3T4AC

Structure of a truncated form of staphylococcal complement inhibitor b bound to human c3c at 3.4 angstrom resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
307
structure length
296
Chain Sequence
TCNKFDLKVTIKPAPKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIQKDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Diversity in the C3b Convertase Contact Residues and Tertiary Structures of the Staphylococcal Complement Inhibitor (SCIN) Protein Family.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Immune system
molecule keywords Complement C3 beta chain
total genus 42
structure length 296
sequence length 307
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3t4aC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 3t4aC01
5FO9B 2WINB 3CKIB 2ICEC 1OO9B 3HRZC 4FXGC 2QKIC 3I70A 4LNVA 3MA2B 1BV8A 2A73B 3FRPB 1EDYA 3HS0C 5JPNC 2TMPA 2XWJB 3G6JB 2I07B 1UAPA 2B39A 5FO8B 3KLSA 4FXKC 3V96A 3T4AC 1XWEA 2E2DC 3OHXC 4D94A 1JB3A 1JC7A 2PN5A 1PXUA 1UEAB 2J0TD 3CU7A 1D2BA 2A74C 1BUVT 4ILWA 1AYOA 5FOBB 1BR9A 1GXDC 2WIIB 5FO7B 3L3OC 1BQQT 5JPMC 2XWBB
chains in the Genus database with same CATH superfamily
1ESRA 1U3ZA 1VFBA 1N2RA 1X54A 4DPRA 5CCGE 1L7IH 4DXFA 3AXLA 1VSCA 1GYAA 5F1KC 4ZMYA 4PJAE 5I15L 4NKIL 4ZFQA 3K4AA 4WENB 5LLIC 1XL6A 1JK9B 1SEQL 3FB8A 4NQXA 2W65B 3U9PH 3LNNA 5E2VL 5C8JA 3EADA 1L6ZA 2GTZA 3JV5A 4OXPA 4X80H 1E4KC 5KG9B 1XL4A 5GGVH 3V95A 5BS0B 1YY8B 1NAMA 3B83A 3BJ91 1T1ZB 1FAIH 5EORH 5C0CB 1RK1B 2AQPA 4W9ZA 1CJYA 4PHZA 5H4ZA 3KLAB 2PO4A 2FD6L 1KRSA 4G7ZC 3TX4A 4JK1C 3O6FC 4JFED 1B7YB 3BIAX 3CFIC 3EFXD 1QW8A 1AQHA 4J2XA 1OGPA 1OAUH 4ELMA 2QQKL 3FL7A 3S37L 1RPUA 5FYLL 1PH2A 1IXRA 2RDHA 3W0WA 4OQTL 4HJGB 4H25A 1VQ6A 4BY7H 3T8VA 2ED8A 1LTTD 5CN2A 1ETZA 1AI1H 3W5NA 2ZJRA 1IC7H 2IDSA 2E7DA 1BIIA 4X0NA 3AYHB 4HJIA 4IIQC 1E7VA 3P3RA 2NY0D 4GY4A 2CIKB 4YWMA 4GI9A 4FNUA 2VISA 2LMCB 1FYHB 5CEZL 1O6SB 2PTTB 4DP6X 4N0UB 2WVTA 2WD0A 5IBTL 3QJSB 1CD8A 3S34L 1S7UB 2FYYB 1QWHA 2PTVA 4FOMA 4LKXA 1OD7A 3O6MH 4Y4HD 2DQHL 4HGKC 4R84A 4WTQA 4F9PC 5I75B 1KY6A 4C57C 1K4DB 4J3TA 1JXGA 5SWSA 3DEOA 1SNMA 5BQ7B 5I18H 2E9GA 2V7NA 2H2PC 2BOSA 3QDAA 1OW0A 3GXNA 1KJ2L 4ODVH 4XVTH 1B0IA 3R8BB 4H4NA 5E8OB 3SJVA 5CORA 1PH3A 4YBHA 3AQDA 4NNYA 2FXQA 1FLRL 2D9QB 4XCEA 4J39A 2JB5L 2NXZB 3C5JA 1BNZA 1RUPH 3D3VA 1MH5B 4JZOB 3TEUA 3NBNA 2EXSA 1JYNA 1PRTF 5K33A 3VYPA 1FV1B 1HNWQ 2X3AA 43CAB 5H35A 1UM5H 2FD6H 3VJ6A 3RBSA 5DZ9A 1UWXH 4JRXB 4I9WE 4OLXL 4P74A 3R7QA 1XR8B 4H26B 1NTDA 4J3BA 3SE3C 2JJTA 4LZKA 5IODA 4B9WA 1OE1A 1WO2A 1PZID 3QS2A 1TZHB 4X9GA 3VYOA 2D9UA 3H9ZA 3F2DA 3Q2CA 1FUNA 3B56A 5K93A 2ZJPA 2I25N 4JM4H 4BQ8A 4X9YA 4YXLH 5I8EB 2VLME 2X10A 4NQVB 2PCPA 4POUB 3WLBA 2Z35A 4V11A 4DKEL 1SSOA 1TLKA 5D7KE 3H9SE 1N7MH 4A3IB 3BH9B 3FU7B 4YPGA 2NTSA 3EFFB 4RMFA 3VWKD 3J81i 4AMXA 4LCUA 3WKYA 5JOPD 1VFUA 4DN4H 2OAAA 2WBJC 4WHTB 4NKOB 2B9BA 3VI4B 1J86A 2BO0A 5CBEA 5C0RH 2JIXA 1S2EA 5B4MC 3R93A 1L5GB 2QGBA 5EZPA 5EBGA 3AY4C 1D5ZC 4GRWH 3U7WL 1XXFC 3UG4A 2WCGA 1P7QB 5IE8A 1XCWA 4TNEA 2GJ6D 1Y7VA 5HHVL 4D94A 3AWGA 2NY2C 1TQVA 3DJ9A 2BFVL 1I1AA 3VCLA 1FFOA 1LO5A 2Z1PA 2VDNB 2GY5A 1AGFA 3DM1A 3I72A 3WEXB 4J7RA 1SYSA 2QVTA 1CB4A 2GN5A 1BXXA 2OMWB 3FCGA 2PZUA 5C4XH 2KVMA 1A7BA 4NQCA 5DK2A 4ZSOB 3RWGB 5D9SA 4XNZC 1R47A 2MFNA 5CV5A 1VA9A 3BMWA 2DQ6A 2R2EA 4NKIH 1MHHB 4YHIA 2WLLB 1SRUA 4FXKA 2EVFA 2ENQA 3TV3H 3HZMB 4QPEA 1YUHA 2VERN 3RWIB 4K07A 1QSFA 5EU7E 4ZMXA 1SNOA 2NX5E 1G0XA 3ESPA 5D4QA 1T5XA 2OR9L 2WSPA 1HZCA 2M00A 4PJ5B 4RCAA 4ELKB 2FL5A 5DZPA 4TVSa 5C09E 3B6SA 3J7HA 4YDIH 3SDXB 4EI5A 3KPLA 5GJSH 2APWA 4N2EA 1MHCA 2BCKB 5JDSA 1QNIA 3VXQA 5HYJA 2QFPA 4M6AA 1IM9A 2K4KA 2KCCA 4IUTA 1GS7A 2W0PA 3FOLA 4P5KB 1CBVH 5TF1L 1ZGLA 5I28A 3WL9B 4F5CA 4K7PH 2QQKH 2AXGB 3ZMRA 4CDGC 2IIJA 1RIUH 2EUVA 3MAQA 1NL0H 3JV4A 2W65A 5D1QE 2NZHA 4JRLA 3C6LB 2I5HA 2VC2L 2VDPL 3HI5H 1HNZL 4KROC 1B9ZA 1WJJA 2O5XH 2EIDA 2VW4A 2V6HA 3EFDH 4I77H 5F7HA 1SDDB 8FABA 1ZGLB 4ABWA 1P7KA 4H8VA 5C0NC 4Z9KB 4CVXA 5HHXH 3VXUA 4Q14A 2VDRH 2BNUA 4O9HL 3PUUA 4CC0A 4BBRB 5E8DL 5CV4A 1FNEB 4JM2F 2F8XC 2IXQA 4KD4A 1SNRA 1BEXA 4LOVA 2VSDA 4FQQA 1T20A 4U2YA 1N32Q 2PCFB 3SGDH 1VQJA 1XEUA 1J1PH 2AQ1A 1QEWA 2WTRA 3L81A 4RGNE 3RU8L 3JYCA 1BWMA 1XF2A 3SHLA 3FQYA 4Z5RA 1ETZB 3A55A 5J39A 5FM4A 2CRYA 4OLXH 3OGCB 4FQXA 1JXJA 1NDGA 1WAAE 2EH7L 3GMLA 5IMMA 4YAQB 2GUYA 1RJLA 3QORC 1OSZB 3QNYB 4WTXA 5FYKE 1NBZA 2B59B 4J3OH 1ET6A 3N41B 4PMFA 4WW1B 3THMH 4BFBD 1WWCA 5PAZA 2OMYB 2A6DA 3FU9A 4UNTA 4XX1E 3OWEB 2Q8IB 4IMKC 3PF2A 3DURA 1W6LA 2XVGA 2W0FA 2WWKO 4FNLH 1JF1A 1RJZA 3Q8CA 5EEVA 4D3CH 4KITB 3C9NA 3WTSA 2P8LA 1YG9A 2RACA 1CL7H 2XYBA 4TTDD 3RG1C 1R9TH 2XZQL 5K9KA 5C4ZA 3I73A 4IMKA 5ABDE 4LPCA 4AMKH 5FKAC 3CMOH 4PJ5E 4N26A 1BD2D 1M05A 4MNGE 2LU7A 5IIEA 5AW8B 4KDTA 2DM7A 3N50A 3QK0A 4MDJA 4V190 4KVPA 5D7KD 4QTFA 4P3CH 1XTDA 4FLHA 1QNKA 1JZDC 4NUGL 5CUSL 1VQCA 1QSZA 3QR2A 5AD0B 4QXTA 3PDOA 1F0LA 4R2GD 1CG9B 1ICTA 1UM6H 4RDQG 1EYAA 1IEAB 2EYRB 3SE9L 1CTOA 5IFAH 3T2LA 1THCA 1I8LA 1ORSB 1M05B 2B2WC 5F96L 5IIEB 4DNTB 3VXUD 1U9KA 5A3IC 5LGJA 3V9EA 1JPGB 1F4YH 4Y9EA 3D8MA 2ICEA 4M5SA 4UANA 3C8KA 3I6GA 5H37H 1UOVA 4ABQA 1NGQL 2JH2A 4HCSA 1HTLD 3O3BB 1XZWA 2NYKA 5BPPA 1QLFA 3T6ZA 3II2A 5F3BA 3V6FA 4GAFB 3GRWA 4FCHA 2V1CC 1Z5LB 3QXDA 3PXJA 5AOIA 1BFOB 2H1LM 1AKPA 1YEEL 5HI3D 5C07D 1GJWA 5DM73 3VD7A 4KK7A 1EX0A 2NN6G 4X6DF 1BF4A 1XD0A 1CK0L 1B3JA 2ZYRA 1IQWL 3A6CL 1E9OB 3LN5A 4KKUA 2KCTA 2HJKA 3HE6B 1KFAH 1RK7A 4POZC 5DUPH 3QVAA 2AJSH 4L29A 5T1KA 4HJTA 1T66D 1NFDA 3VFUA 3B6SB 3CZJA 4P9HH 4OT1H 4TKWA 3ZDYE 1V05A 2YQGA 5KSAB 1CDBA 3I70A 3TCTA 4A3JG 1Y6NR 2WB1A 3S2CA 2I9TB 2MQ3A 2K6WA 3QIUB 1CFBA 5KAQF 4JI4L 3CSYA 4QXWA 2HLAA 3VXSD 1HCYA 3JTBA 4YSUA 3F85A 3R7RA 3S5YA 5LMUL 1UD3A 4RQQA 1YHBA 2GBVA 5HDBF 1WGOA 2R2EB 3AQYA 5I0WA 4KV5F 3DEPA 1NEUA 1S5HB 1RIPA 3R1GH 4YR6A 1OP3H 1ZLUK 3V6OA 5BOPA 5BUPA 4N2NA 2OTWA 2GTZB 1ZXQA 4YDKH 4LAJH 3L4UA 3V0IA 4H88H 3BDOA 4GXUM 2LTQC 4Y4KC 5D2LF 5FUCC 2GVAA 2AAAA 6TAAA 1JV2A 4KXZH 4CKEA 3LSOB 5DWUL 5DF0A 3CNKA 2VDLH 1XGZA 1YEKL 5CSBA 4ID6A 1A7OL 1P5VB 4QR7A 3MV8E 3RPIB 4LF9Q 4M6ML 3PUWA 5J9PA 1IM9B 4IBZA 4PY8J 2PWGA 5BRZB 5E94B 5ANHA 3P9LA 1J8HE 4XN7A 3TN0C 3QS3A 5HHOD 3NIDB 3MXWL 4M7ZC 4W4OA 3P4OB 4WJ4A 3C2AH 2P26A 4IDJH 2PCYA 4QRPE 4OGXH 3VQLA 1TZGL 8CGTA 3BP4B 3L3GB 3US0A 2RCNA 4BKLA 1EFXD 4L5FE 3GLEA 4PJHB 1CI5A 3FB8B 3ZY7A 4D3CL 4ODBD 2Y2WA 3P3YA 4PRBB 2Y7LA 3DX6B 2NTTA 5TDOA 1ML0A 2K14A 2DKUA 3MCYA 4HJ0C 4AYGA 4IJ3C 3ETTA 5I1JH 1HAWA 3DURB 2N8NA 1MCNA 3GXMA 3L3HB 2MHAB 1I7RB 5HDBE 3RDTD 1P7HL 3KZ8A 1T4KA 2P5EE 2FHTA 4F7EB 5I1IH 4QRSB 2ZONA 4IU2B 4UPAA 4BXVA 4DP5X 2VO5A 2X7LA 5B3NA 3TIEA 4E5XB 1GIGH 2QKSA 1CWVA 5C3LD 4WW2B 1BBJB 1YNND 3DDFA 4GRWE 4P5MB 4XO3A 3TA4D 1NA8A 1I8IA 4AX3A 2MMXA 3Q5TA 4BYHA 2NW2B 3QEQD 1K4CB 1SHWA 3GRWL 5I66A 4AEHH 3GSNL 5KS9F 1A15A 1M1KC 1A6ZA 1XYIA 5D2NA 4OV6F 3LNEA 5I76A 3VG0H 1V5JA 1IT9H 4NC1C 5GSVA 4NRXB 3BUIA 4Y2OB 5D1XD 4O9HH 1IKFL 5KAQG 1DQML 1M6OA 1NLDL 2DLFL 2BVOA 3H9HB 1OGSA 2OCEA 5AW5B 3NIFF 1SE3A 4AQ1A 4OZFG 5LGYA 4P57B 4C56E 4HFWB 5J0BA 3KYMB 1Z3RA 2DB8A 3BQUC 1S7UA 2FYYA 5C6PB 2DQJH 3NACH 5AVSB 4J5VA 4J28A 2PNRC 5I19H 1AE2A 3W1GA 1HWGB 1YYMH 1UFGA 1A66A 3TO2B 2FK9A 4A7GF 1AKJB 2BVUA 4OLZL 1WK0A 5HDRA 2OMYA 3RR5A 2IX3A 4B3RQ 3MBWB 3MA9H 2XG4A 4PCTA 1KPUB 2O2LD 5D65A 1V7NH 4HIOA 2JTDA 5DUPL 1F3JB 3GI9H 3AREA 5FA4A 4U1NA 3OXSA 4MBOA 4X3SA 1N70A 4M8UA 1QQDB 3ARYA 1X56A 2B20A 3CIQA 5CP7B 1BCPD 3LWUA 3B34A 2C4FU 5K9OA 3UI2A 4YZFF 1CSPA 3KBFA 3U2SA 4GW1B 3UL4A 1RZ8B 2OX5A 2PW7A 3JWDH 3NPZB 4WSKA 1M90C 3MR9B 4V33A 1DJRD 3HMWL 4F8LA 3I91A 1U9RA 1JPST 1PX3A 1MI5B 2W9LA 2ADGA 3LH2H 3MLSH 1KAAA 1U8PA 5E5MA 2XETA 4KY1L 1U36A 4AV0A 4JI0L 3BD5A 2CBOA 3OPOA 3T1YL 3Q1EA 1Y8OB 2FT6A 4XX1G 4JV5L 1MFNA 4DAVA 3FN9A 4I48A 3H0GB 2VLKA 3NGBC 5D2LE 3VH8A 3K2KA 4GLVB 1FFRA 3D4WA 5J1AA 1V3KA 1STAA 1VESA 2NCEA 2IHEA 2CHDA 1ZHKA 3BZ5A 3K58A 4IGBC 2LT9A 3VB8A 1AIFB 5BN4A 1YJNA 1U8QA 1FIGH 1UM6L 4PJ8D 5DO2D 2J0TD 4DKDC 4C1NI 2UY6A 3BDYH 4GKNB 1P0SE 3FKIB 3EIVA 1JZIA 3S8WA 2PW2A 3EBHA 4HXBH 4CMHB 1OE2A 1NH6A 4LPVA 4DR7L 3LKOA 3VGEA 5D1XA 2C9UA 4Z7NE 1F41A 3JAML 1CFSB 1DL7L 4Y0GA 2ZX8A 1WCBB 5CV6A 4PJBF 4AIEA 2YPKA 5ITBH 3QNZB 5C5MA 2EDYA 3WTVA 1TQCC 4LK1C 3CQPA 3CHRA 1G1KA 2HLAB 1RZ7H 4O4YL 4Z7AA 4P99A 2PXYB 3KWWB 3IKKA 3IBOA 4L2YA 3D3RA 2ATWA 3VI3E 3IT8D 3RZOB 4HLJA 5BQDA 1AOHA 4HIPA 3H42H 4Z0XB 1Y6MR 3REVA 3BQUD 1JPSH 4NKQB 1KYOJ 2XZAL 3IMSA 1EYCA 3CZEA 4RGMB 3ZUNC 5IGGA 4IEFB 4DFAA 4CN4A 1NFKA 3FFCD 4NAJA 5GJTL 5LHY1 4X6BA 3BO8A 1U3YA 1L0QA 3UDFA 2UXBL 1SJEB 1NZRA 3FQTA 3A54A 4MZ9A 4IOAA 2HRLA 4G3YH 4DUZQ 4MJ5A 4NJ9H 5SX5H 1NUFA 2GHWB 1QTYT 3E6HB 4BWWA 4TXVB 1XXDC 4J4PD 3WS6A 1E6OH 2F7QA 1NGWA 4IOSD 3KXFA 3HOWB 3RHWF 1H8SA 1LACA 3TIDA 3U1SL 3WEXA 4B50A 3HNVL 2ADFL 4KN7C 5DZLA 4Y4HC 4AG4H 1QP1A 5CSZB 4S0SD 4JVWA 2CLZB 4NAQA 4GFTB 4G7VH 4PP1C 2SOBA 2ITEA 1GXDC 3MBEA 4PWIA 3BN9C 5BZZA 4XQQA 2PI2A 4P4KA 3VD3A 2EXYC 3LNDA 4F5CE 5AFAA 4A2GA 3VM7A 3RB5A 3V5KA 2GSGA 2Q5BA 2TAAA 1QABA 3PREA 3D4GA 2MQGA 3L5WA 5DJ6A 1HHIA 4OLYH 5ITFA 4XP5H 4FRWA 3LQZA 1Q81C 3G6JF 4OGAD 3WIHH 1BQRA 2RBLA 3MFGB 4LNRB 2YXWA 1HSAA 3CCVA 1DSYA 3N40P 4TULL 5DZJA 1B4RA 4ONFL 1CN4A 5E6IB 4E9VA 3ZIMA 4YHYC 2X09A 3W38A 2J2ZA 3HI1B 2DJ4A 1QRKA 1QBBA 2FR4A 3TF7C 4YDLB 1GA2A 4BDVA 2WCSA 5KSBF 4ZX3A 1K83B 1GGIL 4UAIA 1STEA 1YSOA 2O6DA 3PV6B 2B5IC 3TREA 1HJBC 1I7UB 2XWRA 5E0FA 3TURA 5EEUA 1WISA 3D18B 3NHHA 5TQ0L 2R59A 2NW3A 1ADWA 1ADQL 1RJYB 3PO3H 4GW4B 1YZZA 3EJYC 4MNHB 4MWFA 3C1FA 2Q8AH 1A3QA 4NKMA 2D03L 4F57H 1A1MA 4PJEB 1EIGA 2WAQA 4FQXD 3MRRB 3WOEA 5I1CL 3L7ZC 1QD0A 4KY2A 4LAQL 3SDYL 2BA1A 3KJ6H 4LRIC 3SYCA 3EH5B 1IYUA 1C5DA 2VW6A 4HH9B 1AQMA 1XIWD 2KMWA 3VSUA 2WACA 2M83A 1CKNB 4MA3B 1MFBL 4UIKH 3DV4B 3GSRB 5B7EA 4WI0A 2HTKD 1A6PA 5A2JH 4U49A 2A74B 1WFOA 3FRUB 4URKA 3BSZL 2JI1A 1ZWIA 4RCOA 4EF3A 1BD2E 3QA3A 4FGMA 4K5NA 4MD0B 2XC8A 4TLKA 5C0AD 2MUYA 1BOGB 5DRXB 1JNHB 4CKCA 4N5ED 3DX8B 1PTOD 3FQWB 1R9TB 3O8XD 4GW1A 2EO1A 1I9RL 3CPLA 4JFDE 2XWBB 1LWJA 3DIFB 4XWOD 1BJ8A 3KF6A 3OMAB 1XGYH 2PPCA 4OM1H 5C0IB 4OIKA 2UZYB 3O3AA 3TZVA 4BZ2H 3LH8A 1WICA 3TS0A 2ED6A 2WTRB 3KYKH 5T3XE 5I30H 4YBQC 4G82A 2WQXA 4OZHA 2DZEA 3KPSE 1AG0A 2OLDA 3SDAA 3PLYA 2H2SC 3IJ8A 1G7JA 2BC4A 1I3RA 3ZZLA 1GTFA 4LSRL 1WAEA 2EIKB 3KPRE 4I5BA 4JHBA 1QRNB 2PYEA 5GZND 1HR0L 2PPEA 5JW5B 1ROWA 5C6TL 4POFA 3F8UB 4Z7QB 1EJ8A 1XIWB 5E00B 1BLNB 4KK9D 1AZCA 1DUZA 4PSPA 2Y24A 3LPOA 4ZUVB 3MZTA 4ZPTA 1SVZA 1FNHA 4M7LL 4ZG1A 1AE6H 4ANWA 2KDYA 2YAEA 4Y5YC 1ZRUA 3O11B 4HIEA 3VFVA 4LNVA 4Z7VF 2DPKA 3INUH 2NY6C 3V7MA 5JXEA 2E5EA 1WCQA 3CC7A 1YQVH 2IQ9H 2ITDB 1XIWA 2BZ7A 3C8DA 4YUEH 5FDWB 2UXGA 2CGRH 5DHVA 2VXUL 5CU5A 4XXCA 1HEZA 4W4NA 1PTOB 4WRLA 3TP7A 5M95B 3FQ4A 1HILB 5IROA 4MCZB 1DBAH 5C4JB 4NNPL 2X40A 5CEYB 4HGMA 1EGJH 1IKNC 1A9BA 4IN3A 2XBZA 2NQ3A 3EYSL 3Q6GH 1B9NA 3NDZE 3HNTH 5I6MA 3PNWB 1NFAA 3TTSA 5BW7A 1UKQA 2YGOA 1HQRB 3OPZH 3TBYA 5JA8B 3X1FA 3GMMB 4MGXA 4QGUA 3QUZD 5C2BL 1EZ6A 2CIIB 3ML9A 3TS8A 5I16B 1CU4L 4C3IG 2AERT 3QZOA 2HWZL 2P1YA 4A3LH 4JCVE 4HF5H 1J9TA 1V27A 4XP5L 5CN1A 1XWEA 1OGAD 3HUJF 4NB3A 1NGWB 1JPGA 1QRND 3PO2H 1EHNA 3ZOAA 2PWHA 3EQLC 1KHIA 3DIDA 5EQ0A 1DP0A 3PV0A 1IM3B 5COYA 2AXJA 1CI3M 1URZA 2JP1A 1IC1A 4P3WA 1HNXQ 1P7BA 2G30A 2ZWSA 3FFOA 4XBMA 1JMXA 4OELB 5GS0H 1WOCA 4L8DA 1Q94A 1INDH 3EJPA 3QZPA 3IETA 2A77H 4XBPB 2K70A 1MBYA 1AQKL 5I2IB 1H9DA 1SMYC 1S3KH 3TU6A 1T2JA 4JZJA 4OB5L 3DHQA 1E9QA 2E27H 1SOQA 2W0KA 2FWUA 4FZEL 1CQKA 1MFVA 3VWKB 2OR7A 1CDJA 2DQTL 2G60L 2X5PA 5HDWA 4TUOA 3MKGA 3QFGA 1WTXA 1VQOA 1MFDH 1Q94B 4IKKA 3S5LG 3JV0A 5CEZE 3BSZH 1BCIA 2GC7C 1TTCA 1JZFA 5FPIA 2IOOA 2DWSA 2CH8A 2RFXB 1AD9A 2UY7A 3OYYA 4YIJA 4JBJA 3N1MC 3SPGA 3CC2A 4MXVE 4QRSA 1HVXA 4WHYH 5JQ6L 1C9OA 2AJVL 1N8ZB 1DBBL 4KZDL 4MS8D 1LEIA 3MLYL 4XN8A 4HUWB 4M48H 5FO7A 4BFRA 3UTPE 1TOXA 4XWOC 3NZSA 4HKJB 5E6IA 4BFOA 4A93G 1H9SA 1H0DA 2A1WL 3P3TA 5B39B 4QNPF 4ZD3L 3X13B 2EKJA 1MRCH 1A4KB 2ESVB 2NR6A 4DERA 3V9FA 3VXMD 1S78C 3WHE1 3OKDA 1RZFH 4MX7A 4B3SQ 5DGRA 1MGSA 4ZK9B 4GFXA 4JQXC 2FQDA 3E8VA 4N8X1 1O7SA 3TASA 2AQ2B 1FFQA 4P2CG 5H94A 3UTTA 1CXLA 3ASWA 5FFGA 3Q43A 1KNOB 4DQOL 5G4NA 2UZYA 2DS4A 4FADA 4HEMA 4C59B 4XO9A 4HUVB 5FYKD 3AM8A 4I1RA 1R3JB 1H9SB 1H0DB 3QQ4B 3IGAB 1S40A 1KG0B 3OHXB 4JFEB 1JVLA 4FKHA 4JZNA 4KKPA 5DJAA 4Q97A 3QXWA 5EGTA 5C44G 3ULVC 3V0VB 1BBWA 3ZE0B 4JYAL 2EICA 2QW7A 2EE1A 2OMVB 5DRXA 3HAEG 1H3GA 1A4AA 3ZE2B 2DW5A 4YHNA 2F3WA 3ATBA 4N8VA 2NUPB 1U6AL 3BZ4A 4OFQA 5I6XC 3NUCA 4FYDA 2CBTA 3EN2A 4ZNCD 1CGTA 5I1EL 5SX5K 2O5IC 4HIMA 5C3XA 1BYOA 4P57A 3M86A 5DGQA 3W37A 2HVJA 1K0RA 5D3DA 2O4EA 4LCIH 3ZGHA 3U2SB 2P8MA 4DV2Q 4QXUH 3WKNA 3X11B 4B95C 1KTDB 4OAWB 5AYUL 3QJHB 3ZYIA 5CR1A 1E9OA 4GB9A 4PLJD 5ISZD 4H0HB 3ITPA 2FSDA 3FSVA 1MHPL 1TZIB 2IC2A 4HJ9A 5D2NB 2F7RA 3DVFA 5NUCA 3FO9B 4NRZA 3QXUA 5IREA 1WD1A 1BAFH 4ZFOL 1FVEB 3JUZA 5BN3A 1HESA 3BVWA 5D96B 5KS9A 1P6WA 2NMSA 1NKGA 5DDHB 2GEEA 1VEOA 4LEXH 4PLKC 1I8KB 1R5WB 2ZG2A 2ADJA 2VDOB 1GSMA 1HHHB 1TS2A 1PKOA 2KENA 4JFHE 5GGSB 1FQ9C 5GZOA 2EKSA 1JIBA 3GHEH 1H15A 4Q56A 4WFED 4WI5A 5D7SL 2GPZA 5F7DA 3W82A 1BFOA 2Z0BA 5I71B 1V55B 1L4IA 5I6PA 1EU4A 5FLXc 4MMYB 4LVNC 3NTCL 1JE5A 5I74B 2IPUG 1B0RA 1CGYA 1RSFA 1YPZA 4EZKA 3LMJL 3P20A 1J1XL 3HG3A 3ZTNL 4GAJH 4ANUA 3H3BC 3MA9L 3OWRA 2WAHA 2DM3A 3QO1A 4KROD 1JZ6A 1RP8A 5AZ2L 3CZFA 5I8KL 3KR3H 4NWTH 2VDKL 4JO2L 4JBMA 4FMFA 1A1NB 3MUJA 4QJFA 5IWLC 1DJXA 3D69B 5FOJA 1T9HA 1I85A 2X6AA 2R29H 3JWNC 2K04A 2V2WA 2XZZA 3EFFA 2HCIA 4FMVA 3UAJD 2MCPH 2OXGA 4YBQD 3BIKA 4JRYA 3MRPB 4AUYA 4UT6L 2SODB 3CSBA 3HC4L 5BRZE 4RKBA 2NY4B 5I9PA 2ICWB 5C07B 3ROOA 4ZOCA 4F3FA 2P9RA 3NK9A 1JV5A 3PNWA 2DRUA 3EJIA 4DKAC 3IKCA 4QHMB 1ZHKB 4GI6A 4QUFA 2FB4L 4EGVA 1ZLWK 2FJUB 1WTPA 2V3EA 2X4QA 2Y6TE 4KK5D 3O4LE 3G48A 4F24A 1J9CT 2QHLA 2JF1A 2L7EA 3C5ZC 3QWQB 2ZXDA 4JFSA 5FHAH 3SQOL 3GKZA 4DV1Q 4R26H 1BG9A 1PH6A 4UDTB 3RNKA 5IJBC 1ACYH 1X5ZA 3FU3A 3S36L 2FLMA 4UB0H 2EY5A 4GXUN 4JG9A 4K5LA 3RWFB 5J1ZA 4IRJB 4QTHA 5HDLA 1D9KB 3GZQA 3T3PF 3JWNG 5GHWL 4ZOBA 2BE5D 2PXYA 3KWWA 4MVBC 4DV0L 1Z9LA 3L13A 4TL4A 1NUCA 2CM6A 4OLVL 2WLLA 1KIQB 1GY2A 4FXKB 4NQDB 3ULUC 4XN1A 1UC6A 1TZGH 2RQ8A 3VDBA 3TFKD 2C9QA 4ICWA 4ZFOA 5CGYD 4G43A 1XEDA 2NYYD 3HBZA 3B2VH 3L3KA 2C3XA 1Q9KB 4K3JL 1QOHA 4Z77B 2ZUUA 5KVEH 3PG2A 1NC2B 2NY4D 4M56A 4K3EL 5J56B 2MPVA 3JVFC 1P4IH 1IM9D 1TETL 2HUEA 2NNRA 1CK0H 4LVOC 2B2UA 5AB2A 3QO2A 1KPVB 3LRSB 4X7DC 3GXIA 2QDBA 3QWRA 3TWCL 4TRPH 4HU8A 4HS6A 2VB3X 1JJ2A 1GY1A 1W72H 1JHTB 5F89A 3EAKA 4R4IA 4DK0A 3A5ZB 3IDGB 3MV8B 1WC7A 4BD4A 4EVOA 4NQDE 4BRVA 2F74A 5DUMH 1PW3A 1A62A 1Q82C 2ZOWA 4OIIH 4PGCA 3WFBH 5F7FA 1JBJA 1CGWA 4UILL 5ID1A 3ZHKA 1N4XH 2XRSD 1QKZH 1T1ZA 3DXAE 2WGXA 4D9LH 2VDML 4WQOA 2Z8WC 3D3VE 4UB0L 3PPSA 3WY3A 4XX5A 3CDCA 3LN9A 1CDCA 2FJFA 4L4VA 5TDNA 2Y1ZA 4CMHC 2R0KL 3H6AA 4MS6A 4M3KB 3K0XA 5G5DA 3I4NH 1A7NH 4U6HA 1I8KA 2WQUA 1YEZA 3O3EA 2VXQL 3H4HA 1NCGA 4HETA 4XGZB 5IF0A 4K2UL 3OOCA 2G0KA 4GP4B 1BF8A 1ANUA 3F2BA 3PABB 4G6JH 5KVGL 2AQ3A 4IGBB 1NCWH 4KKRA 3HG1D 4UQEA 4CGYB 1ZLUH 3T1FA 5JHDD 4Y19B 2MNUA 2YD6A 2Y7OA 3QUMA 1S7TB 4M6MH 1RTNA 2JK5A 1SYSB 4AK1A 1KCRH 5I2XA 4NX0A 4A3DB 5M5WB 1JPTH 3UZEC 3HOYB 4N0UE 3KPPB 4EQPA 3ZN6A 1LM8V 1E4WL 1HXKA 4Y8AA 2BH2A 3RIAK 5C0BA 4FMKA 5FCSH 4PNYA 1MQKH 1DYQA 2OYPA 1NTGA 5EPLA 3FO1A 2BERA 4XQJA 3IAQA 5E9DA 2Y0SG 5DS8B 2AGJH 4XB7A 5GJSL 1PFSA 1U3HA 1AKJD 3THML 1UQSB 4M1GH 2YQ2A 2BPBA 3BD3A 4ODSH 3ILQC 3HRZA 3VRLE 4KK5C 3TNNA 2RDFA 4NFDA 3GP7A 3IGUA 2ICWA 2WZ6A 1I9IH 3X3FL 1AFVL 1STNA 1U5KA 3L7EB 3LKSA 2K78A 4IQHA 2A6IA 4M1DL 5TF0A 5TTRA 1I1FB 3UTSA 5I1LA 1MFCL 2CXGA 2CH4A 1ZLSL 1CLOL 3GTPB 3PIO3 4Z0XA 3REVB 5BRZD 1MF2H 1A1OA 2VZ3A 4HXAH 3GFUA 3CCEA 4UDTA 3CV5A 3NWSA 1HRJA 3ZE0E 5B1JA 3F7VB 3TSSA 1C7TA 4YFDB 3VG9B 3NCXA 3HKFA 1IAKA 1Q0EA 4EBQH 2WOBA 3RY5A 3QO1B 5GS3A 3EJRA 1Q9WA 1NPUA 1YNKL 1GXEA 3GK8L 1ICFB 1FNWA 1T5EA 4PJ8B 4XCEB 1EZVX 3KJPA 2C3HA 2Q8TA 5EZLB 2JA5G 4KKLC 4AKQA 3ROOB 4GOPC 2BOBB 4HR7B 2Y7QA 4KKCC 4XPAH 5IB4B 3CW2C 1DQVA 4HPYL 3AG2B 1KTJA 1FZMA 2VDQH 8PAZA 5K1VA 5INDB 1CVSC 1I8AA 3MU3A 2NB0A 2HLFD 4X6FA 3EDKA 1P4LA 3AXLB 2P7TB 5DD0L 4DETA 5ACLA 3NSXA 5C86A 4K8RC 3MRNB 4N2KA 3VRJA 3PO2B 5I8KH 4S1DC 4XP1H 2VRQA 4YX2H 2D73A 5ID0A 4BY1G 4JO4L 4NP9A 3KGUA 4GBXD 4F15B 3GSXB 1G7MA 4U3HA 3IN0A 2I9TA 1WI5A 3UO8B 4BCZA 3EKCA 1X3GA 4V2BA 3W0WD 3QZWA 1A9EB 3A4AA 4HGWB 4PY7A 4GNXA 4ZUUB 4BWGB 3W5MA 4IBUA 3RX8A 4HTHA 3VRIB 4HS6B 4WU7A 3FVQA 5IJVB 4J3WA 4RISL 3KLAA 5D70L 4LVHB 2R7FA 3IWUA 3BPOC 5I4DA 3C5SB 3TWYA 1DM0B 1CL7L 1H5BB 4EI6B 1C8PA 2WV6D 2JIXB 4W93A 5DZAA 5IR1B 4MSWB 2BHUA 5JIIA 4GIAA 2Y1VA 4IOIA 2JLLA 4DF7A 1QSFE 4AW7A 3S14B 1H3PL 4XRCB 3P2TA 1Z0NA 3A74A 1QW9A 3BUDA 3MRLB 4WUUD 2A9AA 3SE3A 2IWGA 3L0OA 1UJ3A 1U8HA 2DJUA 4KGJA 4OZGB 4DVBA 3EDJA 2KUTA 1JGIA 3MYJB 4AVJA 4NXNL 1GPOH 1JUFB 4NXNQ 1QBMH 3QUMH 1J1XH 2YD3A 1TJGL 4X5QA 1PA6A 3GJFA 5FYJL 1UE7A 1Z9FA 3WTYA 3HOXG 1R4PB 2XKNB 4YGVA 2YAOA 4JHAL 1KGXA 3UTTE 4HCGA 1Z3GL 3U0TA 4G6JL 5LJYH 3QUMB 4E0RB 4DV4Q 3QZLA 2A5HA 2V3DA 1OP5H 4PR5A 1YI2A 2HX7A 4KN4C 1PY0A 4FNFA 2K05A 3BH8A 3OG4B 1X5JA 4RZKA 2APXA 4HJSA 4G6MH 5HYQB 1E2VA 2YWZA 1AEXA 2HG0A 3WMSA 15C8L 1HL9A 3PWNA 5CCHE 3VXUE 3KH4A 1GW6A 4YHPA 1AJ7H 1B6UA 5T33H 5MEOB 2CO2A 1VHPA 2X9WA 3MGTB 1BXVA 4N2IA 5INCA 1U30A 2YZ8A 2KLSA 5I6WA 5T1LB 3I4MH 2DY8A 1HHHA 2ES2A 3HE7A 1ADQA 3KNBA 1JDDA 2HTLD 1ORSA 3FONA 3M07A 3T2QA 3SDCD 1RV6X 1JB7A 4KKAD 1UZ6E 2UUCL 5M7QA 4AE0A 1DE4A 3FTZA 5FGRA 1IBGH 2C1PA 4I85A 2ATPB 1ND0B 3DX0A 4UOW1 1ZT4A 4LF5L 3FTGA 3E9UA 1W6KA 4A3MB 2B59A 1ZE3C 5DR5L 1Q1JL 5JOBA 2DAVA 2BMKB 3RAJH 1DCEA 1LTRD 4Z8FH 5E8OA 2F58L 3O6FB 3P4NB 1HNXL 3HS0C 1EEUA 4FG6C 3VFGL 5ICYB 3I4OA 4X6CE 3HRPA 1EJOH 4LCCB 5KS9E 2D0GA 4KK9C 5IM7B 3ZHNA 2PKDA 1T80A 4AGQA 4PD4K 4WWPA 3WO4B 1K5NB 4L8BA 2OSXA 1RXLA 1T20B 4H1LG 2WBJA 4N1EA 5E95B 1FVCA 3QGVA 2DQEH 3RY6A 4A3GH 4JJOA 1V10A 3MLWL 4QOKD 3EJZD 3RL2A 1J8IA 4G4KA 1MW0A 4CBVA 1KLFA 4DCQB 3IRCA 2Z1CA 3PY9A 2DQDH 1DBJL 2KLRA 4P2QB 1WTWA 1J8HD 3QNYA 2JEBI 4CADA 2Y5TB 4HOXA 4MD5B 2DEWX 2CJUH 2Y3AA 3P9LB 5IVXF 3L3OA 3RFZC 3ML8A 1A3RL 4QXTB 5E3FA 4DR4Q 4YXHH 4LSQL 1FJGL 2CLRB 5CSGA 1MIUA 3B37A 2Y7MA 3PP3H 1ZLVK 2A9MH 2QTEA 1WTVA 1VQ9A 2I46A 1SBSH 3HOYG 4LQFL 5C0AA 3IMWA 4CU6A 4L8DB 1GVIA 1G7MB 2A6JB 4G8IB 4H5SB 1OPGH 4ZKBB 1HINH 3ARRA 1JS4A 3QQDA 1T0OA 3GSVB 2NNAB 3MRCA 2ZJQA 1WFQA 3LH2L 3MLSL 4FG4A 2Y6SC 4ELKA 1RLBA 5SWQA 2B4CL 3G5VB 2RKSA 3MODH 4NP4L 4YPJA 4QJ3B 1MFMA 3MV7A 3MXUA 2VMJA 3NUKA 4ZFZA 1WF5A 1CGSH 3SGKC 3SY0B 4O02L 4LLUB 5IT2L 4A3KB 3CQZH 4AI7A 4EQ2A 2EH8H 2Z6FA 3AUWB 4JRXE 4C4KO 2IAMD 1JPFB 4OH2A 1MREL 3I6LE 5LMNQ 4MAYC 4O00A 4L18A 5DYOA 2VL5A 3PGCA 4URTB 3RNQA 2EEBA 1NFDB 4DQOH 3N6RA 4Y9CA 4HOMA 1MCPH 3N1GC 1CICD 2WN3A 3QIBB 4HCRH 5D7IE 3T08A 4P2QD 2NY0B 4YHZL 5BS0D 1KZYA 3BEVB 4F7TB 4Y4KD 5D6DA 1HJCA 2OV0A 4UYQA 4DNRB 2B77A 3MGOB 5FM5M 3C2AL 1DDHB 2VQ1A 2YUVA 3APDA 5IVZA 2BSTA 4U1KA 1ZTMA 4GLRI 5EF2A 1E4WH 1IAOB 1ML0D 3EJZC 4G5ZH 1I3QH 3NJMA 3PWJA 2EXZA 3ALWA 4D9QE 1PH9A 3V6OE 2K28A 1JI2A 2AI0H 2Q10A 1PGRB 2A0LC 2G2NA 4HK0B 4QMGA 4NI3A 1BR9A 3N6YA 3GSNA 4QGYA 2UUBQ 2A9ML 1FHNA 1X6LA 1R46A 4MJ2A 4OD1L 3UTZB 3FKUS 3GMNB 3CLFL 4WF7A 3AEVA 4F7PB 4KHVA 2R29L 4LGRB 3VXTB 3N42B 1VCAA 3C12A 4A4IA 1DQJA 5E6ZA 4KI5E 4J6HA 4YHPB 2BNRD 3RVXD 2V4DA 4TQHA 4AIXA 3GRBA 4MXQD 2QLYA 1NIFA 2J1KA 3VR6A 4EQ5A 1C12A 2EPBA 4K94C 3TBVB 3J80L 5SV3A 4PBVC 2W9DL 1R17A 3EH1A 3SK4A 3GS7A 4JRXD 3TM6A 2A6DB 3UTPD 3MLPA 3X17A 1LO3L 1YQVL 2IQ9L 4F7PA 3FP9A 2QR0A 2WUCL 4NXKA 2A68D 1ORQB 2ZWNA 3CCUA 4MLIA 3S88H 3U0TB 2D31B 1JDCA 5C3EB 4Z7UB 4O02H 3N06B 5F7LB 3HUJE 2BIOA 3EO0B 4HV8B 4PZ6A 4FNSA 2Z6BA 4K94L 1TITA 3KH3A 1N2RB 4OWWB 1I4RA 1FWXA 3X3MA 2VXWA 3GHEL 4OWTB 4IU3A 3PWLA 4UU9A 5CMAA 4YE0A 5EBDA 5HHNB 2YO3A 2VDRL 5ESVB 4DUWA 1BBDH 1N5YH 1Q1JH 5FWQA 1RUQL 4A2FA 3OTOL 2DQCL 5B3JE 1GHFL 2ZSWA 2R0ZH 4JFQB 4OIAA 5HYSA 4DF9A 1AGEB 2CE6A 1B6DA 1QO3B 2PNHA 2OMVA 3D85B 2B08A 2ICES 1L9QA 1SEQH 2WBJB 5EV7A 1CICC 3I3DA 5GGQL 5LWYL 4L8SA 3FQNB 4X4YB 3GDBA 5AZEL 3GIVA 3W3BA 4PBDA 2D3VA 3STLB 1A14L 1AR2A 3OKLA 5E1AA 1GGBL 4AH2A 4YXHL 1H9JA 2OCCB 4I0PD 2VLKE 4TOYL 1I7ZB 4GUPA 2JKLA 3B8SA 4HS3A 5CZXD 4D8PA 3L1FA 2NWGA 4NUPA 1FLRH 4C4UA 2Y22A 2EUZA 3WEOA 4WFHE 1CLVA 4FQHA 5IQMA 2CCLA 3MOBL 4JI7Q 3EJJX 5IW6A 2GTWA 1KTLA 5AWNH 1S7SB 2CK0L 2DQFA 1ACCA 4IFDJ 4B7IA 1RSYA 3G08A 4G6ML 4EIGB 3GUTB 3MV9D 1EHLH 5C0BE 3H3KA 1PQZA 3EOBA 4A2HA 1SPDA 1KBWA 4L9LA 5FM5O 2A6HC 2VDPB 3BX7C 3HOUG 4KUZH 4DP1X 2QCPX 3ARPA 2FTAA 2BNQE 3CFTA 3JYBA 3MV11 1L0XA 5BJTA 4K7FB 1LYLA 2X0UA 4EUPH 4GRLD 1LE9B 1MVUB 5E1QA 2ADYA 1HZAA 4NI6A 4KQ3L 3MRMB 4NJAH 1YN7B 1T89A 4M8RA 1WBZB 2FBOJ 4IBVA 1D5RA 4MA8L 4U6XA 5HYEA 1F2LA 4JDEB 5C3EH 4Q7DA 4DH2A 2X87A 4NZJA 3X1NA 5KEZA 1LV9A 3WU1A 1LE5A 1CQVA 1VIWA 2C3WA 2Y0SB 3QQDB 4WJ3M 2YD8A 3CSYB 4F7KA 3U58A 3W0WE 3T4YA 5TE6L 3UOAB 1MVUA 5ICZB 1H9MA 1XMQQ 5C0AB 3WLWD 1WIPA 2OQJA 2MO0A 4A3EH 3PL6B 2Y5QA 5BMFL 4EVNA 2DKSA 2JCWA 4N6RA 1MAML 3JT2A 2PR9A 4NQEB 3A8JE 1I3UA 3D69A 2UWEA 1DVZA 4ZO7A 3LJ3A 5EOCJ 2EVBA 2G3MA 4NRYB 1HK6A 4JG2A 3OL2A 1EXUA 4R4OA 4RMTA 4QHUA 4U1GB 4WU7B 2JA6B 5FUZL 4XVOA 2F19H 3N2JA 4LSTL 5MP6H 2X6UA 2EXYD 1DQIA 3BSHA 3MNDA 2EQSA 4MSWA 3DTXB 5IP7G 2IANE 3WOVA 1ONLA 1S7XA 4MAYA 3RDTA 1DVXA 4N9TA 5FKAA 3P2DA 4PB9L 2P45B 4JKLA 4L0ZA 2YR3A 4JG1L 5F1NB 3VI3F 2WB1G 4D0BA 3VFOA 1H9VA 2B1OA 2GIXA 3QG7L 1KJVB 2A4EA 1Q9WB 2HN7B 3TS2A 1H6UA 3S2DH 2WUCH 4UDUA 3CFEB 4S1QL 3A7AB 1LD9B 3UYPB 2BSDA 3WFBL 1XH0A 1RKRA 2YBRB 3IS1X 2VDOL 4B3VA 3GTVA 3IMRA 4FFYH 2PP9A 4OJDH 3F5WB 3B1TA 4HIJA 2XFGB 3UZVB 1CXKA 3NE5B 4OCWH 4QF4A 1F6AA 2FX9L 2Z7WA 2VUYA 4XMXA 1MHPH 5L8LB 2IGTA 4K3GA 1I85C 4WEBH 5LL6S 4E0RA 3FF8A 5AJ3Q 2RB8A 2A9NL 1OTUD 3NEEA 4NO0B 4L5SA 1PD1A 5F9JA 3F7VA 1BBJA 4HWBL 4Z7OB 1DZBA 4KKLD 1HZ9A 4DWHA 1CT8B 3TC9A 3KXFB 1WWBX 4FL4C 5T1GA 3V4PL 4EI5D 2YEZA 2AF2A 3J7AV 2YAQA 4A3KG 3KYHC 4LW1A 2XN9D 1SGKA 1SLWA 5JLZA 1JYXA 3P3UA 2GA4B 2QDLA 3NJXA 4UNIA 3TBVA 3JZYA 2XN0A 4OZGA 4WDIB 1JZEA 3HKZG 4F88A 5TDOB 4R2GB 1PG7X 3FULA 1DVQA 2VXQH 4RAUC 4FKEA 1MCCA 5D1ZA 2WZ0A 3M1OA 5FW7A 2DLHA 3KPNA 3ARED 1BVOA 1LT5D 4Z0BH 4AQ1B 2CK0H 2WBKA 2VUOA 3HR5B 4PW3A 1L1OB 5EBMB 3W11C 2K75A 1JHTA 5F89B 1BIIB 1C1EL 3RLOA 5E1FA 4JN1L 3FYIB 3HC3L 5G2NA 5C4JH 1T1YA 4YJZL 4LCYB 1RIHL 1CKMA 2CA3A 3NA9L 6FABL 2D2OA 3LXCA 5JPMB 2YMTA 3APNA 2OSWA 1E43A 4RAUB 5JR1L 3GUTA 5I74C 1A6ZB 4DUZL 3LPGA 2W07B 2X1OA 4ZZKA 3GQBA 4AQEB 3KLQA 2JKSA 2H5XA 1R3IL 4XB3A 1IGCH 3MNMA 4WUUE 4R7VA 3KPOA 4APQA 2X4SB 5AW9B 5L2JB 1AGDB 1A8JH 3BZDA 4K23H 3SKJL 5T5NG 3ARBC 4PSRA 4ZZFA 4GKJQ 3SZ6A 1P7KB 4O5LH 2UXCQ 1MFCH 1ZLSH 3RJDA 3BAEH 4CJ1A 3FH7A 1XPRA 5IMOB 2ZAIA 1KLFB 4DCQA 2KECA 2GAZB 4Y7OC 5J5EA 1S7RB 1TVHA 3KPRA 3WMQA 3II3A 1JZ7A 3AWFA 4I48B 3QUKB 1Z5YD 3ARDB 2EEXA 2ADIB 3TJPA 1AFVH 3NJGA 3VH8B 1BMWA 5IYDG 3CFNA 5HYJE 4D9LL 5DMKB 2R6GA 4J3OC 3UDWA 3KHOA 4K2KA 1WVLA 3H94A 1QBML 4GQPH 3KG5A 4YFLF 5HI3C 3VXSB 1S46A 3SDXF 4J3UA 1FFPA 2X69A 2VQEQ 5CLZA 1PFBA 3AUVA 4YY3L 4NXMQ 2F7PA 1KCUL 3QXTA 2E6JA 4RGNB 4OIJA 1ET5A 1MWAB 2ZSVB 4G72B 4O02B 2A6JA 1L7TL 2NY2B 4MAUH 4JDTL 4YK4C 4L3EA 3QT2A 1HZKA 1BD2A 2YAMA 2AEQL 5IW1B 5D1XB 4PJGB 3N44F 5CGMA 1MHWC 2DN7A 3H7LA 1HHVA 1M7IA 2JKRM 4HQQL 4LP5A 4XCNA 3RLSA 3F7KA 4JCMA 4YSCA 5L8KB 2WXRA 1OCZB 3F12A 2E7LC 4N90D 1CZ8L 3D06A 3QCTL 4J8QA 3C9NB 4LFCL 2Z0SA 1KCRL 3EOAB 1KFAL 4N8PA 5EZLA 3ZDXB 2X9XA 1EFWA 4JFDA 4BK5C 2WCPA 4R7NB 5DC2A 3G6JA 1QUNA 3PGDA 3KL0A 4KRMB 4XB8A 1AR1B 1WPCA 3GBLA 2D03H 4JX0A 2R1YA 3GMRA 1IGCL 4FQIL 4Y2DD 1URIA 3AROA 1B44D 3HS9A 2BP3A 2QPSA 4HHAB 1AZPA 2AK4E 3MGAA 2BRRL 2RR3A 3KPSA 4JO4H 5DQJA 1QLEL 2O5ZH 4MDIB 3STZA 1A1OB 1CLZH 1ZS2A 3KDFA 2H3KA 3FTXA 3Q3GA 3NBHA 4I0PC 1PNCA 4ADGA 5HYFA 1CGUA 3AVEA 4OKVB 1CA6A 2KI6A 1TWGH 3VQMA 4JAMB 5FGCE 4FF2A 2VQ1B 1A6VL 4X8CA 2XSKA 2JFCA 2Q9OA 2JKNA 1RY7B 3K71B 2DYSB 3NZ8A 1DUYB 4HHAA 4AH6A 1Y6KR 2C9RA 4NQDD 4Q4EA 4IGBD 5I5JA 3CMGA 1YCSA 3SGIA 1OE3A 2WJ7A 1GZHC 2EDOA 3IWVA 4LLYA 4U1IB 5FGBA 5HHOB 1PS3A 1U4RA 4M7KH 3DO7A 4XAWL 3KDPB 1F3RB 2FBRA 1YNLH 3GBNL 3KBPA 1T7VA 1X5HA 2IAMA 1RFDH 5C0BD 4GSXA 4P2OB 1PLGH 1JZ2A 2X4QB 3ARGD 4XP9H 1UTDA 2P47B 3HJEA 2BJMH 4I13B 1Z2KA 3NJNA 4YNYB 4HF5L 2QV4A 3TO4A 5ERWB 1C5CH 4IKIA 2YA1A 3E6FA 3G5VA 3K5MA 2E7MA 1E24A 1A47A 3MUUA 1SFHA 5ETUA 2PMZE 2J8UA 3BP5B 1SN5A 4EDWL 1F9RA 3U0WH 2EC8A 3CFUA 4J3OF 1LYQA 1KXVC 3U48A 3ZPDA 3LKNB 3RA7L 2EOTA 4DR1Q 1MCHA 1XT5A 2V33A 4RFEB 1QWUA 3U6RA 3DBSA 4Z7IA 4HIIA 4LOFA 2A6KB 2BCOA 1EJ6A 2V5MA 3T6VA 3P02A 2X89A 3BJUA 2Z4HA 3HFFA 4NWTL 5I1IL 2PW1A 4R5TA 4KGLA 2ZXOA 4K3HA 3SOBL 1XSIA 4ANKA 4YHNB 5LGKA 4NQUA 5DHVH 3MCKA 4FNQA 3H09A 5HGTA 5BVJA 4UAOC 2DWYA 2F53A 4TPRL 3QG7H 1UT1A 4MNQD 5DVPA 1NICA 1MZYA 3L4ZA 3VI3B 2Y2TA 1AHWB 3EGSB 5IYBG 4X7EC 3SZKC 1FSKB 1QB5D 5E2UL 4MJIB 1AE3A 1ZT1B 2NLJA 3MLVH 4J8RA 5D8JH 4I89A 2JXMB 1AHMA 1S7VB 4M4PA 1UXLA 4QLWA 3CCHA 5AW1B 3FU5A 1V8HA 4KH9A 1OAYL 4WHDA 3HUJA 1VQFA 1M2VB 5A6IA 1EO8L 4GI8A 1KWGA 1P8LA 1M9SA 4X9BA 4C4BA 4IALA 4B3EA 2BP8B 3WXWL 1CTNA 2JI3A 1MHCB 2BCKA 4TQUS 1UADC 2NT1A 5J6HB 5JDSB 2VDMB 1EERB 1AO7B 2YFOA 1T3FB 4IK7A 3EYOA 5DD1H 3U36A 3CN2A 4W9JC 1XF2B 4TUKL 1X5GA 2J6EL 3X3GH 1Z9PA 1JE6A 5IYDH 4WI4A 5EBMA 4B97A 5I24A 1E4XL 2ROYA 3HZKB 4WUUB 3MZGB 3VA7A 5F0PB 1L0YA 3FU6A 2WAQG 5IHZA 1S9XB 3E5SA 5J22A 1D9KD 3VX1A 1ADQH 1HYRC 2ADIA 3HLKA 1KGYE 5DQDL 2K52A 4A7SA 4UQ2A 1KIUB 4ACTA 2NW3B 3T5WA 1VAHA 5CR3A 2CH4W 3Q2VA 4AM0B 2MNWA 5M5WH 2VS1A 3G5YB 8FABB 4XOBA 2OR9H 3QAZB 4L1LA 5F9OL 4WU5A 1S3OA 1WVZA 4JLRA 3WFZA 1HDMB 5TFSH 2WXKA 5ISZA 5EEYA 3I4MG 4PS3A 4FZ8H 5B4MD 1I3GH 2X4SA 3E6ZX 2UX6A 3V7AE 5C0JB 5L2JA 2PQAA 5DS8A 4JJ5B 3RWCB 1UUNA 4UF7C 1KNOA 2XBDA 1FRGL 4XE5B 5T1DH 1KUMA 5FUOH 3LH9A 1IQDB 4B6ZA 4N8CL 4JS7A 1Z6JT 1NIBA 3N0AA 3QJZA 5EZIL 4DT2A 5JW4Q 4MNGA 3BPOB 5K9JL 4WEBL 5SWZB 1HKLL 3K74B 4P3DB 2LOEA 3QAQA 3NJFA 4NENA 4X98A 4HHWA 4GG6A 3FMGH 4HLZG 2W1NA 1UOWA 1KNAA 3TJHD 2QKIB 1QILA 1R4QB 2D7NA 3CZLA 3K1KC 3J8F7 2GTWB 3T4AB 5A3ID 2EYPA 1QPKA 4ZS6C 5E4WC 3CD4A 5BO1H 3X14A 5DK0A 3U1PA 1MJ8L 4HCRL 3U7YH 4QRPB 1KCBA 1GGYA 4BUHA 4Z3IA 4WRDA 4P2RA 1JOQA 4JKKA 1HI6A 4DESA 1JFQL 4FNPA 1EDYA 3QUYD 4GKZB 4XMLH 2XJLA 5D5MF 1HNZQ 3T3PB 3HNSH 3BD4A 4QHPA 1XF3A 2BSBA 2LR4A 4OW6A 3U82B 4O2FB 5IGXL 1X44A 3ARDD 4K5OA 2NXZC 2B2WA 2F0VA 1P9MC 1UB6A 3WKQA 4WWOA 1HQRD 1KCVH 5LXGL 2XQBH 1W0YT 3C2PA 1NCBH 3CVHL 1PG7L 2OTPA 2ZWZA 3ABGA 4JHVA 2EYOA 3CXFA 1EHAA 2MRYA 1R34A 4NQEA 2VMEA 1AZBA 2L7QA 3T3MF 2BVQA 2XZAH 2E6PA 3VNZA 4R3SA 5ELDA 4LF4L 3EYQD 4OFPA 5AKSA 1E2ZA 4OM0L 3F7YB 3P2BA 3O9WB 1TR7A 5C3WA 2C4XA 3ZR6A 3OQRA 2R2HB 5M5XB 5J1SC 5JAVA 3CC5A 4BFEA 2RGSA 2CDEA 5D4IA 2XV6B 3V7AG 1URLA 1P2CB 1FVDA 1PZJD 3LEYL 4KKQA 2D7PA 2NYZD 4OJYA 5GGSY 5GGVY 3HZXA 3P7JA 4D0BB 5IMLA 5IP7H 2OMWA 3B1UA 2JSOA 4JGMA 1G6PA 2P48B 4QUCA 1FVEA 2X7LB 4KZCA 1XCQB 3NSFA 4X83A 1YDPA 3WTXA 1MPAH 5E6ID 2D7TH 2WP3O 4CBZA 2HIVA 2DBLL 3EF7A 3KLSX 1VFBB 1F77A 3RX5A 5CZXC 5C2BH 2OTUA 2DMGA 4IPGA 4I1NB 3L6FB 5FYJE 3V4UH 5CGTA 3QJQB 3RFZA 2HMIC 2CHZA 2KPWA 3GV6A 3U4KA 4EQ3A 2CHWA 4A3EG 1I4FB 4GOPB 1MAJA 1A21A 1OT2A 4G7YL 4X6DA 4AY0A 1EUJA 1DOMA 2GT9B 3EYVB 5IESH 5IJVA 4JRYE 2QT6A 2VO8A 1A7RH 2B1AH 1ZSDA 4MNOA 2P3YA 2UZXB 3K81A 3QUXD 4MMZC 2HUGA 1AC0A 2EP6A 3KYKL 4B0MB 2J1XA 1A7NL 1C16B 2DQMA 3SKNA 1PEZA 2VTFA 4HDIB 1LP9B 3VGAC 2YN5A 3PGZA 4B3TL 3BUYB 5J7CC 1DQQA 4OGYL 5F9DC 3WFCH 2ZM6Q 3X13A 3S2HB 1F2MA 2QSCH 3SB3A 5GHWH 4HPOL 1RUAH 4ZAIA 5TSSA 4LHUD 2ESVD 5KYWB 2H2PD 4LLMA 4DGIL 5D1ZI 5DT1L 1E4XH 4G9FA 3SBWC 4GRMB 2DQIL 3K0WA 1KCLA 1UH4A 2Q6WB 4DKTA 3S5LA 4IRSD 3MBXH 1JK8B 3DGGA 1FGNL 3RVVD 4IUNA 1SF3A 1IZKA 1A7QH 2OXGB 4JLRB 2K3HA 3FO0H 3TA3C 1OGTA 1QAWA 2JIXD 5FLXE 4N0CD 3SHSA 1WTHA 3MQIA 3I9GL 3KLKA 3M3YB 1B50A 3TJEH 3VA2C 4BGDA 4UM8A 2I5YL 5FIEA 4OR1A 3ISRA 4U0RB 4ZNEA 2AAVA 1SYGA 2J8UF 4BFIA 3WLWC 3NYKA 5E6SB 5D8JL 1MCBA 2ZF9A 3BHBA 5HGHA 3M4OB 1A64A 1U8IB 1WS7A 3SR1A 4WUUA 5FUOL 2VLJB 2H0JA 5KUMA 1OXXK 2G5BB 1L1OA 3M88A 4Y19A 2O1AA 4GUCA 1OSYA 4FQ2H 1M4KA 1CICB 1G291 1N5AB 4YDKL 4RZCB 4AC4A 1JCKB 1R75A 3L1OL 3BVGA 1JFQH 4XMLL 4Z1PA 3RWCA 1IBLL 4PS4H 4UILH 3UCQA 1QHPA 5CFAA 1ZYRC 4CJ2C 2JQZA 3W2DH 5B7MA 5BUGA 5ISZB 3HZKA 5EG6C 4ZRGA 1F2ZA 2OMXA 3RZDH 3I4NG 3HOVB 4HS8H 3G6JB 3SE0A 1OZUA 1XB8A 3W11D 4O42A 3O6LH 4PI0A 2OJZL 3JQOB 3IS0X 1T5XD 4J12A 2VXSL 4HKXB 4J1UB 2E5LQ 3O2VL 1KABA 3H53A 2XI9A 1U4FA 4HWEL 4NZ8A 1T4WA 4Q6IB 2WAQB 1HXMB 4N8VG 2CO6B 4TNVF 3TPUA 3Q3GB 1ZXKA 2NY1D 3IPBA 5D71H 1L9OA 4PG9A 1NM9A 3M7GA 4L3EB 1QASA 2NY6D 4HH9A 3BWAB 4PJ7A 1S5CD 2HCCA 3ULVD 2HCZX 2B29A 2JB6A 4UT9L 4KUZL 1Q8KA 1EANA 3WFHA 3PXLA 3VQ2C 5IB2A 2E2HH 1Q8IA 2MO1A 2P49B 2QPDB 4O2FA 4ZAKA 1K8GA 3SKUD 5T3ZE 1FFPB 1II3A 4N2GA 3S96B 3EZ8A 1DE4B 1B4OA 2CK2A 4WCYH 4KY5A 4JFDD 4GYBA 2QVKA 5AYUH 3KYNA 2EYSB 3KCWA 4C2MB 3QUGA 4MMXB 3US9A 3WKMH 2VXVL 3GLDA 4RH6A 2HSIA 3EA6A 5HPMA 1AIFA 1GCYA 4M4RB 3S37H 1D5XB 2R4RH 2VLRB 4OCSH 1LO4H 3RTQB 4JPWL 2ORBH 3J27A 1KEMH 3KBXA 1MJ8H 2CBPA 2HG5A 3GSUB 3R06A 5TE6H 2CO4A 4WUKL 2IANB 5DUBB 3HOWH 1T83C 1THAA 5DC9B 2WBJD 3LPFA 4ICXA 5SWSE 4I9XA 5DEFB 3S2HH 1NGZB 1A6TA 2H32A 3T0ED 1H5BC 2ITDA 4PJXE 4XO8A 4OZHB 4DFHA 1MI5A 1S8DB 3NFSH 3CSTA 4E9YA 4ONGL 2A7BA 5LN8A 4BZ1A 4ZS7H 1ED3A 3D2UB 2GT9A 4C1NK 3LRKA 3T0BA 3QQ3B 4C3JB 4ACPA 5E99L 3ZVVA 5DCCA 1ZCRA 3PIP3 3BDBA 3HZMA 3VMNA 2IPKB 5HHME 4IBQA 3HE6A 2YOCA 4K55A 1OXUA 4LCWA 5EBLA 2F5BL 5B38B 4EIUA 5IEHB 1MCFA 2DNEA 2NVTH 4G7QB 5EUOA 3D4ZA 5D5ME 2C9OA 3KD4A 3I74A 3Q01A 4ZFGH 2Z9HA 4W9IC 1JK9A 3OMNB 3ABKB 4R96A 5EF0A 3T4AC 4IDLA 5BV7L 2YPLA 4NZFA 1X55A 1BFTA 2NLJB 4J8RB 4N0RA 1AZQA 1NMGA 1T22B 1T04A 1OM9A 2BH0A 2AK1H 3NP4A 1XXGA 5DZNA 4Q0XH 3L2LA 3V5HB 2HD3A 3GNMH 4AZ8A 5IVXE 4ZAKD 5FK9A 1NAKH 2NY4C 4LMQI 1DN0A 3GTGH 2X6CA 4MDIA 2V9QA 3B5GA 3QEQB 2BP8A 4KTAA 2BSSB 2ZXRA 3TBIB 2SEBB 4G8FB 5IK3B 3U6XS 4FFVD 1HL5A 3HFMH 4ELMB 2ZYSA 2VQEL 4Y2NA 1F1DA 4DN3H 1HQMC 2XICA 2ICWI 3V0JA 4OCXL 4MNQA 4FS0A 2BDOA 1N59A 2L0CA 1J10A 2NZIA 1RK1A 3DVIA 5T1MA 3FRUA 1IBGL 1TJHH 3TIEB 4E5XA 2XWTB 12E8L 1IMHC 3OX8B 3GJEB 2H32H 5BS0A 5CC4A 5M94B 2E0PA 2WQVA 3UGEA 1NCIA 4OZIE 3B4NA 3CVIH 5FW8A 4O0AA 4ZK8A 1BXAA 2K7QA 1MWOA 1VMCA 5CJQH 3LIUA 4ZO6A 2B3RA 3U7WH 1Q1BA 1RZKH 3RRQA 4PJ9C 2MNAA 4AL8H 1OHZA 5E2TH 2AS5M 4HJAA 1COBA 2X88A 3P11L 3H3PL 2Z31B 3W9EA 3QR8A 4EXKA 1SR3A 4HPOH 4UTBA 3OIPA 2CGZA 4HSPA 5LQBH 1RULH 1H8OA 3DVGB 3KEHA 3VA6A 2B2YA 4LVOB 4YHLH 3OLIA 4NC0B 2E76C 4A3FB 4H0IA 4AV5A 5J11B 2ZUXA 4MNHA 4WNJA 1BPLB 2X9YA 4X5WB 4BQBA 2NX5A 3DO4A 3O0RL 5IMKA 3R2IA 4DQAA 3WJMA 4R4TA 4UUJB 5DVLA 2YMOA 3LMJH 1JWSB 1MCOH 2I07A 3B3IA 3QE5A 1U95A 4PJIB 3IMVA 4GW5B 4PRPA 5M3MH 4XHJC 2I5LX 3PHOA 1VZIA 3ERXA 2PCFA 2QJDA 4JO5A 3IJSB 3D09A 5C4HA 2KHIA 3S17H 2HB0A 1MIEL 4X6CA 4ORGA 2F0FA 2CDFA 2CHXA 3QO0B 3AS0A 3AREB 2QF7A 5FA4B 2VT0A 1TVHB 3KPRB 4QI3A 1CLYL 2WXQA 1JOKA 1LNUB 1GOFA 2ICCA 4LF4Q 1NOLA 3S17B 1I75A 4FJYA 1YHAA 1A3ZA 4UAHA 1JGEA 5FYLH 4WV1A 4YXKH 4CSSA 5C44H 3PPEA 4IM8A 4U3XA 1KIUA 4CN1A 1C9SA 4ZMZA 4X64Q 1G7JB 2PTUA 1K5WA 1OXSC 1ZGLP 3X1BA 5JJZA 3RTLA 4ZUIA 2ZYIA 4XXDB 3HOXH 2I7SA 4FQCL 5K69A 1D1KA 1UXSB 4UM9D 3ZE1F 5C70A 1AO7A 1EXHA 3QCUH 5EUKB 5TE4H 1QPXA 1LTLA 3PJSB 1CDGA 2AQQA 3PWVA 1MSPA 5JYMA 2R1WA 1ITCA 1EJOL 3TVMB 2VDQB 4U6YB 1NCNA 3TL5A 2YRBA 4AENB 3GJFH 4DKFH 1BG1A 1CIUA 2CDEB 2PW2B 4FQHB 1IAMA 1U8OB 5DJ0A 2EYJA 2NTFB 2O61B 3KWXA 3QDHA 4LSDA 5FCUH 5JW3L 4XPFL 4XNQA 5ABZA 2X4OB 3Q8FA 4Y4FC 3ZT7A 3D50A 5JOFA 5ALBL 4YWLA 3BI9X 3S96A 4LF8L 4APQD 4CW1B 2K01A 3M8OL 3QQXA 3ZKMC 3W57A 5I73C 1DLFL 4FA8A 3M85A 5IBUB 3OKNA 3NT0A 3C60A 5KBDA 4DR5Q 5GISL 3WDIA 1PCSA 2GW5A 4ODUA 5L4MA 3QWOA 5ELBA 3AG1B 4JDVA 4E9WA 3EFOB 4ODWA 4PJ5A 3LGJA 1KIXA 2L12A 1OW0C 1SYBA 4XAKE 4N1CA 4ZFFB 2YS4A 4UDUB 1CF1A 2YGQA 1FFTB 3DI3B 4AMKL 1HIML 4XNZB 1A4JB 1U91B 3GXTA 5DS2A 1UUPA 1KQSA 1L5GA 2GFBA 4B9GA 1OWWA 3RDTB 5JPNB 2DL2A 4YIQB 1TLMA 4P48A 1AW7A 1MY7A 4V1DA 3AG3B 4JREB 2H41A 3WNNA 2Z91B 4I0KA 3D30A 3IJ7A 4W68A 2PPDA 3S1NB 4D0DA 1QBLH 3TEWA 3LVEA 1I82A 5DI8A 1P1ZB 1VDZA 1D1IA 5IFHL 5D3IB 4MCYA 5ANMA 5CBAE 2JA9A 1FVCB 5FV1L 2XWJA 4DPGA 4X6AH 4AQ8C 2YRZA 1D5ZB 4EOWL 3HMXL 3DETD 3PWLB 4UU9B 5IGXH 1AAJA 4M5ZL 1BF5A 3PUYA 4RGNC 1MREH 2WKGA 3E38A 3U6RB 1QSVA 1SY6H 1VCBC 4LUOA 4AUUA 1TO5A 4K5VA 4QT5B 2NSXA 2F08A 4AL8L 2ARJQ 5DEGB 3I2CH 4KI5F 5D1XC 4ZTPL 3GM8A 2IDFA 3QIWD 3N0PB 4NO0A 5F9JB 3JAMc 3DO3A 4A2DA 5I2IA 3GDEA 3MBEB 3WEMA 1Q1PA 4R3SB 2ESVE 1BUVT 2AQNA 3MNVA 1P4BH 3QEUB 2H0PA 2E74C 2G9HA 3MO1A 5EORL 2HX9A 2DKMA 5EO1B 5PCYA 4OY9A 4NFBA 3SKMA 1ENFA 1H9RA 3GTNA 4MHHI 5EN3A 3U0PB 2WTPA 2I85A 1AS6A 3IJYA 4LSRH 5HHMD 4KMUC 3GZKA 1BQHB 1I7UA 3U9PL 2UUCQ 1S5BD 2HT1A 2OP4L 1RHPA 3O4OC 1O0VA 3IPFA 4APVA 3QHFL 1MXGA 4DR1L 4IRSA 1KTLB 4LSVH 3ZL4L 5A2CA 3BZKA 2DIAA 3HFML 1FC1A 3BKYH 1TQTA 2VNUD 3IDUA 3LCYA 4GRWF 4L5FH 4DTGH 4E68A 3AT9A 1ZT7A 5F88A 3DGCR 1LTID 2DICA 2K8QA 4Y52H 3PWNB 4IHOB 5T1MB 4KRPD 4HJ0D 5GSVB 5I1HH 4RKLA 4H0LC 1I9IL 2H3NA 4FNLL 3BFWA 4XMWA 1A0QH 3A5UA 1MW2A 5M3FG 3I6KA 3MZ5A 1HNYA 3MV7B 4NN6B 4TPRH 5F71A 9CGTA 3CLEL 2FECL 4WW2F 3BGMB 4ZW8A 1U92B 4ZMLA 1AH1A 1PTOF 4OO1I 3JV6A 3NMEA 3R1GL 3NCJL 2CDGA 5GSRA 4IURA 1DVFD 4E9TA 3G9VA 3W1ZA 2WWOA 1FL0A 3CXHK 3HOZB 3L9AX 4OX9L 3C09B 4XWGH 4D8PB 1Z9NA 1I4FA 1K8DB 4CDCC 1BV8A 4RDBA 4HWZB 4PG9B 4GG6F 3HN3A 1EEQA 2J1YA 3G7TA 4YSPA 3PDGA 2RA1A 2GYSA 1Q9OA 3PQYE 4IYKA 2BFGA 5GAHC 2QGEA 1KT2B 2PCXA 5HY6A 3LRMA 4HXAL 1J8HB 1NUGA 1HYSC 1BQKA 4L4JA 1IKFH 1Y1WG 5IQOA 4A04A 3K6FA 4G2AA 1AZUA 3IDJA 3OZKA 1AANA 5C7XL 1UD2A 4FEIA 2OMXB 2BJML 2PZTA 4Y5VA 3UMNA 1F8TL 2FJFB 3HZYA 4HAFA 1N64H 3ZQWA 4PTTB 4JVZA 3MRBA 5ESQA 3ZSSA 4OI9A 2EAEA 3DV4A 3B2DC 4PI2A 4OHJA 4AJYV 1L9SA 3B43A 1PH7A 2AVFA 1FLTX 2GSMB 2H5UA 5FO2A 3O0RH 3PF5A 5H4YA 4OF6A 3DOHA 4ENZA 2OW6A 3CHXA 2MEJB 3VXNA 2CVRA 3FO2A 5BOZG 3CFDA 1YJDH 3OJVC 4S1SH 2FNWA 4G9DA 1F02I 2X4NA 4HT1H 4DAYB 3K5LA 1TJMA 4OQTH 1X7SA 1KTKA 3UC2A 4DEPC 3GTOH 2FBJL 2F0KA 1ESFA 2RHQB 3GXPA 3QBTB 5D5MB 3OD3A 3BSGA 3GHPA 4NBXB 2RCSL 4BZYA 1RZJL 2CKBL 4YQXH 5EB9A 2LXKA 1S5FD 3K46A 3QZBA 5DJCB 5M9OA 4HOZA 1ZYRD 2XG5A 5DJYA 1A25A 4MB5A 1ND0A 2YRPA 1FYCA 2CAKA 3CH1B 3FT3B 4H8HA 4ZW6A 4HCIA 3RL2B 3UJJH 5CLTA 1D5IH 2JJUA 3FHWA 1TKWA 4QKXB 4F7CA 3SY6A 2WTOA 1MCRA 1VFAB 1XF5A 3R4DA 3QUML 4P46C 2WXPA 3JXAA 4G8GA 4JO3H 2F8OA 2A8VA 4ZO8A 2VDLL 4ZKCB 4DPCX 3BWSA 1GPOL 5IM7A 1WT5A 3A6OA 35C8L 4R2GC 3SDDA 3ZX1A 1D6VH 2GCYA 2ZG1A 4PJXA 5FYJU 4A3BH 1P84K 5HGDA 3KAAA 4X66Q 4WAFA 2V5RA 3TP6A 1HCZA 1GUNA 3T2NL 1PBYA 2EUWA 2UUBL 5EOCL 4N0CC 7PAZA 4LBEB 3MXGA 4LJZC 4JGJA 4CNIA 1BVNT 1IEBB 5HPOA 1MH5A 1KCUH 3ECBA 4R7NA 4RBPK 1IBMQ 4WSGA 2G75A 3GD1C 3M8OH 1J5OH 1QZNA 2EH7H 1E50A 3IVKA 3L1EA 5FM8A 4DV0Q 4YE4H 4JI2L 4LF3B 2JA8B 3QYCA 2QILA 1CXFA 1DVYA 5D9SB 1I3QB 2Q76A 1H15B 2YPLE 1CE6A 4TV3A 3D39E 5LBSL 3OX8A 1LDPL 3DRTA 5KYWA 3QYNA 1FNFA 4PRNA 3VXME 4HA1A 2EYSA 4AEFA 5HXMA 4J3XA 2E2JB 2Q8BL 2R7ZB 7FABL 1M9WA 3VXRE 4LSVL 3TRZA 2IPTH 5DTFA 2R7EA 3LD8C 5J6SA 5AW2B 4JMXA 4U1MB 1FN4A 3WIIL 4Q89A 4AKOA 2VM9A 2VC2H 3TA3A 3GTJB 1EPFA 2F0MA 4UTBL 1F4XH 4H40A 4G6KL 4Y16B 1WZ1H 4PYHA 1ID5I 2MQCA 5T5FL 1EIBA 1C7YA 1PLAA 1RCYA 2AABH 2DMBA 4KK6D 5F93C 2PP8A 4ES8A 4HAKA 3K8LA 1OXTA 5GZNA 1IC4H 2WOYA 5EIVA 1UD6A 4UP9A 1E0BA 4OGAC 1FORH 3NCYS 5I5MA 5HD8D 1CFVH 2XWZA 5D7HA 3VTAA 3HKZB 1FNVA 5GAGC 2Z4QA 3NSWA 3OB0K 3VXTA 1T4KB 4ZXBC 4WORA 4LGPB 3HOWG 3MRNA 3VRJB 1PZ2A 3F2UA 4WK0B 1ASPA 1YNTB 1CFQB 3N1FC 4NT6B 5JHLA 2XIWA 2ITCA 1OXVA 4XMKH 3H0GH 3IDXH 3T0XA 4HWZA 3EO1B 1ZVNA 4QL5A 4R9WA 5FB8A 2YGNA 1A9EA 4HGWA 4K3EH 5DVMA 5IGDA 1KT2A 5C08D 3V6ZB 1E6JL 2F0JA 2HKFH 4Z3GA 1R3HB 1B2TA 4ZMWA 5KZCB 1I1CA 1A4KA 5IY0A 1PZ3A 4NQCD 4XI5C 1ZPLA 2XVKA 5D1QB 4OZHF 1QX1A 3WN5A 1IZ6A 4LHUB 4A3DG 1EWCA 4G57A 4FNTA 3PQYD 4ETQB 2J25A 4WI2A 4AYBA 1A6UL 1S7SA 2ZXQA 2CDGB 4A3FG 4PTUB 2ZUSA 1F6LL 3MBWA 1N12A 2WV3A 2IG2H 1FFNA 1N3NA 3FTUA 3QR0A 2IADA 2F0PA 1F11B 1N9WA 3RLNA 1S5ED 1ES0B 1VEMA 3L5IA 1T2XA 3QXVA 4G80A 4KTEL 2VAAA 5IP9H 4S1DD 1HOEA 1G7IB 4QWWD 2Q3ZA 4L9LC 3L4VA 5F1SA 5FYKH 3C8KB 3I6GB 5GRXG 1VQ7A 1S9WB 4RA0C 5EIIA 1KG0A 1KD1C 3OAUL 3OKMB 1CLCA 4I18A 1OSPH 4P4RA 2NY3B 2AK4D 3C2SA 4NCDA 4FO2A 4K2UH 3VFGH 2BC4B 1FC2D 4RMUA 1G7QA 2VLJD 2C3GA 5BZXA 4AMWA 5SWZA 2AQ2A 4XXDA 5H94B 3SDCC 4PGDA 3MJ7A 5GGRA 4JOIC 3QG6A 4GAYA 3R3OA 4K71C 4L8SC 3P0VH 5JQIB 3T1HQ 1WH0A 2IAAC 2XY1A 1L6XA 3STZB 5F96H 3WJMB 3OGOE 3ROLB 1KC5H 1KXQE 1QR1A 2M1KA 4KXCA 3Q1SL 5C0JA 3KEDA 5M3MB 4NMZA 3H3VI 1YYML 1PD6A 4PMWA 2F0CA 3CH1A 4LSQH 4O58H 5T5FA 4JRFA 2L7JA 5DT1H 1XCTB 2IVFC 3KPSD 5AYQA 3SDCB 4ODXA 3SGDI 3ZLQC 4G6FB 2YK1H 3L4YA 3LEXB 3IYLW 4LDOB 1NEZB 3CSGA 1KY7A 4ALPA 2QGDA 3F62A 4ORGB 3V2AR 5EKKA 4YDIL 3K7AB 3DRTB 4FDBA 3QXAB 3LKPB 2JA5B 3DOSB 1QFUH 1A3UA 1T7YA 4M43L 3SBRA 2ARJB 3CF5A 3NWTA 2P4AB 3KJ6L 2N88A 2C34A 4JFWA 4UOW0 4R0LC 4XN4A 5IW1A 2EC9U 4WGVB 5L6YH 3QWOB 3MCKB 1N0XH 4RVBA 3VAEA 2UYLA 1HT6A 1T6VN 2ENSA 2VMCA 3STBA 4KLKA 1W0VB 2AV1A 1F1AA 3L3IB 3MNWB 4N2DA 2XRAH 1S5IL 4LLWB 5F7UA 3BXNB 4FQPA 4KO7A 3BP6B 2XNAA 1NGYA 2HZHA 2PYFB 2R69A 3KCPA 4QOKB 5F7WC 2XY2A 4PIBA 4XCCL 1EVTC 3HGBA 2OXHB 5DMKA 1H6TA 2CFMA 3OKOA 4JJHA 5KSBB 3QNFA 3PO2G 4FJ6A 1UEYA 4I18C 2PABA 3LIZA 2E2JH 1U8KB 1ZAGA 3K6IA 4EE2A 4F8PA 2AK4A 3QDMA 3T2NH 4X3TA 3QFDB 2EDEA 4MB4A 2VXTL 4AENA 4B53A 4KXBA 1KLGB 5ELEA 1J1PL 5EZJB 5AUMA 3SPVA 4EKXA 1KYAA 3WO4C 1J5DA 5KUKA 2RQXA 1JJUA 5E8DH 1HFNA 2F53E 2LW3A 4Z78B 1E4JA 2ZCLL 2ZXWB 2H9GA 3FUJA 4J4PA 5JA9A 3ARVA 4IQZA 3CFBA 4XP9L 3KXFD 1RZGA 1DO5A 2J7LA 1KJMB 1SN8A 4Z7VE 4CBPA 2QZ5A 3EYFB 1NBYA 3PNRB 4KY6A 3NH7H 3QORA 3D2UD 5KOVC 5IB3B 2N1KA 1NWOA 2F53D 4A3JH 4NPYB 2J8OA 3QPKA 2GSGB 5CR8A 2EDMA 5MENB 1QNUA 4PN6A 1CZ8H 3QCTH 4UTCA 4KWUA 2CRMA 2FEDC 1TVBA 1FRGH 2IH1A 5CM1A 4TSBH 2JNZA 5EU6E 4JL1A 2VJ0A 4ZPVA 3CTTA 4YGAB 1N8ZA 3KL3A 2AXWA 4Z77A 2OMTA 1AN8A 3GNML 4ZXBA 3NPPA 5A40E 2RSNA 5EF3A 4FA6A 3HG1A 3V0AC 2DEXX 1VDGA 5JHDA 3HE6C 1RL1A 4OKDA 3DUSB 2EJFC 2ICEC 2JJWA 1BM7A 2WUBL 1WZ1L 4ZUTB 3GTPH 4Y1TA 3QQ9C 2F0NA 2A4ZA 1I6VC 1G7IA 2HFTA 5JJKA 5CGYC 4Y4FD 1AGDA 3OHMB 2I9LA 5C0DA 1MCDA 1INEH 4RGOL 3HG1B 5I8OL 4QEGA 1NLDH 1N33L 4H2CA 3VGBA 4PRIE 2C9XA 2B2VA 3PV7A 2NBFA 4BINA 1KLUA 4S1RL 5E1HB 3GMQB 1BFVL 4IOFD 4C2MH 1J9SA 3GSOA 2OMUA 1BQSA 1UWXK 2YMXL 2ZAHA 3ILQD 3MV7E 3PCOB 5KSVA 4XMKL 5M3FB 5ETUB 2WLKA 5LVEA 3MNZB 3SCMA 5FV2A 3U46B 5F9OH 1NGPH 5I30L 3RL1B 5AL8A 2JKWA 1GKEA 2C1PB 4I8DA 1KTRL 4IJHA 4XP1L 1K8IA 1QVOB 3RZCC 4MD0A 1RIHH 5D7IA 2FX8L 1K8AC 2CLVA 2WMPB 5DEJA 5E8EA 3VX0A 5ADPH 1GOGA 4PW4A 4PRBA 4YHHQ 4X4XB 4Z7OE 3QDJB 2EEFA 2E7CA 3BQVA 1SXAA 2A77L 3GIVB 5DK0B 1OAUL 2G4GA 3ISWA 3T71A 3EVQA 3HHSB 4NQSA 3U46A 3O2WL 1L9NA 1X7QB 2H6PB 1BECA 4DTGL 3U9OA 3WHXA 4P2RE 3F64A 4FE9A 2XX1A 3ERSX 2EABA 4NDMA 3ROLA 1V1PB 4J4PC 1ET7A 1UFUA 4WKZA 3TBSA 3FDTA 3UBXI 4QTIH 3FTGB 4NLHA 4G42A 5EBWB 1NIEA 2DGYA 2Z64C 2QEJA 1NR2A 5CGBA 5E4OA 3TJEL 1A2YA 3UO1H 3SPVB 2QVFB 3HKZE 4DK6C 2NY3C 1YEIL 2VZUA 4Y7NH 3J07A 3GD7A 1GGUA 4HIXH 4XHJD 4DO5A 3O2DH 1TCMA 3DMUA 3TZVD 3A4FA 3L3IA 1HXYB 3D39B 5F6IB 5T1JA 3NJLA 2AJ3A 4KOBA 1DSFL 1EQWA 2D4DA 4ADJA 4Q52A 1ROCA 3ARDA 2XN9C 5CBEB 1H8LA 5ISZE 2P8MB 1OOAA 3AZUA 5CN3A 5HI4C 3BGFC 4GSDH 3EYSH 4I0PB 5IHHA 5ACZB 3PIQA 3A7LA 4PVNA 1K8OA 2PUQT 3GPEA 2Z8LA 4M00A 4L3AA 3RZWA 3QHTC 5F6IC 3CG8A 4CKVX 3H6MA 2IDQA 4IUUA 1P1ZA 2XWXA 4G8IA 4H5SA 3QARA 1XCXA 1LT3D 1XCTA 4WGKA 2CMRH 1RU9H 4P5RA 4WFHD 2AW2A 1FH2A 2DWTA 4Z7UF 3VWJA 5IFHH 4GG6E 3S97C 1KZQA 5B8CB 5I26A 1W6JA 2L0DA 4P72A 1L0PA 4PJFF 4PGJA 4R7DA 1HILA 4LF7L 3INOA 1YRKA 4PGBB 1OO9B 1EYGA 3S4SA 4HSQA 2WM0A 4MJJA 1RZPA 3ECBB 4OKVA 4JFTA 1ONQA 3TFKC 3WSQH 4D0CA 3WXVL 5I0YA 3EJCA 2GC4C 4QHMA 3M4PA 4YXLL 4NKLA 1DZ0A 1B53A 1OLZA 1VGKA 4OZGF 3GTQB 2FJGB 4XH2A 1KWKA 3SKJH 5EF1A 2W81C 4GOPA 1W8NA 4X6DB 2YGVA 4RCNA 4W4OC 5D4HA 1HHGA 3QIBA 3ULLA 5I1JL 1CT1D 2OMTB 2H1PH 5TH2A 3F8TA 2RJMA 4K6DA 2FZ3A 3ZSTA 2YZ1A 2RAMA 5MHSE 1PYWB 2BSEA 2E7HA 4AQ8A 4ZUSA 4UM9B 1YAIA 4AQZA 1NCTA 1KDCA 4DUYQ 1WV7T 5F1NA 3FSWA 3SE4C 3LVTA 1VQ5A 1N59B 3CCLA 1KBGL 3LKQB 3PL6D 1AH9A 4DW2H 4XVUC 3TVMD 2ZXGA 2F0WA 3L4TA 1QI3A 3UAAA 1XF4B 4X65L 4F58L 1KDJA 1UA3A 3K7AH 2VL6A 2XV3A 1BZQK 3OHXC 2F1EA 2W0LA 4A3BB 4FXGA 4YL9A 3P54A 4P2AA 1U3NA 2L3BA 2Z34A 3LZFL 4J2QA 2K5WA 1E7ZA 5FHAL 3F5WA 3E8UL 1SBBA 2BS9A 3GSWA 2ZP0T 4YN3A 3FS9A 3QI9C 3S34H 4P2OC 4FC3E 5GROA 4WJ5A 5M5YH 5D2LB 5AW4B 3CK0H 3VD2A 1WWWX 5C44B 3L5JA 3J7AF 1YDPB 3FN3A 4BFJA 3SD2A 1FZMB 5D71L 5INDA 4EN3A 3QUHA 2X6GA 2JJTC 1KF9B 4BSWB 1A6AB 3ZMNA 1OGAB 4FFWD 5E1AB 4NB7A 3F00A 4MS8C 3UABA 3KYMA 2K32A 4CL7A 2F4VL 1E65A 2ISDA 4N3TA 1AP2A 2ZUTA 3HEJA 4PFEA 4WW1A 1DTUA 3MC0A 4AT6A 1X6OA 4GG8A 1E6OL 2UWEE 1PYWD 3U4EA 1GYWA 2VDOH 4QCIB 3V0WL 4LL9A 2FGWL 5A2LH 3J7YW 5F6HI 3GJFB 1TENA 3FFCA 3O4LA 2H4OA 4FEMA 1EMTL 3HS8A 3LDBC 5FA3B 4A3MG 5MEND 1F9QA 3CDZB 1KXHA 2I07B 4XBEL 5HD8C 3GI8L 4OSUH 2MKWA 1TXYA 4BBRG 3FCSB 3A0JA 2IBGA 4RMRA 4A6YB 4LCYA