3T4VA

Crystal structure of alkb in complex with fe(iii) and n-oxalyl-s-(2-napthalenemethyl)-l-cysteine
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
199
structure length
199
Chain Sequence
LAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase AlkB
publication title Dynamic combinatorial mass spectrometry leads to inhibitors of a 2-oxoglutarate-dependent nucleic Acid demethylase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 48
structure length 199
sequence length 199
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2011-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3t4vA00
3T4HB 3O1SA 4CXXA 4MGTA 4RFRB 4ZHNA 4ZS2A 2IUWA 5DABA 4QKDA 3BU0A 4CXWA 3BTZA 3I2OA 2FDHA 3BKZA 2FDKA 4NRMA 4NJ4A 4JHTA 4QKFA 4QKBA 4IE5A 4IE0A 3S57A 3O1RA 3RZHA 4NIIA 4NRPA 4NIHA 3O1OA 3RZKA 3KHBA 3BTXA 3I3QA 4IE7A 4ZS3A 4OCTA 4NPMA 3BTYA 3RZJA 3H8XA 3LFMA 3KHCA 2FDFA 4MG2A 4IE6A 3BUCA 4CXYA 2FD8A 3RZGA 3O1TA 3RZLA 4IE4A 4O7XA 4NPLA 5F8PA 3O1MA 4O61A 3I49A 3O1UA 3O1VA 3BI3A 2FDGA 2FDIA 4QHOA 3BIEA 4NIDA 3S5AA 3H8RA 4IDZA 3T3YA 4NRQA 3I3MA 3O1PA 3H8OA 4NROA 3T4VA 2FDJA 4NIGA 4QKNA 3RZMA
chains in the Genus database with same CATH superfamily
3MLLA 3MF9A 2BWCA 2KA3A 3LB9A 2UYBA 2Q1ZB 4XFFA 2W3JA 4KI5M 1FATA 1H6YA 2PQQA 4WVZA 4XXAA 4FQZA 5DZEA 4AI1A 2QQPA 3ELNA 4XAAA 2YGMA 2R30A 3LIGA 5FCCA 2ARAA 4IXLA 2HWF3 2VMDA 2QDRA 3ZXFA 4EWEA 1YI9A 1ODNA 2CWSA 3GJAA 3GZTB 2BDRA 1TZOA 2F4LA 2K2SA 4TN7A 4C8DA 4OULA 2JG8C 1ONAA 1TVGA 1OH3A 2HH9A 3OUHA 4IESA 4YLZA 2K9ZA 2ERFA 1OI6A 4EN0A 1HX6A 1YQCA 4YM3A 1JYVA 2HWC2 5C70A 5JMCA 2VO5A 1RINA 4KU8A 5IK8A 4IE5A 1FMD2 4QKFA 2A73B 3ATGA 4D7TA 1ZZ9A 3S57A 2ZTNA 2CAVA 3MICA 2AR6A 4P9WA 5B4XA 5IK4A 4U36A 1QJU3 2VBPA 4PBPA 4EZHA 2VBDA 5A6XA 1ZRFA 1ZZ8A 3MIDA 3KM5A 4JGZB 4L2NA 2WRAA 3OY8B 3CF6E 1N1VA 5K8SA 4FPJA 4AVBA 4MHRA 4BIFA 3O7OA 1W8ZA 1QH7A 2ADEA 1QXRA 2Y6JA 1NA1B 3DXTA 4XEZA 5CFCC 2WNOA 1MACA 5FLIA 1S0DA 1RUF2 5BXXA 4F8AA 1HB3A 4IEXA 1GZWB 1SCRA 3U11A 3MO4A 1NYWA 2Z79A 3E6BA 1R082 4FOVA 1D0GA 3UYJA 1O3QA 4AHWA 5A7NA 3ZXKA 2ZEWA 3ZVXA 1Z7S3 1AX1A 2ET1A 1H8TA 2QQVA 4HKWA 4KWLA 2BOIA 2W1WA 4P08A 1CR7A 3UJOA 4LUKA 2FDFA 5IHRA 1GQGA 3JD71 1DQ1A 2JG9A 2CSGA 1AL21 4GIQA 2AH2A 4IE6A 1W8WA 2JENA 5HCHA 2JG8B 4CXYA 3VBUB 5BYNA 1L7RA 4N43A 2VULA 4Y22B 1CAUB 4F7ZA 1HQLA 3KVAA 3AM2A 5FPBA 1D4VB 4XIKA 1UWWA 5T55A 4BQ1A 3VDDA 4YGCA 1TQ5A 1UYYA 5I0RA 4NPLA 5F8PA 2QQJA 2R043 4HETA 4DUVA 2UWAA 4URTA 1W6NB 3U4SA 4CUBA 1SDWA 1VRH1 4CCEA 1RMU2 3NL1A 5CISA 3NSTA 4PDWA 5C8CA 5IK5A 2W91A 1Q8QA 1LODA 2JE9A 2WT0A 2GDFA 2PHTA 2ETEA 1UXZA 3CQOA 4UBGA 4CDWC 4IEQA 2WQ4A 1FYUA 5CFCB 3POJA 1U0AA 4A41A 2PHFA 3LSEA 4Y1YA 3I3EA 1NCQA 3DYPA 4LBQA 1SLIA 3R4UA 1OMIA 2JDMA 3O0VA 4IEZA 3RNSA 4COWA 5IYYA 1WD3A 4HSJA 3GZUC 1QQP1 3R6SA 3TEWA 2WUHA 1AJOA 2A71A 5F7UA 1MQTA 4ASMB 3ES4A 3HAGA 1EUUA 5J98B 4JVAA 4CPBD 1DF0A 4HONA 5FZIA 2B8MA 3CLPA 1NAEA 1VE0A 5F2SA 2DVFA 2Y6HA 4CDWB 1KQRA 2QQKA 5LASA 1OF4A 5C33A 1YEWA 1ACCA 5BNPA 4LK7A 2JD4A 1GP6A 3I54A 3VD5A 3I2OA 1GYKA 1XU2A 1LOGA 2NZ9A 3ENRA 5DUVA 5IFPA 1NLSA 2WT2A 5FZ7A 2F4PA 1HW5A 3LFIA 5LBCA 3UGGA 4CEWB 2D40A 1O5LA 3DKWA 4AE2A 2BGOA 5IK7A 2QUOA 3PTYA 4JKLA 3BPSA 4QDSA 5LW9A 3H1WA 1OD3A 4QXKA 5BNNB 3AL5A 3E5QA 1H0BA 4CP0A 3OPZA 3JD73 3POIA 1LRHA 1LJ7A 1AL23 1QJX2 1W2NA 1W8NA 2EXKA 2ZPXA 1IGOA 1PVXA 1B35B 2LS6A 3OD4A 3SLIA 3OGSA 1KFUL 4E2GA 4YARA 1ZA7A 1AZDA 4XUOA 1WMDA 3IAPA 4RS5C 4XACA 2EALA 4LQRA 4XF0A 1FT9A 5F5CA 4H3WA 1TME3 5GLWA 5ABJC 2W47A 4QWNA 5FV3A 1AL0G 4Q4W2 1GMMA 2XUEA 4GQ7A 3M1HA 3KD4A 4YW1A 3GCXA 5DUWA 3TWIA 4RGGA 1YXWA 3ETPA 3VB9A 4QX2A 5T5LA 4ZXKA 1SPPA 2HWE1 3ZYPA 2RJLA 4NPMA 2W0XA 3EQEA 1YJLA 1EV11 1H4GA 3N7KA 2MHFA 4QPWA 4CA9A 1H2MA 1W6MA 1GNYA 4W6YA 3HT1A 5LY1A 2D5HA 3E5XA 5FZ0A 5GLZA 1HN1A 4Z1VA 3WG4A 1ZBE1 4Q0UA 3MUZ1 5I8TA 2D6PA 1C8M1 1I9RA 3SHRA 2WC2A 3ZKUA 4AAXA 2V73A 1NE6A 1S0FA 2YZ4A 4LKFA 3AP6A 3SEEA 5FMOS 5IVVA 2A6YA 4XQ4A 1ZZ6A 1QQP3 2BNOA 2YXSA 4GJZA 4M4RA 4WM8C 4YVWB 5FRAA 3SKJE 4D8MA 4FPKA 1NX9A 1UYPA 4AZZA 4H2AA 5KHJA 5L73A 4DXZA 2OUJA 5L36A 1WMEA 3WLUA 1AX2A 3LEIA 1XYNA 3ZFFB 5CKNA 3VBRC 4MUVA 5EZWA 4XFHA 3IBMA 1BK1A 2DTYA 1IS5A 4D69A 4RS5B 2BEOA 4KL1A 2VMCA 2WN3A 3H8RA 2A7AA 5ABJB 2Y34A 1R092 3TEYA 3ABZA 3WCRA 4O9GA 5KBFA 1CWPA 4HK9A 4H14A 5FUNA 1Q8PA 3KMHA 4GAZA 4Q0PA 4O65A 5IVFA 5BUVA 5KXCA 4AI0A 1VBE1 2WQZC 4FSJA 2ORZA 1VAMA 5FY4A 3WDVA 4XBQA 1SEFA 4LMFA 5JUVA 1RUJ3 3AYDA 3NAPC 1W8OA 3J8F1 3APBA 3N9MA 2CGNA 5FZ4A 3H42B 5GZFA 3RZZA 1W8FA 3KVBA 1JZ5A 4CP2A 4KH9A 2YFZA 4M3CB 3T0BA 3ILNA 3IPVB 1J1TA 3PMEA 4GZ9A 5FLHA 1A34A 4W6WA 4B8EA 3R4DB 4W50A 1JZ2A 3VN4A 4R9AA 1KITA 4Y1VA 3RYPA 3FUOA 3LF7A 4IEWA 1GV9A 3LOBA 4QKDA 3ZXEA 1SBFA 4WM8B 1URXA 4DUWA 3BOWA 1SFNA 1NY72 1U5XA 4W6XA 1A6CA 3KT1A 4KG8A 3DPRA 3HN3A 4WVMA 2R042 5C6CA 2ZMKA 5LBBA 4QU2A 2HWE3 2YG0A 4NRMA 3WDWA 1FPN3 3HJRA 2JDYA 1S1AA 1DYKA 1EV13 1JW6A 4C1WA 4CE8A 3LZZA 3KV6A 3VBRB 1AR62 2Y60A 4XDQA 5FZKA 2XJPA 3TN93 1VBC3 5JZGC 3NNFA 1JI6A 1ZBE3 1Y7BA 2AREA 1JMUB 4QAWA 1D4M3 3E6DA 1C8M3 1F4AA 3DF0A 3KQ4B 4NWVA 2BJSA 5FY9A 2DCYA 2PYTA 3W5MA 3MGUA 3T2TA 4JTOA 4OMDA 1K5JA 2A3XA 3ACFA 4RN5A 1O4ZA 1DQ4A 4B29A 3KHBA 3HEIA 1R1A3 4MSVA 4MYEA 5FAXA 5A7SA 3S7IA 2ARCA 4P9LA 1VBB3 1RUE2 4FPOB 1XE7A 1AF9A 4JTNA 2Z2SB 2VJXA 3TEXA 1JOPA 3RJRA 5FOJB 3EJKA 2NQYA 1G9AA 3RWNA 5FMBA 1QH6A 5ANQA 1LTEA 1ND3C 2RVAA 2XVLA 2B42B 4URAA 4GH4C 1HIXA 5L7OC 1QGLA 1L3JA 3A0NA 3AFGA 3QD6A 1ZNPA 2D44A 5BPXA 3RMYA 4BU2A 3ILFA 5DZGA 5A3OA 4Q4Y2 5K9YA 2VECA 1VBE3 4XJZA 3ON7A 5A7WB 3WDXA 1DG6A 2D6KA 4XCBA 3IIIA 3VZJA 3ZSJA 1ASJ1 2N7GA 4S2DA 3VZNA 5A3LA 1UMIA 2PLV1 2YB7A 2YDEA 2ZCWA 5AC92 1STMA 3AZZA 2QNKA 1UW8A 2FZ2A 3IZOA 3IMNA 5JZGB 3I3DA 5GM0A 1V6NA 4Z07A 1W6QB 4I0AA 1QJY1 3CL1A 1PVC1 1UNBA 4LUMA 1C8NA 3FBMA 5LEJA 4OI4A 4Q4X1 4Q4V1 3POBA 1TME2 2FHRA 1AX0A 2VTXJ 3CHXA 3VBOC 4L11A 1B09A 3AP9A 2R0HA 4BMBA 3DEMA 1UKRA 3WX5A 3WW3A 3AMHA 1NCRA 5JOYA 3OGGA 1E5RA 1PK6A 1SACA 4PLNA 2QFEA 1WZXA 1S4CA 4YM0A 1RUC1 3SC7X 3U75A 2NPIA 3AJYA 2R16A 1V6JA 3CEWA 3WY6A 4Y20A 1WA4A 4Q1PA 5C8WA 2YFUA 4R9BA 3ZKYA 2LW8A 4GH4B 5L7OB 4XJ8A 1H30A 2BGCA 3H0OA 3VBFC 4UXAA 4NHXA 4QHZA 2GP5A 4LE3A 3VKOA 2D93A 4WV8A 3VBSC 3RSJA 3WNXA 3WUCA 5J48A 1YFYA 4XBLA 5L19A 1DYOA 4HK8A 5FZGA 2AACA 4DQAA 5F37A 2HEWF 5JI9A 1VB4A 1CJDA 4DXRA 4P9GA 2ZXQA 1LHWA 1WW5A 4MH0E 2A5ZA 3KV9A 3USUB 4BB3A 3VDBA 5FZOB 5JSPA 4AXOA 1V6OA 1UOGA 2KD7A 3OBZA 4A3ZA 4AI2A 2ZGLA 3MPPG 2J1EA 5EJ1B 3RPQA 3MZHA 1PNFA 5FP7A 4JGZA 2IVJA 1QKQA 2OUHA 2ZA9A 5A3TA 2EA7A 3OY8A 5DUUA 3V56A 4C0HA 4HN0A 3BU7A 4Q2FA 1CAXB 1T6GC 4LBQB 3VD9A 3VBOB 2LTNA 2WSUA 2HWC1 5KHGA 1JN2P 3H3ZA 5FY7A 1NA1A 3PUHA 3EB7A 2RS33 2QQWA 2RDQA 1FMD1 5FY8A 2BGPA 5I0DA 1IQAA 1S55A 3G7DA 1GZWA 1LHNA 5HCFA 1ASJ3 3ZYJB 4IV3B 1RUJ2 5FZ6A 2P34A 1O3TA 4EN6B 2VMGA 1YYNA 2VOXA 1BBT3 2XQRA 5EHDA 2GC1A 3MHZA 2E7QA 5C9AA 3M8LA 3ETQA 1IPKA 1G9CA 3AVSA 1QJY3 1CX1A 1OUXA 1Q5OA 3VBFB 1XB9A 5FMOL 3WNMA 1UPIA 2KXLA 5C4WC 5GZCA 2ZGKA 4N9HA 1BHGA 1DYPA 1FOD3 2JG8A 4P14A 4X6QB 4YRDA 3KSCA 5G04L 4EZ4A 3FC0A 3H8XA 4I3PA 1RUF1 3I8TA 4Y22A 1CAUA 1RGSA 1JU3A 5A33B 3MUY1 1R081 1NG0A 1SFPA 1XXNA 1UU4A 1RUC3 3NRUA 1EAH3 1PMJX 1CVNA 5FZ3A 4GD4A 1FPN2 1AR72 2JXAA 1RXGA 1W6NA 3AFKA 2J1AA 2P2KA 4OI1A 2VZ1A 5CU1A 1NE4A 1NZIA 4E27A 2JEMA 4IE4A 1WCSA 2PHXA 2X53S 4MGKE 4O7XA 5CB7A 3TN92 1VBC2 1UY0A 4LLFA 4LJHA 3WW1A 1SLCA 4GB33 3UJQA 3MLJA 4TSVA 1D4M2 2MPFA 4ZONA 2WYFA 2A1XA 3SISA 3U1XA 3K51A 4ISRA 1UMHA 5HPOA 5CFCA 3RI9A 3ZYFA 3IM0A 1C3HA 1Z78A 2PTMA 4M4PA 4LORA 4G4FA 3KV4A 5JPMB 1KRIA 4D7SA 4DO0A 3TNPB 5CG8A 1R1A2 3KCXA 5CA6A 2RM23 1VBB2 1IPJA 4E2SA 3ZIXA 4LOTA 1RMU1 2VVEA 4YM1A 4COVA 5DDJ2 4AEJA 1VAVA 3DN7A 1W03A 2XVGA 2VBBA 5DXDA 4A6SA 2BWAA 5A3MA 3V0BA 1TE1B 1SBDA 2Z4FA 1YRZA 5FZMA 4CCMA 2XKPA 3H1MA 1SQ4A 3LWCA 5C4WB 2FMDA 3MIEA 5CFDB 2G9GA 4ES8A 3AMQA 3E1F1 2Q30A 4XTMA 1BK0A 2EF6A 4AVAA 3MV11 1OLRA 2CY6A 1FNYA 1X82A 1DZTA 5C3QA 3E97A 3WINE 1HB1A 5FYIA 4IUGA 5FO8B 2WZPP 2XBO2 3POYA 1RVF3 2R49A 4P02B 4TXWA 4A2UA 4CEWA 2JDZA 3B01A 3FX3A 4BH9A 1V9U2 4QHBA 5EFUA 5DAQA 5BNQA 5KHKA 1Y3TA 1IKQA 2VVFA 4Y24A 3AMNA 4YZ3A 2XHNA 2ZJCA 4CDWA 4DXSA 2W46A 5KR7A 4NOTA 3P5BA 1X50A 2VOTA 4CTEA 5JSRA 5H9QA 1RJ7A 1G6NA 3H9AA 3I2JA 1GQHA 1RUF3 2BERA 3RZHA 3W58A 4BHPA 1TEIA 4NRPA 3Q9OA 3UL2A 1JZ3A 2WNUC 3B93A 3DECA 3FLPA 5T3NA 3O1OA 3DXUA 4OLLA 1BMV2 1ULFA 4A45A 4AG4A 3DYOA 3SMHA 4B4QA 5FLJA 3TNQA 1N1SA 2AGSA 1LOAA 2WJSA 1QJX1 5FY5A 3AP5A 3BB6A 4YZ2A 1OHFA 5DG1A 4IE7A 4H55A 1PIV2 5F9TA 1CAWA 3H50A 4BM8A 1QWRA 3M4FA 1OVPA 2LALA 3FHIB 2RS13 4QXCA 2QQNA 3VHPA 2NMOA 1KS5A 4Q4W1 4B1MA 4M3CF 2MEV2 4A44A 2G19A 3AX4A 3SQOA 5F1RA 4P00B 3LFMA 3GCWA 3KZ4C 4YG6A 3WHTA 2UWCA 1NLQA 3I2FA 1REDA 2ZGRA 2C5DA 4LBQD 4YVWA 4UW3A 4YZ1A 1RMU3 2K46A 4DXTA 2AZ5A 4PBOA 5IT6A 5FK8A 3T0AA 1JYTA 3RRDA 1CIYA 2RDSA 2RV9A 4DY5A 2BTVC 4CEYC 4EROA 3ZFFA 2WQ8A 5KC6A 1ULCA 5J1XA 4WVWA 1UPSA 1PX4A 3LA2A 2TNFA 4V2VA 5DPNA 3VKFC 4JRLA 4RS5A 1L7QA 5ABJA 4QMAA 3ACGA 4ZU4A 2QZ2A 1JYXA 1LGNA 5LATA 3KCYA 2WNUB 5J96B 1CAVB 1PZ9A 1POQA 2RS32 1QJEA 4AI3A 2Q1MA 1P8JA 1BQPA 2IXLA 3N9PA 4NE9A 4YFZA 5FXWA 3NVCA 3M2MA 2RJ2A 2ZX3A 3N36A 3THCA 3QLQA 3HIFA 1BBT2 4XPVA 4WZCA 1UF2C 4XUTA 3ZPOA 1OQDA 4M0HA 2VVDA 1IQDC 1UZWA 1WW7A 1PK6B 3WR0A 4M3CA 5EIYB 3QCWA 3SITA 3IPVA 5F3GA 1TG7A 2XLFA 4MZUA 5CZKA 5A80A 5FZ1A 1R091 3T09A 3MIBA 4ARYA 2PHRA 2D6NA 1FOD2 1UCXA 3NQHA 4YGEA 4QM8A 3WF1A 5AVPA 5JXIA 4UW5A 2EIBA 4RL7A 3N7JA 5GLUA 1QJZA 3KGZA 4AQSA 4WM8A 1UZ0A 3NV3A 2RS52 4LHKA 1EAH2 4RHV2 2WL1A 4AFMA 4ZZ8A 1H2KA 3ACIA 1COV3 5F5IA 2JECA 4UBHA 5FMCA 1KXGA 4META 2OYZA 4IW3A 3O12A 4OHXA 2AC1A 4ASKA 5CVRA 3VBRA 1DIWA 2XPJA 2YY1A 4FPHA 2FDKA 3WNPA 4GB32 1XYOA 3MBWA 2DCJA 3JU9A 5EQUA 4BK5A 1V6MA 3JZVA 4UFJA 4Q4W3 3GYDA 4GKXA 2GSYA 1W04A 4XETA 4Z2WA 1NY71 4FT8A 5HXMA 1XJAA 5SV5A 5LWBA 2JDPA 2R041 2VMFA 1W9YA 2RM22 2W39A 2XJRA 4Y20B 2XJSA 4JZRA 1OKQA 2XMLA 2YU1A 1IG3A 3EMRA 1GICA 4MVTA 1JS9A 4R4XA 1DQ2A 2VZQA 1AR61 5A7PA 4OYUA 3KV5A 1J3QA 3RYRA 4UFMA 4PF1A 3NNGA 4AFBA 4DPNA 3HWJA 1OPOA 1RC6A 3LD8A 4LEJA 4PLOA 5JWPA 4MGQA 5F6LB 4HBNA 5CYYA 1MS1A 1UMZA 2C9AA 3P6BA 1F8VA 3AP7A 1JUHA 2W08A 2XWBB 4WM7C 1SLLA 4IGOA 2GNMA 4O9EA 1K42A 3O0XA 3PMSA 3PIJA 5FYVA 1US3A 3FL7A 3O14A 1KEXA 3GBGA 4Q29A 4IERA 1CZVA 3HQXA 3LE0A 2A6ZA 1OUSA 2DFBA 3I2HA 3ACHA 4L0PA 3LOIA 1RUE1 1RVF2 5A7WA 4UFIA 4FO9A 1O91A 1WWYA 4BQ2A 1KFXL 3PJQA 1G9FA 3R0RA 3UESA 4AAPA 1YJKA 2QQIA 4RQPC 2E7TA 5JZGA 1LOEA 5JOWA 2DTWA 2WABA 3OBRA 1R093 2D98A 1A8MA 1W6QA 4A7ZA 5FIXA 3RGBA 4TYSA 5B4NA 1UIJA 3TYJA 4E4HA 4CUCA 4Q4Y1 2VZTA 2P3IA 2RDRA 4YPJA 1AXKA 2FCTA 2DUQA 1FAYA 1RITA 2G9FA 3MFAA 5FZFA 2UU8A 2D3RA 4QD2A 2JDHA 1S2KA 3AKTA 5IVEA 5AC91 3VD4A 3U07A 1RXFA 3IMMA 3OEBA 3IDAA 5IFTA 4CCJA 4PIXA 5K7PA 3T1LA 4BQ4A 2C24A 4BLIA 3T4VA 1ND3A 4WM7B 4GH4A 5L7OA 5F32A 3WNKA 1TME1 4QKNA 5FXZA 4XDPA 2RS12 1MEC2 1OFSA 1OQ1A 2RG4A 2VY0A 1O7FA 3AYEA 1CX4A 3WZ1A 2WZ8A 4FPLA 4CCNA 1V00A 2CAUA 4MGTA 4ZHNA 1AR63 1YI7A 4UFHA 3TB0A 5FPLA 4IEVA 3VL8A 2WO7A 3O5SA 4Y26A 2OZJA 4ZS2A 4YGBA 4RQPB 4PI0A 3Q8CA 4MV2A 3USUA 2IUWA 3LGRA 5FZOA 1H8VA 3O1RA 4NMIA 2VQ0A 2CGOA 1R1ZA 1G8WA 3SCGA 3AK0A 2VNGA 3GZEA 4JAAA 4BE3A 2Y38A 4R8HA 1CAXA 1DGWX 2XVKA 3BODA 4C91A 3VBOA 1W2TA 5FKBA 4K7JA 2VW0A 2XJQA 4LBLA 5JIAA 4OQ9A 5E6HA 1RUE3 3BCWA 2P3KA 4FCAA 3CZJA 2H0VA 1DGRN 2WWSA 4JHZA 1V6KA 2B39A 5K0UC 4MGYE 4GWMA 4IV3A 3UKNA 3V0BB 3AL6A 3MW2A 1ZRCA 3ACLA 3PVEA 3RVHA 1XNKA 1RUNA 1J84A 1J3RA 1FI2A 1S0GA 3I7DA 3FUQA 3PU8A 3B5LB 3MEPA 4H7MA 1JH5A 5EJZB 4BQ3A 3PLQA 3DYMA 3MYXA 3GJBA 3NW4A 2BFUS 3I4IA 3VBFA 1LESA 3VKMA 3WQBA 5J7MA 4Q4Y3 5FQ0B 3PURA 4YW4A 2NN8A 4UW6A 3VBSA 2FBEA 1FV2A 3D3AA 4BWOA 3RJ2X 3ZM8A 4PHZA 3ZYIB 2W1QA 4AGVA 4LBOA 3K4ZA 5JR7B 3E5UA 5A1LA 5FYCA 1LGCA 5A33A 1RUJ1 4DNYA 1YIFA 2C4XA 1K3IA 5AC93 2JKBA 1COV2 5DN2A 4ZU5A 4QXHA 3WSOA 5C71A 2DCKA 3OB8A 4FQ4A 2XONA 3PU3A 1OH4A 2WFF2 2W94A 4I0BA 3N9NA 4QQPA 4Z82A 3ZSMA 4CDXC 4YSFA 3GDBA 4MX3A 4PF5A 3SH3A 2R1DA 1LOFC 1W3VA 2ZOEB 4XMIA 4QPGC 1DGLA 2ADDA 2PHWA 1JUIA 4X8PA 4XTPA 4Q8KA 3B94A 1MS4A 2VXRA 4FPEA 1W0NA 3POWA 1OOPC 3VD7A 3HNMA 4A42A 1WMXA 4C90A 5CKQA 3POGA 2VNOA 2NM1A 4HLTA 4MHUA 4WBBA 1J83A 1ENXA 2QTWB 2JICA 5JI7A 5FZDA 5K0UB 2BV4A 1XNAA 3I2KA 1IG0A 1FPN1 1AR71 5E89A 1AXZA 2OT7A 1HQNA 3BIEA 3D0JA 2ZGQA 3A23A 5FPXA 4DFSA 3NKTA 4AWDA 3TN91 1VBC1 4L8QA 1CAWB 1QNYA 1ZRRA 4XFCA 1F15A 3HNBM 5EXOA 1UXXX 2JB8A 3OYWB 2O8QA 4K8FA 3ZSLA 2HWB3 4CYDA 4E8CA 3INAA 1D4M1 2LRPA 5C4WA 3JCIA 2OXBA 4XW3A 5HI0A 5CFDA 4XHXA 5GZEA 1JXNA 5D8AC 3ZFGC 3KF5A 2BZDA 4CDQC 1MZEA 1US2A 5F5QA 2XG3A 1DZQA 1R1A1 4MGIE 3GGLA 4XCAA 2GALA 4PIYA 1N3OA 1VBB1 4HN1A 1SMVA 5C3OA 3MPBA 4D3WA 5C5UA 3O1SA 2VU9A 5DDJ1 2LM3A 4XMAA 4P9JA 1G9BA 5GLTA 2QJVA 4RFRB 3N4MA 2WKKA 2TEPA 4L92A 1WD4A 1FV3A 2JE7A 1YNAA 2PQSA 1UU5A 2IXCA 5F3IA 5LRRA 1TNFA 4QPGB 5FZAA 1WCKA 2A70A 1GU3A 1UN1A 3J26N 1GUIA 1JZ8A 1OOPB 2R6QA 3BU0A 3DCQA 2UURA 5F3EA 2AEZA 4BIOA 2C9KA 2E32A 4Q5OA 5FR3A 1O3SA 1ZX5A 1ND2C 3IAQA 4KGQA 4P9IA 2XBO1 4FPYA 2K0GA 4W65A 1C1LA 1M4WA 3B69A 4E9KA 4QKBA 1XU1A 4LIUA 2EAKA 4AYUA 1V9U1 2IFRA 3FHQA 2ZAHA 4UF0B 5FP9A 2D43A 5GZDA 4ZY9A 4AL9A 5LBEA 1OC1A 1SZBA 2XL9A 2R062 4LA2A 2OW4A 4CZSA 4AEMA 3WG2A 2EICA 2JDUA 3MIHA 2ZGMA 5D8AB 3ZFGB 1VPHA 2WLQA 1KS4A 2WWJA 2Z42A 2ZGPA 3VHNA 4CDQB 1JHJA 2E51A 1GOFA 1XC6A 1W0OA 3L2YA 2ARXA 3IDEA 5T50A 1KJRA 3IIAA 1OKOA 2HEVF 2V09A 2W1SA 3OEAA 4QX8A 1BMV1 2HBTA 3MDPA 1AR73 3CO2A 4FXKB 3ME2A 5J36A 3LEGA 1GANA 5T54A 3W59A 2FZ1A 2XB6C 4IL7A 2XXZA 4AQ6A 1WW4A 3KHCA 1W9FA 2YC2A 3WXPA 1PIV1 2WS92 3D0SA 3ITQA 3POSA 3HPNA 5FO9B 3G6JB 4M01A 4WZFA 1JOJA 4JKMA 2XLAA 5FWEA 1RL3A 5GKAC 1ND2B 2MEV1 3AZXA 3H1YA 3LEMA 5A6ZA 3ZSEA 1CZTA 2W1UA 3AVRA 5D2AA 5IUQA 3NAPB 2WNUA 1YQ6A 1ODMA 3O1TA 1CAVA 3KLSA 1DZRA 2DCTA 4FAHA 1CD3G 1DGRA 1NZCA 3KWVA 5A32B 3CJXA 5T5JA 2JDAA 1V0AA 5DDJ3 5JOZA 5IJRA 1WKYA 4LKEA 1CJPA 2DWRA 1DU3D 3V0AA 3K48A 3O1UA 1BCXA 2ORXA 2FDIA 4NWWA 2X10A 1XE8A 5FUPA 1W90A 3T30A 5IAXA 4BQ5A 5IVBA 4NIDA 1W9TA 3FLTA 3JQWA 3OUIA 1YFWA 2CDPA 2DDUA 4XILA 5FYSA 1OF3A 5DQ0A 2BVBA 3ZN5A 2R072 3K3OA 1BVVA 2RS31 5FYYA 1JODA 4LULA 5JLVA 5C3PA 2XBO3 2ZGTA 3CMGA 2XQXA 1UAIA 4N90A 5CNAA 4AQ2A 3PHMA 5CG9A 3M7AA 4AI9A 1VRBA 2W2IA 1V9U3 4GULA 2D5FA 4BQWA 1BBT1 4XABA 3T4HB 4RGAA 4C1XA 2EXHA 4N43C 3LDRA 3OUJA 4OZXA 1IHMA 1N47A 4CP1A 1ZRDA 4AK3A 5FXVA 5HCBA 1UZZA 2JIGA 3PUSA 3RI8A 3WD5A 1DLLA 1PX3A 1GOGA 3B02A 1YFUA 1QJFA 3P3NA 5DAXA 5E8AA 3T08A 2QKDA 5A6QA 5JAXA 1FOD1 5E1RA 3POEA 4FPCA 4HKOA 4YW3A 3WUDA 1Z0HA 4K9SA 5T5OA 2ZGUA 2RJKA 4EV0A 1WLDA 2V5DA 3EXUA 3J7MA 5TSWA 3WW2A 1LHOA 1VB2A 4A6OA 4ET7A 2RS51 3ZIWA 4M3CE 5FDBA 1EAH1 4IV1C 4RHV1 2QVSB 3HMYA 4GXLA 1VIWB 4NAOA 4XURA 1N1TA 2R0FA 3IT8A 1ND3B 1SFYA 3FJSA 2V4VA 1RUOA 1DQ5A 1W05A 5FYTA 1PIV3 4GMP3 2ZGSA 3WQ7A 4QQLA 1V6IA 2HWB2 4GB31 4K6BA 4UT5A 4OHYA 3FHAA 4QDQA 4Q1RA 1ULDA 2H6CA 4DINB 1AR92 1AYM3 2MEV3 4D94A 3ZOIA 5CADA 5F3CA 4V1PA 3VKLA 4QB2A 1S2BA 1OQEA 5I8SA 2P5BA 2X5IC 5FYBA 2RM21 1PGL2 5HCAA 1CESA 1AXYA 4KNCA 4QU1A 3HR9A 1XNBA 2QQOA 1QDCA 4LNVA 4CU8A 2E63A 3PVNA 3VV1A 2YV8A 4OCTA 5ERLA 1O4YA 1NQJA 4XDOA 1AUYA 3T2QA 1OT5A 1O8SA 3ORJA 4FVVA 2UY8A 1W06A 4Q0VA 2A6VA 5A7OA 3OCPA 5CEHA 5IVJA 5M0TA 2BBVA 5FPAA 1C28A 1REFA 4IEYA 2YBSA 2GMEA 2PN5A 4G9SB 1CGPA 3K4DA 4CUAA 2YPJA 3WNNA 1H6XA 1NT0A 4IV1B 3THPA 4AEDC 5DUXA 1RVF1 2XL7A 2P3JA 3ZXJA 3SCHA 4Z2AA 1DCSA 3ZN4A 3LSDA 1CN1A 4XUNA 4JKKA 4NAMA 1ZYBA 1I6XA 2VZVA 3NNJA 5J09A 3ZN6A 1U5ZA 3D82A 5FJKA 3WDUA 1QU0A 4ES9A 4LO4B 2FDGA 4QHOA 2OIIA 5J3UA 3VBSB 4I3GA 2HKXA 4WM7A 1CPMA 2YROA 1WCQA 2WZR2 3NJYA 1IS4A 3A22A 1BLZA 1LB2A 2JKXA 3K4AA 4BOWA 2BP6A 2WNEA 2E53A 1ZA4A 2RS53 5T52A 4RHV3 2WINB 1NKGA 1J1LA 4L9BA 3RS6A 4JX0A 3MFCA 3EO6A 2GH8A 1W28A 1XNTA 4CRQA 3PNAA 2PAMA 4RQPA 1RB8G 4R52A 2IWGB 4FAGA 4H7LA 1LCLA 4XJUA 1OA3A 2Q8CA 2FCVA 2PHLA 4HG6B 5FP8A 2GNBA 2RS11 4FOWA 4LBNA 5JVVA 2ZKNA 1ENQA 1MEC1 1OLMA 2OVUA 3WQ0A 2ZGOA 2DFCA 2ZEZA 3P3PA 2H6BA 3U78A 4AEDB 4KGGA 3HD8B 4CCKA 1BEV3 1D0HA 1EPZA 1N3PA 3DGTA 4KQ7A 4UWDA 2GH2A 2FDHA 2YBKA 2WA3A 3VZLA 1Q43A 3CNAA 1ENSA 3ZMNA 2JJ6A 3ZX7A 3M3EA 1HXS2 1S0JA 2WYSA 2BRTA 2XJUA 3IDBB 4NJ4A 4SBVA 2AYHA 5FO7B 3A7QA 4ZXEA 1RUG2 3UT0A 4J1WA 1EYBA 4IE0A 2DURA 4BPZA 1O3RA 2A3WA 4UI9L 3ZMOA 4QGLA 4XF3A 1ZRIA 2VCCA 3VDAA 4B7KA 2RE9A 2VW2A 3N9LA 1ZBA3 3PL0A 4MXWB 4ITCA 4YZ4A 1QNWA 3I3BA 4XFIA 5FQ0A 3AZVA 1RUD3 1OBNA 4FOQA 4MXVA 2B5HA 4E4ZA 4QX5A 1VBD3 3THDA 4HANA 1XNDA 3PUAA 1AJKA 1PMHX 3JBG3 5JSOA 4E8DA 2CTVA 3HVDA 3JUUA 2OQ7A 3V65A 1RHI2 2OKXA 1PM7A 2VOVA 4LA3A 2DYCA 2UY9A 5KXEA 1QY4A 5G05L 4NR1A 2D7FA 2GN3A 5GALA 4LO8A 2IXKA 4JC1A 3AYAA 1HB2A 1W6PB 5DG2A 5D21A 1SCSA 1LGBA 1YWKA 4J25A 4CVUA 3C3VA 1SDDB 2CL2A 4XOGA 3WG3A 1JBCA 3LA7A 4NHYA 4HFSA 1JYIA 2IC1A 3I2GA 3L2HA 4Z8BA 3LDBA 1POV1 5IVYA 1COV1 1O5UA 3KQRA 5K0UA 3OJBA 2BQPA 2X09A 5FP4A 4ISQA 1FXZA 2WFF1 2XKOA 3VZOA 3R4SA 3A0KA 3KB5A 3RQ0A 2ZEYA 1XOYA 2VUAA 4ZZ5A 2DV9A 2RMU3 1TNRA 5KXDA 1AR83 3OG2A 3B9IA 2WO1A 4XIOA 3K75B 3OYWA 2D6LX 4XF1A 4LIVA 1WBFA 1WA6X 4YW6A 4YZ5A 1MEC3 1MS9A 1AYM2 1UL9A 2V4AA 2BW8A 4RYDA 1U5IA 1CIWA 4QPIC 3OGRA 2VD7A 3S5AA 3MV01 4DZGA 4DUXA 4XZPA 3D4KA 2W68A 4HMZA 4PLMA 1ULEA 3OGVA 3CDZB 1D2SA 2QZ3A 4ONUA 1GZCA 2FDJA 4XVHA 4EQVA 2W5FA 1D2QA 4J6GA 1UU6A 1PMIA 4QX1A 4CDXA 4HPKB 2XH6A 2PHUA 4PQQA 2CYFA 5FFOC 1W3XA 4HVOA 1LOFA 1XSQA 4BISA 2ZS6B 4F83A 4QPGA 2JX9A 3VBHC 2VOWA 2EIEA 3P1IA 1WCUA 1F9KA 1LEMA 1QXJA 1OOPA 1QOSA 1HRI3 4KBZA 4NPRA 4TTGA 4I2OA 3MIGA 5SV8A 3PUIA 3C7EA 3ZXLA 5JMOA 4EN7B 2GNDA 4AGGA 4D6RA 5K4LA 1S0BA 4CU9A 1JYWA 1RUH3 2ZX4A 4YVSC 3V0AB 4HT1T 3WP4A 2VMIA 3ZFFC 4RGKA 2WAOA 4AGRA 4AOCA 1HB4A 4OHWA 4COYA 1HLCA 4P9XA 1ULPA 5LRSA 5FUIA 2QQMA 2SBAA 4OUMA 1NXMA 2ILMA 4XXPA 1G7YA 4JDOA 3MIFA 3M3QA 4Y4RA 4YFWA 3WQ1A 4LR4A 4A7YA 4UF0A 1UYZA 1HQWA 1UZVA 3AP4A 3VKNA 2ZX0A 3AMMA 4HKLA 1NCRC 3ZFGA 5D8AA 4K1ZA 3ZFEC 1ALYA 2E33A 3I59B 5FZ8A 5F5AA 4CDQA 2PHDA 4E4SA 4QPIB 1APNA 5LA1A 2GC0A 5LCWL 3B9CA 3K46A 1SBEA 3PJYA 1H1MA 1POV3 1TMF3 4OZOA 4DB5A 3Q8AA 4NUBA 2QBXA 2WFF3 4CEYB 4W4ZA 3OPWA 2BU9A 1JYNA 2R061 2VE1A 2PMWB 4AEKA 5DAVA 1YQ8A 3I3QA 3M70A 5IWFA 5KHHA 4Y5TA 3VBHB 2CGPA 1JYCA 1W9SA 4Y1ZA 4NHLA 4LXLA 3SH4A 5EV7A 1QOOA 2B45X 3WNLA 1ZZ7A 3FE5A 4FFHA 5JCTA 5FYUA 5JOXA 4OI0A 1PO22 4YW2A 4BA6A 1GLHA 3RZJA 4S2FA 2OX0A 1ND2A 1FNZA 2EAAA 3Q8FA 4YVSB 3ZYRA 3BOPA 4MLOA 5EYYA 1BEV2 3NAPA 1EY2A 1QF3A 4E2QA 4MG2A 3M3OA 2RR12 1PZ8A 5A32A 2RDNA 2DUPA 3BUCA 1W99A 4QX3A 3NV1A 4XE9A 4BCUA 4AHYA 2FMYA 4QGMA 1KGYA 3CZUA 3DV8A 3ECQA 2FD8A 5A1FA 5AFEA 4KMQA 2TUNA 2WS91 2VCAA 3U0ZA 2O1QA 4TWTA 4BJ0A 2D3SA 3AZWA 2EVXA 2VAUA 3RFRA 3U37A 1ZBA2 2IVIB 5FXXA 4EE2A 5BY5A 4GA9A 2DVDA 1IOAA 2WA4A 1RUD2 4LBKA 5A70A 4QX7A 1VP6A 4Y1UA 1VBD2 4JGYC 2WDBA 4P5YA 1XSRA 2WO3A 3AXDA 5IW0A 1C57A 3J7LA 3JBG2 4IDZA 4ASLA 2D6OX 4K8RB 4NRQA 5LEKA 3I3MA 3NO8A 4YW7A 1RUI2 3ZYHA 1SHWB 1W2OA 2P1BA 1VJ2A 5FYZA 4Q27A 1GQPA 3VBUC 5CBLA 3H3LA 1UIKA 1R64A 1V70A 1OA2A 3Q8BA 4UOJA 2MNGA 4YGDA 4MADA 5B2GB 4XBNA 3QH6A 1HRV3 3MF6A 3PIGA 4TLGA 2R071 2X29A 4MOAA 5H9SA 3F2ZA 5EYXA 2F17A 4XYXA 1AYN2 4QX0A 4UW4A 2DCZA 4YG3A 2BOJA 3GZAA 4ATFA 5E16A 1X36A 2VUCA 1MR5A 2G1MA 3EHKA 1QXPA 1VLNA 3TRSB 5BNOC 1WMFA 2FQPA 1JOBA 2X8KA 3MI8A 1YCIA 2VZOA 3QBQA 1SG3A 3AKQA 1DFQA 3ZN6B 1DQ6A 4CDUC 1JTZX 2R063 3IWZA 5ANNA 2XDVA 1QOTA 3MW4A 5A7QA 1I5ZA 5FZLA 4DEQA 2D6MA 2RMU2 3ZXGA 1AR82 1BXHA 4N53C 5LBFA 5FREA 4OUSA 1SLBA 2JIJA 2VW1A 1Q8OA 4SLIA 1U12A 1Q56A 5KXBA 1O4TA 1UY4A 5DAWA 2D3PA 4LTAA 1DGWA 2BNNA 3J7HA 2J22A 1PHMA 4JGYB 3C8XA 4A4AA 1HV0A 2BNMA 3ASIA 1W6OB 1NQDA 4OVEA 5GZGA 2PFWA 2R32A 5JPNB 3OOXA 4DS0A 1NOVA 3M3IA 4OHZA 2JDKA 2LROA 4ZPIA 2B9VA 4E4DX 1OFNA 4I0WB 3VHOA 4BYYA 1ZZBA 3D5OA 1OSGA 4M00A 4OUEA 2JE8A 1LU2A 4DEVA 4IGQA 2WS93 1UOFA 2HWB1 1Y9MA 2H0BA 1C1FA 2RHPA 2VTFA 3F95A 3RWKX 2WBKA 2HJIA 3LKJA 3IN9A 1AR91 2ZZJA 2B7YA 2VCMA 5A3WA 3W20A 4GJYA 5JXHA 1DDLA 4ZS3A 2EIGA 1LAJA 1LOBA 1HRI2 4QM9A 3ZXAC 5ACA2 1E57A 1HKDA 1OVSA 4ATEA 3S6PA 4F3JA 4CEWC 4EYUA 1K12A 2ARBA 4YYOA 4AR2A 1PGL1 1C5IA 3BTYA 5BNOB 1LEDA 5DZFA 5FPVA 1RUH2 2QQLA 2R1BA 4IV1A 1WBLA 1XNCA 5BNNC 2ZACA 2SLIA 3K2OA 4CDUB 2Y26A 3Q8EA 1KDMA 5FJHA 4OHVA 4AW7A 2HWD2 1B35C 3SKVA 3A4UA 4KWJA 2WO2A 2O0OA 4K21A 1BYHA 1T2XA 4YG0A 3VZKA 4N53B 3ZO0B 1IZ3A 4XFAA 1DQ0A 3RZGA 3HBZA 4FPGA 4FFIA 2VZRA 2R073 4BXSV 2ET7A 1L7LA 4I02A 1POV0 2ZGNA 1Q8SA 3LPFA 2W52A 3WF3A 3O1MA 3KT7A 3AB0A 1YFXA 2A75A 4P9YA 3J9SA 2EIDA 1PO12 2X5IA 3O1VA 3BI3A 4K1YA 5LK5A 2C6SA 2Z5WA 2C26A 2Q8OA 3NNMA 4XFBA 1TMF2 3CJIC 3ZDVA 5A3UA 3N7MA 2PELA 3GM8A 2A6WA 1XBFA 5CAZA 5EJ3A 5HXVA 5FYMA 3AKSA 2D97A 4RR3C 2VM9A 1QMJA 1H1IA 1N3QA 4K3UA 4IETA 1GKBA 2XR4A 1LKNA 1XQNA 2VXJA 2YU2A 3M3CA 3NV2A 1GWLA 2I45A 2OA2A 1RTVA 2VGDA 1H1AA 4K40A 5FYHA 2GNTA 4GWJA 1GWKA 1RIRA 4HXCA 2WZR1 3VZMA 5HBAA 1F5JA 3RZMA 2GMMA 1UY2A 2ZEXA 3JB8A 3N7LA 2V72A 4HOOA 4UAPA 4YVWC 4BZ4A 1VBA2 3NMBA 4D0QA 5CIRA 4CP9A 2ATFA 4CCDA 4L99A 2G4IA 2E9QA 2DVAA 3QH7A 5LA9A 2IXIA 4AEDA 2WNVC 2ID4A 2ZHKA 5FP3A 4LHNA 1MS5A 1UYXA 4R9CA 3S7EA 1A8DA 3NNLA 4KWUA 3ST7A 2IZWA 4MO3M 2VMHA 3MLKA 1ULOA 2O8OA 1X9TA 3J4UH 3WOGA 4CCOA 4LK6A 1REEA 5LK7B 2GU9A 1O8PA 3UV9A 2XJVA 4AHZA 3FFZA 1K5MC 1Y9QA 3BKZA 1AR93 5LB6A 3WV6A 3WVJA 2Q4SA 2AEYA 1V6LA 1W2UA 4X6RB 5JXJA 5FZ9A 3GXUA 4KG0A 3T0DA 4KU7A 4MXWA 4FTEA 1VRH3 1PGW2 1OXCA 3BTAA 3CJIB 3B3QE 2VPVA 2HWF2 3GALA 2UWBA 3V64A 4B4RA 4CDXB 1QDOA 1Y4WA 4HL0A 5KC5A 4RR3B 3C7OA 1HXS1 1MZ6A 1UOJA 3ZPYA 3BYWA 4Y3OA 1OLME 5LZ6A 1I1EA 1RUG1 2HEYF 2G9ZA 1X33A 2WSVA 3UETA 3C7FA 3FN9A 1LU1A 5FBZA 4NN0A 2BBAA 3JQXA 3TOJA 1E5HA 2Y6LA 3VGIA 2WR9A 2CDOA 3BTXA 1HRV2 2A3YA 3C7HA 1F31A 1UQXA 1YHFA 2HYKA 4Q26A 4Y33A 1W6PA 2J1UA 1QJU2 5FY0A 3WP3A 1A78A 4FTSA 2NYYA 5T5PA 2WNVB 4IEPA 4XF4A 2VUDA 2VH9A 2LUWA 3IDCB 1SLTA 4XHBA 1S2EA 2WZEA 2DU1A 3N9QA 4CU6A 3PVBB 2DF7A 4FPFA 1RHI1 3FFQA 2J1TA 3GHMA 2VQUA 2L9LA 3W9AA 1LNSA 2YPDA 4S2HA 1J3PA 1K5MB 4PCRA 2YBPA 4CUGA 1XYPA 1OD5A 3GHNA 2WZR3 3QOPA 3R05A 4CSWA 4LPLA 4MGSA 4U2AA 4LHLA 3C7GA 1Z7S2 4RFT0 3WF0A 4OQ8A 4BXFA 4X8NA 1AVBA 1QEXA 1O59A 1F2NA 2I07B 2VMEA 1YC61 4JCKA 1JZ6A 2Y33A 1W2AX 2GC3A 2VZUA 3WCSA 4C0BA 2WAAA 5FKCA 4AFDA 3X29B 5C3SA 4BDVB 4ZKTB 1UX7A 3LA3A 2IFWA 4GMP1 4HPKA 1A3KA 5JIUA 4Y5Z0 3LIHA 3NJXA 1H4HA 1LULA 1GZ9A 1XRUA 2E26A 2Y0IA 1GP5A 2C1FA 4HSLA 1UZYA 2PXJA 1AYM1 1JZ4A 4FTBA 2Y6GA 5GLVA 3WF4A 3VHRA 3CU7A 4YNIA 3RMXA 1HDKA 3C2UA 3URFA 1LECA 2ZBJA 4LOSA 4OMCA 1MS3A 1E5SA 1YUDA 1EP0A 2Y8KA 4MGZE 5I0SA 4CXXA 2GMPA 4V2WA 1YLLA 2VOKA 3CIHA 3WEZA 1HXS3 1PNGA 2O14A 3AJZA 1RUG3 1MZFA 4JQRA 2DBNA 4QXBA 5A3NA 3W5NA 2A6XA 1VMJA 1S0IA 3ALQA 3FZ3A 4IEOA 2NP0A 2ZZQA 4LBJA 2VCBA 1KDKA 2PAKA 2VQTA 4FXGB 5DABA 1VALA 3JXSA 5L9RA 4AVVA 2ZMLA 4FOYA 3HQRA 5F2WA 2OZ6A 5A6YA 2GP3A 1H8TC 3BIWE 1W8TA 2QDNA 5F39A 3I59A 1WUVA 2GC2A 1YO8A 4QPIA 3LPGA 1EUTA 3JB4C 4XJWA 4XJAA 4K20A 4A3XA 3ZDSA 2JG9C 3UNPA 2P17A 2WFPA 3HQUA 2BYVE 4IQPA 4YW5A 1Q8VA 1RHI3 3HT2A 1X9PA 5I93A 3N9OA 3AMPA 4IEUA 2XLGA 4CEYA 3H3UA 1Q3EA 2ZMNA 2QE3A 3SXWA 2Q5TA 3VDDC 4BQXA 3LEKA 3AKRA 4GWNA 1OLQA 2NLRA 4QB6A 4DY3A 2QCSB 3VBHA 5C5TA 5J37A 3RZKA 4I01A 4CPBA 1LR5A 4I30A 1NXD1 2KM2A 3WDYA 5FZBA 3J8F3 4AFAA 2NMNA 3UK9A 5JR2A 2WT1A 2ZX1A 4PDWC 5C8CC 2DVGA 3ES1A 2GZWA 3L9JT 4PIZA 4YVSA 4RD7A 3JD72 4RA0A 1AL22 4D7YA 2BFUL 1WW6A 4XC9A 4DMIA 4CU7A 4AF9A 4PT6A 1F5FA 1MS8A 4FFGA 4XZUG 2XWJB 5HV0A 3BALA 2PA7A 1NCQC 2VG9A 5L9BA 3RG0A 2AENA 5JXGA 2ZAAA 4LKSA 2ZABA 3B00A 1MPXA 3EYPA 2B46X 1KD7A 1OA4A 4KBBA 3ZFEA 1H8TB 4TZDA 2YC0A 1CONA 1MQTC 1PO21 1FX5A 2VZSA 2YHJA 3U14A 5AFBA 3PDQA 4IV3C 1VRH2 3BN6A 4EWDA 2JG9B 2ES3A 1BEV1 3LAGA 4NHMA 3T1MA 4PJYA 4UYBA 2Q8DA 2RR11 4B4PA 4JRAA 3D8CA 1SLAA 2DVBA 3A21A 1BJQA 4N43B 5DAPA 3HN1A 3VD3A 5BNPC 3I49A 3VLBB 4DRVA 4XUQA 5CKMA 2Y64A 3VDDB 4Q8LA 1CZSA 4XUPA 4AVCA 1BKZA 1GFF2 3T3YA 4PI2A 1QQP2 1ZBA1 2Y0OA 3IKWA 5I0UA 3WDTA 1Y9GA 1BVP1 1ULGA 3I97A 1RUD1 4PDWB 4N8MA 5C8CB 1HV1A 1VBD1 3T2OA 1Y43B 1S0CA 1UX6A 1OURA 3JBG1 4M0NA 3ZSKA 4B3NA 3OBAA 4DOUA 3QACA 1AHSA 3ZR6A 4ORFA 3OD0A 1RUI1 1GBGA 3WF2A 4Y5SA 5F6KA 5E88A 5FTTC 2DUOA 2OPWA 1PM4A 1NCQB 2GAUA 5HV4A 4AFCA 2WLPA 4EJRA 3BVCA 3GBFA 5A1AA 1WLWA 3ZR5A 1UOBA 3GBWA 4BK4A 2FCUA 1HJFA 2ZHNA 3ROUA 3U10A 3ZYBA 1H2LA 2J42A 1MQTB 5AVAA 2Q8EA 3OPTA 2I2SA 1AYN1 2X5IB 4B1LA 3SCFA 2PLV3 3UGHA 3AC0A 3DKQA 4AQTA 4HVQA 5C7GA 3H7YA 1GSLA 1G9DA 3BTZA 2Y6FA 2OQ6A 3B7MA 4JQTA 1GWMA 2Y6KA 4JGYA 5I91A 2XGXA 2CWMA 1W6OA 2J7MA 1O6UA 5BNPB 4AI8A 2OPKA 1PVC3 4JHTA 4ARXA 3MW3A 4FI9A 2X05A 5CFDC 2AUYA 4Q4X3 2EXIA 1YQ2A 1WCDJ 4LO7A 2RMU1 4Q4V3 3RYKA 2VR4A 1AR81 2ZX2A 3VBUA 4ZU7A 4NIIA 1UD1A 1DBNA 3VDCA 2Q0AA 1ZVFA 5GJ6A 5C9AC 4AVTA 1KJLA 2W9XA 4Q0QA 2YGLA 3OBTA 3N35A 5IATA 4CP9B 1PO23 1K45A 2JDNA 3H7JA 4FP3A 4Q0SA 1NLRA 3WHUA 4CCCA 3U4XA 2HWE2 2JWPA 3AXEA 3KT4A 3OSDA 2P6HA 3FMGA 1EV12 2HBUA 3IB3A 3KGLA 2RR13 3FWEA 1X8MA 2BVVA 5BNOA 4XFGA 3UKTA 1ZBE2 3HNYM 3OTFA 4XAEA 3AZYA 4CDUA 1GNHA 1C8M2 4UFKA 4Y1XA 2E7AA 2XUMA 3K3NA 4LO5B 3FBYA 1IS3A 5APAA 4N53A 2R7EB 3TAYA 4S2GA 5C3RA 4LITA 2YMZA 1SPPB 1ZZCA 2P3YA 4P5HA 1HRI1 3I2IA 4R9DA 3S5QA 5ACA1 1ZREA 1XE0A 3NV4A 1HN0A 5IAVA 3OF1A 4FFFA 1W6MB 5ISLA 1RUH1 1LHVA 2OS2A 1I3HA 3ILRA 5DMYA 2BPA2 3RZLA 4COUA 4NO4A 4A7KA 4AVSA 1RUI3 2W92A 1GR3A 3POFA 2HWD1 4LE4A 1MS0A 1UY3A 1MZ5A 5D1IA 1T6BX 4QT6A 5FZCA 1VMFA 3CBNA 2HWC3 5C9AB 4YM2A 1LENA 1F4HA 2E6VA 2P6CA 3LDKA 1JZ7A 2VZ3A 1FMD3 1VBE2 3WP6A 3DPRC 2YUEA 3D6EA 3ZLIA 4CCLA 1G86A 1CPNA 2HYXA 1AYN3 1VAKA 2VC9A 4J1XA 3UGFA 5L9VA 3CKHA 3OGJA 3KS7A 3J8F2 1RJ8A 1C4RA 1PO11 1ENRA 3WW4A 3PUQA 5JDBA 3O1PA 3H8OA 4NROA 1TMF1 2DBIA 2IXHA 3N3HA 4GMP0 4NIGA 5I0TA 4LKDA 5BNNA 2YYOA 4R4ZA 1JU4A 1I5PA 2Z69A 5FBJA 4LHSA 4QQOA 1B35A 1YIPA 1M06G 2UYAA 2J1RA 2KR2A 2XOMA 4GKYA 2PAEA 1YQ5A 1HJGA 4D6QA 1IPSA 1CQ9A 2E31A 4N9IA 5A3PA 3UKVA 1GNZA 1MVEA 1XPWA 3K77A 1R083 3O0WA 1J59A 3WG1A 4RSUA 5LA0A 4KWKA 4G3YC 2P4EA 1VBA1 3GNEA 2VUJA 4D6SA 1ZM1A 3AKPA 1PZ7A 4NHKA 1U5YA 3LQCA 4CXWA 2YC4A 3LCPA 1H9PA 1GZTA 1WGPA 2CU5A 3CJIA 4JDMA 4BMEA 2EXJA 4DRRA 4EWAA 4QQHA 4LBMA 4LO6B 1QHDA 3BGAA 5FPUA 4JV4A 3AYCA 4RR3A 3E6CC 2F6BA 4IGPA 1W9WA 4QGNA 1H2NA 4WVMB 3DPRB 1X7NA 2WWUA 2XHKA 4GALA 4NIHA 1E5IA 5ACA3 1GOHA 3VUOA 2B4KA 4B7EA 2VQAA 5H9PA 1PGW1 4PQ9A 4L97A 3S0MA 1W39A 3DL3A 2TBVA 2ZHLA 3FLRA 3VL9A 5I8YA 5KWRA 1W8UA 2HWF1 2WNVA 5BV6A 4COZA 1C5HA 2CV6A 3KF3A 3SNMA 2VTXA 2HWD3 3TBDA 4EN8B 5IVCA 3NWKA 3T2PA 4QB1A 2JB4A 1LOCA 4Y4YA 3SEPA 3USSA 2J1VA 2J1SA 2VL4A 3BPZA 1PGSA 4GWIA 3THTA 1W0PA 4INDA 3W21A 3WT3A 2VNVA 1S0EA 5FMDA 1LHUA 3PVOA 3ZXDA 4BLJA 2GN7A 1H9WA 4BQYA 1HRV1 1PK6C 2W95A 1K5MA 3S30A 4QPYA 5FZEA 2XJTA 4Z92B 2HLEA 1IKPA 1VR3A 4UFLA 5H9RA 1ASJ2 2I74A 4EN9B 1UKGA 1QJU1 3EBRA 4AHXA 3TEZA 2PLV2 1PO13 1MVQA 4HVRA 2P37A 4N7IA 2VZPA 1IS6A 5FZHA 1UY1A 3HOBA 3DUIA 3WNOA 1WLCA 2ENRA 4N7UA 4OFGA 5LA2A 1QJY2 1PVC2 3H8UA 1VMHA 5FY1A 4Q4X2 4Q4V2 5EP9A 4FBFA 4I09A 2BUKA 1ST8A 1UO9A 1JHNA 4XQDA 1DP0A 2W87A 5EWSA 5FWJA 2WN2A 4TLFA 4LT5A 1GP4A 3J7NA 1BZWA 3NKGA 4O61A 4XF9A 4XJ9A 1EPWA 4WVVA 2ZKLA 4QQ2A 5FPZA 1RYYA 2DU0A 4YWAA 2Q1FA 4NIAA 2WIIB 1OPMA 1VBA3 1WLTA 1RUC2 5FOBB 3NJVA 2V5YA 1Z7S1 4OI2A 1X8EA 3RDIA 1DLCA 1N1YA 4W8JA 3SH5A 5KHIA 1F35A 4XQWA 4NVPA 4QDRA 1QJX3 4JGZC 2IXJA 5LY2A 3WP5A 3GF6A 3KCCA 4JDNA 2QQUA 5EPAA 5FK7A 1W8HA 2C0ZA 1QIQA 1DHKB 3ZYGA 4LLOA 3NJZA 4DIQA 3I2DA 2ZHMA 4HZFA 1J58A 4FP2A 1D7PM 1NCRB 1NA1C 2CHHA 3PTRB 3ZFEB 2B9UA 2CNAA 1NUKA 2JD9A 3HBKA 2VNRA
chains in the Genus database with same CATH topology
3T4HB 3O1SA 4CXXA 4MGTA 4RFRB 4ZHNA 4ZS2A 2IUWA 5DABA 4QKDA 3BU0A 4CXWA 3BTZA 3I2OA 2FDHA 3BKZA 2FDKA 4NRMA 4NJ4A 4JHTA 4QKFA 4QKBA 4IE5A 4IE0A 3S57A 3O1RA 3RZHA 4NIIA 4NRPA 4NIHA 3O1OA 3RZKA 3KHBA 3BTXA 3I3QA 4IE7A 4ZS3A 4OCTA 4NPMA 3BTYA 3RZJA 3H8XA 3LFMA 3KHCA 2FDFA 4MG2A 4IE6A 3BUCA 4CXYA 2FD8A 3RZGA 3O1TA 3RZLA 4IE4A 4O7XA 4NPLA 5F8PA 3O1MA 4O61A 3I49A 3O1UA 3O1VA 3BI3A 2FDGA 2FDIA 4QHOA 3BIEA 4NIDA 3S5AA 3H8RA 4IDZA 3T3YA 4NRQA 3I3MA 3O1PA 3H8OA 4NROA 3T4VA 2FDJA 4NIGA 4QKNA 3RZMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T4H B;  3O1S A;  4CXX A;  4MGT A;  4RFR B;  4ZHN A;  4ZS2 A;  2IUW A;  5DAB A;  4QKD A;  3BU0 A;  4CXW A;  3BTZ A;  3I2O A;  2FDH A;  3BKZ A;  2FDK A;  4NRM A;  4NJ4 A;  4JHT A;  4QKF A;  4QKB A;  4IE5 A;  4IE0 A;  3S57 A;  3O1R A;  3RZH A;  4NII A;  4NRP A;  4NIH A;  3O1O A;  3RZK A;  3KHB A;  3BTX A;  3I3Q A;  4IE7 A;  4ZS3 A;  4OCT A;  4NPM A;  3BTY A;  3RZJ A;  3H8X A;  3LFM A;  3KHC A;  2FDF A;  4MG2 A;  4IE6 A;  3BUC A;  4CXY A;  2FD8 A;  3RZG A;  3O1T A;  3RZL A;  4IE4 A;  4O7X A;  4NPL A;  5F8P A;  3O1M A;  4O61 A;  3I49 A;  3O1U A;  3O1V A;  3BI3 A;  2FDG A;  2FDI A;  4QHO A;  3BIE A;  4NID A;  3S5A A;  3H8R A;  4IDZ A;  3T3Y A;  4NRQ A;  3I3M A;  3O1P A;  3H8O A;  4NRO A;  3T4V A;  2FDJ A;  4NIG A;  4QKN A;  3RZM A; 
#chains in the Genus database with same CATH topology
 3MLL A;  3MF9 A;  2BWC A;  2KA3 A;  3LB9 A;  2UYB A;  2Q1Z B;  4XFF A;  2W3J A;  4KI5 M;  1FAT A;  1H6Y A;  2PQQ A;  4WVZ A;  4XXA A;  4FQZ A;  5DZE A;  4AI1 A;  2QQP A;  3ELN A;  4XAA A;  2YGM A;  2R30 A;  3LIG A;  5FCC A;  2ARA A;  4IXL A;  2HWF 3;  2VMD A;  2QDR A;  3ZXF A;  4EWE A;  1YI9 A;  1ODN A;  2CWS A;  3GJA A;  3GZT B;  2BDR A;  1TZO A;  2F4L A;  2K2S A;  4TN7 A;  4C8D A;  4OUL A;  2JG8 C;  1ONA A;  1TVG A;  1OH3 A;  2HH9 A;  3OUH A;  4IES A;  4YLZ A;  2K9Z A;  2ERF A;  1OI6 A;  4EN0 A;  1HX6 A;  1YQC A;  4YM3 A;  1JYV A;  2HWC 2;  5C70 A;  5JMC A;  2VO5 A;  1RIN A;  4KU8 A;  5IK8 A;  4IE5 A;  1FMD 2;  4QKF A;  2A73 B;  3ATG A;  4D7T A;  1ZZ9 A;  3S57 A;  2ZTN A;  2CAV A;  3MIC A;  2AR6 A;  4P9W A;  5B4X A;  5IK4 A;  4U36 A;  1QJU 3;  2VBP A;  4PBP A;  4EZH A;  2VBD A;  5A6X A;  1ZRF A;  1ZZ8 A;  3MID A;  3KM5 A;  4JGZ B;  4L2N A;  2WRA A;  3OY8 B;  3CF6 E;  1N1V A;  5K8S A;  4FPJ A;  4AVB A;  4MHR A;  4BIF A;  3O7O A;  1W8Z A;  1QH7 A;  2ADE A;  1QXR A;  2Y6J A;  1NA1 B;  3DXT A;  4XEZ A;  5CFC C;  2WNO A;  1MAC A;  5FLI A;  1S0D A;  1RUF 2;  5BXX A;  4F8A A;  1HB3 A;  4IEX A;  1GZW B;  1SCR A;  3U11 A;  3MO4 A;  1NYW A;  2Z79 A;  3E6B A;  1R08 2;  4FOV A;  1D0G A;  3UYJ A;  1O3Q A;  4AHW A;  5A7N A;  3ZXK A;  2ZEW A;  3ZVX A;  1Z7S 3;  1AX1 A;  2ET1 A;  1H8T A;  2QQV A;  4HKW A;  4KWL A;  2BOI A;  2W1W A;  4P08 A;  1CR7 A;  3UJO A;  4LUK A;  2FDF A;  5IHR A;  1GQG A;  3JD7 1;  1DQ1 A;  2JG9 A;  2CSG A;  1AL2 1;  4GIQ A;  2AH2 A;  4IE6 A;  1W8W A;  2JEN A;  5HCH A;  2JG8 B;  4CXY A;  3VBU B;  5BYN A;  1L7R A;  4N43 A;  2VUL A;  4Y22 B;  1CAU B;  4F7Z A;  1HQL A;  3KVA A;  3AM2 A;  5FPB A;  1D4V B;  4XIK A;  1UWW A;  5T55 A;  4BQ1 A;  3VDD A;  4YGC A;  1TQ5 A;  1UYY A;  5I0R A;  4NPL A;  5F8P A;  2QQJ A;  2R04 3;  4HET A;  4DUV A;  2UWA A;  4URT A;  1W6N B;  3U4S A;  4CUB A;  1SDW A;  1VRH 1;  4CCE A;  1RMU 2;  3NL1 A;  5CIS A;  3NST A;  4PDW A;  5C8C A;  5IK5 A;  2W91 A;  1Q8Q A;  1LOD A;  2JE9 A;  2WT0 A;  2GDF A;  2PHT A;  2ETE A;  1UXZ A;  3CQO A;  4UBG A;  4CDW C;  4IEQ A;  2WQ4 A;  1FYU A;  5CFC B;  3POJ A;  1U0A A;  4A41 A;  2PHF A;  3LSE A;  4Y1Y A;  3I3E A;  1NCQ A;  3DYP A;  4LBQ A;  1SLI A;  3R4U A;  1OMI A;  2JDM A;  3O0V A;  4IEZ A;  3RNS A;  4COW A;  5IYY A;  1WD3 A;  4HSJ A;  3GZU C;  1QQP 1;  3R6S A;  3TEW A;  2WUH A;  1AJO A;  2A71 A;  5F7U A;  1MQT A;  4ASM B;  3ES4 A;  3HAG A;  1EUU A;  5J98 B;  4JVA A;  4CPB D;  1DF0 A;  4HON A;  5FZI A;  2B8M A;  3CLP A;  1NAE A;  1VE0 A;  5F2S A;  2DVF A;  2Y6H A;  4CDW B;  1KQR A;  2QQK A;  5LAS A;  1OF4 A;  5C33 A;  1YEW A;  1ACC A;  5BNP A;  4LK7 A;  2JD4 A;  1GP6 A;  3I54 A;  3VD5 A;  3I2O A;  1GYK A;  1XU2 A;  1LOG A;  2NZ9 A;  3ENR A;  5DUV A;  5IFP A;  1NLS A;  2WT2 A;  5FZ7 A;  2F4P A;  1HW5 A;  3LFI A;  5LBC A;  3UGG A;  4CEW B;  2D40 A;  1O5L A;  3DKW A;  4AE2 A;  2BGO A;  5IK7 A;  2QUO A;  3PTY A;  4JKL A;  3BPS A;  4QDS A;  5LW9 A;  3H1W A;  1OD3 A;  4QXK A;  5BNN B;  3AL5 A;  3E5Q A;  1H0B A;  4CP0 A;  3OPZ A;  3JD7 3;  3POI A;  1LRH A;  1LJ7 A;  1AL2 3;  1QJX 2;  1W2N A;  1W8N A;  2EXK A;  2ZPX A;  1IGO A;  1PVX A;  1B35 B;  2LS6 A;  3OD4 A;  3SLI A;  3OGS A;  1KFU L;  4E2G A;  4YAR A;  1ZA7 A;  1AZD A;  4XUO A;  1WMD A;  3IAP A;  4RS5 C;  4XAC A;  2EAL A;  4LQR A;  4XF0 A;  1FT9 A;  5F5C A;  4H3W A;  1TME 3;  5GLW A;  5ABJ C;  2W47 A;  4QWN A;  5FV3 A;  1AL0 G;  4Q4W 2;  1GMM A;  2XUE A;  4GQ7 A;  3M1H A;  3KD4 A;  4YW1 A;  3GCX A;  5DUW A;  3TWI A;  4RGG A;  1YXW A;  3ETP A;  3VB9 A;  4QX2 A;  5T5L A;  4ZXK A;  1SPP A;  2HWE 1;  3ZYP A;  2RJL A;  4NPM A;  2W0X A;  3EQE A;  1YJL A;  1EV1 1;  1H4G A;  3N7K A;  2MHF A;  4QPW A;  4CA9 A;  1H2M A;  1W6M A;  1GNY A;  4W6Y A;  3HT1 A;  5LY1 A;  2D5H A;  3E5X A;  5FZ0 A;  5GLZ A;  1HN1 A;  4Z1V A;  3WG4 A;  1ZBE 1;  4Q0U A;  3MUZ 1;  5I8T A;  2D6P A;  1C8M 1;  1I9R A;  3SHR A;  2WC2 A;  3ZKU A;  4AAX A;  2V73 A;  1NE6 A;  1S0F A;  2YZ4 A;  4LKF A;  3AP6 A;  3SEE A;  5FMO S;  5IVV A;  2A6Y A;  4XQ4 A;  1ZZ6 A;  1QQP 3;  2BNO A;  2YXS A;  4GJZ A;  4M4R A;  4WM8 C;  4YVW B;  5FRA A;  3SKJ E;  4D8M A;  4FPK A;  1NX9 A;  1UYP A;  4AZZ A;  4H2A A;  5KHJ A;  5L73 A;  4DXZ A;  2OUJ A;  5L36 A;  1WME A;  3WLU A;  1AX2 A;  3LEI A;  1XYN A;  3ZFF B;  5CKN A;  3VBR C;  4MUV A;  5EZW A;  4XFH A;  3IBM A;  1BK1 A;  2DTY A;  1IS5 A;  4D69 A;  4RS5 B;  2BEO A;  4KL1 A;  2VMC A;  2WN3 A;  3H8R A;  2A7A A;  5ABJ B;  2Y34 A;  1R09 2;  3TEY A;  3ABZ A;  3WCR A;  4O9G A;  5KBF A;  1CWP A;  4HK9 A;  4H14 A;  5FUN A;  1Q8P A;  3KMH A;  4GAZ A;  4Q0P A;  4O65 A;  5IVF A;  5BUV A;  5KXC A;  4AI0 A;  1VBE 1;  2WQZ C;  4FSJ A;  2ORZ A;  1VAM A;  5FY4 A;  3WDV A;  4XBQ A;  1SEF A;  4LMF A;  5JUV A;  1RUJ 3;  3AYD A;  3NAP C;  1W8O A;  3J8F 1;  3APB A;  3N9M A;  2CGN A;  5FZ4 A;  3H42 B;  5GZF A;  3RZZ A;  1W8F A;  3KVB A;  1JZ5 A;  4CP2 A;  4KH9 A;  2YFZ A;  4M3C B;  3T0B A;  3ILN A;  3IPV B;  1J1T A;  3PME A;  4GZ9 A;  5FLH A;  1A34 A;  4W6W A;  4B8E A;  3R4D B;  4W50 A;  1JZ2 A;  3VN4 A;  4R9A A;  1KIT A;  4Y1V A;  3RYP A;  3FUO A;  3LF7 A;  4IEW A;  1GV9 A;  3LOB A;  4QKD A;  3ZXE A;  1SBF A;  4WM8 B;  1URX A;  4DUW A;  3BOW A;  1SFN A;  1NY7 2;  1U5X A;  4W6X A;  1A6C A;  3KT1 A;  4KG8 A;  3DPR A;  3HN3 A;  4WVM A;  2R04 2;  5C6C A;  2ZMK A;  5LBB A;  4QU2 A;  2HWE 3;  2YG0 A;  4NRM A;  3WDW A;  1FPN 3;  3HJR A;  2JDY A;  1S1A A;  1DYK A;  1EV1 3;  1JW6 A;  4C1W A;  4CE8 A;  3LZZ A;  3KV6 A;  3VBR B;  1AR6 2;  2Y60 A;  4XDQ A;  5FZK A;  2XJP A;  3TN9 3;  1VBC 3;  5JZG C;  3NNF A;  1JI6 A;  1ZBE 3;  1Y7B A;  2ARE A;  1JMU B;  4QAW A;  1D4M 3;  3E6D A;  1C8M 3;  1F4A A;  3DF0 A;  3KQ4 B;  4NWV A;  2BJS A;  5FY9 A;  2DCY A;  2PYT A;  3W5M A;  3MGU A;  3T2T A;  4JTO A;  4OMD A;  1K5J A;  2A3X A;  3ACF A;  4RN5 A;  1O4Z A;  1DQ4 A;  4B29 A;  3KHB A;  3HEI A;  1R1A 3;  4MSV A;  4MYE A;  5FAX A;  5A7S A;  3S7I A;  2ARC A;  4P9L A;  1VBB 3;  1RUE 2;  4FPO B;  1XE7 A;  1AF9 A;  4JTN A;  2Z2S B;  2VJX A;  3TEX A;  1JOP A;  3RJR A;  5FOJ B;  3EJK A;  2NQY A;  1G9A A;  3RWN A;  5FMB A;  1QH6 A;  5ANQ A;  1LTE A;  1ND3 C;  2RVA A;  2XVL A;  2B42 B;  4URA A;  4GH4 C;  1HIX A;  5L7O C;  1QGL A;  1L3J A;  3A0N A;  3AFG A;  3QD6 A;  1ZNP A;  2D44 A;  5BPX A;  3RMY A;  4BU2 A;  3ILF A;  5DZG A;  5A3O A;  4Q4Y 2;  5K9Y A;  2VEC A;  1VBE 3;  4XJZ A;  3ON7 A;  5A7W B;  3WDX A;  1DG6 A;  2D6K A;  4XCB A;  3III A;  3VZJ A;  3ZSJ A;  1ASJ 1;  2N7G A;  4S2D A;  3VZN A;  5A3L A;  1UMI A;  2PLV 1;  2YB7 A;  2YDE A;  2ZCW A;  5AC9 2;  1STM A;  3AZZ A;  2QNK A;  1UW8 A;  2FZ2 A;  3IZO A;  3IMN A;  5JZG B;  3I3D A;  5GM0 A;  1V6N A;  4Z07 A;  1W6Q B;  4I0A A;  1QJY 1;  3CL1 A;  1PVC 1;  1UNB A;  4LUM A;  1C8N A;  3FBM A;  5LEJ A;  4OI4 A;  4Q4X 1;  4Q4V 1;  3POB A;  1TME 2;  2FHR A;  1AX0 A;  2VTX J;  3CHX A;  3VBO C;  4L11 A;  1B09 A;  3AP9 A;  2R0H A;  4BMB A;  3DEM A;  1UKR A;  3WX5 A;  3WW3 A;  3AMH A;  1NCR A;  5JOY A;  3OGG A;  1E5R A;  1PK6 A;  1SAC A;  4PLN A;  2QFE A;  1WZX A;  1S4C A;  4YM0 A;  1RUC 1;  3SC7 X;  3U75 A;  2NPI A;  3AJY A;  2R16 A;  1V6J A;  3CEW A;  3WY6 A;  4Y20 A;  1WA4 A;  4Q1P A;  5C8W A;  2YFU A;  4R9B A;  3ZKY A;  2LW8 A;  4GH4 B;  5L7O B;  4XJ8 A;  1H30 A;  2BGC A;  3H0O A;  3VBF C;  4UXA A;  4NHX A;  4QHZ A;  2GP5 A;  4LE3 A;  3VKO A;  2D93 A;  4WV8 A;  3VBS C;  3RSJ A;  3WNX A;  3WUC A;  5J48 A;  1YFY A;  4XBL A;  5L19 A;  1DYO A;  4HK8 A;  5FZG A;  2AAC A;  4DQA A;  5F37 A;  2HEW F;  5JI9 A;  1VB4 A;  1CJD A;  4DXR A;  4P9G A;  2ZXQ A;  1LHW A;  1WW5 A;  4MH0 E;  2A5Z A;  3KV9 A;  3USU B;  4BB3 A;  3VDB A;  5FZO B;  5JSP A;  4AXO A;  1V6O A;  1UOG A;  2KD7 A;  3OBZ A;  4A3Z A;  4AI2 A;  2ZGL A;  3MPP G;  2J1E A;  5EJ1 B;  3RPQ A;  3MZH A;  1PNF A;  5FP7 A;  4JGZ A;  2IVJ A;  1QKQ A;  2OUH A;  2ZA9 A;  5A3T A;  2EA7 A;  3OY8 A;  5DUU A;  3V56 A;  4C0H A;  4HN0 A;  3BU7 A;  4Q2F A;  1CAX B;  1T6G C;  4LBQ B;  3VD9 A;  3VBO B;  2LTN A;  2WSU A;  2HWC 1;  5KHG A;  1JN2 P;  3H3Z A;  5FY7 A;  1NA1 A;  3PUH A;  3EB7 A;  2RS3 3;  2QQW A;  2RDQ A;  1FMD 1;  5FY8 A;  2BGP A;  5I0D A;  1IQA A;  1S55 A;  3G7D A;  1GZW A;  1LHN A;  5HCF A;  1ASJ 3;  3ZYJ B;  4IV3 B;  1RUJ 2;  5FZ6 A;  2P34 A;  1O3T A;  4EN6 B;  2VMG A;  1YYN A;  2VOX A;  1BBT 3;  2XQR A;  5EHD A;  2GC1 A;  3MHZ A;  2E7Q A;  5C9A A;  3M8L A;  3ETQ A;  1IPK A;  1G9C A;  3AVS A;  1QJY 3;  1CX1 A;  1OUX A;  1Q5O A;  3VBF B;  1XB9 A;  5FMO L;  3WNM A;  1UPI A;  2KXL A;  5C4W C;  5GZC A;  2ZGK A;  4N9H A;  1BHG A;  1DYP A;  1FOD 3;  2JG8 A;  4P14 A;  4X6Q B;  4YRD A;  3KSC A;  5G04 L;  4EZ4 A;  3FC0 A;  3H8X A;  4I3P A;  1RUF 1;  3I8T A;  4Y22 A;  1CAU A;  1RGS A;  1JU3 A;  5A33 B;  3MUY 1;  1R08 1;  1NG0 A;  1SFP A;  1XXN A;  1UU4 A;  1RUC 3;  3NRU A;  1EAH 3;  1PMJ X;  1CVN A;  5FZ3 A;  4GD4 A;  1FPN 2;  1AR7 2;  2JXA A;  1RXG A;  1W6N A;  3AFK A;  2J1A A;  2P2K A;  4OI1 A;  2VZ1 A;  5CU1 A;  1NE4 A;  1NZI A;  4E27 A;  2JEM A;  4IE4 A;  1WCS A;  2PHX A;  2X53 S;  4MGK E;  4O7X A;  5CB7 A;  3TN9 2;  1VBC 2;  1UY0 A;  4LLF A;  4LJH A;  3WW1 A;  1SLC A;  4GB3 3;  3UJQ A;  3MLJ A;  4TSV A;  1D4M 2;  2MPF A;  4ZON A;  2WYF A;  2A1X A;  3SIS A;  3U1X A;  3K51 A;  4ISR A;  1UMH A;  5HPO A;  5CFC A;  3RI9 A;  3ZYF A;  3IM0 A;  1C3H A;  1Z78 A;  2PTM A;  4M4P A;  4LOR A;  4G4F A;  3KV4 A;  5JPM B;  1KRI A;  4D7S A;  4DO0 A;  3TNP B;  5CG8 A;  1R1A 2;  3KCX A;  5CA6 A;  2RM2 3;  1VBB 2;  1IPJ A;  4E2S A;  3ZIX A;  4LOT A;  1RMU 1;  2VVE A;  4YM1 A;  4COV A;  5DDJ 2;  4AEJ A;  1VAV A;  3DN7 A;  1W03 A;  2XVG A;  2VBB A;  5DXD A;  4A6S A;  2BWA A;  5A3M A;  3V0B A;  1TE1 B;  1SBD A;  2Z4F A;  1YRZ A;  5FZM A;  4CCM A;  2XKP A;  3H1M A;  1SQ4 A;  3LWC A;  5C4W B;  2FMD A;  3MIE A;  5CFD B;  2G9G A;  4ES8 A;  3AMQ A;  3E1F 1;  2Q30 A;  4XTM A;  1BK0 A;  2EF6 A;  4AVA A;  3MV1 1;  1OLR A;  2CY6 A;  1FNY A;  1X82 A;  1DZT A;  5C3Q A;  3E97 A;  3WIN E;  1HB1 A;  5FYI A;  4IUG A;  5FO8 B;  2WZP P;  2XBO 2;  3POY A;  1RVF 3;  2R49 A;  4P02 B;  4TXW A;  4A2U A;  4CEW A;  2JDZ A;  3B01 A;  3FX3 A;  4BH9 A;  1V9U 2;  4QHB A;  5EFU A;  5DAQ A;  5BNQ A;  5KHK A;  1Y3T A;  1IKQ A;  2VVF A;  4Y24 A;  3AMN A;  4YZ3 A;  2XHN A;  2ZJC A;  4CDW A;  4DXS A;  2W46 A;  5KR7 A;  4NOT A;  3P5B A;  1X50 A;  2VOT A;  4CTE A;  5JSR A;  5H9Q A;  1RJ7 A;  1G6N A;  3H9A A;  3I2J A;  1GQH A;  1RUF 3;  2BER A;  3RZH A;  3W58 A;  4BHP A;  1TEI A;  4NRP A;  3Q9O A;  3UL2 A;  1JZ3 A;  2WNU C;  3B93 A;  3DEC A;  3FLP A;  5T3N A;  3O1O A;  3DXU A;  4OLL A;  1BMV 2;  1ULF A;  4A45 A;  4AG4 A;  3DYO A;  3SMH A;  4B4Q A;  5FLJ A;  3TNQ A;  1N1S A;  2AGS A;  1LOA A;  2WJS A;  1QJX 1;  5FY5 A;  3AP5 A;  3BB6 A;  4YZ2 A;  1OHF A;  5DG1 A;  4IE7 A;  4H55 A;  1PIV 2;  5F9T A;  1CAW A;  3H50 A;  4BM8 A;  1QWR A;  3M4F A;  1OVP A;  2LAL A;  3FHI B;  2RS1 3;  4QXC A;  2QQN A;  3VHP A;  2NMO A;  1KS5 A;  4Q4W 1;  4B1M A;  4M3C F;  2MEV 2;  4A44 A;  2G19 A;  3AX4 A;  3SQO A;  5F1R A;  4P00 B;  3LFM A;  3GCW A;  3KZ4 C;  4YG6 A;  3WHT A;  2UWC A;  1NLQ A;  3I2F A;  1RED A;  2ZGR A;  2C5D A;  4LBQ D;  4YVW A;  4UW3 A;  4YZ1 A;  1RMU 3;  2K46 A;  4DXT A;  2AZ5 A;  4PBO A;  5IT6 A;  5FK8 A;  3T0A A;  1JYT A;  3RRD A;  1CIY A;  2RDS A;  2RV9 A;  4DY5 A;  2BTV C;  4CEY C;  4ERO A;  3ZFF A;  2WQ8 A;  5KC6 A;  1ULC A;  5J1X A;  4WVW A;  1UPS A;  1PX4 A;  3LA2 A;  2TNF A;  4V2V A;  5DPN A;  3VKF C;  4JRL A;  4RS5 A;  1L7Q A;  5ABJ A;  4QMA A;  3ACG A;  4ZU4 A;  2QZ2 A;  1JYX A;  1LGN A;  5LAT A;  3KCY A;  2WNU B;  5J96 B;  1CAV B;  1PZ9 A;  1POQ A;  2RS3 2;  1QJE A;  4AI3 A;  2Q1M A;  1P8J A;  1BQP A;  2IXL A;  3N9P A;  4NE9 A;  4YFZ A;  5FXW A;  3NVC A;  3M2M A;  2RJ2 A;  2ZX3 A;  3N36 A;  3THC A;  3QLQ A;  3HIF A;  1BBT 2;  4XPV A;  4WZC A;  1UF2 C;  4XUT A;  3ZPO A;  1OQD A;  4M0H A;  2VVD A;  1IQD C;  1UZW A;  1WW7 A;  1PK6 B;  3WR0 A;  4M3C A;  5EIY B;  3QCW A;  3SIT A;  3IPV A;  5F3G A;  1TG7 A;  2XLF A;  4MZU A;  5CZK A;  5A80 A;  5FZ1 A;  1R09 1;  3T09 A;  3MIB A;  4ARY A;  2PHR A;  2D6N A;  1FOD 2;  1UCX A;  3NQH A;  4YGE A;  4QM8 A;  3WF1 A;  5AVP A;  5JXI A;  4UW5 A;  2EIB A;  4RL7 A;  3N7J A;  5GLU A;  1QJZ A;  3KGZ A;  4AQS A;  4WM8 A;  1UZ0 A;  3NV3 A;  2RS5 2;  4LHK A;  1EAH 2;  4RHV 2;  2WL1 A;  4AFM A;  4ZZ8 A;  1H2K A;  3ACI A;  1COV 3;  5F5I A;  2JEC A;  4UBH A;  5FMC A;  1KXG A;  4MET A;  2OYZ A;  4IW3 A;  3O12 A;  4OHX A;  2AC1 A;  4ASK A;  5CVR A;  3VBR A;  1DIW A;  2XPJ A;  2YY1 A;  4FPH A;  2FDK A;  3WNP A;  4GB3 2;  1XYO A;  3MBW A;  2DCJ A;  3JU9 A;  5EQU A;  4BK5 A;  1V6M A;  3JZV A;  4UFJ A;  4Q4W 3;  3GYD A;  4GKX A;  2GSY A;  1W04 A;  4XET A;  4Z2W A;  1NY7 1;  4FT8 A;  5HXM A;  1XJA A;  5SV5 A;  5LWB A;  2JDP A;  2R04 1;  2VMF A;  1W9Y A;  2RM2 2;  2W39 A;  2XJR A;  4Y20 B;  2XJS A;  4JZR A;  1OKQ A;  2XML A;  2YU1 A;  1IG3 A;  3EMR A;  1GIC A;  4MVT A;  1JS9 A;  4R4X A;  1DQ2 A;  2VZQ A;  1AR6 1;  5A7P A;  4OYU A;  3KV5 A;  1J3Q A;  3RYR A;  4UFM A;  4PF1 A;  3NNG A;  4AFB A;  4DPN A;  3HWJ A;  1OPO A;  1RC6 A;  3LD8 A;  4LEJ A;  4PLO A;  5JWP A;  4MGQ A;  5F6L B;  4HBN A;  5CYY A;  1MS1 A;  1UMZ A;  2C9A A;  3P6B A;  1F8V A;  3AP7 A;  1JUH A;  2W08 A;  2XWB B;  4WM7 C;  1SLL A;  4IGO A;  2GNM A;  4O9E A;  1K42 A;  3O0X A;  3PMS A;  3PIJ A;  5FYV A;  1US3 A;  3FL7 A;  3O14 A;  1KEX A;  3GBG A;  4Q29 A;  4IER A;  1CZV A;  3HQX A;  3LE0 A;  2A6Z A;  1OUS A;  2DFB A;  3I2H A;  3ACH A;  4L0P A;  3LOI A;  1RUE 1;  1RVF 2;  5A7W A;  4UFI A;  4FO9 A;  1O91 A;  1WWY A;  4BQ2 A;  1KFX L;  3PJQ A;  1G9F A;  3R0R A;  3UES A;  4AAP A;  1YJK A;  2QQI A;  4RQP C;  2E7T A;  5JZG A;  1LOE A;  5JOW A;  2DTW A;  2WAB A;  3OBR A;  1R09 3;  2D98 A;  1A8M A;  1W6Q A;  4A7Z A;  5FIX A;  3RGB A;  4TYS A;  5B4N A;  1UIJ A;  3TYJ A;  4E4H A;  4CUC A;  4Q4Y 1;  2VZT A;  2P3I A;  2RDR A;  4YPJ A;  1AXK A;  2FCT A;  2DUQ A;  1FAY A;  1RIT A;  2G9F A;  3MFA A;  5FZF A;  2UU8 A;  2D3R A;  4QD2 A;  2JDH A;  1S2K A;  3AKT A;  5IVE A;  5AC9 1;  3VD4 A;  3U07 A;  1RXF A;  3IMM A;  3OEB A;  3IDA A;  5IFT A;  4CCJ A;  4PIX A;  5K7P A;  3T1L A;  4BQ4 A;  2C24 A;  4BLI A;  3T4V A;  1ND3 A;  4WM7 B;  4GH4 A;  5L7O A;  5F32 A;  3WNK A;  1TME 1;  4QKN A;  5FXZ A;  4XDP A;  2RS1 2;  1MEC 2;  1OFS A;  1OQ1 A;  2RG4 A;  2VY0 A;  1O7F A;  3AYE A;  1CX4 A;  3WZ1 A;  2WZ8 A;  4FPL A;  4CCN A;  1V00 A;  2CAU A;  4MGT A;  4ZHN A;  1AR6 3;  1YI7 A;  4UFH A;  3TB0 A;  5FPL A;  4IEV A;  3VL8 A;  2WO7 A;  3O5S A;  4Y26 A;  2OZJ A;  4ZS2 A;  4YGB A;  4RQP B;  4PI0 A;  3Q8C A;  4MV2 A;  3USU A;  2IUW A;  3LGR A;  5FZO A;  1H8V A;  3O1R A;  4NMI A;  2VQ0 A;  2CGO A;  1R1Z A;  1G8W A;  3SCG A;  3AK0 A;  2VNG A;  3GZE A;  4JAA A;  4BE3 A;  2Y38 A;  4R8H A;  1CAX A;  1DGW X;  2XVK A;  3BOD A;  4C91 A;  3VBO A;  1W2T A;  5FKB A;  4K7J A;  2VW0 A;  2XJQ A;  4LBL A;  5JIA A;  4OQ9 A;  5E6H A;  1RUE 3;  3BCW A;  2P3K A;  4FCA A;  3CZJ A;  2H0V A;  1DGR N;  2WWS A;  4JHZ A;  1V6K A;  2B39 A;  5K0U C;  4MGY E;  4GWM A;  4IV3 A;  3UKN A;  3V0B B;  3AL6 A;  3MW2 A;  1ZRC A;  3ACL A;  3PVE A;  3RVH A;  1XNK A;  1RUN A;  1J84 A;  1J3R A;  1FI2 A;  1S0G A;  3I7D A;  3FUQ A;  3PU8 A;  3B5L B;  3MEP A;  4H7M A;  1JH5 A;  5EJZ B;  4BQ3 A;  3PLQ A;  3DYM A;  3MYX A;  3GJB A;  3NW4 A;  2BFU S;  3I4I A;  3VBF A;  1LES A;  3VKM A;  3WQB A;  5J7M A;  4Q4Y 3;  5FQ0 B;  3PUR A;  4YW4 A;  2NN8 A;  4UW6 A;  3VBS A;  2FBE A;  1FV2 A;  3D3A A;  4BWO A;  3RJ2 X;  3ZM8 A;  4PHZ A;  3ZYI B;  2W1Q A;  4AGV A;  4LBO A;  3K4Z A;  5JR7 B;  3E5U A;  5A1L A;  5FYC A;  1LGC A;  5A33 A;  1RUJ 1;  4DNY A;  1YIF A;  2C4X A;  1K3I A;  5AC9 3;  2JKB A;  1COV 2;  5DN2 A;  4ZU5 A;  4QXH A;  3WSO A;  5C71 A;  2DCK A;  3OB8 A;  4FQ4 A;  2XON A;  3PU3 A;  1OH4 A;  2WFF 2;  2W94 A;  4I0B A;  3N9N A;  4QQP A;  4Z82 A;  3ZSM A;  4CDX C;  4YSF A;  3GDB A;  4MX3 A;  4PF5 A;  3SH3 A;  2R1D A;  1LOF C;  1W3V A;  2ZOE B;  4XMI A;  4QPG C;  1DGL A;  2ADD A;  2PHW A;  1JUI A;  4X8P A;  4XTP A;  4Q8K A;  3B94 A;  1MS4 A;  2VXR A;  4FPE A;  1W0N A;  3POW A;  1OOP C;  3VD7 A;  3HNM A;  4A42 A;  1WMX A;  4C90 A;  5CKQ A;  3POG A;  2VNO A;  2NM1 A;  4HLT A;  4MHU A;  4WBB A;  1J83 A;  1ENX A;  2QTW B;  2JIC A;  5JI7 A;  5FZD A;  5K0U B;  2BV4 A;  1XNA A;  3I2K A;  1IG0 A;  1FPN 1;  1AR7 1;  5E89 A;  1AXZ A;  2OT7 A;  1HQN A;  3BIE A;  3D0J A;  2ZGQ A;  3A23 A;  5FPX A;  4DFS A;  3NKT A;  4AWD A;  3TN9 1;  1VBC 1;  4L8Q A;  1CAW B;  1QNY A;  1ZRR A;  4XFC A;  1F15 A;  3HNB M;  5EXO A;  1UXX X;  2JB8 A;  3OYW B;  2O8Q A;  4K8F A;  3ZSL A;  2HWB 3;  4CYD A;  4E8C A;  3INA A;  1D4M 1;  2LRP A;  5C4W A;  3JCI A;  2OXB A;  4XW3 A;  5HI0 A;  5CFD A;  4XHX A;  5GZE A;  1JXN A;  5D8A C;  3ZFG C;  3KF5 A;  2BZD A;  4CDQ C;  1MZE A;  1US2 A;  5F5Q A;  2XG3 A;  1DZQ A;  1R1A 1;  4MGI E;  3GGL A;  4XCA A;  2GAL A;  4PIY A;  1N3O A;  1VBB 1;  4HN1 A;  1SMV A;  5C3O A;  3MPB A;  4D3W A;  5C5U A;  3O1S A;  2VU9 A;  5DDJ 1;  2LM3 A;  4XMA A;  4P9J A;  1G9B A;  5GLT A;  2QJV A;  4RFR B;  3N4M A;  2WKK A;  2TEP A;  4L92 A;  1WD4 A;  1FV3 A;  2JE7 A;  1YNA A;  2PQS A;  1UU5 A;  2IXC A;  5F3I A;  5LRR A;  1TNF A;  4QPG B;  5FZA A;  1WCK A;  2A70 A;  1GU3 A;  1UN1 A;  3J26 N;  1GUI A;  1JZ8 A;  1OOP B;  2R6Q A;  3BU0 A;  3DCQ A;  2UUR A;  5F3E A;  2AEZ A;  4BIO A;  2C9K A;  2E32 A;  4Q5O A;  5FR3 A;  1O3S A;  1ZX5 A;  1ND2 C;  3IAQ A;  4KGQ A;  4P9I A;  2XBO 1;  4FPY A;  2K0G A;  4W65 A;  1C1L A;  1M4W A;  3B69 A;  4E9K A;  4QKB A;  1XU1 A;  4LIU A;  2EAK A;  4AYU A;  1V9U 1;  2IFR A;  3FHQ A;  2ZAH A;  4UF0 B;  5FP9 A;  2D43 A;  5GZD A;  4ZY9 A;  4AL9 A;  5LBE A;  1OC1 A;  1SZB A;  2XL9 A;  2R06 2;  4LA2 A;  2OW4 A;  4CZS A;  4AEM A;  3WG2 A;  2EIC A;  2JDU A;  3MIH A;  2ZGM A;  5D8A B;  3ZFG B;  1VPH A;  2WLQ A;  1KS4 A;  2WWJ A;  2Z42 A;  2ZGP A;  3VHN A;  4CDQ B;  1JHJ A;  2E51 A;  1GOF A;  1XC6 A;  1W0O A;  3L2Y A;  2ARX A;  3IDE A;  5T50 A;  1KJR A;  3IIA A;  1OKO A;  2HEV F;  2V09 A;  2W1S A;  3OEA A;  4QX8 A;  1BMV 1;  2HBT A;  3MDP A;  1AR7 3;  3CO2 A;  4FXK B;  3ME2 A;  5J36 A;  3LEG A;  1GAN A;  5T54 A;  3W59 A;  2FZ1 A;  2XB6 C;  4IL7 A;  2XXZ A;  4AQ6 A;  1WW4 A;  3KHC A;  1W9F A;  2YC2 A;  3WXP A;  1PIV 1;  2WS9 2;  3D0S A;  3ITQ A;  3POS A;  3HPN A;  5FO9 B;  3G6J B;  4M01 A;  4WZF A;  1JOJ A;  4JKM A;  2XLA A;  5FWE A;  1RL3 A;  5GKA C;  1ND2 B;  2MEV 1;  3AZX A;  3H1Y A;  3LEM A;  5A6Z A;  3ZSE A;  1CZT A;  2W1U A;  3AVR A;  5D2A A;  5IUQ A;  3NAP B;  2WNU A;  1YQ6 A;  1ODM A;  3O1T A;  1CAV A;  3KLS A;  1DZR A;  2DCT A;  4FAH A;  1CD3 G;  1DGR A;  1NZC A;  3KWV A;  5A32 B;  3CJX A;  5T5J A;  2JDA A;  1V0A A;  5DDJ 3;  5JOZ A;  5IJR A;  1WKY A;  4LKE A;  1CJP A;  2DWR A;  1DU3 D;  3V0A A;  3K48 A;  3O1U A;  1BCX A;  2ORX A;  2FDI A;  4NWW A;  2X10 A;  1XE8 A;  5FUP A;  1W90 A;  3T30 A;  5IAX A;  4BQ5 A;  5IVB A;  4NID A;  1W9T A;  3FLT A;  3JQW A;  3OUI A;  1YFW A;  2CDP A;  2DDU A;  4XIL A;  5FYS A;  1OF3 A;  5DQ0 A;  2BVB A;  3ZN5 A;  2R07 2;  3K3O A;  1BVV A;  2RS3 1;  5FYY A;  1JOD A;  4LUL A;  5JLV A;  5C3P A;  2XBO 3;  2ZGT A;  3CMG A;  2XQX A;  1UAI A;  4N90 A;  5CNA A;  4AQ2 A;  3PHM A;  5CG9 A;  3M7A A;  4AI9 A;  1VRB A;  2W2I A;  1V9U 3;  4GUL A;  2D5F A;  4BQW A;  1BBT 1;  4XAB A;  3T4H B;  4RGA A;  4C1X A;  2EXH A;  4N43 C;  3LDR A;  3OUJ A;  4OZX A;  1IHM A;  1N47 A;  4CP1 A;  1ZRD A;  4AK3 A;  5FXV A;  5HCB A;  1UZZ A;  2JIG A;  3PUS A;  3RI8 A;  3WD5 A;  1DLL A;  1PX3 A;  1GOG A;  3B02 A;  1YFU A;  1QJF A;  3P3N A;  5DAX A;  5E8A A;  3T08 A;  2QKD A;  5A6Q A;  5JAX A;  1FOD 1;  5E1R A;  3POE A;  4FPC A;  4HKO A;  4YW3 A;  3WUD A;  1Z0H A;  4K9S A;  5T5O A;  2ZGU A;  2RJK A;  4EV0 A;  1WLD A;  2V5D A;  3EXU A;  3J7M A;  5TSW A;  3WW2 A;  1LHO A;  1VB2 A;  4A6O A;  4ET7 A;  2RS5 1;  3ZIW A;  4M3C E;  5FDB A;  1EAH 1;  4IV1 C;  4RHV 1;  2QVS B;  3HMY A;  4GXL A;  1VIW B;  4NAO A;  4XUR A;  1N1T A;  2R0F A;  3IT8 A;  1ND3 B;  1SFY A;  3FJS A;  2V4V A;  1RUO A;  1DQ5 A;  1W05 A;  5FYT A;  1PIV 3;  4GMP 3;  2ZGS A;  3WQ7 A;  4QQL A;  1V6I A;  2HWB 2;  4GB3 1;  4K6B A;  4UT5 A;  4OHY A;  3FHA A;  4QDQ A;  4Q1R A;  1ULD A;  2H6C A;  4DIN B;  1AR9 2;  1AYM 3;  2MEV 3;  4D94 A;  3ZOI A;  5CAD A;  5F3C A;  4V1P A;  3VKL A;  4QB2 A;  1S2B A;  1OQE A;  5I8S A;  2P5B A;  2X5I C;  5FYB A;  2RM2 1;  1PGL 2;  5HCA A;  1CES A;  1AXY A;  4KNC A;  4QU1 A;  3HR9 A;  1XNB A;  2QQO A;  1QDC A;  4LNV A;  4CU8 A;  2E63 A;  3PVN A;  3VV1 A;  2YV8 A;  4OCT A;  5ERL A;  1O4Y A;  1NQJ A;  4XDO A;  1AUY A;  3T2Q A;  1OT5 A;  1O8S A;  3ORJ A;  4FVV A;  2UY8 A;  1W06 A;  4Q0V A;  2A6V A;  5A7O A;  3OCP A;  5CEH A;  5IVJ A;  5M0T A;  2BBV A;  5FPA A;  1C28 A;  1REF A;  4IEY A;  2YBS A;  2GME A;  2PN5 A;  4G9S B;  1CGP A;  3K4D A;  4CUA A;  2YPJ A;  3WNN A;  1H6X A;  1NT0 A;  4IV1 B;  3THP A;  4AED C;  5DUX A;  1RVF 1;  2XL7 A;  2P3J A;  3ZXJ A;  3SCH A;  4Z2A A;  1DCS A;  3ZN4 A;  3LSD A;  1CN1 A;  4XUN A;  4JKK A;  4NAM A;  1ZYB A;  1I6X A;  2VZV A;  3NNJ A;  5J09 A;  3ZN6 A;  1U5Z A;  3D82 A;  5FJK A;  3WDU A;  1QU0 A;  4ES9 A;  4LO4 B;  2FDG A;  4QHO A;  2OII A;  5J3U A;  3VBS B;  4I3G A;  2HKX A;  4WM7 A;  1CPM A;  2YRO A;  1WCQ A;  2WZR 2;  3NJY A;  1IS4 A;  3A22 A;  1BLZ A;  1LB2 A;  2JKX A;  3K4A A;  4BOW A;  2BP6 A;  2WNE A;  2E53 A;  1ZA4 A;  2RS5 3;  5T52 A;  4RHV 3;  2WIN B;  1NKG A;  1J1L A;  4L9B A;  3RS6 A;  4JX0 A;  3MFC A;  3EO6 A;  2GH8 A;  1W28 A;  1XNT A;  4CRQ A;  3PNA A;  2PAM A;  4RQP A;  1RB8 G;  4R52 A;  2IWG B;  4FAG A;  4H7L A;  1LCL A;  4XJU A;  1OA3 A;  2Q8C A;  2FCV A;  2PHL A;  4HG6 B;  5FP8 A;  2GNB A;  2RS1 1;  4FOW A;  4LBN A;  5JVV A;  2ZKN A;  1ENQ A;  1MEC 1;  1OLM A;  2OVU A;  3WQ0 A;  2ZGO A;  2DFC A;  2ZEZ A;  3P3P A;  2H6B A;  3U78 A;  4AED B;  4KGG A;  3HD8 B;  4CCK A;  1BEV 3;  1D0H A;  1EPZ A;  1N3P A;  3DGT A;  4KQ7 A;  4UWD A;  2GH2 A;  2FDH A;  2YBK A;  2WA3 A;  3VZL A;  1Q43 A;  3CNA A;  1ENS A;  3ZMN A;  2JJ6 A;  3ZX7 A;  3M3E A;  1HXS 2;  1S0J A;  2WYS A;  2BRT A;  2XJU A;  3IDB B;  4NJ4 A;  4SBV A;  2AYH A;  5FO7 B;  3A7Q A;  4ZXE A;  1RUG 2;  3UT0 A;  4J1W A;  1EYB A;  4IE0 A;  2DUR A;  4BPZ A;  1O3R A;  2A3W A;  4UI9 L;  3ZMO A;  4QGL A;  4XF3 A;  1ZRI A;  2VCC A;  3VDA A;  4B7K A;  2RE9 A;  2VW2 A;  3N9L A;  1ZBA 3;  3PL0 A;  4MXW B;  4ITC A;  4YZ4 A;  1QNW A;  3I3B A;  4XFI A;  5FQ0 A;  3AZV A;  1RUD 3;  1OBN A;  4FOQ A;  4MXV A;  2B5H A;  4E4Z A;  4QX5 A;  1VBD 3;  3THD A;  4HAN A;  1XND A;  3PUA A;  1AJK A;  1PMH X;  3JBG 3;  5JSO A;  4E8D A;  2CTV A;  3HVD A;  3JUU A;  2OQ7 A;  3V65 A;  1RHI 2;  2OKX A;  1PM7 A;  2VOV A;  4LA3 A;  2DYC A;  2UY9 A;  5KXE A;  1QY4 A;  5G05 L;  4NR1 A;  2D7F A;  2GN3 A;  5GAL A;  4LO8 A;  2IXK A;  4JC1 A;  3AYA A;  1HB2 A;  1W6P B;  5DG2 A;  5D21 A;  1SCS A;  1LGB A;  1YWK A;  4J25 A;  4CVU A;  3C3V A;  1SDD B;  2CL2 A;  4XOG A;  3WG3 A;  1JBC A;  3LA7 A;  4NHY A;  4HFS A;  1JYI A;  2IC1 A;  3I2G A;  3L2H A;  4Z8B A;  3LDB A;  1POV 1;  5IVY A;  1COV 1;  1O5U A;  3KQR A;  5K0U A;  3OJB A;  2BQP A;  2X09 A;  5FP4 A;  4ISQ A;  1FXZ A;  2WFF 1;  2XKO A;  3VZO A;  3R4S A;  3A0K A;  3KB5 A;  3RQ0 A;  2ZEY A;  1XOY A;  2VUA A;  4ZZ5 A;  2DV9 A;  2RMU 3;  1TNR A;  5KXD A;  1AR8 3;  3OG2 A;  3B9I A;  2WO1 A;  4XIO A;  3K75 B;  3OYW A;  2D6L X;  4XF1 A;  4LIV A;  1WBF A;  1WA6 X;  4YW6 A;  4YZ5 A;  1MEC 3;  1MS9 A;  1AYM 2;  1UL9 A;  2V4A A;  2BW8 A;  4RYD A;  1U5I A;  1CIW A;  4QPI C;  3OGR A;  2VD7 A;  3S5A A;  3MV0 1;  4DZG A;  4DUX A;  4XZP A;  3D4K A;  2W68 A;  4HMZ A;  4PLM A;  1ULE A;  3OGV A;  3CDZ B;  1D2S A;  2QZ3 A;  4ONU A;  1GZC A;  2FDJ A;  4XVH A;  4EQV A;  2W5F A;  1D2Q A;  4J6G A;  1UU6 A;  1PMI A;  4QX1 A;  4CDX A;  4HPK B;  2XH6 A;  2PHU A;  4PQQ A;  2CYF A;  5FFO C;  1W3X A;  4HVO A;  1LOF A;  1XSQ A;  4BIS A;  2ZS6 B;  4F83 A;  4QPG A;  2JX9 A;  3VBH C;  2VOW A;  2EIE A;  3P1I A;  1WCU A;  1F9K A;  1LEM A;  1QXJ A;  1OOP A;  1QOS A;  1HRI 3;  4KBZ A;  4NPR A;  4TTG A;  4I2O A;  3MIG A;  5SV8 A;  3PUI A;  3C7E A;  3ZXL A;  5JMO A;  4EN7 B;  2GND A;  4AGG A;  4D6R A;  5K4L A;  1S0B A;  4CU9 A;  1JYW A;  1RUH 3;  2ZX4 A;  4YVS C;  3V0A B;  4HT1 T;  3WP4 A;  2VMI A;  3ZFF C;  4RGK A;  2WAO A;  4AGR A;  4AOC A;  1HB4 A;  4OHW A;  4COY A;  1HLC A;  4P9X A;  1ULP A;  5LRS A;  5FUI A;  2QQM A;  2SBA A;  4OUM A;  1NXM A;  2ILM A;  4XXP A;  1G7Y A;  4JDO A;  3MIF A;  3M3Q A;  4Y4R A;  4YFW A;  3WQ1 A;  4LR4 A;  4A7Y A;  4UF0 A;  1UYZ A;  1HQW A;  1UZV A;  3AP4 A;  3VKN A;  2ZX0 A;  3AMM A;  4HKL A;  1NCR C;  3ZFG A;  5D8A A;  4K1Z A;  3ZFE C;  1ALY A;  2E33 A;  3I59 B;  5FZ8 A;  5F5A A;  4CDQ A;  2PHD A;  4E4S A;  4QPI B;  1APN A;  5LA1 A;  2GC0 A;  5LCW L;  3B9C A;  3K46 A;  1SBE A;  3PJY A;  1H1M A;  1POV 3;  1TMF 3;  4OZO A;  4DB5 A;  3Q8A A;  4NUB A;  2QBX A;  2WFF 3;  4CEY B;  4W4Z A;  3OPW A;  2BU9 A;  1JYN A;  2R06 1;  2VE1 A;  2PMW B;  4AEK A;  5DAV A;  1YQ8 A;  3I3Q A;  3M70 A;  5IWF A;  5KHH A;  4Y5T A;  3VBH B;  2CGP A;  1JYC A;  1W9S A;  4Y1Z A;  4NHL A;  4LXL A;  3SH4 A;  5EV7 A;  1QOO A;  2B45 X;  3WNL A;  1ZZ7 A;  3FE5 A;  4FFH A;  5JCT A;  5FYU A;  5JOX A;  4OI0 A;  1PO2 2;  4YW2 A;  4BA6 A;  1GLH A;  3RZJ A;  4S2F A;  2OX0 A;  1ND2 A;  1FNZ A;  2EAA A;  3Q8F A;  4YVS B;  3ZYR A;  3BOP A;  4MLO A;  5EYY A;  1BEV 2;  3NAP A;  1EY2 A;  1QF3 A;  4E2Q A;  4MG2 A;  3M3O A;  2RR1 2;  1PZ8 A;  5A32 A;  2RDN A;  2DUP A;  3BUC A;  1W99 A;  4QX3 A;  3NV1 A;  4XE9 A;  4BCU A;  4AHY A;  2FMY A;  4QGM A;  1KGY A;  3CZU A;  3DV8 A;  3ECQ A;  2FD8 A;  5A1F A;  5AFE A;  4KMQ A;  2TUN A;  2WS9 1;  2VCA A;  3U0Z A;  2O1Q A;  4TWT A;  4BJ0 A;  2D3S A;  3AZW A;  2EVX A;  2VAU A;  3RFR A;  3U37 A;  1ZBA 2;  2IVI B;  5FXX A;  4EE2 A;  5BY5 A;  4GA9 A;  2DVD A;  1IOA A;  2WA4 A;  1RUD 2;  4LBK A;  5A70 A;  4QX7 A;  1VP6 A;  4Y1U A;  1VBD 2;  4JGY C;  2WDB A;  4P5Y A;  1XSR A;  2WO3 A;  3AXD A;  5IW0 A;  1C57 A;  3J7L A;  3JBG 2;  4IDZ A;  4ASL A;  2D6O X;  4K8R B;  4NRQ A;  5LEK A;  3I3M A;  3NO8 A;  4YW7 A;  1RUI 2;  3ZYH A;  1SHW B;  1W2O A;  2P1B A;  1VJ2 A;  5FYZ A;  4Q27 A;  1GQP A;  3VBU C;  5CBL A;  3H3L A;  1UIK A;  1R64 A;  1V70 A;  1OA2 A;  3Q8B A;  4UOJ A;  2MNG A;  4YGD A;  4MAD A;  5B2G B;  4XBN A;  3QH6 A;  1HRV 3;  3MF6 A;  3PIG A;  4TLG A;  2R07 1;  2X29 A;  4MOA A;  5H9S A;  3F2Z A;  5EYX A;  2F17 A;  4XYX A;  1AYN 2;  4QX0 A;  4UW4 A;  2DCZ A;  4YG3 A;  2BOJ A;  3GZA A;  4ATF A;  5E16 A;  1X36 A;  2VUC A;  1MR5 A;  2G1M A;  3EHK A;  1QXP A;  1VLN A;  3TRS B;  5BNO C;  1WMF A;  2FQP A;  1JOB A;  2X8K A;  3MI8 A;  1YCI A;  2VZO A;  3QBQ A;  1SG3 A;  3AKQ A;  1DFQ A;  3ZN6 B;  1DQ6 A;  4CDU C;  1JTZ X;  2R06 3;  3IWZ A;  5ANN A;  2XDV A;  1QOT A;  3MW4 A;  5A7Q A;  1I5Z A;  5FZL A;  4DEQ A;  2D6M A;  2RMU 2;  3ZXG A;  1AR8 2;  1BXH A;  4N53 C;  5LBF A;  5FRE A;  4OUS A;  1SLB A;  2JIJ A;  2VW1 A;  1Q8O A;  4SLI A;  1U12 A;  1Q56 A;  5KXB A;  1O4T A;  1UY4 A;  5DAW A;  2D3P A;  4LTA A;  1DGW A;  2BNN A;  3J7H A;  2J22 A;  1PHM A;  4JGY B;  3C8X A;  4A4A A;  1HV0 A;  2BNM A;  3ASI A;  1W6O B;  1NQD A;  4OVE A;  5GZG A;  2PFW A;  2R32 A;  5JPN B;  3OOX A;  4DS0 A;  1NOV A;  3M3I A;  4OHZ A;  2JDK A;  2LRO A;  4ZPI A;  2B9V A;  4E4D X;  1OFN A;  4I0W B;  3VHO A;  4BYY A;  1ZZB A;  3D5O A;  1OSG A;  4M00 A;  4OUE A;  2JE8 A;  1LU2 A;  4DEV A;  4IGQ A;  2WS9 3;  1UOF A;  2HWB 1;  1Y9M A;  2H0B A;  1C1F A;  2RHP A;  2VTF A;  3F95 A;  3RWK X;  2WBK A;  2HJI A;  3LKJ A;  3IN9 A;  1AR9 1;  2ZZJ A;  2B7Y A;  2VCM A;  5A3W A;  3W20 A;  4GJY A;  5JXH A;  1DDL A;  4ZS3 A;  2EIG A;  1LAJ A;  1LOB A;  1HRI 2;  4QM9 A;  3ZXA C;  5ACA 2;  1E57 A;  1HKD A;  1OVS A;  4ATE A;  3S6P A;  4F3J A;  4CEW C;  4EYU A;  1K12 A;  2ARB A;  4YYO A;  4AR2 A;  1PGL 1;  1C5I A;  3BTY A;  5BNO B;  1LED A;  5DZF A;  5FPV A;  1RUH 2;  2QQL A;  2R1B A;  4IV1 A;  1WBL A;  1XNC A;  5BNN C;  2ZAC A;  2SLI A;  3K2O A;  4CDU B;  2Y26 A;  3Q8E A;  1KDM A;  5FJH A;  4OHV A;  4AW7 A;  2HWD 2;  1B35 C;  3SKV A;  3A4U A;  4KWJ A;  2WO2 A;  2O0O A;  4K21 A;  1BYH A;  1T2X A;  4YG0 A;  3VZK A;  4N53 B;  3ZO0 B;  1IZ3 A;  4XFA A;  1DQ0 A;  3RZG A;  3HBZ A;  4FPG A;  4FFI A;  2VZR A;  2R07 3;  4BXS V;  2ET7 A;  1L7L A;  4I02 A;  1POV 0;  2ZGN A;  1Q8S A;  3LPF A;  2W52 A;  3WF3 A;  3O1M A;  3KT7 A;  3AB0 A;  1YFX A;  2A75 A;  4P9Y A;  3J9S A;  2EID A;  1PO1 2;  2X5I A;  3O1V A;  3BI3 A;  4K1Y A;  5LK5 A;  2C6S A;  2Z5W A;  2C26 A;  2Q8O A;  3NNM A;  4XFB A;  1TMF 2;  3CJI C;  3ZDV A;  5A3U A;  3N7M A;  2PEL A;  3GM8 A;  2A6W A;  1XBF A;  5CAZ A;  5EJ3 A;  5HXV A;  5FYM A;  3AKS A;  2D97 A;  4RR3 C;  2VM9 A;  1QMJ A;  1H1I A;  1N3Q A;  4K3U A;  4IET A;  1GKB A;  2XR4 A;  1LKN A;  1XQN A;  2VXJ A;  2YU2 A;  3M3C A;  3NV2 A;  1GWL A;  2I45 A;  2OA2 A;  1RTV A;  2VGD A;  1H1A A;  4K40 A;  5FYH A;  2GNT A;  4GWJ A;  1GWK A;  1RIR A;  4HXC A;  2WZR 1;  3VZM A;  5HBA A;  1F5J A;  3RZM A;  2GMM A;  1UY2 A;  2ZEX A;  3JB8 A;  3N7L A;  2V72 A;  4HOO A;  4UAP A;  4YVW C;  4BZ4 A;  1VBA 2;  3NMB A;  4D0Q A;  5CIR A;  4CP9 A;  2ATF A;  4CCD A;  4L99 A;  2G4I A;  2E9Q A;  2DVA A;  3QH7 A;  5LA9 A;  2IXI A;  4AED A;  2WNV C;  2ID4 A;  2ZHK A;  5FP3 A;  4LHN A;  1MS5 A;  1UYX A;  4R9C A;  3S7E A;  1A8D A;  3NNL A;  4KWU A;  3ST7 A;  2IZW A;  4MO3 M;  2VMH A;  3MLK A;  1ULO A;  2O8O A;  1X9T A;  3J4U H;  3WOG A;  4CCO A;  4LK6 A;  1REE A;  5LK7 B;  2GU9 A;  1O8P A;  3UV9 A;  2XJV A;  4AHZ A;  3FFZ A;  1K5M C;  1Y9Q A;  3BKZ A;  1AR9 3;  5LB6 A;  3WV6 A;  3WVJ A;  2Q4S A;  2AEY A;  1V6L A;  1W2U A;  4X6R B;  5JXJ A;  5FZ9 A;  3GXU A;  4KG0 A;  3T0D A;  4KU7 A;  4MXW A;  4FTE A;  1VRH 3;  1PGW 2;  1OXC A;  3BTA A;  3CJI B;  3B3Q E;  2VPV A;  2HWF 2;  3GAL A;  2UWB A;  3V64 A;  4B4R A;  4CDX B;  1QDO A;  1Y4W A;  4HL0 A;  5KC5 A;  4RR3 B;  3C7O A;  1HXS 1;  1MZ6 A;  1UOJ A;  3ZPY A;  3BYW A;  4Y3O A;  1OLM E;  5LZ6 A;  1I1E A;  1RUG 1;  2HEY F;  2G9Z A;  1X33 A;  2WSV A;  3UET A;  3C7F A;  3FN9 A;  1LU1 A;  5FBZ A;  4NN0 A;  2BBA A;  3JQX A;  3TOJ A;  1E5H A;  2Y6L A;  3VGI A;  2WR9 A;  2CDO A;  3BTX A;  1HRV 2;  2A3Y A;  3C7H A;  1F31 A;  1UQX A;  1YHF A;  2HYK A;  4Q26 A;  4Y33 A;  1W6P A;  2J1U A;  1QJU 2;  5FY0 A;  3WP3 A;  1A78 A;  4FTS A;  2NYY A;  5T5P A;  2WNV B;  4IEP A;  4XF4 A;  2VUD A;  2VH9 A;  2LUW A;  3IDC B;  1SLT A;  4XHB A;  1S2E A;  2WZE A;  2DU1 A;  3N9Q A;  4CU6 A;  3PVB B;  2DF7 A;  4FPF A;  1RHI 1;  3FFQ A;  2J1T A;  3GHM A;  2VQU A;  2L9L A;  3W9A A;  1LNS A;  2YPD A;  4S2H A;  1J3P A;  1K5M B;  4PCR A;  2YBP A;  4CUG A;  1XYP A;  1OD5 A;  3GHN A;  2WZR 3;  3QOP A;  3R05 A;  4CSW A;  4LPL A;  4MGS A;  4U2A A;  4LHL A;  3C7G A;  1Z7S 2;  4RFT 0;  3WF0 A;  4OQ8 A;  4BXF A;  4X8N A;  1AVB A;  1QEX A;  1O59 A;  1F2N A;  2I07 B;  2VME A;  1YC6 1;  4JCK A;  1JZ6 A;  2Y33 A;  1W2A X;  2GC3 A;  2VZU A;  3WCS A;  4C0B A;  2WAA A;  5FKC A;  4AFD A;  3X29 B;  5C3S A;  4BDV B;  4ZKT B;  1UX7 A;  3LA3 A;  2IFW A;  4GMP 1;  4HPK A;  1A3K A;  5JIU A;  4Y5Z 0;  3LIH A;  3NJX A;  1H4H A;  1LUL A;  1GZ9 A;  1XRU A;  2E26 A;  2Y0I A;  1GP5 A;  2C1F A;  4HSL A;  1UZY A;  2PXJ A;  1AYM 1;  1JZ4 A;  4FTB A;  2Y6G A;  5GLV A;  3WF4 A;  3VHR A;  3CU7 A;  4YNI A;  3RMX A;  1HDK A;  3C2U A;  3URF A;  1LEC A;  2ZBJ A;  4LOS A;  4OMC A;  1MS3 A;  1E5S A;  1YUD A;  1EP0 A;  2Y8K A;  4MGZ E;  5I0S A;  4CXX A;  2GMP A;  4V2W A;  1YLL A;  2VOK A;  3CIH A;  3WEZ A;  1HXS 3;  1PNG A;  2O14 A;  3AJZ A;  1RUG 3;  1MZF A;  4JQR A;  2DBN A;  4QXB A;  5A3N A;  3W5N A;  2A6X A;  1VMJ A;  1S0I A;  3ALQ A;  3FZ3 A;  4IEO A;  2NP0 A;  2ZZQ A;  4LBJ A;  2VCB A;  1KDK A;  2PAK A;  2VQT A;  4FXG B;  5DAB A;  1VAL A;  3JXS A;  5L9R A;  4AVV A;  2ZML A;  4FOY A;  3HQR A;  5F2W A;  2OZ6 A;  5A6Y A;  2GP3 A;  1H8T C;  3BIW E;  1W8T A;  2QDN A;  5F39 A;  3I59 A;  1WUV A;  2GC2 A;  1YO8 A;  4QPI A;  3LPG A;  1EUT A;  3JB4 C;  4XJW A;  4XJA A;  4K20 A;  4A3X A;  3ZDS A;  2JG9 C;  3UNP A;  2P17 A;  2WFP A;  3HQU A;  2BYV E;  4IQP A;  4YW5 A;  1Q8V A;  1RHI 3;  3HT2 A;  1X9P A;  5I93 A;  3N9O A;  3AMP A;  4IEU A;  2XLG A;  4CEY A;  3H3U A;  1Q3E A;  2ZMN A;  2QE3 A;  3SXW A;  2Q5T A;  3VDD C;  4BQX A;  3LEK A;  3AKR A;  4GWN A;  1OLQ A;  2NLR A;  4QB6 A;  4DY3 A;  2QCS B;  3VBH A;  5C5T A;  5J37 A;  3RZK A;  4I01 A;  4CPB A;  1LR5 A;  4I30 A;  1NXD 1;  2KM2 A;  3WDY A;  5FZB A;  3J8F 3;  4AFA A;  2NMN A;  3UK9 A;  5JR2 A;  2WT1 A;  2ZX1 A;  4PDW C;  5C8C C;  2DVG A;  3ES1 A;  2GZW A;  3L9J T;  4PIZ A;  4YVS A;  4RD7 A;  3JD7 2;  4RA0 A;  1AL2 2;  4D7Y A;  2BFU L;  1WW6 A;  4XC9 A;  4DMI A;  4CU7 A;  4AF9 A;  4PT6 A;  1F5F A;  1MS8 A;  4FFG A;  4XZU G;  2XWJ B;  5HV0 A;  3BAL A;  2PA7 A;  1NCQ C;  2VG9 A;  5L9B A;  3RG0 A;  2AEN A;  5JXG A;  2ZAA A;  4LKS A;  2ZAB A;  3B00 A;  1MPX A;  3EYP A;  2B46 X;  1KD7 A;  1OA4 A;  4KBB A;  3ZFE A;  1H8T B;  4TZD A;  2YC0 A;  1CON A;  1MQT C;  1PO2 1;  1FX5 A;  2VZS A;  2YHJ A;  3U14 A;  5AFB A;  3PDQ A;  4IV3 C;  1VRH 2;  3BN6 A;  4EWD A;  2JG9 B;  2ES3 A;  1BEV 1;  3LAG A;  4NHM A;  3T1M A;  4PJY A;  4UYB A;  2Q8D A;  2RR1 1;  4B4P A;  4JRA A;  3D8C A;  1SLA A;  2DVB A;  3A21 A;  1BJQ A;  4N43 B;  5DAP A;  3HN1 A;  3VD3 A;  5BNP C;  3I49 A;  3VLB B;  4DRV A;  4XUQ A;  5CKM A;  2Y64 A;  3VDD B;  4Q8L A;  1CZS A;  4XUP A;  4AVC A;  1BKZ A;  1GFF 2;  3T3Y A;  4PI2 A;  1QQP 2;  1ZBA 1;  2Y0O A;  3IKW A;  5I0U A;  3WDT A;  1Y9G A;  1BVP 1;  1ULG A;  3I97 A;  1RUD 1;  4PDW B;  4N8M A;  5C8C B;  1HV1 A;  1VBD 1;  3T2O A;  1Y43 B;  1S0C A;  1UX6 A;  1OUR A;  3JBG 1;  4M0N A;  3ZSK A;  4B3N A;  3OBA A;  4DOU A;  3QAC A;  1AHS A;  3ZR6 A;  4ORF A;  3OD0 A;  1RUI 1;  1GBG A;  3WF2 A;  4Y5S A;  5F6K A;  5E88 A;  5FTT C;  2DUO A;  2OPW A;  1PM4 A;  1NCQ B;  2GAU A;  5HV4 A;  4AFC A;  2WLP A;  4EJR A;  3BVC A;  3GBF A;  5A1A A;  1WLW A;  3ZR5 A;  1UOB A;  3GBW A;  4BK4 A;  2FCU A;  1HJF A;  2ZHN A;  3ROU A;  3U10 A;  3ZYB A;  1H2L A;  2J42 A;  1MQT B;  5AVA A;  2Q8E A;  3OPT A;  2I2S A;  1AYN 1;  2X5I B;  4B1L A;  3SCF A;  2PLV 3;  3UGH A;  3AC0 A;  3DKQ A;  4AQT A;  4HVQ A;  5C7G A;  3H7Y A;  1GSL A;  1G9D A;  3BTZ A;  2Y6F A;  2OQ6 A;  3B7M A;  4JQT A;  1GWM A;  2Y6K A;  4JGY A;  5I91 A;  2XGX A;  2CWM A;  1W6O A;  2J7M A;  1O6U A;  5BNP B;  4AI8 A;  2OPK A;  1PVC 3;  4JHT A;  4ARX A;  3MW3 A;  4FI9 A;  2X05 A;  5CFD C;  2AUY A;  4Q4X 3;  2EXI A;  1YQ2 A;  1WCD J;  4LO7 A;  2RMU 1;  4Q4V 3;  3RYK A;  2VR4 A;  1AR8 1;  2ZX2 A;  3VBU A;  4ZU7 A;  4NII A;  1UD1 A;  1DBN A;  3VDC A;  2Q0A A;  1ZVF A;  5GJ6 A;  5C9A C;  4AVT A;  1KJL A;  2W9X A;  4Q0Q A;  2YGL A;  3OBT A;  3N35 A;  5IAT A;  4CP9 B;  1PO2 3;  1K45 A;  2JDN A;  3H7J A;  4FP3 A;  4Q0S A;  1NLR A;  3WHU A;  4CCC A;  3U4X A;  2HWE 2;  2JWP A;  3AXE A;  3KT4 A;  3OSD A;  2P6H A;  3FMG A;  1EV1 2;  2HBU A;  3IB3 A;  3KGL A;  2RR1 3;  3FWE A;  1X8M A;  2BVV A;  5BNO A;  4XFG A;  3UKT A;  1ZBE 2;  3HNY M;  3OTF A;  4XAE A;  3AZY A;  4CDU A;  1GNH A;  1C8M 2;  4UFK A;  4Y1X A;  2E7A A;  2XUM A;  3K3N A;  4LO5 B;  3FBY A;  1IS3 A;  5APA A;  4N53 A;  2R7E B;  3TAY A;  4S2G A;  5C3R A;  4LIT A;  2YMZ A;  1SPP B;  1ZZC A;  2P3Y A;  4P5H A;  1HRI 1;  3I2I A;  4R9D A;  3S5Q A;  5ACA 1;  1ZRE A;  1XE0 A;  3NV4 A;  1HN0 A;  5IAV A;  3OF1 A;  4FFF A;  1W6M B;  5ISL A;  1RUH 1;  1LHV A;  2OS2 A;  1I3H A;  3ILR A;  5DMY A;  2BPA 2;  3RZL A;  4COU A;  4NO4 A;  4A7K A;  4AVS A;  1RUI 3;  2W92 A;  1GR3 A;  3POF A;  2HWD 1;  4LE4 A;  1MS0 A;  1UY3 A;  1MZ5 A;  5D1I A;  1T6B X;  4QT6 A;  5FZC A;  1VMF A;  3CBN A;  2HWC 3;  5C9A B;  4YM2 A;  1LEN A;  1F4H A;  2E6V A;  2P6C A;  3LDK A;  1JZ7 A;  2VZ3 A;  1FMD 3;  1VBE 2;  3WP6 A;  3DPR C;  2YUE A;  3D6E A;  3ZLI A;  4CCL A;  1G86 A;  1CPN A;  2HYX A;  1AYN 3;  1VAK A;  2VC9 A;  4J1X A;  3UGF A;  5L9V A;  3CKH A;  3OGJ A;  3KS7 A;  3J8F 2;  1RJ8 A;  1C4R A;  1PO1 1;  1ENR A;  3WW4 A;  3PUQ A;  5JDB A;  3O1P A;  3H8O A;  4NRO A;  1TMF 1;  2DBI A;  2IXH A;  3N3H A;  4GMP 0;  4NIG A;  5I0T A;  4LKD A;  5BNN A;  2YYO A;  4R4Z A;  1JU4 A;  1I5P A;  2Z69 A;  5FBJ A;  4LHS A;  4QQO A;  1B35 A;  1YIP A;  1M06 G;  2UYA A;  2J1R A;  2KR2 A;  2XOM A;  4GKY A;  2PAE A;  1YQ5 A;  1HJG A;  4D6Q A;  1IPS A;  1CQ9 A;  2E31 A;  4N9I A;  5A3P A;  3UKV A;  1GNZ A;  1MVE A;  1XPW A;  3K77 A;  1R08 3;  3O0W A;  1J59 A;  3WG1 A;  4RSU A;  5LA0 A;  4KWK A;  4G3Y C;  2P4E A;  1VBA 1;  3GNE A;  2VUJ A;  4D6S A;  1ZM1 A;  3AKP A;  1PZ7 A;  4NHK A;  1U5Y A;  3LQC A;  4CXW A;  2YC4 A;  3LCP A;  1H9P A;  1GZT A;  1WGP A;  2CU5 A;  3CJI A;  4JDM A;  4BME A;  2EXJ A;  4DRR A;  4EWA A;  4QQH A;  4LBM A;  4LO6 B;  1QHD A;  3BGA A;  5FPU A;  4JV4 A;  3AYC A;  4RR3 A;  3E6C C;  2F6B A;  4IGP A;  1W9W A;  4QGN A;  1H2N A;  4WVM B;  3DPR B;  1X7N A;  2WWU A;  2XHK A;  4GAL A;  4NIH A;  1E5I A;  5ACA 3;  1GOH A;  3VUO A;  2B4K A;  4B7E A;  2VQA A;  5H9P A;  1PGW 1;  4PQ9 A;  4L97 A;  3S0M A;  1W39 A;  3DL3 A;  2TBV A;  2ZHL A;  3FLR A;  3VL9 A;  5I8Y A;  5KWR A;  1W8U A;  2HWF 1;  2WNV A;  5BV6 A;  4COZ A;  1C5H A;  2CV6 A;  3KF3 A;  3SNM A;  2VTX A;  2HWD 3;  3TBD A;  4EN8 B;  5IVC A;  3NWK A;  3T2P A;  4QB1 A;  2JB4 A;  1LOC A;  4Y4Y A;  3SEP A;  3USS A;  2J1V A;  2J1S A;  2VL4 A;  3BPZ A;  1PGS A;  4GWI A;  3THT A;  1W0P A;  4IND A;  3W21 A;  3WT3 A;  2VNV A;  1S0E A;  5FMD A;  1LHU A;  3PVO A;  3ZXD A;  4BLJ A;  2GN7 A;  1H9W A;  4BQY A;  1HRV 1;  1PK6 C;  2W95 A;  1K5M A;  3S30 A;  4QPY A;  5FZE A;  2XJT A;  4Z92 B;  2HLE A;  1IKP A;  1VR3 A;  4UFL A;  5H9R A;  1ASJ 2;  2I74 A;  4EN9 B;  1UKG A;  1QJU 1;  3EBR A;  4AHX A;  3TEZ A;  2PLV 2;  1PO1 3;  1MVQ A;  4HVR A;  2P37 A;  4N7I A;  2VZP A;  1IS6 A;  5FZH A;  1UY1 A;  3HOB A;  3DUI A;  3WNO A;  1WLC A;  2ENR A;  4N7U A;  4OFG A;  5LA2 A;  1QJY 2;  1PVC 2;  3H8U A;  1VMH A;  5FY1 A;  4Q4X 2;  4Q4V 2;  5EP9 A;  4FBF A;  4I09 A;  2BUK A;  1ST8 A;  1UO9 A;  1JHN A;  4XQD A;  1DP0 A;  2W87 A;  5EWS A;  5FWJ A;  2WN2 A;  4TLF A;  4LT5 A;  1GP4 A;  3J7N A;  1BZW A;  3NKG A;  4O61 A;  4XF9 A;  4XJ9 A;  1EPW A;  4WVV A;  2ZKL A;  4QQ2 A;  5FPZ A;  1RYY A;  2DU0 A;  4YWA A;  2Q1F A;  4NIA A;  2WII B;  1OPM A;  1VBA 3;  1WLT A;  1RUC 2;  5FOB B;  3NJV A;  2V5Y A;  1Z7S 1;  4OI2 A;  1X8E A;  3RDI A;  1DLC A;  1N1Y A;  4W8J A;  3SH5 A;  5KHI A;  1F35 A;  4XQW A;  4NVP A;  4QDR A;  1QJX 3;  4JGZ C;  2IXJ A;  5LY2 A;  3WP5 A;  3GF6 A;  3KCC A;  4JDN A;  2QQU A;  5EPA A;  5FK7 A;  1W8H A;  2C0Z A;  1QIQ A;  1DHK B;  3ZYG A;  4LLO A;  3NJZ A;  4DIQ A;  3I2D A;  2ZHM A;  4HZF A;  1J58 A;  4FP2 A;  1D7P M;  1NCR B;  1NA1 C;  2CHH A;  3PTR B;  3ZFE B;  2B9U A;  2CNA A;  1NUK A;  2JD9 A;  3HBK A;  2VNR A; 
#chains in the Genus database with same CATH homology
 3T4H B;  3O1S A;  4CXX A;  4MGT A;  4RFR B;  4ZHN A;  4ZS2 A;  2IUW A;  5DAB A;  4QKD A;  3BU0 A;  4CXW A;  3BTZ A;  3I2O A;  2FDH A;  3BKZ A;  2FDK A;  4NRM A;  4NJ4 A;  4JHT A;  4QKF A;  4QKB A;  4IE5 A;  4IE0 A;  3S57 A;  3O1R A;  3RZH A;  4NII A;  4NRP A;  4NIH A;  3O1O A;  3RZK A;  3KHB A;  3BTX A;  3I3Q A;  4IE7 A;  4ZS3 A;  4OCT A;  4NPM A;  3BTY A;  3RZJ A;  3H8X A;  3LFM A;  3KHC A;  2FDF A;  4MG2 A;  4IE6 A;  3BUC A;  4CXY A;  2FD8 A;  3RZG A;  3O1T A;  3RZL A;  4IE4 A;  4O7X A;  4NPL A;  5F8P A;  3O1M A;  4O61 A;  3I49 A;  3O1U A;  3O1V A;  3BI3 A;  2FDG A;  2FDI A;  4QHO A;  3BIE A;  4NID A;  3S5A A;  3H8R A;  4IDZ A;  3T3Y A;  4NRQ A;  3I3M A;  3O1P A;  3H8O A;  4NRO A;  3T4V A;  2FDJ A;  4NIG A;  4QKN A;  3RZM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...