 3R9QA 3BPPA 5INIA 2ZL4A 1X0UA 4KPKA 2Q34A 2F9YA 3PE8A 3SLLA 3QXZA 3U9RB 1UYRA 4L8KA 2Q35A 4JJTA 2CE3A 3I47A 4F47A 1K32A 4GM2A 3PEAA 3Q0GA 4NNQA 4L6WA 3U9SB 5C9GA 3GMAA 2VX2A 3FF6A 4ZDDA 2FW2A 5KDRA 1Q52A 3LAOA 4EMMA 3WG5A 1EY3A 4IZBA 1WDKA 4GHNA 3GLMA 3KTJA 4WCZA 4YLHA 2VSUA 2EJ5A 3H0UA 3T88A 2X24A 1XO6A 4B3HA 4OG1A 3G64A 1TYFA 3RSTA 3V5EA 5E0SA 1J7XA 3H02A 4QIJA 3HE2A 3QKAA 5DUCA 5DZKA 4JYLA 5IKLB 2NP9A 2A7SA 2J5IA 2F9IA 3KTIA 4ELXA 3STAA 4MI2A 2D3TA 4JVTA 4QFEA 2FZSA 4U19A 3MOYA 3Q0JA 2A81A 3KTHA 5KDRB 3NJDA 4IZCA 3QWDA 1YG8A 3N6RB 1WDLA 3GKBA 5JBWA 3KTGA 5DTWA 4K3WA 4KD6A 4HC8A 3MFMA 5CTBA 4OMRA 1SZOA 1OD2A 1O8UA 1VRGA 4FN7A 3TLFA 2PPYA 5G1RA 5KJPA 3R6HA 3M6MA 1UYTA 3GF3A 4MXIA 2ZL2A 4JFCA 3RRVA 2CBYA 3QREA 4Z0MA 4RYFA 5DUFA 3T89A 1FC9A 2W3PA 4EMPA 1MJ3A 3PGQA 3K8XA 2X58A 1TG6A 4JCQA 4JCTA 2UZFA 5MGBA 1EF9A 3P5MA 5G1QA 1XNYA 3TZ3A 3TT7A 3QYRA 3NJBA 3ZW9A 3IB9A 4ASIA 1YG6A 3QMJA 1PJHA 3T8BA 1K39A 3BF0A 4K2NA 3MT6A 4ELSA 3TRRA 1FC7A 1EF8A 3TDCA 4JSBA 3R9TA 1N6DA 4ZDCA 4NEKA 3T8AA 3T3WA 2J5GD 5INFA 3H0QA 4I4ZA 5E0NX 3VIVA 3ZWBA 4U0GA 5FIFA 2IEXA 4FNDA 3HLN1 5DU4A 4JWVA 3MYBA 2WTBA 3TVUA 1NZYA 3FDUA 3K50A 4B3IA 3H0JA 1DCIA 4FN8A 3L3SA 3HINA 5DKPA 4QIIA 3KQFA 4ZDBA 5C90A 2ZQQA 1XNVA 4U18A 2BZRA 4I42A 3OMEA 4U0HA 1WZ8A 1FCFA 5DZKH 4HNKA 1JXZA 3ZW8A 4G2RA 4FZWC 1SG4A
chains in the Genus database with same CATH superfamily
3ISAA 4K29A 4WZ8B 4RCNA 4DI1A 1DUBA 2DUBA 1RJMA 4FNBA 2GTRA 2F9IB 2VREA 2J5GA 3TVWA 5DL1A 3OT6A 3PZKA 3ZWAA 2J5II 3U9TB 1HZDA 4JCRA 4NARA 3ST9A 1HNUA 4JYJA 5FUSA 4B3JA 5INGA 1WDMA 3QXIA 4ELWA 1PIXA 3RSIA 5DTPA 1ON9A 2Q2XA 4ZU2A 4J2UA 5CTCA 3ZWCA 3H81A 2DEOA 2QQ3A 3GF7A 1FC6A 4JCSA 2ZL0A 3R9SA 1ON3A 4IZDA 4Q1IA 1N6EA 1UYSA 2FBMA 5HUQA 3V5IA 4KNPA 1Q51A 1W2XA 4MOUA 4FZWA 4RYFH 2VSSF 1XX4A 4FJWD 1HNOA 3R0OA 3TV5A 3P85A 3HRXA 1UYVA 5DU8A 3KTKA 3SWXA 2A7KA 3Q7HA 1OD4A 4EMLA 2PBPA 3LKEA 5DU6A 3H0SA 4OLQA 1N6FA 3P2LA 1UIYA 2YJGA 2HW5A 1RJNA 4FB8A 2ZL3A 3Q1TA 4WYOB 2VSSE 4JOTA 3OC7A 4U1AA 3IBBA 3IAVA 1NZYB 3HP0A 4LK5A 3TT6A 2VSSA 3QK8A 2C8TA 4ZDFA 2PG8A 2VSUF 4I52A 4Q0GA 5E0SH 4ZDEA 2J5IB 2F6QA 5G1SA 3JU1A 3BEZA 2J5SA 3M6NA 2VSUC 1XNWA 5JBXA 2ZQRA 2VSUE 3DJAA 2F9YB 3DORA 1Y7OA 2F6IA 4U0GH 4KWBA 3R9QA 3BPPA 5INIA 2ZL4A 1X0UA 4KPKA 2Q34A 2F9YA 3PE8A 3SLLA 3QXZA 3U9RB 1UYRA 4L8KA 2Q35A 4JJTA 2CE3A 3I47A 4F47A 1K32A 4GM2A 3PEAA 3Q0GA 4NNQA 4L6WA 3U9SB 5C9GA 3GMAA 2VX2A 3FF6A 4ZDDA 2FW2A 5KDRA 1Q52A 3LAOA 4EMMA 4HDTA 3WG5A 1EY3A 4IZBA 1WDKA 4GHNA 3GLMA 3KTJA 4WCZA 4YLHA 2VSUA 3BPTA 2EJ5A 3H0UA 3T88A 2X24A 1XO6A 4B3HA 4OG1A 3G64A 1TYFA 3RSTA 3V5EA 5E0SA 1J7XA 3H02A 4QIJA 3HE2A 3QKAA 5DUCA 5DZKA 4JYLA 5IKLB 2NP9A 2A7SA 2J5IA 2F9IA 3KTIA 4ELXA 3STAA 4MI2A 2D3TA 4JVTA 4QFEA 2FZSA 4U19A 3MOYA 3Q0JA 2A81A 3KTHA 5KDRB 3NJDA 4IZCA 3QWDA 1YG8A 3N6RB 1WDLA 3GKBA 5JBWA 3KTGA 5DTWA 4K3WA 4KD6A 4HC8A 3MFMA 5CTBA 4OMRA 1SZOA 1OD2A 1O8UA 1VRGA 4FN7A 3TLFA 2PPYA 5G1RA 5KJPA 3R6HA 3M6MA 1UYTA 3GF3A 4MXIA 2ZL2A 4JFCA 3RRVA 2CBYA 3QREA 4Z0MA 4RYFA 5DUFA 3T89A 1FC9A 2W3PA 4EMPA 1MJ3A 3PGQA 3K8XA 2X58A 1TG6A 4JCQA 4JCTA 2UZFA 5MGBA 1EF9A 3P5MA 5G1QA 1XNYA 3TZ3A 3TT7A 3QYRA 3NJBA 3ZW9A 3IB9A 4ASIA 1YG6A 3QMJA 1PJHA 3T8BA 1K39A 3BF0A 4K2NA 3MT6A 4ELSA 3TRRA 1FC7A 1EF8A 3TDCA 4JSBA 3R9TA 1N6DA 4ZDCA 4NEKA 3T8AA 3T3WA 2J5GD 5INFA 3H0QA 4I4ZA 5E0NX 3VIVA 3ZWBA 4U0GA 5FIFA 2IEXA 4FNDA 3HLN1 5DU4A 4JWVA 3MYBA 2WTBA 3TVUA 1NZYA 3FDUA 3K50A 4B3IA 3H0JA 1DCIA 4FN8A 3L3SA 3HINA 5DKPA 4QIIA 3KQFA 4ZDBA 5C90A 2ZQQA 1XNVA 4U18A 2BZRA 4I42A 3OMEA 4U0HA 1WZ8A 1FCFA 5DZKH 4HNKA 1JXZA 3ZW8A 4G2RA 4FZWC 1SG4A
chains in the Genus database with same CATH topology
3ISAA 4K29A 4WZ8B 4RCNA 4DI1A 1DUBA 2DUBA 1RJMA 4FNBA 2GTRA 2F9IB 2VREA 2J5GA 3TVWA 5DL1A 3OT6A 3PZKA 3ZWAA 2J5II 3U9TB 1HZDA 4JCRA 4NARA 3ST9A 1HNUA 4JYJA 5FUSA 4B3JA 5INGA 1WDMA 3QXIA 4ELWA 1PIXA 3RSIA 5DTPA 1ON9A 2Q2XA 4ZU2A 4J2UA 5CTCA 3ZWCA 3H81A 2DEOA 2QQ3A 3GF7A 1FC6A 4JCSA 2ZL0A 3R9SA 1ON3A 4IZDA 4Q1IA 1N6EA 1UYSA 2FBMA 5HUQA 3V5IA 4KNPA 1Q51A 1W2XA 4MOUA 4FZWA 4RYFH 2VSSF 1XX4A 4FJWD 1HNOA 3R0OA 3TV5A 3P85A 3HRXA 1UYVA 5DU8A 3KTKA 3SWXA 2A7KA 3Q7HA 1OD4A 4EMLA 2PBPA 3LKEA 5DU6A 3H0SA 4OLQA 1N6FA 3P2LA 1UIYA 2YJGA 2HW5A 1RJNA 4FB8A 2ZL3A 3Q1TA 4WYOB 2VSSE 4JOTA 3OC7A 4U1AA 3IBBA 3IAVA 1NZYB 3HP0A 4LK5A 3TT6A 2VSSA 3QK8A 2C8TA 4ZDFA 2PG8A 2VSUF 4I52A 4Q0GA 5E0SH 4ZDEA 2J5IB 2F6QA 5G1SA 3JU1A 3BEZA 2J5SA 3M6NA 2VSUC 1XNWA 5JBXA 2ZQRA 2VSUE 3DJAA 2F9YB 3DORA 1Y7OA 2F6IA 4U0GH 4KWBA 3R9QA 3BPPA 5INIA 2ZL4A 1X0UA 4KPKA 2Q34A 2F9YA 3PE8A 3SLLA 3QXZA 3U9RB 1UYRA 4L8KA 2Q35A 4JJTA 2CE3A 3I47A 4F47A 1K32A 4GM2A 3PEAA 3Q0GA 4NNQA 4L6WA 3U9SB 5C9GA 3GMAA 2VX2A 3FF6A 4ZDDA 2FW2A 5KDRA 1Q52A 3LAOA 4EMMA 4HDTA 3WG5A 1EY3A 4IZBA 1WDKA 4GHNA 3GLMA 3KTJA 4WCZA 4YLHA 2VSUA 3BPTA 2EJ5A 3H0UA 3T88A 2X24A 1XO6A 4B3HA 4OG1A 3G64A 1TYFA 3RSTA 3V5EA 5E0SA 1J7XA 3H02A 4QIJA 3HE2A 3QKAA 5DUCA 5DZKA 4JYLA 5IKLB 2NP9A 2A7SA 2J5IA 2F9IA 3KTIA 4ELXA 3STAA 4MI2A 2D3TA 4JVTA 4QFEA 2FZSA 4U19A 3MOYA 3Q0JA 2A81A 3KTHA 5KDRB 3NJDA 4IZCA 3QWDA 1YG8A 3N6RB 1WDLA 3GKBA 5JBWA 3KTGA 5DTWA 4K3WA 4KD6A 4HC8A 3MFMA 5CTBA 4OMRA 1SZOA 1OD2A 1O8UA 1VRGA 4FN7A 3TLFA 2PPYA 5G1RA 5KJPA 3R6HA 3M6MA 1UYTA 3GF3A 4MXIA 2ZL2A 4JFCA 3RRVA 2CBYA 3QREA 4Z0MA 4RYFA 5DUFA 3T89A 1FC9A 2W3PA 4EMPA 1MJ3A 3PGQA 3K8XA 2X58A 1TG6A 4JCQA 4JCTA 2UZFA 5MGBA 1EF9A 3P5MA 5G1QA 1XNYA 3TZ3A 3TT7A 3QYRA 3NJBA 3ZW9A 3IB9A 4ASIA 1YG6A 3QMJA 1PJHA 3T8BA 1K39A 3BF0A 4K2NA 3MT6A 4ELSA 3TRRA 1FC7A 1EF8A 3TDCA 4JSBA 3R9TA 1N6DA 4ZDCA 4NEKA 3T8AA 3T3WA 2J5GD 5INFA 3H0QA 4I4ZA 5E0NX 3VIVA 3ZWBA 4U0GA 5FIFA 2IEXA 4FNDA 3HLN1 5DU4A 4JWVA 3MYBA 2WTBA 3TVUA 1NZYA 3FDUA 3K50A 4B3IA 3H0JA 1DCIA 4FN8A 3L3SA 3HINA 5DKPA 4QIIA 3KQFA 4ZDBA 5C90A 2ZQQA 1XNVA 4U18A 2BZRA 4I42A 3OMEA 4U0HA 1WZ8A 1FCFA 5DZKH 4HNKA 1JXZA 3ZW8A 4G2RA 4FZWC 1SG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ISA A;  4K29 A;  4WZ8 B;  4RCN A;  4DI1 A;  1DUB A;  2DUB A;  1RJM A;  4FNB A;  2GTR A;  2F9I B;  2VRE A;  2J5G A;  3TVW A;  5DL1 A;  3OT6 A;  3PZK A;  3ZWA A;  2J5I I;  3U9T B;  1HZD A;  4JCR A;  3ST9 A;  1HNU A;  4JYJ A;  5FUS A;  4B3J A;  5ING A;  1WDM A;  3QXI A;  4ELW A;  1PIX A;  3RSI A;  5DTP A;  1ON9 A;  2Q2X A;  4ZU2 A;  5CTC A;  3ZWC A;  3H81 A;  2DEO A;  2QQ3 A;  3GF7 A;  1FC6 A;  4JCS A;  2ZL0 A;  3R9S A;  1ON3 A;  4IZD A;  4Q1I A;  1N6E A;  1UYS A;  2FBM A;  3V5I A;  4KNP A;  1Q51 A;  1W2X A;  4MOU A;  4FZW A;  4RYF H;  2VSS F;  1XX4 A;  4FJW D;  1HNO A;  3R0O A;  3TV5 A;  3P85 A;  3HRX A;  1UYV A;  5DU8 A;  3KTK A;  3SWX A;  2A7K A;  3Q7H A;  1OD4 A;  4EML A;  2PBP A;  3LKE A;  5DU6 A;  3H0S A;  4OLQ A;  1N6F A;  3P2L A;  1UIY A;  2HW5 A;  1RJN A;  4FB8 A;  2ZL3 A;  3Q1T A;  4WYO B;  2VSS E;  4JOT A;  3OC7 A;  4U1A A;  3IBB A;  3IAV A;  1NZY B;  3HP0 A;  4LK5 A;  3TT6 A;  2VSS A;  3QK8 A;  2C8T A;  4ZDF A;  2PG8 A;  2VSU F;  4I52 A;  4Q0G A;  5E0S H;  4ZDE A;  2J5I B;  2F6Q A;  5G1S A;  3JU1 A;  3BEZ A;  2J5S A;  3M6N A;  2VSU C;  1XNW A;  5JBX A;  2ZQR A;  2VSU E;  3DJA A;  2F9Y B;  3DOR A;  1Y7O A;  2F6I A;  4U0G H;  4KWB A;  3R9Q A;  3BPP A;  5INI A;  2ZL4 A;  1X0U A;  4KPK A;  2Q34 A;  2F9Y A;  3PE8 A;  3SLL A;  3QXZ A;  3U9R B;  1UYR A;  4L8K A;  2Q35 A;  4JJT A;  2CE3 A;  3I47 A;  4F47 A;  1K32 A;  4GM2 A;  3PEA A;  3Q0G A;  4NNQ A;  4L6W A;  3U9S B;  5C9G A;  3GMA A;  2VX2 A;  3FF6 A;  4ZDD A;  2FW2 A;  5KDR A;  1Q52 A;  3LAO A;  4EMM A;  3WG5 A;  1EY3 A;  4IZB A;  1WDK A;  4GHN A;  3GLM A;  3KTJ A;  4WCZ A;  4YLH A;  2VSU A;  2EJ5 A;  3H0U A;  3T88 A;  2X24 A;  1XO6 A;  4B3H A;  4OG1 A;  3G64 A;  1TYF A;  3RST A;  3V5E A;  5E0S A;  1J7X A;  3H02 A;  4QIJ A;  3HE2 A;  3QKA A;  5DUC A;  5DZK A;  4JYL A;  5IKL B;  2NP9 A;  2A7S A;  2J5I A;  2F9I A;  3KTI A;  4ELX A;  3STA A;  4MI2 A;  2D3T A;  4JVT A;  4QFE A;  2FZS A;  4U19 A;  3MOY A;  3Q0J A;  2A81 A;  3KTH A;  5KDR B;  3NJD A;  4IZC A;  3QWD A;  1YG8 A;  3N6R B;  1WDL A;  3GKB A;  5JBW A;  3KTG A;  5DTW A;  4K3W A;  4KD6 A;  4HC8 A;  3MFM A;  5CTB A;  4OMR A;  1SZO A;  1OD2 A;  1O8U A;  1VRG A;  4FN7 A;  3TLF A;  2PPY A;  5G1R A;  5KJP A;  3R6H A;  3M6M A;  1UYT A;  3GF3 A;  4MXI A;  2ZL2 A;  4JFC A;  3RRV A;  2CBY A;  3QRE A;  4Z0M A;  4RYF A;  5DUF A;  3T89 A;  1FC9 A;  2W3P A;  4EMP A;  1MJ3 A;  3PGQ A;  3K8X A;  2X58 A;  1TG6 A;  4JCQ A;  4JCT A;  2UZF A;  5MGB A;  1EF9 A;  3P5M A;  5G1Q A;  1XNY A;  3TZ3 A;  3TT7 A;  3QYR A;  3NJB A;  3ZW9 A;  3IB9 A;  4ASI A;  1YG6 A;  3QMJ A;  1PJH A;  3T8B A;  1K39 A;  3BF0 A;  4K2N A;  3MT6 A;  4ELS A;  3TRR A;  1FC7 A;  1EF8 A;  3TDC A;  4JSB A;  3R9T A;  1N6D A;  4ZDC A;  4NEK A;  3T8A A;  3T3W A;  2J5G D;  5INF A;  3H0Q A;  4I4Z A;  5E0N X;  3VIV A;  3ZWB A;  4U0G A;  5FIF A;  2IEX A;  4FND A;  3HLN 1;  5DU4 A;  4JWV A;  3MYB A;  2WTB A;  3TVU A;  1NZY A;  3FDU A;  3K50 A;  4B3I A;  3H0J A;  1DCI A;  4FN8 A;  3L3S A;  3HIN A;  5DKP A;  4QII A;  3KQF A;  4ZDB A;  5C90 A;  2ZQQ A;  1XNV A;  4U18 A;  2BZR A;  4I42 A;  3OME A;  4U0H A;  1WZ8 A;  1FCF A;  5DZK H;  4HNK A;  1JXZ A;  3ZW8 A;  4G2R A;  4FZW C;  1SG4 A; 
#chains in the Genus database with same CATH topology
 3ISA A;  4K29 A;  4WZ8 B;  4RCN A;  4DI1 A;  1DUB A;  2DUB A;  1RJM A;  4FNB A;  2GTR A;  2F9I B;  2VRE A;  2J5G A;  3TVW A;  5DL1 A;  3OT6 A;  3PZK A;  3ZWA A;  2J5I I;  3U9T B;  1HZD A;  4JCR A;  4NAR A;  3ST9 A;  1HNU A;  4JYJ A;  5FUS A;  4B3J A;  5ING A;  1WDM A;  3QXI A;  4ELW A;  1PIX A;  3RSI A;  5DTP A;  1ON9 A;  2Q2X A;  4ZU2 A;  4J2U A;  5CTC A;  3ZWC A;  3H81 A;  2DEO A;  2QQ3 A;  3GF7 A;  1FC6 A;  4JCS A;  2ZL0 A;  3R9S A;  1ON3 A;  4IZD A;  4Q1I A;  1N6E A;  1UYS A;  2FBM A;  5HUQ A;  3V5I A;  4KNP A;  1Q51 A;  1W2X A;  4MOU A;  4FZW A;  4RYF H;  2VSS F;  1XX4 A;  4FJW D;  1HNO A;  3R0O A;  3TV5 A;  3P85 A;  3HRX A;  1UYV A;  5DU8 A;  3KTK A;  3SWX A;  2A7K A;  3Q7H A;  1OD4 A;  4EML A;  2PBP A;  3LKE A;  5DU6 A;  3H0S A;  4OLQ A;  1N6F A;  3P2L A;  1UIY A;  2YJG A;  2HW5 A;  1RJN A;  4FB8 A;  2ZL3 A;  3Q1T A;  4WYO B;  2VSS E;  4JOT A;  3OC7 A;  4U1A A;  3IBB A;  3IAV A;  1NZY B;  3HP0 A;  4LK5 A;  3TT6 A;  2VSS A;  3QK8 A;  2C8T A;  4ZDF A;  2PG8 A;  2VSU F;  4I52 A;  4Q0G A;  5E0S H;  4ZDE A;  2J5I B;  2F6Q A;  5G1S A;  3JU1 A;  3BEZ A;  2J5S A;  3M6N A;  2VSU C;  1XNW A;  5JBX A;  2ZQR A;  2VSU E;  3DJA A;  2F9Y B;  3DOR A;  1Y7O A;  2F6I A;  4U0G H;  4KWB A;  3R9Q A;  3BPP A;  5INI A;  2ZL4 A;  1X0U A;  4KPK A;  2Q34 A;  2F9Y A;  3PE8 A;  3SLL A;  3QXZ A;  3U9R B;  1UYR A;  4L8K A;  2Q35 A;  4JJT A;  2CE3 A;  3I47 A;  4F47 A;  1K32 A;  4GM2 A;  3PEA A;  3Q0G A;  4NNQ A;  4L6W A;  3U9S B;  5C9G A;  3GMA A;  2VX2 A;  3FF6 A;  4ZDD A;  2FW2 A;  5KDR A;  1Q52 A;  3LAO A;  4EMM A;  4HDT A;  3WG5 A;  1EY3 A;  4IZB A;  1WDK A;  4GHN A;  3GLM A;  3KTJ A;  4WCZ A;  4YLH A;  2VSU A;  3BPT A;  2EJ5 A;  3H0U A;  3T88 A;  2X24 A;  1XO6 A;  4B3H A;  4OG1 A;  3G64 A;  1TYF A;  3RST A;  3V5E A;  5E0S A;  1J7X A;  3H02 A;  4QIJ A;  3HE2 A;  3QKA A;  5DUC A;  5DZK A;  4JYL A;  5IKL B;  2NP9 A;  2A7S A;  2J5I A;  2F9I A;  3KTI A;  4ELX A;  3STA A;  4MI2 A;  2D3T A;  4JVT A;  4QFE A;  2FZS A;  4U19 A;  3MOY A;  3Q0J A;  2A81 A;  3KTH A;  5KDR B;  3NJD A;  4IZC A;  3QWD A;  1YG8 A;  3N6R B;  1WDL A;  3GKB A;  5JBW A;  3KTG A;  5DTW A;  4K3W A;  4KD6 A;  4HC8 A;  3MFM A;  5CTB A;  4OMR A;  1SZO A;  1OD2 A;  1O8U A;  1VRG A;  4FN7 A;  3TLF A;  2PPY A;  5G1R A;  5KJP A;  3R6H A;  3M6M A;  1UYT A;  3GF3 A;  4MXI A;  2ZL2 A;  4JFC A;  3RRV A;  2CBY A;  3QRE A;  4Z0M A;  4RYF A;  5DUF A;  3T89 A;  1FC9 A;  2W3P A;  4EMP A;  1MJ3 A;  3PGQ A;  3K8X A;  2X58 A;  1TG6 A;  4JCQ A;  4JCT A;  2UZF A;  5MGB A;  1EF9 A;  3P5M A;  5G1Q A;  1XNY A;  3TZ3 A;  3TT7 A;  3QYR A;  3NJB A;  3ZW9 A;  3IB9 A;  4ASI A;  1YG6 A;  3QMJ A;  1PJH A;  3T8B A;  1K39 A;  3BF0 A;  4K2N A;  3MT6 A;  4ELS A;  3TRR A;  1FC7 A;  1EF8 A;  3TDC A;  4JSB A;  3R9T A;  1N6D A;  4ZDC A;  4NEK A;  3T8A A;  3T3W A;  2J5G D;  5INF A;  3H0Q A;  4I4Z A;  5E0N X;  3VIV A;  3ZWB A;  4U0G A;  5FIF A;  2IEX A;  4FND A;  3HLN 1;  5DU4 A;  4JWV A;  3MYB A;  2WTB A;  3TVU A;  1NZY A;  3FDU A;  3K50 A;  4B3I A;  3H0J A;  1DCI A;  4FN8 A;  3L3S A;  3HIN A;  5DKP A;  4QII A;  3KQF A;  4ZDB A;  5C90 A;  2ZQQ A;  1XNV A;  4U18 A;  2BZR A;  4I42 A;  3OME A;  4U0H A;  1WZ8 A;  1FCF A;  5DZK H;  4HNK A;  1JXZ A;  3ZW8 A;  4G2R A;  4FZW C;  1SG4 A; 
#chains in the Genus database with same CATH homology
 3ISA A;  4K29 A;  4WZ8 B;  4RCN A;  4DI1 A;  1DUB A;  2DUB A;  1RJM A;  4FNB A;  2GTR A;  2F9I B;  2VRE A;  2J5G A;  3TVW A;  5DL1 A;  3OT6 A;  3PZK A;  3ZWA A;  2J5I I;  3U9T B;  1HZD A;  4JCR A;  4NAR A;  3ST9 A;  1HNU A;  4JYJ A;  5FUS A;  4B3J A;  5ING A;  1WDM A;  3QXI A;  4ELW A;  1PIX A;  3RSI A;  5DTP A;  1ON9 A;  2Q2X A;  4ZU2 A;  4J2U A;  5CTC A;  3ZWC A;  3H81 A;  2DEO A;  2QQ3 A;  3GF7 A;  1FC6 A;  4JCS A;  2ZL0 A;  3R9S A;  1ON3 A;  4IZD A;  4Q1I A;  1N6E A;  1UYS A;  2FBM A;  5HUQ A;  3V5I A;  4KNP A;  1Q51 A;  1W2X A;  4MOU A;  4FZW A;  4RYF H;  2VSS F;  1XX4 A;  4FJW D;  1HNO A;  3R0O A;  3TV5 A;  3P85 A;  3HRX A;  1UYV A;  5DU8 A;  3KTK A;  3SWX A;  2A7K A;  3Q7H A;  1OD4 A;  4EML A;  2PBP A;  3LKE A;  5DU6 A;  3H0S A;  4OLQ A;  1N6F A;  3P2L A;  1UIY A;  2YJG A;  2HW5 A;  1RJN A;  4FB8 A;  2ZL3 A;  3Q1T A;  4WYO B;  2VSS E;  4JOT A;  3OC7 A;  4U1A A;  3IBB A;  3IAV A;  1NZY B;  3HP0 A;  4LK5 A;  3TT6 A;  2VSS A;  3QK8 A;  2C8T A;  4ZDF A;  2PG8 A;  2VSU F;  4I52 A;  4Q0G A;  5E0S H;  4ZDE A;  2J5I B;  2F6Q A;  5G1S A;  3JU1 A;  3BEZ A;  2J5S A;  3M6N A;  2VSU C;  1XNW A;  5JBX A;  2ZQR A;  2VSU E;  3DJA A;  2F9Y B;  3DOR A;  1Y7O A;  2F6I A;  4U0G H;  4KWB A;  3R9Q A;  3BPP A;  5INI A;  2ZL4 A;  1X0U A;  4KPK A;  2Q34 A;  2F9Y A;  3PE8 A;  3SLL A;  3QXZ A;  3U9R B;  1UYR A;  4L8K A;  2Q35 A;  4JJT A;  2CE3 A;  3I47 A;  4F47 A;  1K32 A;  4GM2 A;  3PEA A;  3Q0G A;  4NNQ A;  4L6W A;  3U9S B;  5C9G A;  3GMA A;  2VX2 A;  3FF6 A;  4ZDD A;  2FW2 A;  5KDR A;  1Q52 A;  3LAO A;  4EMM A;  4HDT A;  3WG5 A;  1EY3 A;  4IZB A;  1WDK A;  4GHN A;  3GLM A;  3KTJ A;  4WCZ A;  4YLH A;  2VSU A;  3BPT A;  2EJ5 A;  3H0U A;  3T88 A;  2X24 A;  1XO6 A;  4B3H A;  4OG1 A;  3G64 A;  1TYF A;  3RST A;  3V5E A;  5E0S A;  1J7X A;  3H02 A;  4QIJ A;  3HE2 A;  3QKA A;  5DUC A;  5DZK A;  4JYL A;  5IKL B;  2NP9 A;  2A7S A;  2J5I A;  2F9I A;  3KTI A;  4ELX A;  3STA A;  4MI2 A;  2D3T A;  4JVT A;  4QFE A;  2FZS A;  4U19 A;  3MOY A;  3Q0J A;  2A81 A;  3KTH A;  5KDR B;  3NJD A;  4IZC A;  3QWD A;  1YG8 A;  3N6R B;  1WDL A;  3GKB A;  5JBW A;  3KTG A;  5DTW A;  4K3W A;  4KD6 A;  4HC8 A;  3MFM A;  5CTB A;  4OMR A;  1SZO A;  1OD2 A;  1O8U A;  1VRG A;  4FN7 A;  3TLF A;  2PPY A;  5G1R A;  5KJP A;  3R6H A;  3M6M A;  1UYT A;  3GF3 A;  4MXI A;  2ZL2 A;  4JFC A;  3RRV A;  2CBY A;  3QRE A;  4Z0M A;  4RYF A;  5DUF A;  3T89 A;  1FC9 A;  2W3P A;  4EMP A;  1MJ3 A;  3PGQ A;  3K8X A;  2X58 A;  1TG6 A;  4JCQ A;  4JCT A;  2UZF A;  5MGB A;  1EF9 A;  3P5M A;  5G1Q A;  1XNY A;  3TZ3 A;  3TT7 A;  3QYR A;  3NJB A;  3ZW9 A;  3IB9 A;  4ASI A;  1YG6 A;  3QMJ A;  1PJH A;  3T8B A;  1K39 A;  3BF0 A;  4K2N A;  3MT6 A;  4ELS A;  3TRR A;  1FC7 A;  1EF8 A;  3TDC A;  4JSB A;  3R9T A;  1N6D A;  4ZDC A;  4NEK A;  3T8A A;  3T3W A;  2J5G D;  5INF A;  3H0Q A;  4I4Z A;  5E0N X;  3VIV A;  3ZWB A;  4U0G A;  5FIF A;  2IEX A;  4FND A;  3HLN 1;  5DU4 A;  4JWV A;  3MYB A;  2WTB A;  3TVU A;  1NZY A;  3FDU A;  3K50 A;  4B3I A;  3H0J A;  1DCI A;  4FN8 A;  3L3S A;  3HIN A;  5DKP A;  4QII A;  3KQF A;  4ZDB A;  5C90 A;  2ZQQ A;  1XNV A;  4U18 A;  2BZR A;  4I42 A;  3OME A;  4U0H A;  1WZ8 A;  1FCF A;  5DZK H;  4HNK A;  1JXZ A;  3ZW8 A;  4G2R A;  4FZW C;  1SG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...