3T4AG

Structure of a truncated form of staphylococcal complement inhibitor b bound to human c3c at 3.4 angstrom resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
68
structure length
68
Chain Sequence
AEELRTLLNKSNVYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMADAKVALEKIYKEIDEIINR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C3 beta chain
publication title Diversity in the C3b Convertase Contact Residues and Tertiary Structures of the Staphylococcal Complement Inhibitor (SCIN) Protein Family.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Immune system
total genus 27
structure length 68
sequence length 68
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-07-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.10 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3t4aG00
5TKYA 4JN4A 3L3OM 3D2FA 5E84A 3T4AG 4EZYA 4JWCA 1U00A 4E81A 4B9QA 4H6IA 4EZNA 3DPOA 3OHXM 4H6HA 1DKXA 3C7NA 4R5IA 3QNJA 4F00A 4R5GA 4R5KA 4EZTA 4R5LA 3DPQA 2KHOA 4JWEA 4JNEA 1DKYA 2QXLA 3D2EA 3T46A 4EZRA 4EZXA 3T49A 4EZQA 4HY9A 4HYBA 4EZZA 4JWDA 4EZUA 1DKZA 4EZPA 4EZOA 4F01A 4PO2A 4JNFA 4R5JA 2WINM 3DPPA 4EZVA 3T47A 4EZWA 3T48A 2QFFA 4EZSA 4JWIA
chains in the Genus database with same CATH superfamily
4EZYA 4IWQA 1MJGA 4WPCA 4D8JA 3M3WA 3OK8A 1E1DA 4IWPA 2EFLA 4AZGA 3ACOA 3T46A 3EJPA 1GNTA 3EJTA 2Z0OA 4JLCA 4I1QA 4IM0A 1ZWWA 2C08A 2EWFA 4ATMA 3L3OM 3QA8A 2Z8YA 3BUBA 3CKDA 3D52A 3ABHA 1TQTA 2YL6A 4R5LA 2Z0NA 2QXLA 1I49A 1SU8A 4AKVA 4JWDA 4NQIA 5C5BA 2Z0VA 3ZEDA 2PMRA 4IWOA 4FZPA 2QFFA 3EJQA 1DKXA 3C7NA 3B53X 3ER9B 2X3WA 2LXYA 2GF4A 3VKHA 1I4LA 3DDFA 3HAJA 2RAJA 1O7DC 2Q13A 5TKYA 1WDZA 1U00A 2F18A 1PS3A 4JNEA 3D4YA 4EZRA 2X3VA 4HYBA 4KIKB 4EZUA 1ZYLA 3DDGA 1HWWA 4UDXX 4JWCA 4M0MA 3BVXA 3OHXM 2F7PA 3D2EA 5FLEX 3DX1A 3CZNA 4EZXA 2JNSA 3Q0KA 4WPEA 1SU7A 4EZSA 2OO2A 3G9GA 4FZSA 2YL9A 1SUFA 4JWEA 2ALWA 1W9MA 4AVMA 2JNKA 2QKWA 3DYTA 3PLTA 2ND1A 3KAVA 3BUQA 2V0OA 2YL8A 2O0I1 3DX3A 1YWMA 2KHOA 2N3KA 2NCZA 4AZ6A 3Q84A 4EZPA 1GN9A 3O3OB 2YIAA 1TQWA 3L3PA 5C5BB 3HAIA 3O3MB 3D4ZA 5E84A 2GAFD 3T4AG 2F7QA 4HR1B 5KBPA 1E9VA 1OAOA 3DPQA 3EJUA 3D50A 1I4DA 1UPXA 2WINM 3BVTA 3DX4A 3QE6A 3QWEA 1TQVA 4JN4A 4IM2A 3BUDA 1LQ7A 3F7WA 2OW7A 4EZTA 2F1AA 1DKYA 3I2WA 2LM0A 1OA0A 3T49A 1E2UA 4JL9A 3KDRA 1X03A 4PO2A 2RAKA 1I4TA 3BVVA 4NPHA 1GNLA 4IW0A 4AZCB 3CV5A 4DYLA 2WYHA 1QWUA 4DCNC 2OZNB 1R5EA 3RV1A 4R5GA 4KIKA 4EZQA 4FM3A 1R33A 4R5JA 3DPPA 4NSWA 2GA9D 2WYIA 4EZWA 1R34A 1Y2OA 2OW6A 2X3XA 2YI8A 4EZNA 3EJSA 1URUA 4F00A 2YLLA 3ERCC 1DKZA 4F01A 4H8SA 2ZXQA 3UITA 3CZSA 2X5CA 2YLAA 2D1LA 2YI9A 1HTYA 4R5IA 3D51A 3QNJA 3BUPA 3DX0A 3SYVA 4E3CA 3I01A 3CAZA 3ER8C 3LVTA 2EX3B 3I39X 3EJRA 3OWGA 3B52X 4JNFA 4IM3A 4EZVA 4AZ7A 3RV0A 3BVUA 3KAWA 1OA1A 3SOGA 2EFKA 4B9QA 4H6IA 3DPOA 2OBLA 4H6HA 2F7RA 3I04A 3BLBA 3QNIA 2F1BA 3DX2A 3T48A 1JQKA 4HR1A 1X04A 4E81A 2ELBA 4AZIA 2FICA 2Q12A 4FZOA 4R5KA 3LMFA 3CVRA 3VEAA 4AZ5A 2PY6A 2D4CA 2F7OA 2YKTA 2ND0A 3GI7A 3D2FA 4AZBA 1TQSA 4HY9A 1HXKA 3A98A 4AZCA 2RAIA 4G6QA 2MI7A 2FYVA 5FIGA 2RT6A 1SU6A 1O7DB 1QX1A 2YIBA 3O3NB 4UDYX 1TQUA 3BUIA 3FD9A 2YL5A 3LLLA 3RPMA 1QWNA 2YIVX 3BVWA 4EZZA 4BNEA 4EZOA 3HAHA 3VEBA 3T47A 2OBMA 3B51X 4AZHA 4JWIA
chains in the Genus database with same CATH topology
4JN4A 4IM2A 4EZYA 1OA1A 4UDXX 4JWCA 4M0MA 4IWQA 1MJGA 4B9QA 4D8JA 3F7WA 4H6IA 3DPOA 3OHXM 2OBLA 4H6HA 1E1DA 4IWPA 4EZTA 3I04A 1DKYA 3D2EA 5FLEX 3T46A 2LM0A 1OA0A 4EZXA 3T49A 2JNSA 1E2UA 1GNTA 4JL9A 3KDRA 4JLCA 4PO2A 4IM0A 4NPHA 1GNLA 4IW0A 1SU7A 3T48A 1JQKA 2EWFA 4HR1A 4EZSA 3L3OM 3QA8A 4E81A 2Z8YA 3RV1A 4R5GA 4KIKA 1SUFA 4R5KA 4R5LA 4JWEA 2QXLA 1SU8A 3LMFA 1W9MA 4EZQA 3VEAA 4JWDA 2PY6A 2ND1A 4FM3A 3KAVA 4R5JA 3DPPA 2GA9D 3ZEDA 4EZWA 4IWOA 2ND0A 2QFFA 3GI7A 3D2FA 2YI8A 4EZNA 1DKXA 3C7NA 4F00A 2KHOA 3B53X 2N3KA 3ER9B 2NCZA 4HY9A 4EZPA 1GN9A 1DKZA 3O3OB 3A98A 4F01A 3ERCC 2YIAA 4G6QA 3UITA 3VKHA 5FIGA 2RT6A 3O3MB 2X5CA 1SU6A 5TKYA 5E84A 2GAFD 3T4AG 2YIBA 3O3NB 1U00A 2YI9A 4UDYX 4HR1B 3FD9A 1E9VA 1OAOA 4R5IA 3QNJA 3DPQA 4JNEA 4E3CA 3I01A 3ER8C 4EZRA 2YIVX 4HYBA 4KIKB 2EX3B 4EZUA 4EZZA 1ZYLA 3I39X 4EZOA 3OWGA 3B52X 1UPXA 4JNFA 4IM3A 3VEBA 2WINM 4EZVA 3T47A 2OBMA 3B51X 3RV0A 4JWIA 3KAWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TKY A;  4JN4 A;  3L3O M;  3D2F A;  5E84 A;  3T4A G;  4EZY A;  4JWC A;  1U00 A;  4E81 A;  4B9Q A;  4H6I A;  4EZN A;  3DPO A;  3OHX M;  4H6H A;  1DKX A;  3C7N A;  4R5I A;  3QNJ A;  4F00 A;  4R5G A;  4R5K A;  4EZT A;  4R5L A;  3DPQ A;  2KHO A;  4JWE A;  4JNE A;  1DKY A;  2QXL A;  3D2E A;  3T46 A;  4EZR A;  4EZX A;  3T49 A;  4EZQ A;  4HY9 A;  4HYB A;  4EZZ A;  4JWD A;  4EZU A;  1DKZ A;  4EZP A;  4EZO A;  4F01 A;  4PO2 A;  4JNF A;  4R5J A;  2WIN M;  3DPP A;  4EZV A;  3T47 A;  4EZW A;  3T48 A;  2QFF A;  4EZS A;  4JWI A; 
#chains in the Genus database with same CATH topology
 4EZY A;  4IWQ A;  1MJG A;  4WPC A;  4D8J A;  3M3W A;  3OK8 A;  1E1D A;  4IWP A;  2EFL A;  4AZG A;  3ACO A;  3T46 A;  3EJP A;  1GNT A;  3EJT A;  2Z0O A;  4JLC A;  4I1Q A;  4IM0 A;  1ZWW A;  2C08 A;  2EWF A;  4ATM A;  3L3O M;  3QA8 A;  2Z8Y A;  3BUB A;  3CKD A;  3D52 A;  3ABH A;  1TQT A;  2YL6 A;  4R5L A;  2Z0N A;  2QXL A;  1I49 A;  1SU8 A;  4AKV A;  4JWD A;  4NQI A;  5C5B A;  2Z0V A;  3ZED A;  2PMR A;  4IWO A;  4FZP A;  2QFF A;  3EJQ A;  1DKX A;  3C7N A;  3B53 X;  3ER9 B;  2X3W A;  2LXY A;  2GF4 A;  3VKH A;  1I4L A;  3DDF A;  3HAJ A;  2RAJ A;  1O7D C;  2Q13 A;  5TKY A;  1WDZ A;  1U00 A;  2F18 A;  1PS3 A;  4JNE A;  3D4Y A;  4EZR A;  2X3V A;  4HYB A;  4KIK B;  4EZU A;  1ZYL A;  3DDG A;  1HWW A;  4UDX X;  4JWC A;  4M0M A;  3BVX A;  3OHX M;  2F7P A;  3D2E A;  5FLE X;  3DX1 A;  3CZN A;  4EZX A;  2JNS A;  3Q0K A;  4WPE A;  1SU7 A;  4EZS A;  2OO2 A;  3G9G A;  4FZS A;  2YL9 A;  1SUF A;  4JWE A;  2ALW A;  1W9M A;  4AVM A;  2JNK A;  2QKW A;  3DYT A;  3PLT A;  2ND1 A;  3KAV A;  3BUQ A;  2V0O A;  2YL8 A;  2O0I 1;  3DX3 A;  1YWM A;  2KHO A;  2N3K A;  2NCZ A;  4AZ6 A;  3Q84 A;  4EZP A;  1GN9 A;  3O3O B;  2YIA A;  1TQW A;  3L3P A;  5C5B B;  3HAI A;  3O3M B;  3D4Z A;  5E84 A;  2GAF D;  3T4A G;  2F7Q A;  4HR1 B;  5KBP A;  1E9V A;  1OAO A;  3DPQ A;  3EJU A;  3D50 A;  1I4D A;  1UPX A;  2WIN M;  3BVT A;  3DX4 A;  3QE6 A;  3QWE A;  1TQV A;  4JN4 A;  4IM2 A;  3BUD A;  1LQ7 A;  3F7W A;  2OW7 A;  4EZT A;  2F1A A;  1DKY A;  3I2W A;  2LM0 A;  1OA0 A;  3T49 A;  1E2U A;  4JL9 A;  3KDR A;  1X03 A;  4PO2 A;  2RAK A;  1I4T A;  3BVV A;  4NPH A;  1GNL A;  4IW0 A;  4AZC B;  3CV5 A;  4DYL A;  2WYH A;  1QWU A;  4DCN C;  2OZN B;  1R5E A;  3RV1 A;  4R5G A;  4KIK A;  4EZQ A;  4FM3 A;  1R33 A;  4R5J A;  3DPP A;  4NSW A;  2GA9 D;  2WYI A;  4EZW A;  1R34 A;  1Y2O A;  2OW6 A;  2X3X A;  2YI8 A;  4EZN A;  3EJS A;  1URU A;  4F00 A;  2YLL A;  3ERC C;  1DKZ A;  4F01 A;  4H8S A;  2ZXQ A;  3UIT A;  3CZS A;  2X5C A;  2YLA A;  2D1L A;  2YI9 A;  1HTY A;  4R5I A;  3D51 A;  3QNJ A;  3BUP A;  3DX0 A;  3SYV A;  4E3C A;  3I01 A;  3CAZ A;  3ER8 C;  3LVT A;  2EX3 B;  3I39 X;  3EJR A;  3OWG A;  3B52 X;  4JNF A;  4IM3 A;  4EZV A;  4AZ7 A;  3RV0 A;  3BVU A;  3KAW A;  1OA1 A;  3SOG A;  2EFK A;  4B9Q A;  4H6I A;  3DPO A;  2OBL A;  4H6H A;  2F7R A;  3I04 A;  3BLB A;  3QNI A;  2F1B A;  3DX2 A;  3T48 A;  1JQK A;  4HR1 A;  1X04 A;  4E81 A;  2ELB A;  4AZI A;  2FIC A;  2Q12 A;  4FZO A;  4R5K A;  3LMF A;  3CVR A;  3VEA A;  4AZ5 A;  2PY6 A;  2D4C A;  2F7O A;  2YKT A;  2ND0 A;  3GI7 A;  3D2F A;  4AZB A;  1TQS A;  4HY9 A;  1HXK A;  3A98 A;  4AZC A;  2RAI A;  4G6Q A;  2MI7 A;  2FYV A;  5FIG A;  2RT6 A;  1SU6 A;  1O7D B;  1QX1 A;  2YIB A;  3O3N B;  4UDY X;  1TQU A;  3BUI A;  3FD9 A;  2YL5 A;  3LLL A;  3RPM A;  1QWN A;  2YIV X;  3BVW A;  4EZZ A;  4BNE A;  4EZO A;  3HAH A;  3VEB A;  3T47 A;  2OBM A;  3B51 X;  4AZH A;  4JWI A; 
#chains in the Genus database with same CATH homology
 4JN4 A;  4IM2 A;  4EZY A;  1OA1 A;  4UDX X;  4JWC A;  4M0M A;  4IWQ A;  1MJG A;  4B9Q A;  4D8J A;  3F7W A;  4H6I A;  3DPO A;  3OHX M;  2OBL A;  4H6H A;  1E1D A;  4IWP A;  4EZT A;  3I04 A;  1DKY A;  3D2E A;  5FLE X;  3T46 A;  2LM0 A;  1OA0 A;  4EZX A;  3T49 A;  2JNS A;  1E2U A;  1GNT A;  4JL9 A;  3KDR A;  4JLC A;  4PO2 A;  4IM0 A;  4NPH A;  1GNL A;  4IW0 A;  1SU7 A;  3T48 A;  1JQK A;  2EWF A;  4HR1 A;  4EZS A;  3L3O M;  3QA8 A;  4E81 A;  2Z8Y A;  3RV1 A;  4R5G A;  4KIK A;  1SUF A;  4R5K A;  4R5L A;  4JWE A;  2QXL A;  1SU8 A;  3LMF A;  1W9M A;  4EZQ A;  3VEA A;  4JWD A;  2PY6 A;  2ND1 A;  4FM3 A;  3KAV A;  4R5J A;  3DPP A;  2GA9 D;  3ZED A;  4EZW A;  4IWO A;  2ND0 A;  2QFF A;  3GI7 A;  3D2F A;  2YI8 A;  4EZN A;  1DKX A;  3C7N A;  4F00 A;  2KHO A;  3B53 X;  2N3K A;  3ER9 B;  2NCZ A;  4HY9 A;  4EZP A;  1GN9 A;  1DKZ A;  3O3O B;  3A98 A;  4F01 A;  3ERC C;  2YIA A;  4G6Q A;  3UIT A;  3VKH A;  5FIG A;  2RT6 A;  3O3M B;  2X5C A;  1SU6 A;  5TKY A;  5E84 A;  2GAF D;  3T4A G;  2YIB A;  3O3N B;  1U00 A;  2YI9 A;  4UDY X;  4HR1 B;  3FD9 A;  1E9V A;  1OAO A;  4R5I A;  3QNJ A;  3DPQ A;  4JNE A;  4E3C A;  3I01 A;  3ER8 C;  4EZR A;  2YIV X;  4HYB A;  4KIK B;  2EX3 B;  4EZU A;  4EZZ A;  1ZYL A;  3I39 X;  4EZO A;  3OWG A;  3B52 X;  1UPX A;  4JNF A;  4IM3 A;  3VEB A;  2WIN M;  4EZV A;  3T47 A;  2OBM A;  3B51 X;  3RV0 A;  4JWI A;  3KAW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...