3T4VA

Crystal structure of alkb in complex with fe(iii) and n-oxalyl-s-(2-napthalenemethyl)-l-cysteine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
199
structure length
199
Chain Sequence
LAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Dynamic combinatorial mass spectrometry leads to inhibitors of a 2-oxoglutarate-dependent nucleic Acid demethylase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 48
structure length 199
sequence length 199
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2011-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3t4vA00
2FDFA 3H8OA 3S57A 3O1VA 4NROA 4O7XA 3RZHA 4ZS3A 3O1UA 3RZLA 3BKZA 2FDKA 3BUCA 4IE5A 3O1PA 3BIEA 2FDIA 3I49A 4ZS2A 4OCTA 3KHBA 5F8PA 4IE4A 4NJ4A 3O1RA 3BTZA 2FDGA 4NRPA 4NPLA 4CXYA 3T4VA 4IDZA 3BTXA 3I3QA 4QKDA 3H8XA 3H8RA 4IE7A 3T3YA 4ZHNA 4MG2A 4CXWA 3I3MA 2FD8A 4CXXA 4NRQA 4NRMA 3BTYA 3O1OA 3RZGA 3RZJA 3O1TA 4RFRB 2FDJA 4IE0A 4NIDA 2IUWA 2FDHA 4O61A 4JHTA 3S5AA 4MGTA 3BI3A 4NIHA 3RZKA 5DABA 4NIIA 3LFMA 3KHCA 3T4HB 4QKBA 3BU0A 3O1SA 4IE6A 4NIGA 4QKNA 3I2OA 4NPMA 3RZMA 4QKFA 4QHOA 3O1MA
chains in the Genus database with same CATH superfamily
2DFBA 3KT7A 4ZKTB 2VU9A 1O3TA 3S57A 5LBEA 1K3IA 5CYYA 4O7XA 5DAQA 1UY1A 3J4UH 3K51A 3SMHA 1BMV2 2NYYA 4JVAA 4FOYA 4Y1XA 2D6MA 2HWE3 2YBKA 1PVC1 3UESA 5FUIA 3BYWA 4B29A 4AHWA 4ARXA 4CDXA 5FMOL 2QDNA 3U37A 3VZOA 1VPHA 1J3RA 2RS31 4QPGA 1BBT2 3KT1A 4GD4A 1RUD3 3N3HA 3AKSA 1XRUA 1TME2 3DPRA 3RYPA 5AC93 1J3PA 5JZGA 3K48A 1JZ5A 1HV1A 1S0EA 3ALQA 4JTNA 1SG3A 4UWDA 2AENA 3SH4A 2ZX0A 5FP4A 3TEYA 4YZ5A 2C0ZA 5A3PA 3WP4A 2Y0OA 2A6WA 4M4RA 2RS12 4OMDA 3HBKA 3AMNA 4HN0A 4XF4A 1WW4A 1XE8A 2GC3A 4V1PA 1C8M2 4LO8A 4NPLA 5FZHA 4LULA 3WXPA 3CZUA 5C4WA 2WZPP 4M4PA 1QJY1 1W9TA 4FPOB 3UJOA 5F5CA 4D3WA 2R041 2EIDA 2W94A 2Y26A 1S0DA 4HZFA 4XZUG 5IFTA 3FL7A 3MIGA 1HB2A 2V5YA 4IEWA 5JOWA 5KXCA 1LOGA 1RUE1 3EHKA 3FWEA 1VBE2 2ZGTA 4QHBA 1DGLA 1NXMA 1UO9A 3WW2A 4CZSA 4DUVA 4DPNA 1DCSA 1FV3A 5FLIA 4DIQA 4XF9A 2ZAAA 2RR11 3FE5A 4JGYB 4NHYA 4N7IA 4PLOA 3TAYA 4OI4A 3I3MA 1H2LA 2QKDA 3JD72 2JB8A 3M8LA 4W4ZA 3PUIA 5FQ0B 4CP9B 1SFPA 5DG2A 3HT2A 2PHDA 2Q8EA 4DQAA 2RMU3 2WZR2 4S2DA 1C4RA 1B35B 1ULGA 1WGPA 4U2AA 1ZX5A 3MV11 3USUA 4SBVA 1Q8PA 1YWKA 2W47A 1N1VA 4DY5A 1YLLA 4JGYC 1G6NA 1MS9A 3J7HA 4RR3A 4XQ4A 4ZPIA 4LBLA 4MGYE 4PIXA 4P00B 2MNGA 1O4TA 4YVSB 1AYN3 4UFHA 5A6ZA 3OF1A 1JI6A 2AH2A 2PLV1 4WM8A 4QPYA 4CEYB 3OPTA 2BNMA 5EV7A 1HQLA 1B35C 3S0MA 4GWNA 1AR63 2ZS6B 1GWLA 4C8DA 5ACA3 1XQNA 1HXS1 3NNGA 5JSOA 1DZTA 1IPJA 2C9KA 2VQUA 3C8XA 2XKPA 1VB2A 3OG2A 4HPKB 4CU6A 2O8OA 4UFMA 3H50A 5L7OA 3D3AA 5LA2A 5FPLA 4A7ZA 3ZPOA 4CDQA 1V0AA 4XQDA 1D0GA 2MEV3 4KWLA 5H9RA 1R081 2ARCA 4CEYC 5F1RA 2YC2A 3N4MA 4QDRA 2WAAA 4JKLA 3AKPA 1TNFA 3JBG2 4Y26A 3WQBA 2JICA 3TEWA 5DDJ1 1W6PA 1S4CA 4GKYA 4KL1A 3OEAA 3VLBB 2RHPA 3POFA 2XH6A 4HSJA 3DGTA 3NL1A 2UYAA 4BQ5A 2VY0A 1JZ8A 3H8OA 1PM4A 4HK9A 1SLCA 3B69A 3N9LA 3LIGA 1UOGA 4Q4X1 1GR3A 5FY0A 1SFNA 2R073 5EYXA 4ZS3A 1RUF3 1RUG1 2D43A 2Q0AA 3K77A 1X7NA 4I3GA 4NVPA 1PIV1 3HN3A 2AYHA 3POJA 2Z69A 4YFWA 5FYZA 4ASKA 1UCXA 2BPA2 1W8TA 1KXGA 5CFDA 4XCAA 3LSDA 2Y6LA 4Q4V2 5FPZA 3CF6E 4IE5A 3CO2A 3AP9A 4R9AA 5EJ1B 4GKXA 2GNMA 2VW1A 4PJYA 4KI5M 4XURA 5CKQA 1TZOA 3SKVA 3GZTB 2JE8A 3VHNA 4OCTA 1UOFA 1X9PA 5A7QA 2WNVA 4WM7A 2B45X 4I30A 2ZKLA 1G7YA 3RJ2X 1BKZA 1GYKA 4IESA 1NKGA 5EHDA 5A1LA 4IE4A 3Q8FA 4CSWA 4HKWA 1RMU1 2QUOA 1H8VA 4QPIA 2ZACA 2VMDA 5A1AA 2EVXA 1Z7S1 2WNUB 3HR9A 1LHWA 4FFHA 4BH9A 1XE7A 3FJSA 1AYM2 4NHKA 2RS53 5FXWA 4CXYA 5GLZA 4AW7A 4D8MA 3AP7A 1LNSA 5CFCA 1E5IA 2P2KA 5L9VA 3J26N 4PIZA 2ARBA 3AL5A 4AEKA 1QGLA 2BU9A 3LD8A 5F37A 1ULPA 2WNUC 2W1UA 1GBGA 2HWB3 1XNDA 4XXPA 4CXWA 4W65A 2WJSA 2XQXA 2JE9A 2ZX2A 5FYUA 4PBOA 4LHLA 4QB2A 1FPN3 5GKAC 4XZPA 4XJ9A 3WLUA 2GH2A 1AR83 4F83A 3DYOA 1HRV3 1X36A 2BVBA 3KV4A 4XFIA 2VTXA 4LO4B 5FPVA 5BV6A 1AX0A 4QHZA 1PGL2 1TEIA 1FMD1 4UFIA 1LB2A 4JDMA 3A21A 1IS3A 2FDJA 1DHKB 1POV0 3SISA 3ZR5A 2WINB 4M0HA 1PO21 2WO3A 5GALA 3I3DA 1O4ZA 4EROA 1ND3B 3OBRA 1W04A 4LQRA 4AQSA 4YVWA 3PUHA 3RRDA 2HWF2 2Y60A 1UY0A 1PMJX 3LE0A 3NNMA 1TMF3 4Q0PA 4BIOA 1BYHA 2QDRA 1VJ2A 2W5FA 3LFMA 3KHCA 3MBWA 2O8QA 1W3XA 2IVJA 4E2QA 2XJVA 2DU1A 3V56A 1V6KA 2ET7A 1JOPA 1IGOA 4DB5A 3CMGA 1ND3C 4Q29A 2D5FA 1S1AA 5GLTA 3ELNA 4IV3B 5IK8A 3FZ3A 4EWAA 1E5RA 2WYSA 3NAPB 4XVHA 1W2UA 5FZKA 3ZDSA 5CZKA 5APAA 1KFUL 1LESA 2WT0A 1IG3A 4NPMA 3ZDVA 3SCFA 2BGCA 4AQTA 1AR72 2BOJA 2RDSA 2IVIB 4A45A 2WNOA 5C33A 4RHV2 4MH0E 3VDCA 5IVFA 5A6YA 5D2AA 3N9NA 1ZZCA 4IV3C 1UU4A 5FY7A 1YJKA 2HJIA 5IT6A 1CX1A 3NAPC 1OVPA 4DRVA 1QWRA 1S0BA 1DQ5A 2XBO1 5FBJA 1OUSA 3WZ1A 2DVAA 3MIDA 4AVSA 1TQ5A 2RE9A 3UKVA 1AR91 1N3OA 4FFGA 2ZX4A 4HFSA 3ZN5A 5FOJB 2FMDA 4L97A 4R9CA 2AR6A 4LE4A 3ZYGA 2G9FA 3EO6A 3P5BA 1JH5A 1NOVA 1JHJA 3HN1A 4E4ZA 5CISA 2UYBA 5FPXA 1HX6A 4FQ4A 1LODA 3AZZA 2F6BA 5K7PA 2WT1A 2E51A 1YYNA 2K9ZA 3IPVA 1X9TA 1L7QA 2VZTA 4LBQD 4LLFA 1KS5A 1IQDC 4RQPA 1WMXA 5C5UA 1STMA 1O91A 1XNCA 3DF0A 3MIEA 3KLSA 1QQP2 1H6YA 1RUC3 1SBDA 3JCIA 3OY8B 4MOAA 4D6QA 5LRSA 1X82A 3PURA 2PAKA 1C57A 1LOFC 4L0PA 3PTYA 4XXAA 5FZ7A 1C8NA 5GM0A 1W6MB 3SEEA 1VRH2 1IG0A 4LTAA 2WO1A 1H1IA 4Q0UA 2QQVA 1W8HA 4XW3A 4MXWA 2B39A 3NV4A 3RS6A 4HVQA 4R4ZA 3ZOIA 4U36A 4A7KA 1OOPB 2ZOEB 4W6XA 1MZ5A 4L8QA 3RYKA 3OCPA 3WVJA 4CPBA 1JN2P 2HWC3 1ZRCA 2GALA 4DXRA 1QNWA 3B9IA 3N7JA 4QXBA 4YG0A 4AAXA 1NY72 3OD4A 1PGW1 5F2WA 3U78A 2CAVA 3WNPA 3NJZA 4DEQA 5LBFA 1RTVA 2VD7A 5IAXA 5I8TA 3ZSMA 2UWBA 4AGGA 4V2VA 3N7MA 4R52A 1R091 1DIWA 4YW1A 3USSA 3ZXJA 2R6QA 3K4AA 3D8CA 2NQYA 3UK9A 2DVGA 5AVPA 1GNHA 3RZJA 2VR4A 2YDEA 1GZTA 1W06A 1VBC1 2CAUA 5JVVA 3QACA 4Q4W2 5HCFA 3VKLA 1JYIA 2GP3A 2WWUA 1MZFA 4IE0A 4LBJA 1AF9A 1BCXA 3WF1A 5F7UA 5TSWA 5F2SA 2AEYA 5HXMA 3M3OA 4LK7A 4O61A 2VW0A 3DV8A 2UWAA 1Q8VA 2IXKA 3G7DA 3PMSA 4IV1A 2GC1A 1KGYA 3N36A 2I74A 1N1YA 4XE9A 1JYXA 1U0AA 4TLGA 5DABA 3RG0A 1WA4A 1YFYA 1IPKA 1CR7A 1WLDA 2VBBA 4RS5C 2XHKA 3ZFEB 4K7JA 4QX7A 1E5HA 4EQVA 1RHI1 4FOVA 4Q8LA 1PVC3 2W2IA 3MZHA 3S5QA 1TVGA 2PHRA 5BNPB 5FZ0A 3NMBA 3ZIXA 3U1XA 2VZUA 5D1IA 3MPBA 3OUJA 1RUH2 1UY2A 3HAGA 5FZ9A 5E1RA 3PUQA 2KM2A 2FCUA 1RJ8A 3CL1A 2D6PA 1P8JA 1QEXA 1V9U1 4NO4A 3ST7A 4FPKA 3D82A 3ZFEC 4P08A 1NA1B 4P9LA 3ACGA 4ZU5A 3ZXLA 4WZCA 5JDBA 2DCKA 4QM9A 1NQDA 5T55A 4H14A 5L9BA 5BNPC 4PT6A 1W9SA 2QQJA 5C3RA 4CUCA 4DS0A 3OOXA 2VE1A 2WA4A 4LORA 1S0CA 4XF3A 1X33A 5K0UA 1LTEA 3WNLA 1Y4WA 4FTBA 3VBOB 2BNOA 4HMZA 4WVWA 1GANA 1Q56A 5FZOA 1QJY3 5FJHA 3OBZA 4DNYA 2R043 4Y1ZA 5GZDA 2IXHA 4R8HA 5G05L 2ZEZA 4BE3A 1Y9MA 3ZLIA 4AVTA 4JGZB 1QJZA 1ZRFA 4PLMA 3VBHB 3POGA 3WHUA 3BIEA 1BJQA 1YI7A 3N7LA 4FOWA 2H6CA 3GZUC 4Y5SA 5KWRA 3H1WA 4GQ7A 4JZRA 4NUBA 1IS6A 1QHDA 1U5YA 1AL21 5FDBA 3MIHA 3DKQA 4B7EA 3VBOC 1CN1A 4QU1A 4E4HA 3M3QA 4K8FA 4OULA 3ZYJB 5A32A 1OLRA 3QH6A 1MQTB 2CGOA 2QJVA 3AKRA 4JGZC 5FUPA 3VBFB 3VBHC 3PIJA 2VBPA 1UN1A 1MS4A 2Q1FA 1CAUA 3AZVA 2PHXA 3VKOA 3ZN6A 4BU2A 4CP1A 1CZVA 4OLLA 2K46A 1NE6A 4FFFA 3B7MA 2YY1A 1FAYA 1BEV2 1VBA2 1G9DA 1J1TA 5FK8A 3WP6A 1FOD2 2ZMKA 5LA0A 3B3QE 3WCRA 2W0XA 3BTXA 4D7YA 3R4SA 4FXGB 3I2KA 3WW1A 4ITCA 1ASJ2 3AL6A 1MQTC 3VBFC 4ZHNA 1DFQA 1AL0G 4XILA 2JIGA 3SXWA 5FKBA 3AJYA 3S6PA 1UD1A 1NYWA 4BYYA 5JCTA 4R9BA 1WMEA 1GMMA 1L7RA 1ZBA2 1JYVA 5KHJA 4R9DA 4FVVA 2DVBA 1HXS3 4RGAA 3ZFGB 4FPLA 2JDMA 2P3JA 4L11A 5F39A 1ZA4A 2XXZA 3H3ZA 3VB9A 4YG6A 2J7MA 2ZGUA 1CAXB 4HG6B 4XEZA 3ITQA 4LUMA 1ND2A 5KC6A 1GWKA 2YPDA 4XFFA 1HB3A 1LHNA 1R083 4R4XA 2DWRA 5A3NA 1QXRA 4GMP1 4JHZA 2GP5A 3GJBA 4N9HA 3D0JA 5DDJ3 4FO9A 3FLTA 5F6KA 1E57A 3VZMA 1GUIA 1D0HA 3WG1A 3RMYA 2NM1A 2BQPA 3ZFGC 4CRQA 2PHLA 3ES4A 2R16A 4NIIA 4PF1A 1JZ6A 4LA2A 4L99A 1H2KA 2PAEA 3EB7A 3JU9A 5K8SA 2D6NA 4Y5Z0 5LWBA 4H3WA 3VBRB 1WWYA 1ZYBA 2JJ6A 4HL0A 1F4AA 2N7GA 1RUG3 5DMYA 2OQ7A 4HONA 4XC9A 4CVUA 5EQUA 2LM3A 1G9FA 2V5DA 3WNXA 3HQRA 5FZEA 2WRAA 1NX9A 3VL8A 3KCXA 3E6DA 4ARYA 5H9QA 1EY2A 4CDXB 3LA3A 1LGNA 1ST8A 1Q8SA 2W95A 5GJ6A 4AFCA 3ILFA 5LY1A 2BP6A 2JE7A 5CB7A 3MFAA 3VBRC 4QHOA 1BMV1 5C3SA 2WSUA 2EAKA 2OYZA 2R49A 4E27A 2VCCA 4RYDA 3ASIA 4GB33 5AFEA 1UMHA 2B8MA 2Y64A 5EZWA 1W6QB 4YW3A 4DRRA 2LS6A 4M3CF 1RVF1 4GA9A 1RMU3 5FJKA 1LCLA 3J8F1 1BBT1 3MW4A 5EP9A 4CDXC 2AZ5A 3WV6A 3ZXAC 4CE8A 1TME1 1D4M2 1Z7S3 3GGLA 1L7LA 3I59B 4H2AA 4QPGC 3VBSB 3E6CC 2XONA 3O1UA 4UI9L 1RXFA 1C3HA 3KF3A 1RUD2 1M4WA 5LB6A 5AC92 3W5MA 4QGNA 4B8EA 3V0AA 3KGZA 1N3PA 4JDNA 4XABA 1QJU3 4XMAA 4YWAA 3HNYM 1GZCA 2WLPA 4FTSA 2V73A 3P3PA 1NCQA 4V2WA 2Q8OA 2VG9A 2VJXA 4MLOA 1LOCA 3B02A 4AEDB 2VULA 3VBSC 3FX3A 4NJ4A 3UKNA 3O1RA 1CESA 3KV5A 3PU8A 1V6NA 3LEKA 4I0AA 2HEYF 3POWA 4LNVA 1DYOA 1VR3A 4QX2A 3VKNA 3ZKUA 1QU0A 1VAVA 4ISRA 3WX5A 1ALYA 3FFZA 4ES8A 5AFBA 2ZCWA 1O59A 4QQHA 2YBSA 1Y9QA 1FMD3 1LHUA 4YZ1A 4AEDC 3IT8A 3U10A 5GLUA 3MEPA 3SQOA 2OS2A 3V0BA 3USUB 1PO23 1ZBE2 4LBMA 3UETA 5F6LB 1SLBA 3JD71 3THTA 4TLFA 4OHYA 5DZGA 1QH7A 4M01A 5ISLA 4XJWA 1QOOA 1UYPA 2B7YA 3RI9A 3MUY1 4M3CE 1VAKA 1YQ5A 2NMNA 2WZR1 3FLRA 2WUHA 2YFZA 1I5ZA 1WA6X 4AZZA 2RMU2 1XBFA 3IAPA 2IWGB 4NMIA 5FYBA 2X5IB 4MO3M 1XB9A 5JXGA 1JU3A 2ZX1A 2JDHA 3HEIA 3WINE 5IK5A 1JODA 1GQGA 1MVQA 2CTVA 4AHZA 4EN6B 1UZZA 1GNZA 1RGSA 3C7HA 5C9AB 1OF3A 1YIFA 2K0GA 4WM8C 3AVRA 2XUMA 3BI3A 4F7ZA 4WV8A 4XCBA 1HN1A 3IMMA 4OHZA 1GU3A 1OHFA 4Q4Y3 5DAPA 2X5IC 2DVFA 4OFGA 4QX1A 3C7FA 4Y22B 1KRIA 1AR62 2P6HA 3POEA 3WDWA 5ANNA 3T4HB 4FXKB 5ACA2 4OI0A 1I1EA 3NKGA 3D0SA 2Z5WA 3OBAA 4QQPA 2P3IA 5C9AC 4CDQC 4XYXA 2XBO3 1UAIA 1XU2A 3TRSB 4JRAA 4YGEA 2XJTA 1ZZ9A 3O0XA 4INDA 4WVZA 1ZA7A 4L9BA 1A34A 3UNPA 1GOHA 2XUEA 3POBA 4YLZA 1D4VB 1AJOA 3CJIA 3SH3A 1G86A 4YGCA 4FTEA 5A7SA 4BQ1A 1LGCA 1SPPB 3KB5A 2R1BA 3CIHA 1OD5A 2A6ZA 3FUOA 2VC9A 3POIA 1FV2A 1I9RA 5EXOA 3ORJA 4CDWA 2PFWA 1HIXA 2WYFA 4TN7A 5FYCA 1ZZBA 4URAA 1F5JA 3IWZA 1XOYA 3EBRA 4D0QA 2R072 3J9SA 3UYJA 3AYEA 4EE2A 1RUF2 1COV1 1W39A 3ZN4A 3M7AA 1YEWA 3BGAA 4KU7A 1OBNA 2A5ZA 3W58A 4X8PA 1JZ2A 3AZYA 1B09A 5KHGA 2YHJA 2XHNA 4XUQA 1SBEA 1T6GC 5JR7B 2FDKA 2HLEA 1LULA 1X8MA 1H4GA 5DPNA 2HH9A 3OGGA 3DL3A 3VN4A 4QGMA 3EJKA 5FXVA 4AI0A 5EWSA 1IS5A 5CFCB 1RJ7A 3BN6A 3SNMA 3T2TA 4QGLA 4P5YA 3MV01 4E8DA 4K21A 4BOWA 1OQEA 3INAA 5FZ3A 1WMDA 3KQ4B 4XAAA 1GNYA 4Z82A 1VBB3 4EWDA 1QJX1 1WBLA 2PHFA 4O9GA 3C7OA 3ACLA 1D2SA 2YG0A 1R093 4EYUA 3GYDA 4S2HA 1J1LA 4UW5A 4Y20A 3BOPA 4QXHA 5CFCC 2C4XA 1I3HA 1VBC3 5J37A 1K45A 5FP8A 4AAPA 5JPMB 1UYYA 5CG9A 1XNBA 4XF1A 2P34A 4CEWA 2J1EA 4XBQA 4W8JA 4KWJA 3T3YA 2VL4A 5LEJA 2WO7A 1JTZX 2HWB2 2VAUA 1ZVFA 2P4EA 3FC0A 4CXXA 1UZ0A 4YVWB 4N53A 1FPN2 2YC0A 3PVOA 4FCAA 1AR82 4ZXEA 1BZWA 1HRV2 2VGDA 3MICA 4NPRA 3OGSA 4WVMB 1RHI3 3UGHA 5F5IA 4HVOA 4HOOA 2H6BA 4KMQA 1U5XA 2B9VA 3ILNA 2XJQA 3OYWA 1HJGA 3N9OA 1NLSA 4KWKA 4XOGA 3NKTA 4BDVB 5A33B 3TB0A 4CCCA 4YVWC 1G9AA 2XGXA 3R4UA 5FYHA 2YXSA 1EPWA 2Y34A 1MS8A 1OA3A 2A75A 5A80A 4E2GA 4Y4RA 1A6CA 1TMF2 1GV9A 2JB4A 3IIAA 2C24A 5BNNA 4TYSA 1YQ2A 2BZDA 2W91A 4DXZA 3ZMNA 2DFCA 4IUGA 3TOJA 1NCRA 1V6JA 1EYBA 2VMFA 3WNMA 4BJ0A 3EMRA 5SV8A 2JG9A 3VBUA 2P17A 1ZZ7A 5JMOA 2J42A 4WBBA 4IEUA 1NZCA 2R30A 2UY9A 4LK6A 3SC7X 3WNNA 3MGUA 1CAVB 4NIGA 1SLIA 2ES3A 1AR71 1SLTA 2Y6KA 2XVGA 3PVNA 4CCOA 3ACIA 3AZWA 1DZRA 2VMGA 4LO5B 4Z07A 2ETEA 1YQ8A 4D69A 2E9QA 3I3EA 3WP5A 3ZSLA 3DN7A 4NROA 1I6XA 3RZHA 4CUBA 4AHXA 3D6EA 5J1XA 5JWPA 1SQ4A 4JCKA 2JDKA 4IGOA 1VIWB 1A8MA 4LHKA 1S55A 4PI2A 4CTEA 2WKKA 1JXNA 4GWJA 1VAMA 5C3QA 1QMJA 3G6JB 3VDBA 5T52A 3DECA 4P14A 3ME2A 3ZSKA 4CCJA 4ORFA 1OXCA 4S2FA 4KBBA 1QDOA 4AVBA 2VNVA 1WLWA 1EAH2 1WCUA 3RI8A 1QQP1 5FWEA 2TNFA 4LBQA 1BQPA 5JXJA 1FNYA 1FNZA 4OYUA 4O65A 3O12A 2DTYA 1VRH1 1SBFA 2EXIA 4UBHA 2QE3A 1RUC2 4N43A 2EIGA 1FI2A 4BZ4A 5DG1A 2IXCA 3KCYA 1IPSA 2DUQA 2QVSB 2PN5A 4EN0A 1FXZA 1V6LA 2WLQA 3U4XA 4ATEA 2QQPA 1ZNPA 2HWD3 2JD9A 4YM1A 1Q8OA 1WW5A 3T4VA 3MPPG 1S0IA 2RDNA 2ADEA 2YYOA 4RA0A 5D8AB 1XYNA 5C3PA 1G8WA 1NY71 3V65A 4A6SA 1UXXX 1CAWA 3CNAA 2Q30A 4RFT0 4GMP3 3T2OA 2HWC2 3OUHA 1OI6A 3H3UA 1CIYA 3I97A 2Z42A 3WOGA 1ULCA 3U75A 1NQJA 1SACA 3AMQA 4Q0VA 1LEMA 5KXBA 2LW8A 2VNOA 2RM21 1X8EA 1JBCA 4J6GA 4CUAA 5C8CB 4E8CA 1W6OB 1ODNA 5FPUA 4Y3OA 3M2MA 3H1MA 4IV1B 4GH4B 3X29B 3BPZA 5D8AC 5C8WA 4UW4A 4AR2A 2I2SA 4Q4W1 4YW7A 5L9RA 3I2DA 3WQ7A 2O14A 4BMEA 3CDZB 4A4AA 2XJPA 4CCDA 5A6QA 3HMYA 5LA1A 5E6HA 3LAGA 1YO8A 4L92A 4Y5TA 5F5AA 4M3CA 3AM2A 4NWWA 5C8CC 4UF0B 4QDSA 2FDHA 4JHTA 1MS5A 2E32A 3J7MA 3GJAA 2D97A 4IV1C 4GH4C 4RGKA 1JOJA 1XNAA 4AXOA 1VBD2 3DXTA 4NHLA 5BNQA 2ZGQA 3TWIA 4MV2A 5HPOA 4QX5A 5JSRA 4BXFA 3R6SA 4KH9A 5IJRA 4Y1VA 3PNAA 3E5XA 1DP0A 1ZRRA 1S0JA 2BFUS 3ACFA 5FYSA 5A3TA 4DUXA 3U07A 2NP0A 1EV13 4LIVA 1RVF3 3ZYPA 4JKKA 1YRZA 3V64A 3J8F3 2AGSA 1GZWA 5EFUA 1RUH1 3TNQA 4C1WA 1W9FA 3LDKA 4GZ9A 1PVC2 5F3GA 1HRI3 1K5MB 1TME3 3KT4A 3F2ZA 4LLOA 5JI9A 5LCWL 5LEKA 2D6OX 4ET7A 5JOYA 1S2KA 4BK4A 3O0WA 2G9GA 1SLAA 4TZDA 5FZOB 1V6IA 2W46A 4IGPA 4XFCA 5T3NA 2W1QA 4JC1A 1O5LA 3T09A 4F3JA 1GFF2 1F5FA 1JS9A 1XC6A 1MEC1 3MFCA 4C0HA 2JKBA 1PMIA 1WD3A 4ZONA 3MF6A 1PK6B 1UOJA 5IVCA 1CVNA 4AVCA 1GZ9A 1K5MC 2EXJA 5CIRA 4ZXKA 1ONAA 4HKOA 3OEBA 3LF7A 1PVXA 3FUQA 5IVEA 4YGBA 5K0UC 3SCHA 4MADA 5L73A 4XIKA 1F9KA 2DVDA 3LQCA 3M3CA 1XPWA 4XPVA 4BQ2A 3ZYBA 1C28A 2VZRA 3LB9A 2TEPA 5FLHA 1PK6C 3AP4A 5IWFA 1CAUB 2ZMLA 3O14A 4IL7A 4N8MA 1DU3D 2E31A 2I07B 4CP2A 3W21A 1SCSA 3KVBA 4FI9A 2ARAA 3ZXGA 2PQSA 2A6XA 5FPAA 3KM5A 4KGGA 1H1AA 2BWAA 2NLRA 1CQ9A 4XETA 2WAOA 4BB3A 2WS91 1HW5A 5DXDA 2BWCA 3KV6A 1QY4A 2WFF1 4BXSV 5KR7A 1OA2A 1POV1 1G9BA 2ZGRA 2QNKA 1KFXL 3LFIA 4C0BA 1UU5A 3NQHA 2ZAHA 4CA9A 3I54A 5A1FA 3W20A 2B9UA 2JDZA 4RN5A 1DQ6A 3TBDA 5A3OA 1VMHA 2ZBJA 4AOCA 1UPSA 1W6NB 2ZEWA 2VZSA 1SHWB 5FQ0A 2D40A 3AK0A 4CU7A 4CP9A 3SHRA 3N9PA 2EIBA 3VD4A 1U12A 2QQOA 4JRLA 1ZBA1 1KJRA 3EXUA 2W68A 4XACA 5GZFA 1B35A 1OA4A 2AREA 2L9LA 1REDA 3C2UA 3OD0A 2LRPA 1HB1A 4MHRA 4YM2A 3PTRB 4EN8B 2Y6GA 4A6OA 3MLJA 5FYYA 3GCWA 3BB6A 5IATA 3MIBA 3VD7A 3DKWA 3MIFA 2VW2A 4BHPA 1DGWA 3AMHA 1BVVA 3OSDA 3U11A 1HXS2 4JQRA 4YVSA 4DXSA 1QOTA 4ES9A 3ZO0B 3WD5A 4PHZA 1KDKA 2VUAA 1ENXA 5FZMA 4CEYA 1J3QA 1S0GA 1M06G 5F5QA 2W3JA 3MYXA 4NHMA 1OUXA 3GNEA 4NIDA 5F32A 1R082 1CIWA 3ZMOA 4ZU4A 2YUEA 4CYDA 5FV3A 1DF0A 4AI2A 3DUIA 1GOGA 1NXD1 1RUI1 1XNKA 5LY2A 1UF2C 4YW4A 3WUDA 4HPKA 2O1QA 3I2GA 3JQWA 4YNIA 2XR4A 2ZHNA 5HXVA 4UW6A 4P9YA 5A7WB 2W1WA 3U0ZA 2VUCA 1UQXA 2BJSA 4IQPA 2OX0A 3FHAA 5FZ1A 4OZXA 2HBTA 5FRAA 1U5IA 5J48A 3BU0A 4P9XA 1GQHA 4META 1COV3 1RUG2 4OUEA 5D21A 5JXHA 3LOIA 2ZHMA 5HV4A 5B4NA 4RS5B 4NAMA 2JXAA 3KVAA 1ZZ6A 2J1RA 3AFGA 3HVDA 3M4FA 2XVLA 1UY3A 5EYYA 3ZR6A 3H3LA 4QX8A 2WIIB 4OI1A 1L3JA 5LA9A 2H0VA 2R063 4IEXA 3CHXA 4AFAA 1LR5A 1IKPA 4UT5A 2ZEXA 2CWSA 4AFMA 1O5UA 4GB32 1H0BA 1D4M1 2XWJB 4YYOA 4YW5A 1DZQA 1DYKA 2WNEA 1QJX3 2XKOA 2EF6A 5J7MA 5BYNA 3SEPA 3ZX7A 4LHSA 1KITA 1RUD1 2VNGA 1UU6A 3NNFA 4Q1PA 1Z7S2 5AC91 4HLTA 1R64A 1X50A 4KQ7A 4I0WB 4PDWB 2UWCA 3TNPB 2RS33 3BKZA 1V6MA 1AXYA 2CU5A 5I0RA 4LUKA 5B2GB 4URTA 3T2PA 3ZYHA 4SLIA 1QJU2 3GCXA 3WG2A 5A70A 1R1A1 3AYAA 5ABJB 2WNUA 2IC1A 1RUJ1 1YC61 5F8PA 3OPWA 2V09A 3MW2A 4I3PA 4Q27A 5FMDA 1QJEA 1YQCA 4PDWC 5HCHA 4CU9A 4MYEA 3GHNA 2A6YA 1JZ3A 1Z0HA 2D98A 2GN7A 2XMLA 4K6BA 3JZVA 1W9YA 1UZWA 2ZTNA 3WT3A 3LPGA 2DCZA 2Q1ZB 3KZ4C 3Q8BA 4A3ZA 5ABJC 3C7GA 5CVRA 2WQ4A 3ETQA 1JUHA 4XJ8A 1SFYA 1ZBE1 4BLJA 3WY6A 1LEDA 1RUE3 1OPOA 3GBGA 3TN92 1HQNA 2D93A 1YFUA 1WMFA 4ZU7A 5JUVA 1YIPA 1PO11 1YHFA 1RIRA 2Q1MA 3ETPA 3EYPA 3NNLA 1PO22 2WABA 4ONUA 4A42A 4FAGA 1DGRN 2FCTA 4H7LA 4YG3A 3S7IA 4CUGA 5F3EA 4HVRA 2RR13 3I8TA 3ZM8A 4Q8KA 3FMGA 4OHWA 1V6OA 3VZLA 3WW4A 1F35A 2RMU1 1K5JA 2VO5A 2VECA 4AVVA 4Z2WA 4A44A 2WBKA 3CEWA 4P9GA 4J25A 1ND3A 1O3QA 1C5IA 5CG8A 1LAJA 4KG0A 1XSQA 3E97A 3ZYIB 2FZ1A 3SH5A 2J1UA 3HWJA 3AXEA 3BU7A 2HEWF 2WWSA 3ZVXA 2JDUA 1AR61 4AWDA 2PLV3 4H7MA 1OKOA 5IHRA 4GMP0 1H6XA 2D3SA 1ENQA 4Q4Y2 5CADA 4M00A 3SLIA 1JYTA 4IV3A 3IZOA 3UV9A 1GOFA 3CJIB 1QKQA 3CQOA 3NAPA 2E6VA 4ZZ8A 1UKGA 5IVVA 3E1F1 3WF0A 4QQLA 3RWNA 3VUOA 2XBO2 4TSVA 1N1TA 4Y33A 1H4HA 4LT5A 3OGRA 5DN2A 3AYDA 5FKCA 4B1LA 3J7NA 1LKNA 2SLIA 4FAHA 1DLLA 2UU8A 3UT0A 3CJIC 4XJZA 4QKFA 3NJYA 1RB8G 2GN3A 4QDQA 3PVBB 2RG4A 5FYVA 4NAOA 2B42B 3AC0A 2QQUA 4XDOA 2VZOA 5FLJA 1MS0A 2OXBA 1EPZA 2R071 3BTAA 2CDPA 4LJHA 4DOUA 5F3CA 5JOZA 3MUZ1 3T2QA 1VRH3 3KF5A 2A7AA 1LOFA 3ZFFA 3THCA 4Z1VA 2G1MA 4Q4X3 5KBFA 2OUJA 4KU8A 1QNYA 4XUPA 2LALA 3QLQA 5JIAA 3GBFA 2XOMA 2BBAA 3PHMA 2E7QA 4AI3A 1PIV3 2NMOA 2OT7A 3H1YA 4PLNA 1WLTA 4RSUA 1WCDJ 4FBFA 3HD8B 4Z2AA 5FZIA 4XF0A 3T0BA 5I91A 3OY8A 1OFSA 1MZEA 3FLPA 5EPAA 4QPGB 2TBVA 1V70A 1YI9A 1IZ3A 1W6MA 1YUDA 3DPRB 4LKEA 2V4AA 4ATFA 1AVBA 5JZGB 1UX7A 3MDPA 4AK3A 4Z92B 2JWPA 4BPZA 5FWJA 3OPZA 4AGRA 1F31A 3THPA 3WDXA 2QQKA 2X09A 2RM23 3P3NA 5HV0A 2XG3A 1OOPA 1VBB2 1W0OA 3RNSA 3SITA 5KC5A 2SBAA 5GLWA 4NR1A 5FY5A 4W50A 5HBAA 3PDQA 2HWE2 2NZ9A 2ZGNA 2QTWB 3QOPA 4E9KA 2ZGPA 2DTWA 3Q8CA 4QB1A 3DPRC 5JZGC 2VMHA 3ZXEA 1URXA 2WZEA 2P3YA 5A6XA 1VBC2 2EIEA 5C4WB 1REFA 1TE1B 2ENRA 1SCRA 3I3QA 4CEWC 3Q8AA 5FIXA 1E5SA 2HWB1 4AQ2A 1N47A 3AZXA 1PNFA 3WUCA 2RS11 1XYOA 4K40A 2OUHA 4QX3A 1HV0A 2DCYA 3ON7A 1FPN1 2PQQA 3LKJA 5CBLA 1C8M1 3K46A 1RITA 1HRV1 4UAPA 2EXKA 1YFXA 1F8VA 4QB6A 2A3YA 2VVEA 5E16A 1A8DA 5T5JA 1QDCA 2PELA 3JQXA 5GZEA 1UIJA 1GP6A 4YSFA 4S2GA 5C4WC 1KS4A 4IEQA 2CSGA 5DAXA 3S7EA 1JYWA 2Y33A 2RV9A 1RUH3 2RJ2A 1RHI2 1J59A 2W52A 2E53A 1VBE1 3ENRA 2VQ0A 3AX4A 4D6RA 1XNTA 4COWA 3RZZA 2VM9A 1OQDA 1C5HA 3ZYRA 1S2EA 1AX2A 1CJPA 1VB4A 1W2TA 1RC6A 5IUQA 1TMF1 3ZFEA 3VL9A 2R0FA 3EQEA 3FN9A 1MEC3 5LBCA 3WNKA 4RR3B 5L19A 3BVCA 1Y7BA 2B46X 4F8AA 1ENSA 1MACA 4TTGA 4WM8B 3OGVA 4QT6A 2VVDA 4QKBA 5EJ3A 5LASA 3FHIB 3KMHA 3Q9OA 3C7EA 1PM7A 4OVEA 2JENA 1NA1A 1UWWA 1W8WA 4IE6A 4FPJA 1LOEA 3PUSA 2GAUA 3O7OA 4QXCA 4RR3C 4LHNA 4PI0A 3IAQA 2BOIA 4UBGA 5J98B 4YW6A 1H9PA 2Q5TA 3OJBA 5EJZB 2C9AA 1J58A 4FPYA 4CDQB 3VZNA 1AYN2 3B01A 4HBNA 1CJDA 3VBOA 5C70A 3MLLA 3NO8A 3B9CA 5JMCA 2XVKA 3LGRA 3UJQA 2IXJA 1W6PB 2WS93 1Q8QA 2ZEYA 2EAAA 1W90A 4QD2A 4NE9A 5FZGA 4Y4YA 4JGZA 2DV9A 2WFF3 3VBHA 2XDVA 4RGGA 1W05A 1CD3G 2H0BA 5A3MA 2R0HA 2E63A 4Q0QA 1GKBA 1H1MA 4LIUA 3JBG1 1FT9A 3KWVA 1EAH1 1QF3A 2IXLA 4ASMB 1LENA 3CU7A 1G9CA 2MEV2 1AR93 4COZA 4OQ8A 3NV2A 2X10A 5T54A 5FMOS 2RJKA 4XMIA 1MQTA 3B93A 3VBFA 2BVVA 1R1ZA 5I8YA 2ZA9A 5CFDB 1RUC1 3AVSA 4D7TA 2NN8A 1ULEA 5FMBA 4N43C 1ZREA 3PJQA 3RWKX 3WDYA 1CX4A 3LZZA 1WW6A 1JOBA 5BPXA 2VZVA 2OIIA 2Q8DA 2WNVB 4WM7B 2DURA 3VV1A 3PL0A 1Z78A 2WDBA 1DQ4A 5IK4A 4Q4V1 4FPEA 1Q3EA 2HWD2 5I0UA 3WNOA 2BYVE 5LZ6A 5CFDC 3VZKA 1ULDA 4QPIB 1XYPA 1W28A 2JG8A 2PMWB 4Z8BA 1NE4A 3DCQA 1F4HA 4FP2A 2GNTA 2PXJA 4I0BA 4CCLA 1MS1A 4E4DX 3PJYA 4IGQA 4OUMA 2QCSB 3ZFGA 5JSPA 4MG2A 1RUI3 2WNVC 4WM7C 4B1MA 2VOKA 1CAXA 1US3A 3NJXA 4HANA 4I01A 3RQ0A 1PMHX 3K2OA 2CHHA 1SLLA 4QPIC 3OGJA 3WW3A 1AYM1 2VXRA 3BTYA 5IVJA 2UY8A 4LBNA 1F15A 4MXVA 3H8XA 1Y9GA 2XJUA 5G04L 2BUKA 2RS52 3HQXA 2EALA 1VBD1 3MI8A 5EIYB 3PVEA 2KD7A 5KXEA 2DCJA 3S5AA 2ZZQA 4FT8A 2GZWA 3VBRA 4Q26A 4GIQA 1PX3A 1D7PM 4LKFA 1PX4A 2IXIA 1I5PA 4HETA 2J1TA 4O9EA 3FBYA 2A71A 1OVSA 1D4M3 1EV12 1LJ7A 4FOQA 3T0AA 1PGL1 1RVF2 1LGBA 4G3YC 4AQ6A 1GLHA 3J8F2 3B5LB 2XLGA 5FO9B 1NZIA 2P3KA 2YROA 1CGPA 1HRI2 1T6BX 2I45A 4MZUA 4QKNA 1A78A 5JIUA 2R1DA 3I2OA 1UKRA 4P9IA 5H9SA 2VQTA 4XTMA 1W6QA 1O6UA 2HWF1 1WKYA 2YMZA 2QZ2A 4OHVA 2WQZC 5I8SA 4DZGA 2B4KA 2ILMA 1V9U3 2P37A 1YFWA 2DYCA 3B94A 4ISQA 4N90A 4XQWA 1R1A3 3A0NA 1H8TA 4XJAA 1TG7A 1EP0A 1POQA 3M3IA 2JDAA 3I59A 3VBSA 3BPSA 1RUJ3 3MO4A 5LBBA 4QX0A 3NRUA 5FUNA 1VMJA 2AUYA 1OKQA 4BQXA 2YB7A 4X6RB 3T1MA 1CPNA 2DBIA 4BQWA 5DZFA 1YJLA 1OSGA 3RZLA 1VLNA 2GC2A 4AEDA 4KGQA 4MGZE 2G4IA 2GSYA 2WQ8A 4OQ9A 3O1PA 1CZTA 1OFNA 1ZBE3 1OLME 1HLCA 4K8RB 4RHV1 3AKQA 3ES1A 3SKJE 1PO13 3VDAA 1QXPA 2ZABA 4ZS2A 3GF6A 4B4QA 4EZ4A 1AL23 1AXZA 5FZCA 2PA7A 4QPWA 2FDGA 2AEZA 2OA2A 2CYFA 1YCIA 3T08A 1QIQA 2ATFA 3IPVB 2VTFA 4CCMA 4RQPB 4LITA 1PZ9A 2JKXA 4DUWA 2ORZA 5I0TA 2C26A 1W03A 4AF9A 2VOVA 1W8ZA 3HT1A 3I2IA 1K42A 1XJAA 1PNGA 2GMEA 5FTTC 3ZIWA 1H2NA 4PIYA 4XUTA 2VCBA 4QKDA 3D4KA 4MXWB 4I02A 4XBNA 3N9MA 4RQPC 5KHIA 2E7AA 3IM0A 5BUVA 3WP3A 1ZRIA 3RYRA 2X5IA 5DUWA 1LRHA 2WN3A 2ZGSA 1BHGA 4NRQA 2Y6FA 4NRMA 2YPJA 4QMAA 2FHRA 4YVSC 3JB4C 4LMFA 2OVUA 5C9AA 1ENRA 1QXJA 2MHFA 5ERLA 4B4RA 3DEMA 2W9XA 3NVCA 5FZBA 3KSCA 2HYKA 4PCRA 4RFRB 1ACCA 3LA7A 1TNRA 3PLQA 5BNOA 3BALA 3VDDA 2A1XA 4D7SA 4FQZA 3QH7A 2IUWA 4Y22A 5BXXA 5T5OA 1JW6A 2GMMA 1YXWA 1V00A 2K2SA 4MGTA 1RL3A 4BWOA 2RVAA 4LR4A 3WF4A 2F4PA 3VKMA 2JIJA 2UURA 1IOAA 3WCSA 3UGGA 3KS7A 4YPJA 2GU9A 5LRRA 4BLIA 4E4SA 2VCMA 5JR2A 4HKLA 3KCCA 4AEJA 4XFBA 4AHYA 2QQMA 4TXWA 4W6YA 2DF7A 2JDYA 5FFOC 5J96B 3NJVA 1VALA 3FHQA 4C90A 2Q4SA 5J3UA 2Y38A 2XLFA 2B5HA 4CU8A 1ZRDA 3IKWA 5FYTA 4QQ2A 1COV2 5A3WA 2CGPA 4MX3A 3AMPA 5C3OA 2JEMA 1SPPA 3APBA 3M70A 3MLKA 4JAAA 1ULFA 3LWCA 2VOWA 2YU2A 2BGOA 1JUIA 2HEVF 1RXGA 4FSJA 1GWMA 1W9WA 2VH9A 3RZMA 2KXLA 4AFBA 4Y1YA 2A3WA 4JKMA 4XFHA 2ADDA 4GJYA 4CDUA 5JXIA 5K9YA 4GB31 4DXTA 2FDFA 2V4VA 3PMEA 2FMYA 2YV8A 2R062 4H55A 2JD4A 2EICA 3GXUA 1CPMA 1W99A 2DBNA 3WQ1A 2OQ6A 5E8AA 5FZ4A 4XDPA 5FZAA 4YGDA 5IYYA 3P6BA 1JMUB 3D5OA 4IETA 1C1LA 1PZ7A 1QJX2 1W8FA 4NOTA 3S30A 4Y24A 1CONA 1BBT3 5B4XA 1JZ7A 3WDTA 4IEZA 3N7KA 4FFIA 3VHRA 2YU1A 4XDQA 3W5NA 1AZDA 3LDRA 4GWMA 1QJU1 2PYTA 4JTOA 2RS32 4LKDA 3ZPYA 5K0UB 4UFKA 2EXHA 1XE0A 3J7LA 4LEJA 1DGWX 1QH6A 2BTVC 2TUNA 2ZHLA 5A7NA 4OI2A 2NPIA 5FO8B 2PHUA 1US2A 4UYBA 3I49A 1VP6A 4AGVA 2ZJCA 5FP7A 5A3LA 2YC4A 4AYUA 3LDBA 3I7DA 2RS13 4NHXA 4GULA 3LA2A 2XJRA 2QQLA 1S0FA 2GNBA 3BTZA 2Y8KA 1C8M3 4P02B 2ZHKA 3GZAA 3O0VA 3HBZA 2VMIA 4JX0A 1DDLA 3A4UA 3N35A 5DQ0A 4COVA 5DZEA 4UFJA 5A32B 1QJY2 3TN91 4A2UA 2DCTA 2X29A 4N9IA 2R042 3LCPA 1U5ZA 1VBE3 2W1SA 3RMXA 2BRTA 4FPGA 4AL9A 3K4DA 3ROUA 3UL2A 2VMEA 4IW3A 3ZN6B 1RUE2 2D44A 2OPKA 3BCWA 2DUPA 4AFDA 4AG4A 3WEZA 4Q0SA 5HCAA 1UYXA 2WWJA 2WZ8A 4WVMA 1RUOA 1LOBA 3JD73 4NWVA 1HDKA 1Y3TA 2WN2A 1H30A 1ZZ8A 2FD8A 2RR12 3OUIA 3E5QA 4EJRA 2OPWA 4COYA 5FR3A 2WZR3 4XHXA 2BW8A 1LU1A 2VTXJ 1XSRA 3AXDA 2PAMA 5A33A 3VHPA 4IEPA 4BQ3A 1BEV1 1VBA1 1O7FA 1WCSA 4QXKA 3K3NA 2X05A 4AEMA 4AVAA 1FOD1 3ZXFA 1SEFA 1MZ6A 4LE3A 4LO7A 2Y0IA 5C71A 3IDAA 3H9AA 2ZGMA 1ASJ1 5IAVA 4JGYA 5I0DA 3GHMA 4FP3A 3K75B 2BFUL 3E6BA 2BERA 3OTFA 4K3UA 1ND2B 4Q4Y1 5JI7A 2LTNA 2VOXA 4X8NA 3RZKA 2PLV2 5KHHA 2JDPA 1OPMA 1CAVA 1OT5A 4YZ4A 4AI8A 4DEVA 3IDEA 2X53S 1HQWA 5I0SA 3RGBA 5FZLA 3RVHA 4OUSA 1T2XA 2E26A 3WQ0A 1DLCA 1GQPA 3IDBB 4XIOA 4YARA 3O1SA 3ZFFB 1ND2C 2HYXA 3IN9A 3R0RA 5C7GA 3THDA 3ZKYA 3JBG3 4CCKA 1NLRA 1OD3A 1W3VA 4KWUA 1EAH3 5FBZA 5FO7B 3RDIA 4BK5A 4YFZA 1OH4A 1DG6A 1FX5A 1WUVA 3JUUA 4J1XA 2VVFA 5HI0A 2CNAA 1O4YA 3LOBA 4BQYA 5FP3A 1DBNA 5M0TA 2JDNA 5DDJ2 3O1MA 4Q1RA 1UW8A 1FYUA 2DU0A 3BOWA 1UOBA 4NN0A 3VZJA 2ZX3A 5FP9A 2BV4A 1VRBA 2WR9A 2P5BA 3VHOA 3ZFFC 2FZ2A 3L2HA 4K9SA 5FZFA 2ZGLA 3AMMA 4CCNA 1W2OA 3VD5A 4Q4X2 4A41A 2ID4A 4KNCA 1PHMA 5IFPA 1UZVA 2A73B 3ACHA 3OBTA 1AX1A 3WG3A 1CZSA 4Q4V3 5KHKA 1PIV2 1SZBA 1F2NA 4HXCA 3IB3A 2XLAA 1HB4A 2Y6JA 3POYA 3AFKA 4FPCA 3BUCA 5FY4A 3UGFA 4XAEA 3NSTA 4W6WA 2XB6C 4QM8A 3RFRA 2ET1A 4TWTA 5FOBB 1WW7A 1NT0A 2ZXQA 1OURA 4P9WA 4X6QB 4YZ2A 3W59A 1VBB1 4AI1A 2AC1A 3V0AB 1HJFA 1WZXA 1OOPC 2W92A 2HWE1 4COUA 2QFEA 2RM22 1OLMA 5D8AA 1NCQB 1AYM3 1RMU2 4BISA 4A3XA 4D6SA 1D2QA 2C5DA 4PBPA 3POSA 3I2HA 5FZ8A 3I4IA 1WD4A 1W0NA 2W87A 3WHTA 5JAXA 2D3RA 4YW2A 2J1SA 1NUKA 3M3EA 2BDRA 2R7EB 4B4PA 3TEZA 3KV9A 5C8CA 1W6OA 1VBD3 2GC0A 2OZ6A 3LEMA 4GH4A 2ZZJA 3P1IA 3ZXKA 3AP6A 1NCQC 1MPXA 5DUUA 4UXAA 3WDVA 4DFSA 5A7PA 2A6VA 3U4SA 2VNRA 4QAWA 1LECA 2WFPA 3V0BB 2R32A 1DGRA 3DYMA 1OH3A 4ASLA 1N1SA 2WO2A 3H7YA 2J1VA 1UPIA 2O0OA 4UOJA 4BCUA 4DY3A 3RZGA 2KA3A 4UF0A 1A3KA 4XJUA 1WLCA 5CKMA 3ZSJA 4ZZ5A 3CJXA 4N7UA 1MS3A 1MVEA 1UX6A 1W8NA 3HOBA 4B3NA 4CP0A 1OQ1A 3HPNA 3O1TA 5CU1A 1KEXA 2DDUA 1RUNA 3FFQA 4C91A 1NAEA 4OHXA 1FMD2 1Q43A 4MVTA 3ABZA 5J09A 4JQTA 4K1YA 2J1AA 2HWF3 1FATA 2ARXA 2AACA 2P1BA 3DYPA 4B7KA 3WG4A 4DINB 2ZKNA 4YRDA 1MEC2 3C3VA 3T0DA 1K5MA 3TEXA 2QZ3A 3IMNA 5LATA 3HQUA 5E88A 2OW4A 1SDWA 4YM3A 1NLQA 4E2SA 2CL2A 2P6CA 2ZPXA 5T50A 3SCGA 2VUJA 1Q5OA 3A23A 3T1LA 3N9QA 1NA1C 1VE0A 5C6CA 1IHMA 1VMFA 2D3PA 4JV4A 1UNBA 1C1FA 3GM8A 4Q5OA 4YM0A 1PK6A 2ZMNA 2ZGKA 3GBWA 3IDCB 4FPHA 5A7OA 4BMBA 4BA6A 1AYN1 1ZM1A 2VUDA 3VD9A 1AR73 4DO0A 5FAXA 5I93A 5T5LA 2F4LA 2CWMA 1AJKA 1QJFA 4GALA 3A0KA 4RHV3 1AHSA 2FCVA 3CLPA 3WSOA 5DAVA 1JU4A 4NIAA 5DAWA 1SDDB 5ACA1 3O1VA 1JHNA 1UMZA 2VZ3A 1BXHA 5CEHA 1O8SA 2WS92 3LEIA 2XWBB 2W39A 2GH8A 1KDMA 1MR5A 2WFF2 1W8OA 1JZ4A 1W0PA 3AJZA 2MEV1 2VZPA 3HIFA 1IKQA 3W9AA 4CDWB 1BK0A 2WA3A 4A7YA 2LROA 5L36A 4LBOA 4MGSA 1O8PA 5SV5A 1AR92 2QQWA 4HT1T 3F95A 3HNBM 4OMCA 5DUXA 3VD3A 3WF3A 4AI9A 3H0OA 3KGLA 1BLZA 4J1WA 1OMIA 1UY4A 1APNA 2J22A 2IZWA 3GALA 3KHBA 4EN7B 1REEA 2G9ZA 2JG8B 2WL1A 1KD7A 1QQP3 4LA3A 3TYJA 4CCEA 4XTPA 4CDWC 3NV1A 4GXLA 5FK7A 1GSLA 4OZOA 1RUF1 2VQAA 2CY6A 1W6NA 2HWD1 2VZ1A 3Q8EA 2RJLA 5IW0A 1IS4A 5IK7A 2VOTA 3O1OA 5A3UA 2IFWA 2WC2A 4XBLA 4IDZA 1W8UA 3DXUA 3WR0A 1BVP1 4BM8A 1XXNA 2E33A 2JG8C 5CNAA 2Z79A 4CPBD 1H2MA 3QD6A 4LOTA 1IQAA 4XUNA 4QQOA 2CV6A 4Y20B 4JDOA 1UIKA 4I2OA 4QU2A 3GDBA 1OC1A 3NWKA 1RUI2 4IXLA 5FREA 4MGQA 3WDUA 2XL7A 1PGW2 5F9TA 2YZ4A 3CZJA 5FZDA 4CEWB 2ZGOA 2V72A 2A70A 1WCQA 2MPFA 4GJZA 2RS51 3KD4A 4P5HA 1R092 2D7FA 5LK7B 1LU2A 3AKTA 4Q4W3 4DMIA 3NV3A 4Y1UA 2WSVA 4N53B 5FYMA 2FBEA 2OKXA 1DQ1A 1UYZA 4GWIA 3ZXDA 2QQNA 4XFAA 5A7WA 2BGPA 2KR2A 5LW9A 4K1ZA 3L2YA 4XUOA 4M0NA 2OZJA 2PHTA 5FY9A 2YBPA 4NIHA 3MW3A 5CKNA 3OYWB 2VBDA 3AB0A 3QCWA 4KBZA 4XHBA 2Q8CA 1EV11 4FPFA 4P9JA 1AR81 4N53C 4MHUA 3H42B 4G4FA 1K12A 4LKSA 3BODA 1YNAA 2VZQA 1H8TB 4LOSA 4RS5A 1HRI1 3NW4A 5FZ6A 2HBUA 3HNMA 1UL9A 5JLVA 1W2AX 1GICA 5BNNB 2YGLA 3A7QA 4IEOA 4IEYA 4EZHA 4L2NA 1NCRB 1GP5A 1CWPA 2D6KA 4LXLA 3K4ZA 3BIWE 2JG9B 3E5UA 5IVYA 3VBUB 4MUVA 4HSLA 4RL7A 5DUVA 3L9JT 3AP5A 2F17A 2GNDA 3K3OA 2X8KA 4EN9B 3HJRA 1H8TC 1V9U2 2LUWA 3CBNA 5FY8A 5GLVA 1WCKA 1R1A2 5CA6A 2QQIA 3I2FA 4C1XA 2C6SA 4LPLA 3T30A 5BNPA 4PDWA 1RUJ2 5BNNC 3NNJA 4LBKA 1NCRC 3LSEA 1O3RA 2HKXA 2JG9C 2YGMA 2WT2A 2W08A 3R4DB 4LO6B 4PQ9A 3VBUC 2VXJA 1EUTA 1RYYA 2IFRA 3R05A 4D94A 1XU1A 1N3QA 1OLQA 3ECQA 4MGKE 3WF2A 5ABJA 2BNNA 2C1FA 3VKFC 2A3XA 1Y43B 3TN93 2CDOA 2YFUA 3AYCA 1OF4A 1AUYA 5FCCA 3OB8A 3GZEA 4WZFA 3RSJA 2FDIA 2ERFA 5T5PA 3H8UA 4WVVA 5F3IA 3M1HA 1W2NA 4EV0A 4PF5A 1UXZA 1PO12 5FXXA 3LIHA 4UW3A 3JXSA 4ZY9A 1AL22 2RDRA 5FXZA 1EUUA 4NRPA 2DUOA 1BK1A 1PGSA 3UKTA 2RDQA 1S2BA 5FMCA 5CAZA 1J84A 4LBQB 2ORXA 1QOSA 3I2JA 1HKDA 1HN0A 1POV3 5AVAA 4AE2A 2Y6HA 1BEV3 1VBA3 2JX9A 5KXDA 4YZ3A 5HCBA 3FBMA 1FOD3 4N43B 2VPVA 4HN1A 2PHWA 5J36A 4KG8A 1UZYA 3IIIA 4QWNA 3U14A 4BQ4A 2XPJA 4EWEA 1AXKA 1ASJ3 2XL9A 2BBVA 2QBXA 3RJRA 1JYCA 5E89A 4BIFA 3PU3A 3H8RA 4IE7A 1H9WA 5JPNB 2VMCA 5LK5A 5BNOB 2FQPA 3VDDB 3B00A 4I09A 3H7JA 2Z4FA 1ZBA3 1CAWB 1ODMA 2VCAA 5BY5A 3QBQA 4PQQA 5K4LA 5ANQA 5FPBA 3JB8A 1UMIA 4RD7A 5IVBA 3KQRA 4IEVA 4HK8A 2JECA 2G19A 1NG0A 1DQ0A 2PTMA 4MSVA 3PUAA 1JYNA 5BNOC 4IERA 3VDDC 4GAZA 1KQRA 2BEOA 5H9PA 1PZ8A 2HWC1 2Z2SB 4XFGA 1SMVA 3LPFA 3VGIA 3CKHA 4K20A 1RINA 4UFLA 1YQ6A 1LHVA 2GDFA 2D5HA 1LHOA 4M3CB 3I3BA 4G9SB 3IBMA 3A22A 1ULOA 2CGNA 5C5TA 3ATGA 2D6LX 3PIGA 4CDUB 5L7OB 3ZYFA 3MF9A 1GP4A 2XQRA 1DQ2A 2XJSA 3MHZA 5FY1A 1J83A 3RPQA 2EA7A 5FYIA 5GZCA 4MGIE 5GZGA 1WBFA 1KJLA 3ILRA 3LEGA 3ZSEA 2E7TA 1GZWB 1O3SA 1LOAA 3O5SA 2GMPA 3URFA 5JOXA 4CDUC 2R061 4Q2FA 5L7OC 1DYPA
chains in the Genus database with same CATH topology
2FDFA 3H8OA 3S57A 3O1VA 4NROA 4O7XA 3RZHA 4ZS3A 3O1UA 3RZLA 3BKZA 2FDKA 3BUCA 4IE5A 3O1PA 3BIEA 2FDIA 3I49A 4ZS2A 4OCTA 3KHBA 5F8PA 4IE4A 4NJ4A 3O1RA 3BTZA 2FDGA 4NRPA 4NPLA 4CXYA 3T4VA 4IDZA 3BTXA 3I3QA 4QKDA 3H8XA 3H8RA 4IE7A 3T3YA 4ZHNA 4MG2A 4CXWA 3I3MA 2FD8A 4CXXA 4NRQA 4NRMA 3BTYA 3O1OA 3RZGA 3RZJA 3O1TA 4RFRB 2FDJA 4IE0A 4NIDA 2IUWA 2FDHA 4O61A 4JHTA 3S5AA 4MGTA 3BI3A 4NIHA 3RZKA 5DABA 4NIIA 3LFMA 3KHCA 3T4HB 4QKBA 3BU0A 3O1SA 4IE6A 4NIGA 4QKNA 3I2OA 4NPMA 3RZMA 4QKFA 4QHOA 3O1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FDF A;  3H8O A;  3S57 A;  3O1V A;  4NRO A;  4O7X A;  3RZH A;  4ZS3 A;  3O1U A;  3RZL A;  3BKZ A;  2FDK A;  3BUC A;  4IE5 A;  3O1P A;  3BIE A;  2FDI A;  3I49 A;  4ZS2 A;  4OCT A;  3KHB A;  5F8P A;  4IE4 A;  4NJ4 A;  3O1R A;  3BTZ A;  2FDG A;  4NRP A;  4NPL A;  4CXY A;  3T4V A;  4IDZ A;  3BTX A;  3I3Q A;  4QKD A;  3H8X A;  3H8R A;  4IE7 A;  3T3Y A;  4ZHN A;  4MG2 A;  4CXW A;  3I3M A;  2FD8 A;  4CXX A;  4NRQ A;  4NRM A;  3BTY A;  3O1O A;  3RZG A;  3RZJ A;  3O1T A;  4RFR B;  2FDJ A;  4IE0 A;  4NID A;  2IUW A;  2FDH A;  4O61 A;  4JHT A;  3S5A A;  4MGT A;  3BI3 A;  4NIH A;  3RZK A;  5DAB A;  4NII A;  3LFM A;  3KHC A;  3T4H B;  4QKB A;  3BU0 A;  3O1S A;  4IE6 A;  4NIG A;  4QKN A;  3I2O A;  4NPM A;  3RZM A;  4QKF A;  4QHO A;  3O1M A; 
#chains in the Genus database with same CATH topology
 2DFB A;  3KT7 A;  4ZKT B;  2VU9 A;  1O3T A;  3S57 A;  5LBE A;  1K3I A;  5CYY A;  4O7X A;  5DAQ A;  1UY1 A;  3J4U H;  3K51 A;  3SMH A;  1BMV 2;  2NYY A;  4JVA A;  4FOY A;  4Y1X A;  2D6M A;  2HWE 3;  2YBK A;  1PVC 1;  3UES A;  5FUI A;  3BYW A;  4B29 A;  4AHW A;  4ARX A;  4CDX A;  5FMO L;  2QDN A;  3U37 A;  3VZO A;  1VPH A;  1J3R A;  2RS3 1;  4QPG A;  1BBT 2;  3KT1 A;  4GD4 A;  1RUD 3;  3N3H A;  3AKS A;  1XRU A;  1TME 2;  3DPR A;  3RYP A;  5AC9 3;  1J3P A;  5JZG A;  3K48 A;  1JZ5 A;  1HV1 A;  1S0E A;  3ALQ A;  4JTN A;  1SG3 A;  4UWD A;  2AEN A;  3SH4 A;  2ZX0 A;  5FP4 A;  3TEY A;  4YZ5 A;  2C0Z A;  5A3P A;  3WP4 A;  2Y0O A;  2A6W A;  4M4R A;  2RS1 2;  4OMD A;  3HBK A;  3AMN A;  4HN0 A;  4XF4 A;  1WW4 A;  1XE8 A;  2GC3 A;  4V1P A;  1C8M 2;  4LO8 A;  4NPL A;  5FZH A;  4LUL A;  3WXP A;  3CZU A;  5C4W A;  2WZP P;  4M4P A;  1QJY 1;  1W9T A;  4FPO B;  3UJO A;  5F5C A;  4D3W A;  2R04 1;  2EID A;  2W94 A;  2Y26 A;  1S0D A;  4HZF A;  4XZU G;  5IFT A;  3FL7 A;  3MIG A;  1HB2 A;  2V5Y A;  4IEW A;  5JOW A;  5KXC A;  1LOG A;  1RUE 1;  3EHK A;  3FWE A;  1VBE 2;  2ZGT A;  4QHB A;  1DGL A;  1NXM A;  1UO9 A;  3WW2 A;  4CZS A;  4DUV A;  4DPN A;  1DCS A;  1FV3 A;  5FLI A;  4DIQ A;  4XF9 A;  2ZAA A;  2RR1 1;  3FE5 A;  4JGY B;  4NHY A;  4N7I A;  4PLO A;  3TAY A;  4OI4 A;  3I3M A;  1H2L A;  2QKD A;  3JD7 2;  2JB8 A;  3M8L A;  4W4Z A;  3PUI A;  5FQ0 B;  4CP9 B;  1SFP A;  5DG2 A;  3HT2 A;  2PHD A;  2Q8E A;  4DQA A;  2RMU 3;  2WZR 2;  4S2D A;  1C4R A;  1B35 B;  1ULG A;  1WGP A;  4U2A A;  1ZX5 A;  3MV1 1;  3USU A;  4SBV A;  1Q8P A;  1YWK A;  2W47 A;  1N1V A;  4DY5 A;  1YLL A;  4JGY C;  1G6N A;  1MS9 A;  3J7H A;  4RR3 A;  4XQ4 A;  4ZPI A;  4LBL A;  4MGY E;  4PIX A;  4P00 B;  2MNG A;  1O4T A;  4YVS B;  1AYN 3;  4UFH A;  5A6Z A;  3OF1 A;  1JI6 A;  2AH2 A;  2PLV 1;  4WM8 A;  4QPY A;  4CEY B;  3OPT A;  2BNM A;  5EV7 A;  1HQL A;  1B35 C;  3S0M A;  4GWN A;  1AR6 3;  2ZS6 B;  1GWL A;  4C8D A;  5ACA 3;  1XQN A;  1HXS 1;  3NNG A;  5JSO A;  1DZT A;  1IPJ A;  2C9K A;  2VQU A;  3C8X A;  2XKP A;  1VB2 A;  3OG2 A;  4HPK B;  4CU6 A;  2O8O A;  4UFM A;  3H50 A;  5L7O A;  3D3A A;  5LA2 A;  5FPL A;  4A7Z A;  3ZPO A;  4CDQ A;  1V0A A;  4XQD A;  1D0G A;  2MEV 3;  4KWL A;  5H9R A;  1R08 1;  2ARC A;  4CEY C;  5F1R A;  2YC2 A;  3N4M A;  4QDR A;  2WAA A;  4JKL A;  3AKP A;  1TNF A;  3JBG 2;  4Y26 A;  3WQB A;  2JIC A;  3TEW A;  5DDJ 1;  1W6P A;  1S4C A;  4GKY A;  4KL1 A;  3OEA A;  3VLB B;  2RHP A;  3POF A;  2XH6 A;  4HSJ A;  3DGT A;  3NL1 A;  2UYA A;  4BQ5 A;  2VY0 A;  1JZ8 A;  3H8O A;  1PM4 A;  4HK9 A;  1SLC A;  3B69 A;  3N9L A;  3LIG A;  1UOG A;  4Q4X 1;  1GR3 A;  5FY0 A;  1SFN A;  2R07 3;  5EYX A;  4ZS3 A;  1RUF 3;  1RUG 1;  2D43 A;  2Q0A A;  3K77 A;  1X7N A;  4I3G A;  4NVP A;  1PIV 1;  3HN3 A;  2AYH A;  3POJ A;  2Z69 A;  4YFW A;  5FYZ A;  4ASK A;  1UCX A;  2BPA 2;  1W8T A;  1KXG A;  5CFD A;  4XCA A;  3LSD A;  2Y6L A;  4Q4V 2;  5FPZ A;  3CF6 E;  4IE5 A;  3CO2 A;  3AP9 A;  4R9A A;  5EJ1 B;  4GKX A;  2GNM A;  2VW1 A;  4PJY A;  4KI5 M;  4XUR A;  5CKQ A;  1TZO A;  3SKV A;  3GZT B;  2JE8 A;  3VHN A;  4OCT A;  1UOF A;  1X9P A;  5A7Q A;  2WNV A;  4WM7 A;  2B45 X;  4I30 A;  2ZKL A;  1G7Y A;  3RJ2 X;  1BKZ A;  1GYK A;  4IES A;  1NKG A;  5EHD A;  5A1L A;  4IE4 A;  3Q8F A;  4CSW A;  4HKW A;  1RMU 1;  2QUO A;  1H8V A;  4QPI A;  2ZAC A;  2VMD A;  5A1A A;  2EVX A;  1Z7S 1;  2WNU B;  3HR9 A;  1LHW A;  4FFH A;  4BH9 A;  1XE7 A;  3FJS A;  1AYM 2;  4NHK A;  2RS5 3;  5FXW A;  4CXY A;  5GLZ A;  4AW7 A;  4D8M A;  3AP7 A;  1LNS A;  5CFC A;  1E5I A;  2P2K A;  5L9V A;  3J26 N;  4PIZ A;  2ARB A;  3AL5 A;  4AEK A;  1QGL A;  2BU9 A;  3LD8 A;  5F37 A;  1ULP A;  2WNU C;  2W1U A;  1GBG A;  2HWB 3;  1XND A;  4XXP A;  4CXW A;  4W65 A;  2WJS A;  2XQX A;  2JE9 A;  2ZX2 A;  5FYU A;  4PBO A;  4LHL A;  4QB2 A;  1FPN 3;  5GKA C;  4XZP A;  4XJ9 A;  3WLU A;  2GH2 A;  1AR8 3;  4F83 A;  3DYO A;  1HRV 3;  1X36 A;  2BVB A;  3KV4 A;  4XFI A;  2VTX A;  4LO4 B;  5FPV A;  5BV6 A;  1AX0 A;  4QHZ A;  1PGL 2;  1TEI A;  1FMD 1;  4UFI A;  1LB2 A;  4JDM A;  3A21 A;  1IS3 A;  2FDJ A;  1DHK B;  1POV 0;  3SIS A;  3ZR5 A;  2WIN B;  4M0H A;  1PO2 1;  2WO3 A;  5GAL A;  3I3D A;  1O4Z A;  4ERO A;  1ND3 B;  3OBR A;  1W04 A;  4LQR A;  4AQS A;  4YVW A;  3PUH A;  3RRD A;  2HWF 2;  2Y60 A;  1UY0 A;  1PMJ X;  3LE0 A;  3NNM A;  1TMF 3;  4Q0P A;  4BIO A;  1BYH A;  2QDR A;  1VJ2 A;  2W5F A;  3LFM A;  3KHC A;  3MBW A;  2O8Q A;  1W3X A;  2IVJ A;  4E2Q A;  2XJV A;  2DU1 A;  3V56 A;  1V6K A;  2ET7 A;  1JOP A;  1IGO A;  4DB5 A;  3CMG A;  1ND3 C;  4Q29 A;  2D5F A;  1S1A A;  5GLT A;  3ELN A;  4IV3 B;  5IK8 A;  3FZ3 A;  4EWA A;  1E5R A;  2WYS A;  3NAP B;  4XVH A;  1W2U A;  5FZK A;  3ZDS A;  5CZK A;  5APA A;  1KFU L;  1LES A;  2WT0 A;  1IG3 A;  4NPM A;  3ZDV A;  3SCF A;  2BGC A;  4AQT A;  1AR7 2;  2BOJ A;  2RDS A;  2IVI B;  4A45 A;  2WNO A;  5C33 A;  4RHV 2;  4MH0 E;  3VDC A;  5IVF A;  5A6Y A;  5D2A A;  3N9N A;  1ZZC A;  4IV3 C;  1UU4 A;  5FY7 A;  1YJK A;  2HJI A;  5IT6 A;  1CX1 A;  3NAP C;  1OVP A;  4DRV A;  1QWR A;  1S0B A;  1DQ5 A;  2XBO 1;  5FBJ A;  1OUS A;  3WZ1 A;  2DVA A;  3MID A;  4AVS A;  1TQ5 A;  2RE9 A;  3UKV A;  1AR9 1;  1N3O A;  4FFG A;  2ZX4 A;  4HFS A;  3ZN5 A;  5FOJ B;  2FMD A;  4L97 A;  4R9C A;  2AR6 A;  4LE4 A;  3ZYG A;  2G9F A;  3EO6 A;  3P5B A;  1JH5 A;  1NOV A;  1JHJ A;  3HN1 A;  4E4Z A;  5CIS A;  2UYB A;  5FPX A;  1HX6 A;  4FQ4 A;  1LOD A;  3AZZ A;  2F6B A;  5K7P A;  2WT1 A;  2E51 A;  1YYN A;  2K9Z A;  3IPV A;  1X9T A;  1L7Q A;  2VZT A;  4LBQ D;  4LLF A;  1KS5 A;  1IQD C;  4RQP A;  1WMX A;  5C5U A;  1STM A;  1O91 A;  1XNC A;  3DF0 A;  3MIE A;  3KLS A;  1QQP 2;  1H6Y A;  1RUC 3;  1SBD A;  3JCI A;  3OY8 B;  4MOA A;  4D6Q A;  5LRS A;  1X82 A;  3PUR A;  2PAK A;  1C57 A;  1LOF C;  4L0P A;  3PTY A;  4XXA A;  5FZ7 A;  1C8N A;  5GM0 A;  1W6M B;  3SEE A;  1VRH 2;  1IG0 A;  4LTA A;  2WO1 A;  1H1I A;  4Q0U A;  2QQV A;  1W8H A;  4XW3 A;  4MXW A;  2B39 A;  3NV4 A;  3RS6 A;  4HVQ A;  4R4Z A;  3ZOI A;  4U36 A;  4A7K A;  1OOP B;  2ZOE B;  4W6X A;  1MZ5 A;  4L8Q A;  3RYK A;  3OCP A;  3WVJ A;  4CPB A;  1JN2 P;  2HWC 3;  1ZRC A;  2GAL A;  4DXR A;  1QNW A;  3B9I A;  3N7J A;  4QXB A;  4YG0 A;  4AAX A;  1NY7 2;  3OD4 A;  1PGW 1;  5F2W A;  3U78 A;  2CAV A;  3WNP A;  3NJZ A;  4DEQ A;  5LBF A;  1RTV A;  2VD7 A;  5IAX A;  5I8T A;  3ZSM A;  2UWB A;  4AGG A;  4V2V A;  3N7M A;  4R52 A;  1R09 1;  1DIW A;  4YW1 A;  3USS A;  3ZXJ A;  2R6Q A;  3K4A A;  3D8C A;  2NQY A;  3UK9 A;  2DVG A;  5AVP A;  1GNH A;  3RZJ A;  2VR4 A;  2YDE A;  1GZT A;  1W06 A;  1VBC 1;  2CAU A;  5JVV A;  3QAC A;  4Q4W 2;  5HCF A;  3VKL A;  1JYI A;  2GP3 A;  2WWU A;  1MZF A;  4IE0 A;  4LBJ A;  1AF9 A;  1BCX A;  3WF1 A;  5F7U A;  5TSW A;  5F2S A;  2AEY A;  5HXM A;  3M3O A;  4LK7 A;  4O61 A;  2VW0 A;  3DV8 A;  2UWA A;  1Q8V A;  2IXK A;  3G7D A;  3PMS A;  4IV1 A;  2GC1 A;  1KGY A;  3N36 A;  2I74 A;  1N1Y A;  4XE9 A;  1JYX A;  1U0A A;  4TLG A;  5DAB A;  3RG0 A;  1WA4 A;  1YFY A;  1IPK A;  1CR7 A;  1WLD A;  2VBB A;  4RS5 C;  2XHK A;  3ZFE B;  4K7J A;  4QX7 A;  1E5H A;  4EQV A;  1RHI 1;  4FOV A;  4Q8L A;  1PVC 3;  2W2I A;  3MZH A;  3S5Q A;  1TVG A;  2PHR A;  5BNP B;  5FZ0 A;  3NMB A;  3ZIX A;  3U1X A;  2VZU A;  5D1I A;  3MPB A;  3OUJ A;  1RUH 2;  1UY2 A;  3HAG A;  5FZ9 A;  5E1R A;  3PUQ A;  2KM2 A;  2FCU A;  1RJ8 A;  3CL1 A;  2D6P A;  1P8J A;  1QEX A;  1V9U 1;  4NO4 A;  3ST7 A;  4FPK A;  3D82 A;  3ZFE C;  4P08 A;  1NA1 B;  4P9L A;  3ACG A;  4ZU5 A;  3ZXL A;  4WZC A;  5JDB A;  2DCK A;  4QM9 A;  1NQD A;  5T55 A;  4H14 A;  5L9B A;  5BNP C;  4PT6 A;  1W9S A;  2QQJ A;  5C3R A;  4CUC A;  4DS0 A;  3OOX A;  2VE1 A;  2WA4 A;  4LOR A;  1S0C A;  4XF3 A;  1X33 A;  5K0U A;  1LTE A;  3WNL A;  1Y4W A;  4FTB A;  3VBO B;  2BNO A;  4HMZ A;  4WVW A;  1GAN A;  1Q56 A;  5FZO A;  1QJY 3;  5FJH A;  3OBZ A;  4DNY A;  2R04 3;  4Y1Z A;  5GZD A;  2IXH A;  4R8H A;  5G05 L;  2ZEZ A;  4BE3 A;  1Y9M A;  3ZLI A;  4AVT A;  4JGZ B;  1QJZ A;  1ZRF A;  4PLM A;  3VBH B;  3POG A;  3WHU A;  3BIE A;  1BJQ A;  1YI7 A;  3N7L A;  4FOW A;  2H6C A;  3GZU C;  4Y5S A;  5KWR A;  3H1W A;  4GQ7 A;  4JZR A;  4NUB A;  1IS6 A;  1QHD A;  1U5Y A;  1AL2 1;  5FDB A;  3MIH A;  3DKQ A;  4B7E A;  3VBO C;  1CN1 A;  4QU1 A;  4E4H A;  3M3Q A;  4K8F A;  4OUL A;  3ZYJ B;  5A32 A;  1OLR A;  3QH6 A;  1MQT B;  2CGO A;  2QJV A;  3AKR A;  4JGZ C;  5FUP A;  3VBF B;  3VBH C;  3PIJ A;  2VBP A;  1UN1 A;  1MS4 A;  2Q1F A;  1CAU A;  3AZV A;  2PHX A;  3VKO A;  3ZN6 A;  4BU2 A;  4CP1 A;  1CZV A;  4OLL A;  2K46 A;  1NE6 A;  4FFF A;  3B7M A;  2YY1 A;  1FAY A;  1BEV 2;  1VBA 2;  1G9D A;  1J1T A;  5FK8 A;  3WP6 A;  1FOD 2;  2ZMK A;  5LA0 A;  3B3Q E;  3WCR A;  2W0X A;  3BTX A;  4D7Y A;  3R4S A;  4FXG B;  3I2K A;  3WW1 A;  4ITC A;  1ASJ 2;  3AL6 A;  1MQT C;  3VBF C;  4ZHN A;  1DFQ A;  1AL0 G;  4XIL A;  2JIG A;  3SXW A;  5FKB A;  3AJY A;  3S6P A;  1UD1 A;  1NYW A;  4BYY A;  5JCT A;  4R9B A;  1WME A;  1GMM A;  1L7R A;  1ZBA 2;  1JYV A;  5KHJ A;  4R9D A;  4FVV A;  2DVB A;  1HXS 3;  4RGA A;  3ZFG B;  4FPL A;  2JDM A;  2P3J A;  4L11 A;  5F39 A;  1ZA4 A;  2XXZ A;  3H3Z A;  3VB9 A;  4YG6 A;  2J7M A;  2ZGU A;  1CAX B;  4HG6 B;  4XEZ A;  3ITQ A;  4LUM A;  1ND2 A;  5KC6 A;  1GWK A;  2YPD A;  4XFF A;  1HB3 A;  1LHN A;  1R08 3;  4R4X A;  2DWR A;  5A3N A;  1QXR A;  4GMP 1;  4JHZ A;  2GP5 A;  3GJB A;  4N9H A;  3D0J A;  5DDJ 3;  4FO9 A;  3FLT A;  5F6K A;  1E57 A;  3VZM A;  1GUI A;  1D0H A;  3WG1 A;  3RMY A;  2NM1 A;  2BQP A;  3ZFG C;  4CRQ A;  2PHL A;  3ES4 A;  2R16 A;  4NII A;  4PF1 A;  1JZ6 A;  4LA2 A;  4L99 A;  1H2K A;  2PAE A;  3EB7 A;  3JU9 A;  5K8S A;  2D6N A;  4Y5Z 0;  5LWB A;  4H3W A;  3VBR B;  1WWY A;  1ZYB A;  2JJ6 A;  4HL0 A;  1F4A A;  2N7G A;  1RUG 3;  5DMY A;  2OQ7 A;  4HON A;  4XC9 A;  4CVU A;  5EQU A;  2LM3 A;  1G9F A;  2V5D A;  3WNX A;  3HQR A;  5FZE A;  2WRA A;  1NX9 A;  3VL8 A;  3KCX A;  3E6D A;  4ARY A;  5H9Q A;  1EY2 A;  4CDX B;  3LA3 A;  1LGN A;  1ST8 A;  1Q8S A;  2W95 A;  5GJ6 A;  4AFC A;  3ILF A;  5LY1 A;  2BP6 A;  2JE7 A;  5CB7 A;  3MFA A;  3VBR C;  4QHO A;  1BMV 1;  5C3S A;  2WSU A;  2EAK A;  2OYZ A;  2R49 A;  4E27 A;  2VCC A;  4RYD A;  3ASI A;  4GB3 3;  5AFE A;  1UMH A;  2B8M A;  2Y64 A;  5EZW A;  1W6Q B;  4YW3 A;  4DRR A;  2LS6 A;  4M3C F;  1RVF 1;  4GA9 A;  1RMU 3;  5FJK A;  1LCL A;  3J8F 1;  1BBT 1;  3MW4 A;  5EP9 A;  4CDX C;  2AZ5 A;  3WV6 A;  3ZXA C;  4CE8 A;  1TME 1;  1D4M 2;  1Z7S 3;  3GGL A;  1L7L A;  3I59 B;  4H2A A;  4QPG C;  3VBS B;  3E6C C;  2XON A;  3O1U A;  4UI9 L;  1RXF A;  1C3H A;  3KF3 A;  1RUD 2;  1M4W A;  5LB6 A;  5AC9 2;  3W5M A;  4QGN A;  4B8E A;  3V0A A;  3KGZ A;  1N3P A;  4JDN A;  4XAB A;  1QJU 3;  4XMA A;  4YWA A;  3HNY M;  1GZC A;  2WLP A;  4FTS A;  2V73 A;  3P3P A;  1NCQ A;  4V2W A;  2Q8O A;  2VG9 A;  2VJX A;  4MLO A;  1LOC A;  3B02 A;  4AED B;  2VUL A;  3VBS C;  3FX3 A;  4NJ4 A;  3UKN A;  3O1R A;  1CES A;  3KV5 A;  3PU8 A;  1V6N A;  3LEK A;  4I0A A;  2HEY F;  3POW A;  4LNV A;  1DYO A;  1VR3 A;  4QX2 A;  3VKN A;  3ZKU A;  1QU0 A;  1VAV A;  4ISR A;  3WX5 A;  1ALY A;  3FFZ A;  4ES8 A;  5AFB A;  2ZCW A;  1O59 A;  4QQH A;  2YBS A;  1Y9Q A;  1FMD 3;  1LHU A;  4YZ1 A;  4AED C;  3IT8 A;  3U10 A;  5GLU A;  3MEP A;  3SQO A;  2OS2 A;  3V0B A;  3USU B;  1PO2 3;  1ZBE 2;  4LBM A;  3UET A;  5F6L B;  1SLB A;  3JD7 1;  3THT A;  4TLF A;  4OHY A;  5DZG A;  1QH7 A;  4M01 A;  5ISL A;  4XJW A;  1QOO A;  1UYP A;  2B7Y A;  3RI9 A;  3MUY 1;  4M3C E;  1VAK A;  1YQ5 A;  2NMN A;  2WZR 1;  3FLR A;  2WUH A;  2YFZ A;  1I5Z A;  1WA6 X;  4AZZ A;  2RMU 2;  1XBF A;  3IAP A;  2IWG B;  4NMI A;  5FYB A;  2X5I B;  4MO3 M;  1XB9 A;  5JXG A;  1JU3 A;  2ZX1 A;  2JDH A;  3HEI A;  3WIN E;  5IK5 A;  1JOD A;  1GQG A;  1MVQ A;  2CTV A;  4AHZ A;  4EN6 B;  1UZZ A;  1GNZ A;  1RGS A;  3C7H A;  5C9A B;  1OF3 A;  1YIF A;  2K0G A;  4WM8 C;  3AVR A;  2XUM A;  3BI3 A;  4F7Z A;  4WV8 A;  4XCB A;  1HN1 A;  3IMM A;  4OHZ A;  1GU3 A;  1OHF A;  4Q4Y 3;  5DAP A;  2X5I C;  2DVF A;  4OFG A;  4QX1 A;  3C7F A;  4Y22 B;  1KRI A;  1AR6 2;  2P6H A;  3POE A;  3WDW A;  5ANN A;  3T4H B;  4FXK B;  5ACA 2;  4OI0 A;  1I1E A;  3NKG A;  3D0S A;  2Z5W A;  3OBA A;  4QQP A;  2P3I A;  5C9A C;  4CDQ C;  4XYX A;  2XBO 3;  1UAI A;  1XU2 A;  3TRS B;  4JRA A;  4YGE A;  2XJT A;  1ZZ9 A;  3O0X A;  4IND A;  4WVZ A;  1ZA7 A;  4L9B A;  1A34 A;  3UNP A;  1GOH A;  2XUE A;  3POB A;  4YLZ A;  1D4V B;  1AJO A;  3CJI A;  3SH3 A;  1G86 A;  4YGC A;  4FTE A;  5A7S A;  4BQ1 A;  1LGC A;  1SPP B;  3KB5 A;  2R1B A;  3CIH A;  1OD5 A;  2A6Z A;  3FUO A;  2VC9 A;  3POI A;  1FV2 A;  1I9R A;  5EXO A;  3ORJ A;  4CDW A;  2PFW A;  1HIX A;  2WYF A;  4TN7 A;  5FYC A;  1ZZB A;  4URA A;  1F5J A;  3IWZ A;  1XOY A;  3EBR A;  4D0Q A;  2R07 2;  3J9S A;  3UYJ A;  3AYE A;  4EE2 A;  1RUF 2;  1COV 1;  1W39 A;  3ZN4 A;  3M7A A;  1YEW A;  3BGA A;  4KU7 A;  1OBN A;  2A5Z A;  3W58 A;  4X8P A;  1JZ2 A;  3AZY A;  1B09 A;  5KHG A;  2YHJ A;  2XHN A;  4XUQ A;  1SBE A;  1T6G C;  5JR7 B;  2FDK A;  2HLE A;  1LUL A;  1X8M A;  1H4G A;  5DPN A;  2HH9 A;  3OGG A;  3DL3 A;  3VN4 A;  4QGM A;  3EJK A;  5FXV A;  4AI0 A;  5EWS A;  1IS5 A;  5CFC B;  1RJ7 A;  3BN6 A;  3SNM A;  3T2T A;  4QGL A;  4P5Y A;  3MV0 1;  4E8D A;  4K21 A;  4BOW A;  1OQE A;  3INA A;  5FZ3 A;  1WMD A;  3KQ4 B;  4XAA A;  1GNY A;  4Z82 A;  1VBB 3;  4EWD A;  1QJX 1;  1WBL A;  2PHF A;  4O9G A;  3C7O A;  3ACL A;  1D2S A;  2YG0 A;  1R09 3;  4EYU A;  3GYD A;  4S2H A;  1J1L A;  4UW5 A;  4Y20 A;  3BOP A;  4QXH A;  5CFC C;  2C4X A;  1I3H A;  1VBC 3;  5J37 A;  1K45 A;  5FP8 A;  4AAP A;  5JPM B;  1UYY A;  5CG9 A;  1XNB A;  4XF1 A;  2P34 A;  4CEW A;  2J1E A;  4XBQ A;  4W8J A;  4KWJ A;  3T3Y A;  2VL4 A;  5LEJ A;  2WO7 A;  1JTZ X;  2HWB 2;  2VAU A;  1ZVF A;  2P4E A;  3FC0 A;  4CXX A;  1UZ0 A;  4YVW B;  4N53 A;  1FPN 2;  2YC0 A;  3PVO A;  4FCA A;  1AR8 2;  4ZXE A;  1BZW A;  1HRV 2;  2VGD A;  3MIC A;  4NPR A;  3OGS A;  4WVM B;  1RHI 3;  3UGH A;  5F5I A;  4HVO A;  4HOO A;  2H6B A;  4KMQ A;  1U5X A;  2B9V A;  3ILN A;  2XJQ A;  3OYW A;  1HJG A;  3N9O A;  1NLS A;  4KWK A;  4XOG A;  3NKT A;  4BDV B;  5A33 B;  3TB0 A;  4CCC A;  4YVW C;  1G9A A;  2XGX A;  3R4U A;  5FYH A;  2YXS A;  1EPW A;  2Y34 A;  1MS8 A;  1OA3 A;  2A75 A;  5A80 A;  4E2G A;  4Y4R A;  1A6C A;  1TMF 2;  1GV9 A;  2JB4 A;  3IIA A;  2C24 A;  5BNN A;  4TYS A;  1YQ2 A;  2BZD A;  2W91 A;  4DXZ A;  3ZMN A;  2DFC A;  4IUG A;  3TOJ A;  1NCR A;  1V6J A;  1EYB A;  2VMF A;  3WNM A;  4BJ0 A;  3EMR A;  5SV8 A;  2JG9 A;  3VBU A;  2P17 A;  1ZZ7 A;  5JMO A;  2J42 A;  4WBB A;  4IEU A;  1NZC A;  2R30 A;  2UY9 A;  4LK6 A;  3SC7 X;  3WNN A;  3MGU A;  1CAV B;  4NIG A;  1SLI A;  2ES3 A;  1AR7 1;  1SLT A;  2Y6K A;  2XVG A;  3PVN A;  4CCO A;  3ACI A;  3AZW A;  1DZR A;  2VMG A;  4LO5 B;  4Z07 A;  2ETE A;  1YQ8 A;  4D69 A;  2E9Q A;  3I3E A;  3WP5 A;  3ZSL A;  3DN7 A;  4NRO A;  1I6X A;  3RZH A;  4CUB A;  4AHX A;  3D6E A;  5J1X A;  5JWP A;  1SQ4 A;  4JCK A;  2JDK A;  4IGO A;  1VIW B;  1A8M A;  4LHK A;  1S55 A;  4PI2 A;  4CTE A;  2WKK A;  1JXN A;  4GWJ A;  1VAM A;  5C3Q A;  1QMJ A;  3G6J B;  3VDB A;  5T52 A;  3DEC A;  4P14 A;  3ME2 A;  3ZSK A;  4CCJ A;  4ORF A;  1OXC A;  4S2F A;  4KBB A;  1QDO A;  4AVB A;  2VNV A;  1WLW A;  1EAH 2;  1WCU A;  3RI8 A;  1QQP 1;  5FWE A;  2TNF A;  4LBQ A;  1BQP A;  5JXJ A;  1FNY A;  1FNZ A;  4OYU A;  4O65 A;  3O12 A;  2DTY A;  1VRH 1;  1SBF A;  2EXI A;  4UBH A;  2QE3 A;  1RUC 2;  4N43 A;  2EIG A;  1FI2 A;  4BZ4 A;  5DG1 A;  2IXC A;  3KCY A;  1IPS A;  2DUQ A;  2QVS B;  2PN5 A;  4EN0 A;  1FXZ A;  1V6L A;  2WLQ A;  3U4X A;  4ATE A;  2QQP A;  1ZNP A;  2HWD 3;  2JD9 A;  4YM1 A;  1Q8O A;  1WW5 A;  3T4V A;  3MPP G;  1S0I A;  2RDN A;  2ADE A;  2YYO A;  4RA0 A;  5D8A B;  1XYN A;  5C3P A;  1G8W A;  1NY7 1;  3V65 A;  4A6S A;  1UXX X;  1CAW A;  3CNA A;  2Q30 A;  4RFT 0;  4GMP 3;  3T2O A;  2HWC 2;  3OUH A;  1OI6 A;  3H3U A;  1CIY A;  3I97 A;  2Z42 A;  3WOG A;  1ULC A;  3U75 A;  1NQJ A;  1SAC A;  3AMQ A;  4Q0V A;  1LEM A;  5KXB A;  2LW8 A;  2VNO A;  2RM2 1;  1X8E A;  1JBC A;  4J6G A;  4CUA A;  5C8C B;  4E8C A;  1W6O B;  1ODN A;  5FPU A;  4Y3O A;  3M2M A;  3H1M A;  4IV1 B;  4GH4 B;  3X29 B;  3BPZ A;  5D8A C;  5C8W A;  4UW4 A;  4AR2 A;  2I2S A;  4Q4W 1;  4YW7 A;  5L9R A;  3I2D A;  3WQ7 A;  2O14 A;  4BME A;  3CDZ B;  4A4A A;  2XJP A;  4CCD A;  5A6Q A;  3HMY A;  5LA1 A;  5E6H A;  3LAG A;  1YO8 A;  4L92 A;  4Y5T A;  5F5A A;  4M3C A;  3AM2 A;  4NWW A;  5C8C C;  4UF0 B;  4QDS A;  2FDH A;  4JHT A;  1MS5 A;  2E32 A;  3J7M A;  3GJA A;  2D97 A;  4IV1 C;  4GH4 C;  4RGK A;  1JOJ A;  1XNA A;  4AXO A;  1VBD 2;  3DXT A;  4NHL A;  5BNQ A;  2ZGQ A;  3TWI A;  4MV2 A;  5HPO A;  4QX5 A;  5JSR A;  4BXF A;  3R6S A;  4KH9 A;  5IJR A;  4Y1V A;  3PNA A;  3E5X A;  1DP0 A;  1ZRR A;  1S0J A;  2BFU S;  3ACF A;  5FYS A;  5A3T A;  4DUX A;  3U07 A;  2NP0 A;  1EV1 3;  4LIV A;  1RVF 3;  3ZYP A;  4JKK A;  1YRZ A;  3V64 A;  3J8F 3;  2AGS A;  1GZW A;  5EFU A;  1RUH 1;  3TNQ A;  4C1W A;  1W9F A;  3LDK A;  4GZ9 A;  1PVC 2;  5F3G A;  1HRI 3;  1K5M B;  1TME 3;  3KT4 A;  3F2Z A;  4LLO A;  5JI9 A;  5LCW L;  5LEK A;  2D6O X;  4ET7 A;  5JOY A;  1S2K A;  4BK4 A;  3O0W A;  2G9G A;  1SLA A;  4TZD A;  5FZO B;  1V6I A;  2W46 A;  4IGP A;  4XFC A;  5T3N A;  2W1Q A;  4JC1 A;  1O5L A;  3T09 A;  4F3J A;  1GFF 2;  1F5F A;  1JS9 A;  1XC6 A;  1MEC 1;  3MFC A;  4C0H A;  2JKB A;  1PMI A;  1WD3 A;  4ZON A;  3MF6 A;  1PK6 B;  1UOJ A;  5IVC A;  1CVN A;  4AVC A;  1GZ9 A;  1K5M C;  2EXJ A;  5CIR A;  4ZXK A;  1ONA A;  4HKO A;  3OEB A;  3LF7 A;  1PVX A;  3FUQ A;  5IVE A;  4YGB A;  5K0U C;  3SCH A;  4MAD A;  5L73 A;  4XIK A;  1F9K A;  2DVD A;  3LQC A;  3M3C A;  1XPW A;  4XPV A;  4BQ2 A;  3ZYB A;  1C28 A;  2VZR A;  3LB9 A;  2TEP A;  5FLH A;  1PK6 C;  3AP4 A;  5IWF A;  1CAU B;  2ZML A;  3O14 A;  4IL7 A;  4N8M A;  1DU3 D;  2E31 A;  2I07 B;  4CP2 A;  3W21 A;  1SCS A;  3KVB A;  4FI9 A;  2ARA A;  3ZXG A;  2PQS A;  2A6X A;  5FPA A;  3KM5 A;  4KGG A;  1H1A A;  2BWA A;  2NLR A;  1CQ9 A;  4XET A;  2WAO A;  4BB3 A;  2WS9 1;  1HW5 A;  5DXD A;  2BWC A;  3KV6 A;  1QY4 A;  2WFF 1;  4BXS V;  5KR7 A;  1OA2 A;  1POV 1;  1G9B A;  2ZGR A;  2QNK A;  1KFX L;  3LFI A;  4C0B A;  1UU5 A;  3NQH A;  2ZAH A;  4CA9 A;  3I54 A;  5A1F A;  3W20 A;  2B9U A;  2JDZ A;  4RN5 A;  1DQ6 A;  3TBD A;  5A3O A;  1VMH A;  2ZBJ A;  4AOC A;  1UPS A;  1W6N B;  2ZEW A;  2VZS A;  1SHW B;  5FQ0 A;  2D40 A;  3AK0 A;  4CU7 A;  4CP9 A;  3SHR A;  3N9P A;  2EIB A;  3VD4 A;  1U12 A;  2QQO A;  4JRL A;  1ZBA 1;  1KJR A;  3EXU A;  2W68 A;  4XAC A;  5GZF A;  1B35 A;  1OA4 A;  2ARE A;  2L9L A;  1RED A;  3C2U A;  3OD0 A;  2LRP A;  1HB1 A;  4MHR A;  4YM2 A;  3PTR B;  4EN8 B;  2Y6G A;  4A6O A;  3MLJ A;  5FYY A;  3GCW A;  3BB6 A;  5IAT A;  3MIB A;  3VD7 A;  3DKW A;  3MIF A;  2VW2 A;  4BHP A;  1DGW A;  3AMH A;  1BVV A;  3OSD A;  3U11 A;  1HXS 2;  4JQR A;  4YVS A;  4DXS A;  1QOT A;  4ES9 A;  3ZO0 B;  3WD5 A;  4PHZ A;  1KDK A;  2VUA A;  1ENX A;  5FZM A;  4CEY A;  1J3Q A;  1S0G A;  1M06 G;  5F5Q A;  2W3J A;  3MYX A;  4NHM A;  1OUX A;  3GNE A;  4NID A;  5F32 A;  1R08 2;  1CIW A;  3ZMO A;  4ZU4 A;  2YUE A;  4CYD A;  5FV3 A;  1DF0 A;  4AI2 A;  3DUI A;  1GOG A;  1NXD 1;  1RUI 1;  1XNK A;  5LY2 A;  1UF2 C;  4YW4 A;  3WUD A;  4HPK A;  2O1Q A;  3I2G A;  3JQW A;  4YNI A;  2XR4 A;  2ZHN A;  5HXV A;  4UW6 A;  4P9Y A;  5A7W B;  2W1W A;  3U0Z A;  2VUC A;  1UQX A;  2BJS A;  4IQP A;  2OX0 A;  3FHA A;  5FZ1 A;  4OZX A;  2HBT A;  5FRA A;  1U5I A;  5J48 A;  3BU0 A;  4P9X A;  1GQH A;  4MET A;  1COV 3;  1RUG 2;  4OUE A;  5D21 A;  5JXH A;  3LOI A;  2ZHM A;  5HV4 A;  5B4N A;  4RS5 B;  4NAM A;  2JXA A;  3KVA A;  1ZZ6 A;  2J1R A;  3AFG A;  3HVD A;  3M4F A;  2XVL A;  1UY3 A;  5EYY A;  3ZR6 A;  3H3L A;  4QX8 A;  2WII B;  4OI1 A;  1L3J A;  5LA9 A;  2H0V A;  2R06 3;  4IEX A;  3CHX A;  4AFA A;  1LR5 A;  1IKP A;  4UT5 A;  2ZEX A;  2CWS A;  4AFM A;  1O5U A;  4GB3 2;  1H0B A;  1D4M 1;  2XWJ B;  4YYO A;  4YW5 A;  1DZQ A;  1DYK A;  2WNE A;  1QJX 3;  2XKO A;  2EF6 A;  5J7M A;  5BYN A;  3SEP A;  3ZX7 A;  4LHS A;  1KIT A;  1RUD 1;  2VNG A;  1UU6 A;  3NNF A;  4Q1P A;  1Z7S 2;  5AC9 1;  4HLT A;  1R64 A;  1X50 A;  4KQ7 A;  4I0W B;  4PDW B;  2UWC A;  3TNP B;  2RS3 3;  3BKZ A;  1V6M A;  1AXY A;  2CU5 A;  5I0R A;  4LUK A;  5B2G B;  4URT A;  3T2P A;  3ZYH A;  4SLI A;  1QJU 2;  3GCX A;  3WG2 A;  5A70 A;  1R1A 1;  3AYA A;  5ABJ B;  2WNU A;  2IC1 A;  1RUJ 1;  1YC6 1;  5F8P A;  3OPW A;  2V09 A;  3MW2 A;  4I3P A;  4Q27 A;  5FMD A;  1QJE A;  1YQC A;  4PDW C;  5HCH A;  4CU9 A;  4MYE A;  3GHN A;  2A6Y A;  1JZ3 A;  1Z0H A;  2D98 A;  2GN7 A;  2XML A;  4K6B A;  3JZV A;  1W9Y A;  1UZW A;  2ZTN A;  3WT3 A;  3LPG A;  2DCZ A;  2Q1Z B;  3KZ4 C;  3Q8B A;  4A3Z A;  5ABJ C;  3C7G A;  5CVR A;  2WQ4 A;  3ETQ A;  1JUH A;  4XJ8 A;  1SFY A;  1ZBE 1;  4BLJ A;  3WY6 A;  1LED A;  1RUE 3;  1OPO A;  3GBG A;  3TN9 2;  1HQN A;  2D93 A;  1YFU A;  1WMF A;  4ZU7 A;  5JUV A;  1YIP A;  1PO1 1;  1YHF A;  1RIR A;  2Q1M A;  3ETP A;  3EYP A;  3NNL A;  1PO2 2;  2WAB A;  4ONU A;  4A42 A;  4FAG A;  1DGR N;  2FCT A;  4H7L A;  4YG3 A;  3S7I A;  4CUG A;  5F3E A;  4HVR A;  2RR1 3;  3I8T A;  3ZM8 A;  4Q8K A;  3FMG A;  4OHW A;  1V6O A;  3VZL A;  3WW4 A;  1F35 A;  2RMU 1;  1K5J A;  2VO5 A;  2VEC A;  4AVV A;  4Z2W A;  4A44 A;  2WBK A;  3CEW A;  4P9G A;  4J25 A;  1ND3 A;  1O3Q A;  1C5I A;  5CG8 A;  1LAJ A;  4KG0 A;  1XSQ A;  3E97 A;  3ZYI B;  2FZ1 A;  3SH5 A;  2J1U A;  3HWJ A;  3AXE A;  3BU7 A;  2HEW F;  2WWS A;  3ZVX A;  2JDU A;  1AR6 1;  4AWD A;  2PLV 3;  4H7M A;  1OKO A;  5IHR A;  4GMP 0;  1H6X A;  2D3S A;  1ENQ A;  4Q4Y 2;  5CAD A;  4M00 A;  3SLI A;  1JYT A;  4IV3 A;  3IZO A;  3UV9 A;  1GOF A;  3CJI B;  1QKQ A;  3CQO A;  3NAP A;  2E6V A;  4ZZ8 A;  1UKG A;  5IVV A;  3E1F 1;  3WF0 A;  4QQL A;  3RWN A;  3VUO A;  2XBO 2;  4TSV A;  1N1T A;  4Y33 A;  1H4H A;  4LT5 A;  3OGR A;  5DN2 A;  3AYD A;  5FKC A;  4B1L A;  3J7N A;  1LKN A;  2SLI A;  4FAH A;  1DLL A;  2UU8 A;  3UT0 A;  3CJI C;  4XJZ A;  4QKF A;  3NJY A;  1RB8 G;  2GN3 A;  4QDQ A;  3PVB B;  2RG4 A;  5FYV A;  4NAO A;  2B42 B;  3AC0 A;  2QQU A;  4XDO A;  2VZO A;  5FLJ A;  1MS0 A;  2OXB A;  1EPZ A;  2R07 1;  3BTA A;  2CDP A;  4LJH A;  4DOU A;  5F3C A;  5JOZ A;  3MUZ 1;  3T2Q A;  1VRH 3;  3KF5 A;  2A7A A;  1LOF A;  3ZFF A;  3THC A;  4Z1V A;  2G1M A;  4Q4X 3;  5KBF A;  2OUJ A;  4KU8 A;  1QNY A;  4XUP A;  2LAL A;  3QLQ A;  5JIA A;  3GBF A;  2XOM A;  2BBA A;  3PHM A;  2E7Q A;  4AI3 A;  1PIV 3;  2NMO A;  2OT7 A;  3H1Y A;  4PLN A;  1WLT A;  4RSU A;  1WCD J;  4FBF A;  3HD8 B;  4Z2A A;  5FZI A;  4XF0 A;  3T0B A;  5I91 A;  3OY8 A;  1OFS A;  1MZE A;  3FLP A;  5EPA A;  4QPG B;  2TBV A;  1V70 A;  1YI9 A;  1IZ3 A;  1W6M A;  1YUD A;  3DPR B;  4LKE A;  2V4A A;  4ATF A;  1AVB A;  5JZG B;  1UX7 A;  3MDP A;  4AK3 A;  4Z92 B;  2JWP A;  4BPZ A;  5FWJ A;  3OPZ A;  4AGR A;  1F31 A;  3THP A;  3WDX A;  2QQK A;  2X09 A;  2RM2 3;  3P3N A;  5HV0 A;  2XG3 A;  1OOP A;  1VBB 2;  1W0O A;  3RNS A;  3SIT A;  5KC5 A;  2SBA A;  5GLW A;  4NR1 A;  5FY5 A;  4W50 A;  5HBA A;  3PDQ A;  2HWE 2;  2NZ9 A;  2ZGN A;  2QTW B;  3QOP A;  4E9K A;  2ZGP A;  2DTW A;  3Q8C A;  4QB1 A;  3DPR C;  5JZG C;  2VMH A;  3ZXE A;  1URX A;  2WZE A;  2P3Y A;  5A6X A;  1VBC 2;  2EIE A;  5C4W B;  1REF A;  1TE1 B;  2ENR A;  1SCR A;  3I3Q A;  4CEW C;  3Q8A A;  5FIX A;  1E5S A;  2HWB 1;  4AQ2 A;  1N47 A;  3AZX A;  1PNF A;  3WUC A;  2RS1 1;  1XYO A;  4K40 A;  2OUH A;  4QX3 A;  1HV0 A;  2DCY A;  3ON7 A;  1FPN 1;  2PQQ A;  3LKJ A;  5CBL A;  1C8M 1;  3K46 A;  1RIT A;  1HRV 1;  4UAP A;  2EXK A;  1YFX A;  1F8V A;  4QB6 A;  2A3Y A;  2VVE A;  5E16 A;  1A8D A;  5T5J A;  1QDC A;  2PEL A;  3JQX A;  5GZE A;  1UIJ A;  1GP6 A;  4YSF A;  4S2G A;  5C4W C;  1KS4 A;  4IEQ A;  2CSG A;  5DAX A;  3S7E A;  1JYW A;  2Y33 A;  2RV9 A;  1RUH 3;  2RJ2 A;  1RHI 2;  1J59 A;  2W52 A;  2E53 A;  1VBE 1;  3ENR A;  2VQ0 A;  3AX4 A;  4D6R A;  1XNT A;  4COW A;  3RZZ A;  2VM9 A;  1OQD A;  1C5H A;  3ZYR A;  1S2E A;  1AX2 A;  1CJP A;  1VB4 A;  1W2T A;  1RC6 A;  5IUQ A;  1TMF 1;  3ZFE A;  3VL9 A;  2R0F A;  3EQE A;  3FN9 A;  1MEC 3;  5LBC A;  3WNK A;  4RR3 B;  5L19 A;  3BVC A;  1Y7B A;  2B46 X;  4F8A A;  1ENS A;  1MAC A;  4TTG A;  4WM8 B;  3OGV A;  4QT6 A;  2VVD A;  4QKB A;  5EJ3 A;  5LAS A;  3FHI B;  3KMH A;  3Q9O A;  3C7E A;  1PM7 A;  4OVE A;  2JEN A;  1NA1 A;  1UWW A;  1W8W A;  4IE6 A;  4FPJ A;  1LOE A;  3PUS A;  2GAU A;  3O7O A;  4QXC A;  4RR3 C;  4LHN A;  4PI0 A;  3IAQ A;  2BOI A;  4UBG A;  5J98 B;  4YW6 A;  1H9P A;  2Q5T A;  3OJB A;  5EJZ B;  2C9A A;  1J58 A;  4FPY A;  4CDQ B;  3VZN A;  1AYN 2;  3B01 A;  4HBN A;  1CJD A;  3VBO A;  5C70 A;  3MLL A;  3NO8 A;  3B9C A;  5JMC A;  2XVK A;  3LGR A;  3UJQ A;  2IXJ A;  1W6P B;  2WS9 3;  1Q8Q A;  2ZEY A;  2EAA A;  1W90 A;  4QD2 A;  4NE9 A;  5FZG A;  4Y4Y A;  4JGZ A;  2DV9 A;  2WFF 3;  3VBH A;  2XDV A;  4RGG A;  1W05 A;  1CD3 G;  2H0B A;  5A3M A;  2R0H A;  2E63 A;  4Q0Q A;  1GKB A;  1H1M A;  4LIU A;  3JBG 1;  1FT9 A;  3KWV A;  1EAH 1;  1QF3 A;  2IXL A;  4ASM B;  1LEN A;  3CU7 A;  1G9C A;  2MEV 2;  1AR9 3;  4COZ A;  4OQ8 A;  3NV2 A;  2X10 A;  5T54 A;  5FMO S;  2RJK A;  4XMI A;  1MQT A;  3B93 A;  3VBF A;  2BVV A;  1R1Z A;  5I8Y A;  2ZA9 A;  5CFD B;  1RUC 1;  3AVS A;  4D7T A;  2NN8 A;  1ULE A;  5FMB A;  4N43 C;  1ZRE A;  3PJQ A;  3RWK X;  3WDY A;  1CX4 A;  3LZZ A;  1WW6 A;  1JOB A;  5BPX A;  2VZV A;  2OII A;  2Q8D A;  2WNV B;  4WM7 B;  2DUR A;  3VV1 A;  3PL0 A;  1Z78 A;  2WDB A;  1DQ4 A;  5IK4 A;  4Q4V 1;  4FPE A;  1Q3E A;  2HWD 2;  5I0U A;  3WNO A;  2BYV E;  5LZ6 A;  5CFD C;  3VZK A;  1ULD A;  4QPI B;  1XYP A;  1W28 A;  2JG8 A;  2PMW B;  4Z8B A;  1NE4 A;  3DCQ A;  1F4H A;  4FP2 A;  2GNT A;  2PXJ A;  4I0B A;  4CCL A;  1MS1 A;  4E4D X;  3PJY A;  4IGQ A;  4OUM A;  2QCS B;  3ZFG A;  5JSP A;  4MG2 A;  1RUI 3;  2WNV C;  4WM7 C;  4B1M A;  2VOK A;  1CAX A;  1US3 A;  3NJX A;  4HAN A;  4I01 A;  3RQ0 A;  1PMH X;  3K2O A;  2CHH A;  1SLL A;  4QPI C;  3OGJ A;  3WW3 A;  1AYM 1;  2VXR A;  3BTY A;  5IVJ A;  2UY8 A;  4LBN A;  1F15 A;  4MXV A;  3H8X A;  1Y9G A;  2XJU A;  5G04 L;  2BUK A;  2RS5 2;  3HQX A;  2EAL A;  1VBD 1;  3MI8 A;  5EIY B;  3PVE A;  2KD7 A;  5KXE A;  2DCJ A;  3S5A A;  2ZZQ A;  4FT8 A;  2GZW A;  3VBR A;  4Q26 A;  4GIQ A;  1PX3 A;  1D7P M;  4LKF A;  1PX4 A;  2IXI A;  1I5P A;  4HET A;  2J1T A;  4O9E A;  3FBY A;  2A71 A;  1OVS A;  1D4M 3;  1EV1 2;  1LJ7 A;  4FOQ A;  3T0A A;  1PGL 1;  1RVF 2;  1LGB A;  4G3Y C;  4AQ6 A;  1GLH A;  3J8F 2;  3B5L B;  2XLG A;  5FO9 B;  1NZI A;  2P3K A;  2YRO A;  1CGP A;  1HRI 2;  1T6B X;  2I45 A;  4MZU A;  4QKN A;  1A78 A;  5JIU A;  2R1D A;  3I2O A;  1UKR A;  4P9I A;  5H9S A;  2VQT A;  4XTM A;  1W6Q A;  1O6U A;  2HWF 1;  1WKY A;  2YMZ A;  2QZ2 A;  4OHV A;  2WQZ C;  5I8S A;  4DZG A;  2B4K A;  2ILM A;  1V9U 3;  2P37 A;  1YFW A;  2DYC A;  3B94 A;  4ISQ A;  4N90 A;  4XQW A;  1R1A 3;  3A0N A;  1H8T A;  4XJA A;  1TG7 A;  1EP0 A;  1POQ A;  3M3I A;  2JDA A;  3I59 A;  3VBS A;  3BPS A;  1RUJ 3;  3MO4 A;  5LBB A;  4QX0 A;  3NRU A;  5FUN A;  1VMJ A;  2AUY A;  1OKQ A;  4BQX A;  2YB7 A;  4X6R B;  3T1M A;  1CPN A;  2DBI A;  4BQW A;  5DZF A;  1YJL A;  1OSG A;  3RZL A;  1VLN A;  2GC2 A;  4AED A;  4KGQ A;  4MGZ E;  2G4I A;  2GSY A;  2WQ8 A;  4OQ9 A;  3O1P A;  1CZT A;  1OFN A;  1ZBE 3;  1OLM E;  1HLC A;  4K8R B;  4RHV 1;  3AKQ A;  3ES1 A;  3SKJ E;  1PO1 3;  3VDA A;  1QXP A;  2ZAB A;  4ZS2 A;  3GF6 A;  4B4Q A;  4EZ4 A;  1AL2 3;  1AXZ A;  5FZC A;  2PA7 A;  4QPW A;  2FDG A;  2AEZ A;  2OA2 A;  2CYF A;  1YCI A;  3T08 A;  1QIQ A;  2ATF A;  3IPV B;  2VTF A;  4CCM A;  4RQP B;  4LIT A;  1PZ9 A;  2JKX A;  4DUW A;  2ORZ A;  5I0T A;  2C26 A;  1W03 A;  4AF9 A;  2VOV A;  1W8Z A;  3HT1 A;  3I2I A;  1K42 A;  1XJA A;  1PNG A;  2GME A;  5FTT C;  3ZIW A;  1H2N A;  4PIY A;  4XUT A;  2VCB A;  4QKD A;  3D4K A;  4MXW B;  4I02 A;  4XBN A;  3N9M A;  4RQP C;  5KHI A;  2E7A A;  3IM0 A;  5BUV A;  3WP3 A;  1ZRI A;  3RYR A;  2X5I A;  5DUW A;  1LRH A;  2WN3 A;  2ZGS A;  1BHG A;  4NRQ A;  2Y6F A;  4NRM A;  2YPJ A;  4QMA A;  2FHR A;  4YVS C;  3JB4 C;  4LMF A;  2OVU A;  5C9A A;  1ENR A;  1QXJ A;  2MHF A;  5ERL A;  4B4R A;  3DEM A;  2W9X A;  3NVC A;  5FZB A;  3KSC A;  2HYK A;  4PCR A;  4RFR B;  1ACC A;  3LA7 A;  1TNR A;  3PLQ A;  5BNO A;  3BAL A;  3VDD A;  2A1X A;  4D7S A;  4FQZ A;  3QH7 A;  2IUW A;  4Y22 A;  5BXX A;  5T5O A;  1JW6 A;  2GMM A;  1YXW A;  1V00 A;  2K2S A;  4MGT A;  1RL3 A;  4BWO A;  2RVA A;  4LR4 A;  3WF4 A;  2F4P A;  3VKM A;  2JIJ A;  2UUR A;  1IOA A;  3WCS A;  3UGG A;  3KS7 A;  4YPJ A;  2GU9 A;  5LRR A;  4BLI A;  4E4S A;  2VCM A;  5JR2 A;  4HKL A;  3KCC A;  4AEJ A;  4XFB A;  4AHY A;  2QQM A;  4TXW A;  4W6Y A;  2DF7 A;  2JDY A;  5FFO C;  5J96 B;  3NJV A;  1VAL A;  3FHQ A;  4C90 A;  2Q4S A;  5J3U A;  2Y38 A;  2XLF A;  2B5H A;  4CU8 A;  1ZRD A;  3IKW A;  5FYT A;  4QQ2 A;  1COV 2;  5A3W A;  2CGP A;  4MX3 A;  3AMP A;  5C3O A;  2JEM A;  1SPP A;  3APB A;  3M70 A;  3MLK A;  4JAA A;  1ULF A;  3LWC A;  2VOW A;  2YU2 A;  2BGO A;  1JUI A;  2HEV F;  1RXG A;  4FSJ A;  1GWM A;  1W9W A;  2VH9 A;  3RZM A;  2KXL A;  4AFB A;  4Y1Y A;  2A3W A;  4JKM A;  4XFH A;  2ADD A;  4GJY A;  4CDU A;  5JXI A;  5K9Y A;  4GB3 1;  4DXT A;  2FDF A;  2V4V A;  3PME A;  2FMY A;  2YV8 A;  2R06 2;  4H55 A;  2JD4 A;  2EIC A;  3GXU A;  1CPM A;  1W99 A;  2DBN A;  3WQ1 A;  2OQ6 A;  5E8A A;  5FZ4 A;  4XDP A;  5FZA A;  4YGD A;  5IYY A;  3P6B A;  1JMU B;  3D5O A;  4IET A;  1C1L A;  1PZ7 A;  1QJX 2;  1W8F A;  4NOT A;  3S30 A;  4Y24 A;  1CON A;  1BBT 3;  5B4X A;  1JZ7 A;  3WDT A;  4IEZ A;  3N7K A;  4FFI A;  3VHR A;  2YU1 A;  4XDQ A;  3W5N A;  1AZD A;  3LDR A;  4GWM A;  1QJU 1;  2PYT A;  4JTO A;  2RS3 2;  4LKD A;  3ZPY A;  5K0U B;  4UFK A;  2EXH A;  1XE0 A;  3J7L A;  4LEJ A;  1DGW X;  1QH6 A;  2BTV C;  2TUN A;  2ZHL A;  5A7N A;  4OI2 A;  2NPI A;  5FO8 B;  2PHU A;  1US2 A;  4UYB A;  3I49 A;  1VP6 A;  4AGV A;  2ZJC A;  5FP7 A;  5A3L A;  2YC4 A;  4AYU A;  3LDB A;  3I7D A;  2RS1 3;  4NHX A;  4GUL A;  3LA2 A;  2XJR A;  2QQL A;  1S0F A;  2GNB A;  3BTZ A;  2Y8K A;  1C8M 3;  4P02 B;  2ZHK A;  3GZA A;  3O0V A;  3HBZ A;  2VMI A;  4JX0 A;  1DDL A;  3A4U A;  3N35 A;  5DQ0 A;  4COV A;  5DZE A;  4UFJ A;  5A32 B;  1QJY 2;  3TN9 1;  4A2U A;  2DCT A;  2X29 A;  4N9I A;  2R04 2;  3LCP A;  1U5Z A;  1VBE 3;  2W1S A;  3RMX A;  2BRT A;  4FPG A;  4AL9 A;  3K4D A;  3ROU A;  3UL2 A;  2VME A;  4IW3 A;  3ZN6 B;  1RUE 2;  2D44 A;  2OPK A;  3BCW A;  2DUP A;  4AFD A;  4AG4 A;  3WEZ A;  4Q0S A;  5HCA A;  1UYX A;  2WWJ A;  2WZ8 A;  4WVM A;  1RUO A;  1LOB A;  3JD7 3;  4NWV A;  1HDK A;  1Y3T A;  2WN2 A;  1H30 A;  1ZZ8 A;  2FD8 A;  2RR1 2;  3OUI A;  3E5Q A;  4EJR A;  2OPW A;  4COY A;  5FR3 A;  2WZR 3;  4XHX A;  2BW8 A;  1LU1 A;  2VTX J;  1XSR A;  3AXD A;  2PAM A;  5A33 A;  3VHP A;  4IEP A;  4BQ3 A;  1BEV 1;  1VBA 1;  1O7F A;  1WCS A;  4QXK A;  3K3N A;  2X05 A;  4AEM A;  4AVA A;  1FOD 1;  3ZXF A;  1SEF A;  1MZ6 A;  4LE3 A;  4LO7 A;  2Y0I A;  5C71 A;  3IDA A;  3H9A A;  2ZGM A;  1ASJ 1;  5IAV A;  4JGY A;  5I0D A;  3GHM A;  4FP3 A;  3K75 B;  2BFU L;  3E6B A;  2BER A;  3OTF A;  4K3U A;  1ND2 B;  4Q4Y 1;  5JI7 A;  2LTN A;  2VOX A;  4X8N A;  3RZK A;  2PLV 2;  5KHH A;  2JDP A;  1OPM A;  1CAV A;  1OT5 A;  4YZ4 A;  4AI8 A;  4DEV A;  3IDE A;  2X53 S;  1HQW A;  5I0S A;  3RGB A;  5FZL A;  3RVH A;  4OUS A;  1T2X A;  2E26 A;  3WQ0 A;  1DLC A;  1GQP A;  3IDB B;  4XIO A;  4YAR A;  3O1S A;  3ZFF B;  1ND2 C;  2HYX A;  3IN9 A;  3R0R A;  5C7G A;  3THD A;  3ZKY A;  3JBG 3;  4CCK A;  1NLR A;  1OD3 A;  1W3V A;  4KWU A;  1EAH 3;  5FBZ A;  5FO7 B;  3RDI A;  4BK5 A;  4YFZ A;  1OH4 A;  1DG6 A;  1FX5 A;  1WUV A;  3JUU A;  4J1X A;  2VVF A;  5HI0 A;  2CNA A;  1O4Y A;  3LOB A;  4BQY A;  5FP3 A;  1DBN A;  5M0T A;  2JDN A;  5DDJ 2;  3O1M A;  4Q1R A;  1UW8 A;  1FYU A;  2DU0 A;  3BOW A;  1UOB A;  4NN0 A;  3VZJ A;  2ZX3 A;  5FP9 A;  2BV4 A;  1VRB A;  2WR9 A;  2P5B A;  3VHO A;  3ZFF C;  2FZ2 A;  3L2H A;  4K9S A;  5FZF A;  2ZGL A;  3AMM A;  4CCN A;  1W2O A;  3VD5 A;  4Q4X 2;  4A41 A;  2ID4 A;  4KNC A;  1PHM A;  5IFP A;  1UZV A;  2A73 B;  3ACH A;  3OBT A;  1AX1 A;  3WG3 A;  1CZS A;  4Q4V 3;  5KHK A;  1PIV 2;  1SZB A;  1F2N A;  4HXC A;  3IB3 A;  2XLA A;  1HB4 A;  2Y6J A;  3POY A;  3AFK A;  4FPC A;  3BUC A;  5FY4 A;  3UGF A;  4XAE A;  3NST A;  4W6W A;  2XB6 C;  4QM8 A;  3RFR A;  2ET1 A;  4TWT A;  5FOB B;  1WW7 A;  1NT0 A;  2ZXQ A;  1OUR A;  4P9W A;  4X6Q B;  4YZ2 A;  3W59 A;  1VBB 1;  4AI1 A;  2AC1 A;  3V0A B;  1HJF A;  1WZX A;  1OOP C;  2W92 A;  2HWE 1;  4COU A;  2QFE A;  2RM2 2;  1OLM A;  5D8A A;  1NCQ B;  1AYM 3;  1RMU 2;  4BIS A;  4A3X A;  4D6S A;  1D2Q A;  2C5D A;  4PBP A;  3POS A;  3I2H A;  5FZ8 A;  3I4I A;  1WD4 A;  1W0N A;  2W87 A;  3WHT A;  5JAX A;  2D3R A;  4YW2 A;  2J1S A;  1NUK A;  3M3E A;  2BDR A;  2R7E B;  4B4P A;  3TEZ A;  3KV9 A;  5C8C A;  1W6O A;  1VBD 3;  2GC0 A;  2OZ6 A;  3LEM A;  4GH4 A;  2ZZJ A;  3P1I A;  3ZXK A;  3AP6 A;  1NCQ C;  1MPX A;  5DUU A;  4UXA A;  3WDV A;  4DFS A;  5A7P A;  2A6V A;  3U4S A;  2VNR A;  4QAW A;  1LEC A;  2WFP A;  3V0B B;  2R32 A;  1DGR A;  3DYM A;  1OH3 A;  4ASL A;  1N1S A;  2WO2 A;  3H7Y A;  2J1V A;  1UPI A;  2O0O A;  4UOJ A;  4BCU A;  4DY3 A;  3RZG A;  2KA3 A;  4UF0 A;  1A3K A;  4XJU A;  1WLC A;  5CKM A;  3ZSJ A;  4ZZ5 A;  3CJX A;  4N7U A;  1MS3 A;  1MVE A;  1UX6 A;  1W8N A;  3HOB A;  4B3N A;  4CP0 A;  1OQ1 A;  3HPN A;  3O1T A;  5CU1 A;  1KEX A;  2DDU A;  1RUN A;  3FFQ A;  4C91 A;  1NAE A;  4OHX A;  1FMD 2;  1Q43 A;  4MVT A;  3ABZ A;  5J09 A;  4JQT A;  4K1Y A;  2J1A A;  2HWF 3;  1FAT A;  2ARX A;  2AAC A;  2P1B A;  3DYP A;  4B7K A;  3WG4 A;  4DIN B;  2ZKN A;  4YRD A;  1MEC 2;  3C3V A;  3T0D A;  1K5M A;  3TEX A;  2QZ3 A;  3IMN A;  5LAT A;  3HQU A;  5E88 A;  2OW4 A;  1SDW A;  4YM3 A;  1NLQ A;  4E2S A;  2CL2 A;  2P6C A;  2ZPX A;  5T50 A;  3SCG A;  2VUJ A;  1Q5O A;  3A23 A;  3T1L A;  3N9Q A;  1NA1 C;  1VE0 A;  5C6C A;  1IHM A;  1VMF A;  2D3P A;  4JV4 A;  1UNB A;  1C1F A;  3GM8 A;  4Q5O A;  4YM0 A;  1PK6 A;  2ZMN A;  2ZGK A;  3GBW A;  3IDC B;  4FPH A;  5A7O A;  4BMB A;  4BA6 A;  1AYN 1;  1ZM1 A;  2VUD A;  3VD9 A;  1AR7 3;  4DO0 A;  5FAX A;  5I93 A;  5T5L A;  2F4L A;  2CWM A;  1AJK A;  1QJF A;  4GAL A;  3A0K A;  4RHV 3;  1AHS A;  2FCV A;  3CLP A;  3WSO A;  5DAV A;  1JU4 A;  4NIA A;  5DAW A;  1SDD B;  5ACA 1;  3O1V A;  1JHN A;  1UMZ A;  2VZ3 A;  1BXH A;  5CEH A;  1O8S A;  2WS9 2;  3LEI A;  2XWB B;  2W39 A;  2GH8 A;  1KDM A;  1MR5 A;  2WFF 2;  1W8O A;  1JZ4 A;  1W0P A;  3AJZ A;  2MEV 1;  2VZP A;  3HIF A;  1IKQ A;  3W9A A;  4CDW B;  1BK0 A;  2WA3 A;  4A7Y A;  2LRO A;  5L36 A;  4LBO A;  4MGS A;  1O8P A;  5SV5 A;  1AR9 2;  2QQW A;  4HT1 T;  3F95 A;  3HNB M;  4OMC A;  5DUX A;  3VD3 A;  3WF3 A;  4AI9 A;  3H0O A;  3KGL A;  1BLZ A;  4J1W A;  1OMI A;  1UY4 A;  1APN A;  2J22 A;  2IZW A;  3GAL A;  3KHB A;  4EN7 B;  1REE A;  2G9Z A;  2JG8 B;  2WL1 A;  1KD7 A;  1QQP 3;  4LA3 A;  3TYJ A;  4CCE A;  4XTP A;  4CDW C;  3NV1 A;  4GXL A;  5FK7 A;  1GSL A;  4OZO A;  1RUF 1;  2VQA A;  2CY6 A;  1W6N A;  2HWD 1;  2VZ1 A;  3Q8E A;  2RJL A;  5IW0 A;  1IS4 A;  5IK7 A;  2VOT A;  3O1O A;  5A3U A;  2IFW A;  2WC2 A;  4XBL A;  4IDZ A;  1W8U A;  3DXU A;  3WR0 A;  1BVP 1;  4BM8 A;  1XXN A;  2E33 A;  2JG8 C;  5CNA A;  2Z79 A;  4CPB D;  1H2M A;  3QD6 A;  4LOT A;  1IQA A;  4XUN A;  4QQO A;  2CV6 A;  4Y20 B;  4JDO A;  1UIK A;  4I2O A;  4QU2 A;  3GDB A;  1OC1 A;  3NWK A;  1RUI 2;  4IXL A;  5FRE A;  4MGQ A;  3WDU A;  2XL7 A;  1PGW 2;  5F9T A;  2YZ4 A;  3CZJ A;  5FZD A;  4CEW B;  2ZGO A;  2V72 A;  2A70 A;  1WCQ A;  2MPF A;  4GJZ A;  2RS5 1;  3KD4 A;  4P5H A;  1R09 2;  2D7F A;  5LK7 B;  1LU2 A;  3AKT A;  4Q4W 3;  4DMI A;  3NV3 A;  4Y1U A;  2WSV A;  4N53 B;  5FYM A;  2FBE A;  2OKX A;  1DQ1 A;  1UYZ A;  4GWI A;  3ZXD A;  2QQN A;  4XFA A;  5A7W A;  2BGP A;  2KR2 A;  5LW9 A;  4K1Z A;  3L2Y A;  4XUO A;  4M0N A;  2OZJ A;  2PHT A;  5FY9 A;  2YBP A;  4NIH A;  3MW3 A;  5CKN A;  3OYW B;  2VBD A;  3AB0 A;  3QCW A;  4KBZ A;  4XHB A;  2Q8C A;  1EV1 1;  4FPF A;  4P9J A;  1AR8 1;  4N53 C;  4MHU A;  3H42 B;  4G4F A;  1K12 A;  4LKS A;  3BOD A;  1YNA A;  2VZQ A;  1H8T B;  4LOS A;  4RS5 A;  1HRI 1;  3NW4 A;  5FZ6 A;  2HBU A;  3HNM A;  1UL9 A;  5JLV A;  1W2A X;  1GIC A;  5BNN B;  2YGL A;  3A7Q A;  4IEO A;  4IEY A;  4EZH A;  4L2N A;  1NCR B;  1GP5 A;  1CWP A;  2D6K A;  4LXL A;  3K4Z A;  3BIW E;  2JG9 B;  3E5U A;  5IVY A;  3VBU B;  4MUV A;  4HSL A;  4RL7 A;  5DUV A;  3L9J T;  3AP5 A;  2F17 A;  2GND A;  3K3O A;  2X8K A;  4EN9 B;  3HJR A;  1H8T C;  1V9U 2;  2LUW A;  3CBN A;  5FY8 A;  5GLV A;  1WCK A;  1R1A 2;  5CA6 A;  2QQI A;  3I2F A;  4C1X A;  2C6S A;  4LPL A;  3T30 A;  5BNP A;  4PDW A;  1RUJ 2;  5BNN C;  3NNJ A;  4LBK A;  1NCR C;  3LSE A;  1O3R A;  2HKX A;  2JG9 C;  2YGM A;  2WT2 A;  2W08 A;  3R4D B;  4LO6 B;  4PQ9 A;  3VBU C;  2VXJ A;  1EUT A;  1RYY A;  2IFR A;  3R05 A;  4D94 A;  1XU1 A;  1N3Q A;  1OLQ A;  3ECQ A;  4MGK E;  3WF2 A;  5ABJ A;  2BNN A;  2C1F A;  3VKF C;  2A3X A;  1Y43 B;  3TN9 3;  2CDO A;  2YFU A;  3AYC A;  1OF4 A;  1AUY A;  5FCC A;  3OB8 A;  3GZE A;  4WZF A;  3RSJ A;  2FDI A;  2ERF A;  5T5P A;  3H8U A;  4WVV A;  5F3I A;  3M1H A;  1W2N A;  4EV0 A;  4PF5 A;  1UXZ A;  1PO1 2;  5FXX A;  3LIH A;  4UW3 A;  3JXS A;  4ZY9 A;  1AL2 2;  2RDR A;  5FXZ A;  1EUU A;  4NRP A;  2DUO A;  1BK1 A;  1PGS A;  3UKT A;  2RDQ A;  1S2B A;  5FMC A;  5CAZ A;  1J84 A;  4LBQ B;  2ORX A;  1QOS A;  3I2J A;  1HKD A;  1HN0 A;  1POV 3;  5AVA A;  4AE2 A;  2Y6H A;  1BEV 3;  1VBA 3;  2JX9 A;  5KXD A;  4YZ3 A;  5HCB A;  3FBM A;  1FOD 3;  4N43 B;  2VPV A;  4HN1 A;  2PHW A;  5J36 A;  4KG8 A;  1UZY A;  3III A;  4QWN A;  3U14 A;  4BQ4 A;  2XPJ A;  4EWE A;  1AXK A;  1ASJ 3;  2XL9 A;  2BBV A;  2QBX A;  3RJR A;  1JYC A;  5E89 A;  4BIF A;  3PU3 A;  3H8R A;  4IE7 A;  1H9W A;  5JPN B;  2VMC A;  5LK5 A;  5BNO B;  2FQP A;  3VDD B;  3B00 A;  4I09 A;  3H7J A;  2Z4F A;  1ZBA 3;  1CAW B;  1ODM A;  2VCA A;  5BY5 A;  3QBQ A;  4PQQ A;  5K4L A;  5ANQ A;  5FPB A;  3JB8 A;  1UMI A;  4RD7 A;  5IVB A;  3KQR A;  4IEV A;  4HK8 A;  2JEC A;  2G19 A;  1NG0 A;  1DQ0 A;  2PTM A;  4MSV A;  3PUA A;  1JYN A;  5BNO C;  4IER A;  3VDD C;  4GAZ A;  1KQR A;  2BEO A;  5H9P A;  1PZ8 A;  2HWC 1;  2Z2S B;  4XFG A;  1SMV A;  3LPF A;  3VGI A;  3CKH A;  4K20 A;  1RIN A;  4UFL A;  1YQ6 A;  1LHV A;  2GDF A;  2D5H A;  1LHO A;  4M3C B;  3I3B A;  4G9S B;  3IBM A;  3A22 A;  1ULO A;  2CGN A;  5C5T A;  3ATG A;  2D6L X;  3PIG A;  4CDU B;  5L7O B;  3ZYF A;  3MF9 A;  1GP4 A;  2XQR A;  1DQ2 A;  2XJS A;  3MHZ A;  5FY1 A;  1J83 A;  3RPQ A;  2EA7 A;  5FYI A;  5GZC A;  4MGI E;  5GZG A;  1WBF A;  1KJL A;  3ILR A;  3LEG A;  3ZSE A;  2E7T A;  1GZW B;  1O3S A;  1LOA A;  3O5S A;  2GMP A;  3URF A;  5JOX A;  4CDU C;  2R06 1;  4Q2F A;  5L7O C;  1DYP A; 
#chains in the Genus database with same CATH homology
 2FDF A;  3H8O A;  3S57 A;  3O1V A;  4NRO A;  4O7X A;  3RZH A;  4ZS3 A;  3O1U A;  3RZL A;  3BKZ A;  2FDK A;  3BUC A;  4IE5 A;  3O1P A;  3BIE A;  2FDI A;  3I49 A;  4ZS2 A;  4OCT A;  3KHB A;  5F8P A;  4IE4 A;  4NJ4 A;  3O1R A;  3BTZ A;  2FDG A;  4NRP A;  4NPL A;  4CXY A;  3T4V A;  4IDZ A;  3BTX A;  3I3Q A;  4QKD A;  3H8X A;  3H8R A;  4IE7 A;  3T3Y A;  4ZHN A;  4MG2 A;  4CXW A;  3I3M A;  2FD8 A;  4CXX A;  4NRQ A;  4NRM A;  3BTY A;  3O1O A;  3RZG A;  3RZJ A;  3O1T A;  4RFR B;  2FDJ A;  4IE0 A;  4NID A;  2IUW A;  2FDH A;  4O61 A;  4JHT A;  3S5A A;  4MGT A;  3BI3 A;  4NIH A;  3RZK A;  5DAB A;  4NII A;  3LFM A;  3KHC A;  3T4H B;  4QKB A;  3BU0 A;  3O1S A;  4IE6 A;  4NIG A;  4QKN A;  3I2O A;  4NPM A;  3RZM A;  4QKF A;  4QHO A;  3O1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...