3T4YA

S25-2- kdo monosaccharide complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
219
structure length
219
Chain Sequence
DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTITSVQAEDLAVYYCKQSYNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S25-2 FAB (IGG1K) LIGHT CHAIN
publication title Germline antibody recognition of distinct carbohydrate epitopes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 53
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2011-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3t4yA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3t4yA01
4QHMA 1OLZA 3KYKL 4QGTA 2Z8RA 4XXCA 5I1GH 1I3GL 4IJ3C 4XMPH 5FO7B 1R3IL 3S36H 4BA8A 2C7UB 3QNZA 5C0BA 3U6RA 3RGHA 4KTEL 5CBEB 4HDIA 1Y6MR 4D0CB 4I3GA 3ARBB 1IVLA 3I84A 3KDMB 1RPQA 1N26A 5ILTL 4OLZH 3SDDA 2GJZB 3W9EA 3Q6GL 2VR4A 1S9XA 4X4MA 1GGBL 1EGJL 5KAQF 1I3UA 1TVBA 1E4XI 1U95B 2FCBA 3IDXH 4HUKB 3CPLA 5GZNC 1V7NH 2EYTB 1L7TL 2LU7A 5FKAB 3OKMA 3VWJA 1X5KA 3LKSB 4ODTH 4XBPA 3O3BB 1MF2H 4U1SB 5JQ6L 4RSVA 1QA9A 3MV01 4FFZH 2J8OA 3ESUF 3S5LB 1R24B 3PV7A 1RUKH 1T66C 4XVUC 4AENA 1UWGL 4ZUSA 3DJ9A 5TE6H 4JQVC 5JA8B 3S4SG 3B9KD 4LLAA 1MAKA 5FFLA 5KOVC 1F4YL 1R5IA 2AV7A 5KVGH 5TDNA 4OIAA 3V6FB 1KYOJ 1ZANL 2E8ZA 1ZXQA 4WTXA 5DQDH 1PW3A 1CFBA 5T33L 1HZHL 2I24N 2HN7B 3A67L 4PJXF 1E0OB 4XNMB 1ZGLA 4KI5C 1CDGA 25C8L 1SJHB 4IMKA 4M9OA 4U2YA 4MJIA 1D6EA 4JFQA 4IRZH 1H15B 4FP8H 3MRLB 1JNHA 2FBJH 3H3PL 3TWCH 1ZHNA 5I75B 4QTIL 1DBBH 4GKSA 5GJSH 4AL8L 1A2YA 3ARZA 4WI2A 4S1QH 4OV6F 1S7WB 2Z35B 1MSPA 3QHTC 1HXMB 5DJDB 4QHMB 2FX8L 4M7ZB 4X9HA 1T1XA 3DVFA 3WFBL 2G9HB 4XPTH 3D5OF 3PGFL 1URLA 5ERWB 1HIMH 2EEBA 3MX0A 1MIEH 3QNZB 3P0VH 3VFPA 5I1GL 5C0BB 3U6RB 2X1WL 3S36L 4QOKE 4AJ0A 4HDIB 3WFEL 5A40E 3GJEB 4XBEH 5JHLH 5GZND 1ZA3A 5FK9B 4YHZH 5B38A 3SDDB 4LHJB 3WFDH 5DC9B 3W9EB 5TH2A 1S9XB 3ZO0A 1J05A 1E4KA 3KPTA 4LCWD 2JLLA 3PXJA 4HCRH 4DEPB 4OLZL 5DVLA 1TVBB 2EYSA 3TJEH 2DLFH 3FHAA 3CPLB 3IKCA 1JK8A 3OKMB 2NY7H 2Q20A 3VWJB 3LSOA 1T66D 1MFDH 2FGZA 3D48R 4XVUD 4Y8AA 1IM9D 3JBG7 1QA9B 1UYWH 2CXGA 3IS1X 4ODTL 1VESA 5I1IL 3MODH 1MF2L 4XC3H 3WN5A 5JIIA 4G9FA 3ZE1F 4FQIH 3TV3H 3VRJA 4ZUSB 1DVFA 4WU7A 35C8H 1RUKL 4R4NC 1ITCA 1S78C 3DX8A 3TN0A 4TUOA 5HPMA 3P0GB 5DLMH 4XNXH 1KXQE 5TE6L 5KSBB 2NNAA 2A9MH 1R5IB 5MHSE 5TDNB 4HIJB 2A2QT 1PG7H 2F15A 4KK9C 4Z7VA 2VDLH 4LCWE 5J11C 3MGAA 2DQJH 5HYIA 3DNKA 1J8HA 1ZGLB 2PYEA 4FMFA 3RUGA 1KB5H 5INCA 5DQDL 1T6WA 2X2YA 1KELH 4MJIB 4RQQA 4JFQB 1P84K 4BSWA 2I60H 3LD8B 3UROR 3B3IB 1JNHB 1QFPA 1ZHNB 4NSKA 4X4ME 4IRZL 1YNTA 4XHJD 3FFDA 3NFSH 3WO4C 4Z7WB 3M17A 4GKSB 4JFYB 3BOVA 1A2YB 2FBJL 5D2LE 3TWCL 4ELMF 4PIRF 4R0LB 2EXWC 1H3UA 3G5ZA 1DBBL 2AJXH 5GJSL 4OIBA 4ZPTB 4S1QL 3J7HA 4EKXA 5KZCD 3AAZB 3D3VA 3UZEA 1IKFH 3L5JA 3A6OA 2Y5EA 3UJIH 5HY9A 3VFPB 4XPTL 4KI5E 1HIML 4PJAF 2EIDA 1MIEL 5IW1A 4ZNEA 1QHPA 4IRJD 1HQRA 1ZA3B 5JUEH 1MCIA 4KDTA 2ORBH 5B38B 3GBMH 4XBEL 5JHLL 2JIXD 1FN4A 1J05B 1K4DB 4O5LH 3UBXB 3O2DA 4XP1H 4YHZL 1NC4A 1W0YT 4UMGA 2R69L 3WFDL 3Q1SH 4LSUH 3IKCB 1FL6A 3P77A 5E8PB 2B39A 2ZWLT 1CS6A 3TJEL 3LSOB 1QSVA 3I3EA 1MJJA 2NY7L 3QO1A 2BY2A 1MFDL 4R4ND 1RZIA 1S78D 1F6AA 3WN5B 5A2KH 1JZ3A 2XWTA 1CN4A 1REIA 3VRJB 3MODL 4XC3L 1EEYA 2P5ED 4TTDC 1NDMA 1DVFB 4WU7B 5C0IA 4MAYC 4FQIL 4KK9D 5JOPD 3TV3L 4NOFA 4EIZC 2ZSWA 3DX8B 3TN0B 4TUOB 1DDHA 1PGRB 1AXTH 3VH8A 1WT5A 35C8L 4TRPH 4BSVA 5CHNA 1N0LA 4KKAC 2ED9A 4LHUG 3MLRH 2JCCF 1WGOA 5DLML 3WNMA 2FRGP 4XNXL 4Z7VB 4JVPA 2QSCH 2VR9A 5DD3H 2A9ML 3MYJA 3KS0H 2MKWA 1UKQA 5TF0A 2CJUH 1ZGLP 2YK1H 1PG7L 1J8HB 4MA7L 2VDLL 2PYEB 3RUGB 1U8JA 1B88A 4JFEB 2D0HA 2EXWD 4RQQB 2IPKA 5I74B 4Q97A 4MJ6A 1KB5L 2XT1B 3LN4B 1J1PH 1KELL 1CTOA 2FJGA 1YNTB 1YY8A 2I60L 4Z0BH 3FFDB 3FQXB 3HTLX 3TBSA 3QNYA 4JY5L 3M17B 4Q6YA 5DRNB 1QPXA 4LHUD 1EV2E 5SV3A 3G5ZB 2P5EE 3NFSL 4FQHA 4P2YA 4PRIA 2FX9H 4X9BA 5CEZE 3HR6A 4Y5YA 3GKZA 1ZVYA 1XGUA 3D3VB 4X9IA 4JPVH 2AJXL 1JWMB 1XF5A 1FVCA 1IKFL 1U2CA 4G9FE 1DUYA 3UJIL 1RJLA 4ZOAA 5AZ2H 1AC0A 1HQRB 2D4FA 3RZCC 1X3DA 4FQJH 3BPOB 3QSKB 1FN4B 4JFDD 5JUEL 3DXAD 2ORBL 4DGYL 3GBML 2J6EH 1EO8H 3WV0A 3CC5A 2IFFH 2EIBA 4H26A 3X3FH 3T04D 5K9KA 4RGMC 2W9EH 3P77B 3MV9D 4Z7VE 4Q58C 1GCFA 5HHOD 5F7YC 3Q1SL 1MJJB 4TTDD 1J8HE 1Q8MA 1N0XH 2PYEE 3RUGE 3QO1B 4MAYD 3VWKA 2XPGA 1A0QH 3MRIB 1F6AB 2GYSA 2QHRH 5BV7B 4NQEA 2XWTB 3QXWA 2RBLA 4KKAD 3CVHH 1EEYB 3QHZH 5I71B 1FVDA 5C0IB 5IFJB 1FV1A 4BUHA 4J7RA 2YZ1A 2J2ZA 3VH8B 1IARB 4UINL 5CHNB 4BSVB 1WITA 4XVTH 1JYNA 1M1SA 1XGQA 3AFLA 3CDYA 3VXNA 3O4LB 4WW2A 3D3VE 1AXTL 3PHQB 1QFWH 3ES6A 3V0AC 1DBML 3QUYD 3MLRL 3MYJB 1A9EA 2N1KA 4NNXA 2QSCL 5DD3L 1CG9B 5DMGC 1U8JB 2IQAA 5IJKC 2CJUL 2IPKB 2YK1L 3IDYC 4PY8J 4NFBA 1F4WH 4MJ6B 2Q87A 5BZDA 1UC6A 2ESVB 4O9HH 5K9JH 2A6IA 2FJGB 1YY8B 4WI5A 4PJBF 3EYVA 2IPTL 5E1HB 3TBSB 3QNYB 3K3QA 1WZ1H 4CRPA 1J1PL 4LCYA 4FQHB 1G1YA 4PRIB 3QUMA 4Y5YB 4AEFA 2JJVA 1J86A 3EOTL 1TPXC 3AC0A 3D2UA 4KV5F 3RZCD 4XAKD 2FX9L 5C92A 3SDYH 4ONOA 1ITBB 5E9DA 4HS8L 1FVCB 1HSAA 4JZJC 3EDJA 4X7EC 4JJ5A 4KRLB 1OSZA 4JPVL 3GMLB 3WIHH 1DUYB 4S0SD 5FUZH 1RJLB 4RWHA 2AK1H 3ZE2F 4LQ1A 4UQ3A 5DZOA 4ZODA 3OWEA 5AZ2L 1KNOA 1XAUA 2Z9TA 1MAML 3KS0J 4OGZA 2WAHA 4FQJL 4HPOH 3NA9H 2A0LC 3KPPA 3CC5B 4H26B 4EBQH 5K9KB 4U31A 3BGFB 2BOCA 2J6EL 1EO8L 3UPAA 5ELIA 3OR6A 2IFFL 2XA8H 3EO9H 3X3FL 4R90H 3O11A 1UCTA 2W9EL 4LIQH 4L3AA 1QG3A 3L7FA 2XPGB 1R3JA 3GSVA 4CN6A 3V95A 1N0XL 1T7VA 2DBJA 4LSQL 4XGZB 4D8PA 1A0QL 1EHNA 2QHLA 3L3DA 3QDHA 5J06A 4GRWB 1YC8A 3S6CA 1FV1B 2G75A 3QFDB 3DI2B 3FQRA 3U9PH 4FFVC 4M1DH 3QHZL 4A2LA 5F97E 4OGAC 1ODAA 3WNKA 3TNMA 2IALB 1FZOA 3EBAA 5A16A 4PRIE 4JO1H 5DMGD 1XGQB 3VXNB 4WW2B 1CXKA 3ES6B 3BPLB 3NTCH 4HJJH 1CLOH 4XVTL 4LRNH 3WJJA 3LS5H 2D0GA 4NNXB 4RZCA 5HYJA 4W6YB 4MA8H 4NCDA 4ONHA 4LLYB 5IBUB 5HGHA 2IQAB 2FIKB 1Y6NR 2GSIB 1ES0A 1HWGB 4H1LH 1QHOA 1J0YA 1U91A 2A6IB 1F4WL 1RSFA 3CMGA 1NGWA 4OZIF 4O9HL 1IC7H 3U30C 4K71B 1KACB 3JV6A 3WIIH 4LCYB 5D72H 4RMUA 5IVZB 4Q74A 3D2UB 2WP3T 4L9DA 6FABH 1XGRA 2LABA 3CU1A 5E9DB 4NWUH 5KTEH 1HSAB 3RA7H 4PJ7F 4JJ5B 4KY1H 1OSZB 2VDNH 4HF5H 4L3EA 4K3HA 4NQEE 4WJ5A 4HS6A 3WFHA 4G6JL 3SDYL 2A0LD 4UQ3B 2APBA 4J3TA 3ARRA 6CGTA 3WIHL 1LE9A 5FUZL 3DSNA 3SKUD 2AK1L 5D71H 1KNOB 2W07A 3DECA 2Z4QA 4FQPA 4W4OC 5MEPA 4WGVB 4G43B 2G5RA 3KPPB 1BX2A 3TFKC 5KSVA 4HPOL 2DTSA 4BH8A 3NA9L 4OQTA 3DYPA 3OR6B 5F96H 1KB9K 4JCMA 2OXHA 4EBQL 4I77H 1S5HA 5E5UB 3REWA 3L7FB 2ZNXA 4RX4D 2FO4A 2XA8L 1R3JB 3EO9L 4R90L 3GSVB 1RJYA 1HILB 2R39A 5TGBA 1BQHA 4OGAD 4LIQL 4YPGA 4LVHC 1IGCH 4D8PB 1TNNA 1JPFA 3L3DB 2FNBA 2BXZA 4F7EA 4OZGE 1SHMA 3VMPA 3FQRB 4PJ5D 1HNFA 2EDXA 1NH6A 3T1WA 3TNMB 3CFDB 1VGKA 3U9PL 5A16B 4M1DL 5C09A 1HHHA 3A6CH 1ZTXH 3DHMA 1KFAH 4K7FA 2VB5A 1BOGA 4JO1L 3K8KA 5E9DE 4R2GC 4QHLA 4RZCB 5HYJB 1OCWH 4HJJL 5E6IC 1CLOL 2BNQB 5DHVA 4ONHB 4LRNL 5GGSY 4HBCH 4TULH 4BK5A 3LS5L 3LMJH 4MA8L 1ZT1A 2FWOA 4KZDH 1ES0B 2ENYA 4PJEF 3FONA 1OQXA 3P4OA 4WFFD 2GY7B 1SJEA 4ZO7A 5A2LH 1LEKA 4HWBA 4FFYH 5BS0D 3SBWA 2VLJA 1KENH 1NGWB 5D2NA 4K7PX 1L9MA 1OARH 3C8KA 3SHSA 1XF2B 1B2WH 4D2NA 1JUFA 3EHBC 3JV6B 4IHOA 5SWSD 1QFUL 5ANMA 4UNUA 1V7MH 1KJ2H 4JM2A 2GJ6A 2ZUSA 3F5WB 4N0UA 2FL5A 5MI0C 2Z31B 3WIIL 3TVMA 1XGRB 3FAWA 5EU5A 5FGCE 4FQ1L 3G9AB 4HS6B 1OTSC 3WFHB 6FABL 5KTEL 2Y36H 4NWUL 1F3DH 3RA7L 1NAKH 4EI6A 3TFKD 4KY1L 3VFGH 2WM0A 4HF5L 2X4QA 2P8MB 1S7VA 3ILPB 4Z0XA 2AXGA 4PY7A 5DJZA 5FYJH 3KLHD 1NGPH 2IC2A 5D2NC 1H3VA 1EHAA 3JV0A 2Z4QB 1O0VA 5MEPB 4BZYA 3RX7A 5D71L 2P8LA 1BX2B 3QT2A 4WFFE 4WRLA 1YJDH 2K3TA 5KSVB 3OJDB 2YRPA 4WY7H 1RULH 3AROA 4HC1H 5C0AA 32C2A 3GFUA 5HYJE 4N68A 1S5HB 3REWB 1NEZG 2EXYC 5F96L 2FO4B 4G8EB 1I9RH 3SDCC 1RJYB 3D25A 1BQHB 1JRHH 5J89A 2CDFA 1WUNT 1J0ZA 3ZTJG 2VO5A 5BW7C 1JPFB 5EBWA 1HH6A 5ETUA 2E8YA 3VI3F 5LJYH 1EVUA 1ZVSA 4NWTH 1IGCL 3MCLL 1QSFD 2EC9T 2X5PA 3CXHJ 4P5TA 4LQFH 4R2GD 5IESH 2OXGA 3EYOB 5E6ID 1F4AA 1QSEA 5DMIL 5C09B 1HHHB 2PR4H 1MELA 2FH8A 4M48H 1BOGB 2BVQA 3FO9A 2GTZA 4DKDC 2I9TA 4H1LG 4PJHE 4PJFA 4WUKH 2HJFA 1KFAL 4QHLB 4L3EE 4MYWB 4GXVH 2X40A 4QYOA 5DHVB 5DZNA 4QF1A 2GKIA 2YPKA 5DT1H 3H7BA 4MWFA 2AJVL 1OCWL 2OZ4H 3EHBD 4M03A 1ZT1B 1KJ3H 4RWYH 4MZ2A 3FONB 4HBCL 4TULL 2X9YA 5EO9A 1L0QA 3LMJL 1SJEB 1NJ9A 3QXDA 4YDLB 5J1TC 3I02B 5IHBA 4KZDL 2VLJB 4DZ8A 4X9GA 2AS5M 4P5TC 8FABA 3C8KB 1JUFB 4KGLA 4FFYL 4IHOB 1JGEA 1KENL 2JJSA 3RWFA 4HAGA 5ANMB 3K80A 1OTSD 5HSFA 1OARL 2VN4A 4PJ9B 4JM2B 3WCYA 3CFKA 3SKJH 4N0UB 2FL5B 1LILA 4NN5B 3TVMB 1PEZA 4FQCH 1V7ML 1KJ2L 1QFWI 2YUWA 5EU5B 3D0LA 1NPUA 1DBJL 3MV7B 2OR9H 4LASH 5IB1A 4I0KA 1NFDB 1O7SA 1ZV5A 3VXSD 3EDDA 5A2FA 5C0DA 1S7VB 3BHBA 1MLCA 2CKBB 2Y36L 4Z0XB 2AXGB 4PY7B 5DJZB 5IBLD 3R0MA 1NAKL 4JGMA 1YMHA 3VFGL 5E8OA 3EFDH 4NGHL 2DM3A 2EXYD 3FOLB 5FYJL 5C08A 5C09E 2P8LB 4LLVA 1K5NA 3SDCD 3AM8C 2DLEA 3BMVA 32C2B 2F54A 1YJDL 2DS4A 1EFXA 1SM3H 3GSQA 4WW1A 3VXRB 4WY7L 1RULL 4X4ZA 1JJUA 4I18A 4HC1L 2Z92A 3WXWH 1WLHA 2E7CA 3D25B 3BEVA 3BXNA 1CWVA 1NGZA 2CDFB 2K7PA 3IJHA 4K23H 4KRNA 3SDXF 2F5BH 1I9RL 5EBWB 1HH6B 5ETUB 5HVHB 1JRHL 1SEQH 4F7PA 1VADB 2VLJE 5D2NE 1ZEAH 3D85D 4G8FA 4F80A 2XG4A 2BSSA 1F90H 4N0FA 4F9LC 1OM3L 1BREA 3NIFE 5GS0C 3M8OH 4NWTL 3T1FB 5DMKA 1FFNA 1YJDC 2DKUA 5ANME 1QSEB 2GJ6E 4LQFL 4N0UE 1LQSR 1F3DJ 3QZWB 3PP4H 5IEHA 2BVQB 3FO9B 2I9TB 4LSRH 4EDXA 4PJFB 2VAAA 3KPQA 3OTTA 3RWJA 3KYOA 2PR4L 4G5ZH 4M48L 4QYOB 1I7RA 2YPKB 2H2SC 3MRBA 3H7BB 4MWFB 3CFIC 5EIIB 3G6DL 4GXVL 4Y2OA 4PREB 5DRWA 5EO9B 5DT1L 5FYKE 1NJ9B 3QXDB 2OZ4L 3NIGE 1X5AA 2UVFA 1KJ3L 2NXZB 3QAZB 2W65A 4DZ8B 4MCZB 3E8UH 3KPSD 1TETH 1JGEB 2HTLC 2RIKA 3RWFB 2OTUB 1KOAA 5C0AE 4ZYKA 1JTPA 3CFKB 1S7XB 2E9JA 5SX5K 1H5BC 1K8DA 5DK0B 3D0LB 3SKJL 2X1OA 3P40A 4UI2A 1TZHB 2E6QA 2VLKD 3MXVL 4XCYB 2LVEA 4G7YH 2WLZA 4FQCL 1UH2A 3PDOA 5D7LA 4HV8A 4LP5A 5F9WC 1TTUA 3T4YA 2NTSP 2OR9L 2ZZUT 4LASL 5C0DB 1MLCB 1B0GA 2UWEA 1I1FA 1N4XH 1YMHB 2ZG1A 3MRNA 5E8OB 1NUNB 1RUQH 3BKJH 4PRAA 4WO4C 5F3HA 1H3WM 5C08B 3EFDL 1K5NB 5C2UB 1MCWM 1KSRA 3JWOH 2WNGA 5SV4A 5T5NG 4WFHE 3DOSA 4QKXB 4PJFE 3CVIH 1CYGA 3QXVA 2F54B 3KPSE 5FYJD 4WW1B 3GSQB 5INDB 4I18B 5CJOH 2Z92B 1NSNH 3VGGA 1SM3L 3BEVB 3BXNB 5GS0D 3IJHB 2BJMH 5EORH 2Y6SC 1G6RB 3WXWL 4CDGC 3ARXA 5C6WH 3MFFA 3I2CL 4KRMB 4WI3A 1W8OA 4F7PB 4DK6A 2I27N 2VSCA 1KB9J 1P5UA 4G8FB 4K23L 3RVWC 4N0FB 4NO0D 4RDQF 4JG0H 5EZOH 1M05A 5GJTH 5DMKB 1FFNB 2P49B 1E28B 1ZEAL 1SMAA 1F90L 2A83A 2H2SD 2JE8A 1VGEH 2BFVH 3M8OL 4G80A 5IEHB 4G9DA 4YGAB 4EDXB 1TENA 2VAAB 3KPQB 3RWJB 3PP4L 1DQMH 1W72L 5AUMA 1I7RB 4LSRL 3MRBB 2DTML 4PGBB 1P9MA 2HTLD 1VPOL 2YRLA 3HE7C 4HFWA 1DQJA 1S7SA 1NMCB 2W65B 4Y1AB 5E95B 4MA1C 5C08E 5IW6B 2ZP0T 1T1WA 4EXPX 3RU8H 1FAKT 2YEZA 4ZYKB 2F54E 4AZ8A 2P42B 3ZSSA 1AXIB 5IB3A 5F71A 1K8DB 1KCLA 1LWRA 3UTTB 4Z7QF 1S9KC 4FZ8H 1OTUC 4OKVA 4WO4D 4PD4K 5D7LB 4HV8B 3MJ8A 1QLFB 3T4YB 4AIOA 5H37G 4G7YL 4YDKH 1B0GB 2B0SH 2UWEB 1QEWA 1I1FB 1RY7B 4DN3H 4DAGH 4BFGA 5ESQA 1PX3A 4PRAB 3KG5A 1AR1C 2NYYC 4NRYA 5F3HB 3FQNA 4JHWL 1N4XL 3BZEB 1DN0A 1RUQL 3BKJL 5B3JE 1HCVA 2NZ9C 2X10A 2Q1EA 2Y6SD 4P2OA 1FE8H 2OMNA 1OGAA 1U8MA 5CLTA 2PUQT 1MPAH 3JWOL 4HMDA 2ID5A 5I8EA 3CVIL 5J0BA 3RVWD 1J1OH 3F7PC 3SJVA 1ONQA 1S7TA 5HGGS 4R8WH 5CJOL 1UZ6E 4K8RH 1NSNL 3DX9A 3T3PE 1NQBA 5GRUL 3NA4A 1RUPH 4MQSB 2QKIA 1XIWC 1M05B 2CIKA 5I8KH 1KV3A 3WO3B 2SEBA 2F53A 4JG0L 5EZOL 2GCYB 5GJTL 3MMEA 5EG6C 3PQYD 3OAZK 4P2OC 5D6CA 5I66A 2WV3A 3VFUA 4G9DB 3QISA 3HE7D 2VJXA 1VGEL 3JXAA 2BFVL 3V9FA 4NKMA 5SX5H 2BY1A 3WDIA 5JOEA 4PR5A 4LL9A 5AUMB 5IFHH 3SCMA 4Q2ZB 5MP6H 4IDJH 5D7LE 3CX5K 2BXYA 1JRHI 1G1CA 2DQHH 2UWEE 4HFWB 1DQJB 1S7SB 2DL2A 3V0WH 3BIKA 5D6DA 2X4TA 3BP7A 3ZDYE 2HA1A 4N9GA 3FB8B 3T0AA 4U2ZA 1T1WB 5MEOA 1QRKA 2J8UA 5CMAB 3G6AA 4OLWH 3BP5A 2VXUH 2YEZB 1OTUD 4X7SL 3RU8L 3DROA 1DFBH 4HX1A 4OF5A 1PJ9A 5IB3B 2HT3D 4D3CL 4KRPC 1EXUB 4MQ7A 3TBYA 3QIUC 3ZHLA 2AK4B 1MCNA 3PQYE 1AR1D 4RGNC 3NCYP 2NYYD 4OKVB 5E4EC 3BQUC 5FM5O 4ZFOA 2VE6A 3MJ8B 4IBLT 2EE3A 3ARPA 5AYUH 1NCNA 1NCCH 4PJCA 3TCLA 5CD5C 4FZ8L 2NZ9D 2KKQA 2VKWA 3TZVB 1AY1H 1QEWB 2VDPH 4NNYA 1J0KA 3OR7A 4YDKL 1GL4B 2VN7A 2B0SL 3FQNB 2P1YA 1JBJA 2GK0B 4DN3L 4DAGL 4R0LC 4GG8A 3QIBC 3O2DH 1KJVA 1Z9LA 1JWSA 1OGAB 1U8MB 2BK8A 4QCIA 1S9WB 3J8F7 1EUUA 1GHFL 2V2XA 1FE8L 1MH5A 5I8EB 2ERJB 3LEXA 3VE0A 3SJVB 1ONQB 1XIWD 4H5SA 1S7TB 5I1CH 1MPAL 3AREA 3PXHA 5F7EH 3HG1A 4NKDA 5DXWA 4M3KB 5IG7B 1J1OL 5I18L 2OMBA 2NZIA 4R8WL 5BV7H 4XAWH 3ESVF 3MRQA 4K8RL 1JGVH 2W9DH 4JQIH 4YHLH 3CSYA 1FJ1A 1MCEA 5T1DH 4AT6A 4K2UL 1RUPL 1U9KA 2NY1C 4W6WB 4F9PC 2SEBB 3OZ9H 3DARA 2F53B 3VI4E 5D9SA 2YXMA 4WENB 3MMEB 4D9LH 2D7PA 5D6CB 5I8KL 3O4OC 4JHZA 3S96B 2HRPH 4QXGH 4NKMB 2AI0H 4AYFA 4U1HA 4PR5B 4PJ8A 5I1KL 3K1DA 1W8NA 4NO3A 1OVZA 4BELD 2R2EA 2Y7QA 4K8RC 5DJXA 2NY6B 3OJVC 1AGCB 1NC2B 4F7MA 1ADQA 2VMFA 5IFHL 4XMLL 5MP6L 4HLZG 2IAMB 3B4NA 3BIKB 1B6DA 2J3SA 2NY2B 2X4TB 4OCRH 5EOTB 1QBAA 2DQHL 3BP7B 1YMMA 3V0WL 4N9GB 5A2JH 4KRPD 3QIUD 1OY3B 2J8UB 4HIIB 5DFTA 3G6AB 3BP5B 1RFDH 4ODBD 4RGND 1OGAE 5EU7E 3BQUD 1BZ9A 4YZFE 5F8RC 5DTFA 4OLWL 3DROB 2AW2A 2VXUL 5CD5D 1LE5A 1MHPH 3P11H 4MQ7B 4PJ8C 3SJVE 3TBYB 2OL3A 1CXLA 2XQYG 15C8H 3LKNA 2EC9U 4ZS6C 4XPAH 1DFBL 2WINA 3QDMD 4PGCB 3KXFD 1MJUH 2VE6B 4G3YH 4KI5F 4GQ9L 3VFVB 4HT1H 1X6NA 3QIBD 1I7UA 4PJCB 4XC1H 3TCLB 4K3EH 3ULVE 1HEZA 4NNYB 3IRZA 3V6BR 1I1YA 3OR7B 5AYUL 1NCCL 2GITA 2P5WB 5CIPA 1AY1L 4P3CH 1U8KA 2VDPL 3G04A 5C0EA 4UDTA 2EDTA 4LVEA 4M8VA 4XTRC 4GG8B 5JOFB 3UXFA 3U7WH 4PYHA 3T4AA 3OAZH 4PJDA 1KJVB 3WE6A 3PL6B 4QCIB 3GDBA 5TFSH 3F58H 1WAAE 2V2XB 2EECA 3LEXB 3HCVA 1T03H 3VE0B 4RGNE 4H5SB 5I9QC 5H94A 3AREB 2ZPKL 3NAAH 3HG1B 2YD9A 3INUH 2NY1D 5I1CL 5F7EL 2X7LA 4QLRA 3WS6A 5DJYA 4OV5B 3MRQB 1MAJA 2Y72A 3U48A 3CSYB 1FJ1B 4XMKH 2J8UE 4GW1B 4XPGH 4KMQA 3KXFE 4P9HC 5BV7L 4XAWL 4WUUA 3C8DA 4GRWH 1JGVL 1SJXA 2W9DL 4YHLL 5DVMA 4LNVA 5D9SB 4JPIB 4K8RD 1EFQA 4P2RB 5T1DL 4KJQC 3RBGA 4LVOB 3OZ9L 4NOBA 4D9LL 1C7SA 4U1HB 5B21A 4Q0XL 4NO3B 2HRPL 2CGRH 2R2EB 2Y7QB 4QXGL 5DQ9A 5DJXB 1V3LA 2AI0L 5T5FH 4KJWC 4P4RA 4PJCE 1CDJA 1MHHB 5E2VH 3WS6C 5E7FA 2E7BA 4CN4A 5DUMH 2DB8A 1AKJD 4R26H 5F1KC 3E2HB 5F1NB 1P4BH 1YMMB 3VDCA 1RZ7H 4MXWH 3HFMH 3TIEA 4OCRL 3PWPD 4ZS6D 4R7NA 4Y16C 1LO2H 1WJ3A 1AXSA 5F89A 1FNLA 1LO0L 4Q9RH 2OTPA 1BZ9B 5FF6A 4JFED 1LE5B 2LAGB 2OL3B 3LKNB 2X9XA 3HG1E 2WINB 4NZJA 1MHPL 2F8XC 3P11L 3HUJB 3CLEH 3HMXA 3RWDB 15C8L 3RTQA 3V8CA 4KC3B 4XPAL 1P6AB 4XTRD 4ETQB 3VXMD 1I7UB 4LPCA 1CQKA 1HEZB 1MJUL 4DKFL 1I1YB 4G3YL 4X83A 2GITB 4HT1L 4XC1L 5CIPB 1W0WA 4K3EL 3STBA 3I3BA 3U36A 3G04B 4LCCC 5C0EB 4UDTB 3MJ7A 4GAJH 1R3HA 4OCWH 4HEME 2HTKC 4P3CL 3T4AB 4PJDB 1QKZH 1G7IA 3QEQD 5IJVA 3N06B 3GIZH 2E9WA 4M61B 1LNUA 1NANH 3U7WL 4E5XA 4Z7VF 4DKEH 1T6VN 2FIRT 3KLDA 3BWUC 4KXZH 3HCVB 4O51A 4ORGA 4DWHA 5H94B 5TFSL 2Y06H 4YAQB 1C5DA 3RUGF 1J8KA 2X7LB 3BKMH 3BZ4A 4KJQD 3INUL 1MCSA 5DJYB 3UP1A 5CGMA 4MNGA 5DJ6A 4KK8C 4WHYH 4S1SH 4WUUB 5HXMA 2HFGH 3VXME 3OAYK 3KJ4B 4XMKL 4XPGL 1WF5A 4P46C 4KJWD 4IM8A 1T83C 3ALWA 2NXYC 2DI9A 2EH8H 3UBXI 1KGCD 3C09B 2J5LC 3C8HA 1YYLH 1QD0A 4YDVA 4ZAKA 5DQ9B 1IGYA 1FNFA 2C3VB 2D7NA 3EYQC 4RAVB 5HYSB 4P4RB 4Y16D 3CIQA 4OZFH 2CGRL 4UNVA 2DQTH 5T5FL 4ZFGH 3EFFA 4CGTA 5E2VL 3O4LD 4Z7NE 3HRZA 1LP9E 4ZXBA 3HS0A 5DUML 4ETYA 4R26L 1N5AA 3TIEB 3DVIA 4DOHE 1DQDH 1P4BL 1AXSB 1DQQB 5F89B 4Y19A 1RZ7L 4EQ3A 1ORQA 5FF6B 3HFML 5KSAB 5GRXG 1WZKA 1LO2L 4XB7A 4XHQA 4Q9RL 1X5GA 3U0WH 2VIRA 1QLRA 2J12B 3ZHDA 2ESVD 4I0PC 3ZKSD 4N8CH 4ZAKC 4FTVD 4S11A 4X8JB 1AHWA 3VGHA 4AM0A 3RTQB 2HTKD 3L95B 3CLEL 3FRUA 1MEXH 1UM4H 4OT1H 3MGOB 4WUUE 3JWDH 4ZXBC 4V1DA 1SBSH 4NHCL 4HKJA 3U36B 1A6UH 3QXAA 3MLTA 4OD1H 3MJ7B 2DOCA 5IFAH 1A7NH 4K71C 2VXTH 1G7IB 1KN4H 5IJVB 4BZ1H 4GAJL 4OCWL 4OCSH 4E5XB 3MV8A 2F74A 2ZUQB 4OQTH 4O51B 3MOQA 4NBZB 3GIZL 2OI9C 1A6PA 4KK8D 3ULUE 3ZKXC 4DKEL 3C5SB 1V8HA 4HGWA 1CGWA 4IS6A 5E56A 2Y06L 3BZ4B 3ARDA 4C56B 4P46D 2VZTA 2FO1A 4R4FH 3TT1H 3NMEA 5DJ6B 5FO9A 1D7FA 3BKML 1Q9WA 1BQLH 3ZYIA 1MRCH 3L3HB 3EYQD 3FQWA 4S1SL 3O45A 4FOMA 3LN5A 2HFGL 4EUPH 2H45A 4GBXC 1M7IA 3VFMA 4C59B 3DRQA 3HZVA 4TVPH 1M71B 4LLUA 4YDVB 1IGYB 4KUCD 5FHBH 3SGDH 2X41A 1N3NA 1YA5A 3ARDC 1T2JA 4ZDHA 3EFFB 3SGJA 3HRZB 4N5EC 3QCVH 3HS0B 2DQTL 4ZFGL 2HJKB 2E6JA 1N5AB 4HWBH 4I0PD 2C3GA 5DFVC 5FOJA 4I48A 4Y19B 4UILL 4ZTPH 1ORQB 4YHIB 1FYTA 2VXQH 1DQDL 2V5TA 3AY4A 1FLRH 2BCKA 2VIRB 5J3HD 1QLRB 1TZGH 1DLFH 2JELL 1K85A 3LCYA 1OAYH 3U0WL 4L8CA 3BP4A 1AHWB 2BVOA 3QXTA 4N8CL 4P5KA 3BD5A 2OQJA 3VG9B 4M93B 1D5BA 4MNGE 2D3VA 3FRUB 5IROA 3MLPA 4GRWF 4V1DB 4LCIL 1SMOA 4L1HA 1T7ZA 4HKJB 2CKBH 3QXAB 3MLTB 1UM4L 1A6WH 4OT1L 3OAYH 3JWDL 4HAFA 5TDPB 1CK0L 1SBSL 1HOCA 4MJ2A 1PSKH 5HVWA 1S7RB 2WBKA 4RRPG 1A6UL 3WDJA 4OD1L 2VUOA 4WW2F 5CKGA 4LAJH 4X5XA 4CVZA 2KDGA 3D6GA 4IOFC 3MV8B 2JJTA 2VXTL 1KN4L 3SOBH 1RZGB 4OFKA 1FLTX 4FMKA 4BZ1L 4OCSL 1OD9A 4JO4H 2K1MA 4PB9H 4OQTL 4HGWB 1A47A 1LK3H 2YN3A 5HDBE 4IS6B 4J12A 1GOHA 5JZ7C 2FSEA 1PYWA 1DSFH 4FQLH 2RCSH 4X6BA 4GBXD 5FO9B 2IANA 3VDBA 5SWZD 4OFVA 4R4FL 4O2FA 4XXDB 4Y19E 5MEND 1OD7A 3TT1L 2BDNH 4DCQA 3FQWB 3SGKA 1MCBA 4NQVA 1BQLL 2YR3A 3L7EA 3LN5B 3O45B 3ZKQD 1MRCL 3OG4B 4OZFG 1U3HA 4KU1A 1M7IB 5F6IC 3VFMB 4QHKJ 2FATH 3WS3B 3MPCA 1MRDH 3DRQB 3HAEG 1NAMA 4N5ED 2V6HA 4LEOA 4R97B 1GH7A 3MLXH 1N3NB 4PGZA 1HHJB 3ZLQC 1FL3A 4TVPL 1CU4H 5DFVD 5C7XH 5FHBL 3B2UC 4ZDHB 5T1MA 4V1DE 4U1NA 2H6PA 3C08H 4BH7A 5E2JA 5EU3B 3RVVD 3QCVL 5CGTA 2DMBA 2B8OT 2BNQD 1FYTB 1HYRC 5T1LD 4HWBL 5CD3B 4JY6A 1OAXH 4ZTPL 5SWZE 2VXQL 4C54A 2BCKB 5L88H 4YHOH 1FLRL 1J12A 3GRWA 4L8CB 3BWAA 3BGMA 2BVOB 5BRZA 1DLFL 2MSPA 4P5KB 5FHAH 4U6YA 1D5BB 1BMGA 1HYSC 1CD8A 3EJZC 4IOFD 3PG2A 2Z31D 1BVKB 3IDGA 2YWZA 2ICES 4F57H 2GIYA 1JMZA 1HOCB 2MJWA 2YD5A 2CKBL 1A6WL 3TCXA 1G7PA 4CVZB 2EC8A 5HGBA 3B5TA 5JZ7D 4ZOEA 4EQ2A 5DS8A 5TDOA 1HINH 1ZS8A 1MY7A 2ADIA 4RMQA 2EE6A 1UWXK 3QWRA 1XMWA 5T3XH 4JO4L 4PB9L 4R3SA 2FSEB 1M7XA 1SVCP 1G6RH 4EUPG 1LK3L 4OZHA 1A4KB 4JREC 4X6BB 2IANB 1VEOA 1G9ML 4O2FB 1DSFL 3UX9B 4FQLL 2RCSL 4FFWC 1FYTE 4ZTOH 4DCQB 1HI6A 1MFBH 1DEDA 5I17A 4NQVB 4CW1A 1JF1A 3Q2CA 4K3DH 4EI5A 2BDNL 1QLEL 1U3HB 1RIHH 1NAMB 4LEOB 2FATL 4KXZI 1MRDL 4ODUA 4J6RL 1I1AB 1FL3B 2B1HH 3JSSA 1G9MC 3K2UH 2VKXA 3MLXL 3PIQA 1WCBA 5T1MB 3D39D 3IETA 4H25A 4WDIA 3BPNB 3FZUC 4U1NB 5C7XL 2H6PB 4BH7B 4KROB 1JWUA 4TVPD 4YNYA 1O5DT 1E27A 2DJUA 3N0PB 5EBLA 2BZDA 3QPQC 3C08L 3IFNH 1BBJA 5FV1L 1WFOA 1HCFX 1GGUA 5L9DH 2HMID 5EZJA 5FB8A 1I7ZB 4P4KB 4JY6B 3VGDA 3UTPD 3W9DA 1CE1H 3QHFH 3HPJA 1MVUA 1UG9A 4WCYH 2IH1A 4YO0A 1IAIM 1HYSD 2H8PA 1OAXL 4G8IB 1MOEA 2DRUA 4HWZA 5SX4H 1GZPA 3BWAB 3BGMB 5L88L 5BRZB 4YHOL 3WBDA 4U6YB 3FT2A 2C9AA 5GS1A 5CINH 2EO9A 4WEUD 1IAMA 3TBTA 1EEUA 2NCMA 1W0VA 4PJ9D 1CDUA 5FHAL 4NNPH 1YYMH 1BVZA 4CVWA 3IDGB 2DQGL 1EBPA 5CKAA 3PV6B 2R23B 1G84A 3BP6A 2BNRA 1BVLA 3MV7D 2EKSA 3V5DB 4NQCA 4F57L 1CXHA 5B39A 1YEJH 3E6FB 1EERB 1G7PB 3ZMRA 5J6HA 5HGBB 5DS8B 4QNPF 5TDOB 2VZVA 1ZS8B 2ADIB 5HVFB 3CFBA 3GIVA 1EH9A 4UOW1 3UTSA 1X4ZA 2HLAA 3BIAX 1CGXA 3W39A 1HINL 5D5ME 4FFWD 3OMZA 4L8BB 2KH2B 1K8IA 3FFCD 3B6SA 4OIIH 4MHHI 4GRLC 4R3SB 1X5ZA 2DMKA 4OZHB 1B4RA 3PWUA 4NZUH 5T3XL 5EUOA 1T7YA 2FLRT 1G6RL 3VXRD 1KIPB 1UFUA 2PO6A 1H0DA 5I17B 4CW1B 1JF1B 2ADJA 3ARFB 4EI5B 3ARGC 4ZTOL 1QPPA 1MFBL 4JM2F 2XICA 4GRMA 4ODHH 5FUOH 2BVTA 4HKXA 2XNAA 4K3DL 3FZUD 2NY5H 3T0DA 3TBWB 3LEVH 2AJZA 1RIHL 2VNCA 4ODUB 3RIFK 3GHBH 1P7QA 2KL6A 3G5YB 4GG6A 2VSDA 2YUZA 3PIQB 1WCBB 3HI6H 3IETB 2X4PA 2B1HL 2GY5A 3KPOB 5DR5H 1PZUB 2GJJA 4DZBA 5E08H 3K8LA 3K2UL 3SKNB 1JZ6A 3NIGF 2VDOL 4X5LA 1E27B 4XNZB 5EBLB 4JY4A 5CS7A 4AH2A 1BBJB 1YPZA 5I73B 3HR5B 5E5MA 3NN8A 1RZKC 3VXUD 4MX7A 5FB8B 3W9DB 1RURH 2VABA 3HPJB 1MVUB 2DAVA 5JHDA 2IH1B 5L9DL 5J12B 2X89D 2H8PB 3ZSTA 3LRGA 1CE1L 5L0QC 3QHFL 3RKDD 4HWZB 2XY1A 1DL7H 4WCYL 1A7OH 4J3WA 1GZPB 4Q9BA 1UWXH 4NRXA 4UDUA 3SGDI 1P1ZA 5GS1B 4Y7MA 5E8DH 3VFSA 4G6KH 4KDWA 5LCVH 4XX1G 2PTTA 3TBTB 5CCKH 5GRZA 1H8OA 4NPYA 1NMCC 5CINL 4M6NH 3QEUA 2OK0L 5F7FA 4APQA 4K94H 3FTGA 4OLVL 1NBVL 4L9LC 4NNPL 4NFDA 1YYML 5CSGA 1BVLB 2EKSB 4NQCB 1LGVA 1TZIA 2DQUL 2HYMA 4YBQC 5B39B 4YFLF 4YJZL 4L5FL 5J6HB 4GRLD 1F4HA 1T21A 2XYCA 4PJFF 4Y5XA 2IPUG 1T1ZA 1YEJL 1IM3A 3ORJA 1F45A 3CFBB 3GIVB 2HLAB 1CIDA 4GOSA 4FA8A 1I3RA 1Z9SA 1K8IB 4NN6B 3B6SB 2VDKH 4CDHA 1JGLL 2XZCH 5DVOA 5L6YH 1UXWA 3ARGD 1CICA 2R0ZH 4HS3A 3F62A 4OIIL 2XIDA 2NY3C 5EUOB 3QYCA 2IBBA 3OQ3B 1PFCA 1K3ZA 3ULVH 1NFKA 4A6YA 2PO6B 1H0DB 1RI8A 4NZUL 1X44A 4P2QA 3IAQA 1NBZB 3MSPA 2PW1A 4LSVH 2QQLH 3C6LA 5T3XD 3TYGH 1H9VA 1TQCB 3BZDA 1NCAH 2FGWH 4GRMB 5C9KA 4HKXB 2LU3A 2XNAB 4Y4HA 4YK4C 3EZ8A 1YNKH 3N50A 3O3AB 4ODHL 5FUOL 2AJZB 2HFEA 4N9OB 5DJ2A 1FNSH 1P7QB 2NY5L 4RFNC 5ACZA 4GG6B 3V6ZA 4PFEA 4RBPK 1QRND 2X4PB 3GHBL 2DN7A 4DZBB 3JZ7A 5C0CA 4UIKH 5D7SL 1WWWX 3SO3C 3HI6L 3DRTA 4U3HA 5I15H 3NH7H 4JY4B 2BNRE 1Z9OA 4R7DB 5GIRA 5E08L 4AH2B 1YPZB 5JDJA 5L8JB 4M4PA 5E5MB 3NN8B 1FNAA 3TA3C 4MX7B 5GQBA 4YHYB 2VABB 3PE9A 3OJ2C 4LSSH 5JHDB 3GUTA 4P0DA 4NQDD 4HK3J 3LQAH 1RURL 3ZL4H 3UTSE 4YFLI 1T0NA 3IAPA 4Y1AD 4WU5B 1J9CT 4NRXB 1QVOA 5KOMC 4UDUB 3ARSA 1P1ZB 1HXYA 2GEEA 4X9FA 1G7JA 3VFSB 4Y2DC 1A7OL 1PY9A 2ICWA 2PTTB 4TSCH 3WHE0 2HG5A 4YBQD 3WJLC 1MCQA 4HGMA 4NPYB 5EUOE 3PGCA 2V7NA 2YKLH 5LCVL 4APQB 3W2DL 5CCKL 3FTGB 4PBWD 2I25N 4JRXA 2IMMA 1QBLH 3UTTD 4M6NL 3STLA 4OUUA 3EO0A 3AU1A 4K94L 1T0MA 5F7DA 3NIDF 4P23A 5LGJA 5B3JF 1T21B 3F7VA 1T1ZB 4S1RH 5EO0A 3T77A 2NY3D 4OTXH 1INEH 4GG6E 1IKNC 2MQ3A 1I3RB 3FRPG 4NQDE 5KSUB 4DK3A 2IG2H 1UZ6F 1IC5H 1UXWB 5D7KD 3QDJA 1CICB 4HS3B 1RUAL 2PXYC 2VDKL 1KEGH 1JFQH 1Q38A 3JUZA 3F12A 5L6YL 5F70A 1YPZE 2B5IC 2R0ZL 4A6YB 4Q9QH 1MCLA 4O58L 2PW1B 3C6LB 4J1UA 1JHKH 3ZDXE 4P23C 5A2IH 3W5NA 2G5BA 3QUZB 5KANG 2C3HA 4RMRA 4LSVL 2QQLL 1HHGB 4Y4HB 2JJWA 1IZJA 2FGWL 2XN9D 1X4XA 2GFBA 1JL8A 1KLFA 5ACZB 1FFPB 3HHRB 1YNKL 5IKCB 2PW2A 2XKNA 3TA3D 1FNSL 5GRWA 1NCUA 2UWEF 3H9ZA 4JRWA 5C0CB 4HIHA 2AQ3A 4JFFD 5IT2H 3RWCA 3DRTB 2QL1A 3DBXA 4ISVA 2W60A 4CMHB 1ZT7A 1A5FH 3ZDYF 4PUBH 5DMJB 5I15L 3NH7L 2VWEE 3QI9A 3WNNA 5EWIH 2ZG2A 2DJSA 4Y2DD 3GUTB 3MROB 3BSZH 3OXRB 1FSKC 3CSBA 4PJEB 1UJ3C 1T0NB 4LSSL 1GC1H 3QFJA 5IVOA 3MJ9A 3LQAL 3WUWA 3OX8A 2OL3H 4JB9H 4OF6A 1QVOB 1HXYB 1DQLH 3KYNA 1G7JB 1Q9KB 5K9QG 3S3PA 1PDKA 2ICWB 2HG5B 3AS0A 1G0XA 4UAOC 4LKCA 1VEMA 3PGCB 5D1QA 4TSCL 1T89C 3KPNA 4MNQB 3QH3A 4JLRA 3QEGH 3H9SD 1BFOA 4P2QE 3AS2A 2YZ8A 3JVGC 4OUUB 2YKLL 4LK4A 3EO0B 2AK4D 3AU1B 1T0MB 5F7DB 2XRAH 2EICA 1QBLL 3SE8H 4JFFE 5LGJB 1IEAA 4ONGL 3OL2A 3F7VB 5TPWH 3S9DB 3TZVD 5EO0B 5KG9A 2PXYD 3WD5H 3T77B 1WV7T 2VH5H 3DIFA 3QIWA 1I75A 4S1RL 1HWHB 1XR8A 3GSNA 3HA0A 3SQOH 4OTXL 3TJHC 1INEL 4RBPH 5BMFH 1IAKB 2XTJC 4N8VA 5C0CE 4KGJA 4JQXA 4GT7A 5D1QC 2R2HA 3O3DA 5HDQH 2IG2L 3F12B 1IC5L 3SE4C 1MJ7H 2DICA 3LKRA 1KLGB 1INDH 1KEGL 3VGEA 1JFQL 4OCMC 1CFVL 4J1UB 3MCKA 1WBYA 4IOSD 1EEZB 1MHEA 4MDJA 4Q9QL 3VI4F 2G5BB 4POZC 1IGMH 4OLEA 3H9SE 5F6HJ 3K7UA 5DEZA 1UZ8B 3W5MA 2VDRH 3O8XC 3T0EC 1IRAY 3UZQA 2VR5A 5CZVH 5EFIA 5B8CB 2A1WH 3RNKA 4I4WA 4JFPA 5CSZA 1Z9MA 2PW2B 5KS9A 3QDGA 2XKNB 5I1AA 1IILE 5F1IA 3ULUH 3IXTA 1VCAA 3MYZA 4HIHB 2DKMA 4JKWA 1U42A 1WEJH 4NC1E 1A4JA 4JRXE 3HE6C 1ZK9A 3DBXB 3HPLA 4ISVB 2W60B 2RJMA 1ZT7B 5C9JA 1DE4B 3MUGA 1MREH 5TE4H 5IT2L 5HI4D 4CU7A 2DMCA 3QI9B 4H0GA 2NY6D 1A5FL 1NC2D 2ZUVA 2YD8A 3D0VA 1XFPA 4KKLC 5FEBA 1B0RA 4YZFF 1OAQH 2IAMD 4L3CA 3QFJB 3WMSA 5BVPH 2NY2D 3WUWB 3BSZL 1FBIH 3FT3A 3JUYA 3TNNA 2X1QA 1GC1L 3KYNB 2VERN 3QDJE 4MJ5A 3QR2A 3HMXH 4JB9L 3FN3A 1DQLL 2NY4C 4LKCB 4JKPH 5F9JA 3ULVF 3KPNB 5DWUH 3QH3B 2UYLA 1CE6A 4NQXB 2I07A 5JPMA 2YS4A 2DWEA 1MUJB 3GMNA 4YDIH 3NCFB 1U8QA 3QEGL 5J4MA 1MI5D 5D1XC 4PJGA 1IEAB 3TJHD 2XRAL 1GC1C 2XTJD 4H8WH 3S3JA 5KG9B 3GB7A 2DLIA 4EN3C 1EAJA 1OT1A 1WAAF 2X4SB 3KJ6H 5TPWL 5C70A 2P5WD 3DIFB 3MO1B 3QIWB 2X4NA 3P73B 1XR8B 1NKRA 2HP4A 2VH5L 4HUXA 1GAFL 3KNBA 2VXSH 4I2XA 4N8VB 1A02N 3HC0A 3DX6A 4POZD 3PL6D 3SQOL 2R2HB 3O3DB 4WHCA 1FZJA 3FO1A 1Z3GH 1OGTA 3LKRB 3K2MC 4F33A 1BFVH 4NBYB 4M4RA 3O8XD 2J8UF 3T0ED 5HDQL 2VC2H 4NM4L 2ZUUA 1R5VA 3MCKB 1MJ7L 1WBYB 3RY6A 3MZGB 1MHEB 4MDJB 1INDL 5I6XC 1U41A 3QA3B 2ZCLH 3CFCH 2P4AB 4K3JH 2QLVB 4OFYA 3GMPA 5EOCH 4P9MH 2APXA 5A43C 1IGML 3HE6D 3H2WA 3PJSA 3F6LA 5EFIB 1TFHA 3RNKB 4XRCA 2VDRL 4JFPB 5CSZB 1Q72H 5HJ3A 2EDEA 3QDGB 5I1AB 2XTJE 2AQ2A 5F1IB 5CZVL 4P2RD 4PJCF 2A1WL 3GM8A 4X6CA 3QQ3A 4EOWH 4U1GC 4KKLD 1D5XA 4N0RA 3HPLB 7FABH 1WCQA 3MUGB 4F37K 2B4CH 3MXWH 5C86A 5JXEA 2LTQC 3BE1L 3O6LH 1XGYH 1BGXH 5E2TH 3TP4A 2BY0A 1LD9B 1LEIA 5IMLA 1OQOA 3D0VB 1MREL 4HD9A 5TE4L 3U46A 1B0RB 3UDWC 5ENWA 1PVHA 4TNWF 4X7FC 2NY4D 3T0EE 1BOYA 5ICZB 4H20H 5HHPB 3MUJA 3RIFF 1TTGA 3RGVC 3FT3B 1E4JA 3TNNB 1WQVT 2ARJQ 1OAQL 2HFFA 5GZOC 1I8KA 2IEPA 2YWYA 1A6ZA 1FO0A 5BVPL 4MJ5B 3GSWA 1FBIL 1T7XA 2D0FA 2BNUA 5D1XD 4BSJA 1NGYA 4Y5VC 3WYRA 1D5MA 5F9JB 2BRQA 5EU6D 3KVQA 4HK3N 1KXTB 4L4TD 4QRRA 2UYLB 1CE6B 3PHOA 2I07B 5JPMB 4EN3D 3FO2A 4RNRA 2DWEB 1F00I 4JKPL 5DURD 3GMNB 5JW5A 3RJQB 1U8QB 1CGVA 3F8UB 1TVHA 4MB5A 4PJGB 4YDIL 2AEWA 2WBJA 4X0KB 1T3FA 3U0TA 1JGDA 4HKBA 2LFGA 4H8WL 2X4NB 4NIKB 1CGTA 3SDAA 2PF6A 2YRZA 3CD4A 5KS9E 4YHPA 2Y5TA 4KTYA 3KJ6L 5DD0L 4NQSB 4KK5C 4I2XB 2XKUA 3HC0B 3DX6B 4LPWA 3C5ZA 1DTUA 2EEDA 1FZJB 3FO1B 5F6HI 4G8GD 2VXSL 3SE3C 5T1KA 3ZT5A 1KXVC 4F33B 5DJ8A 1NBQA 3QUXA 4G7VH 2W9LA 3EYUH 4PLJC 3DYMA 3BRDA 2JJUA 3KLAB 4FABH 1Z3GL 5EC2A 1R5VB 2Z0BA 1BFVL 2YUVA 4HUWA 3ROLA 3SGEH 5DGQA 5I1EH 1IL1A 5J1SC 1NCWH 3GMPB 2EDHA 3TO2A 3CFCL 1TITA 2XY2A 1ND0A 3QB7C 3PJSB 4K3JL 3HMWH 5GSVA 4XCCH 4XRCB 5EOCL 4UQ2A 2YSSA 4P9ML 3TH2T 2E5EA 8CGTA 5HJ3B 3LY6A 2W59A 2O61A 4I8DA 5F88B 3AVEA 3QQ3B 5L8KB 1Q72L 4BUGA 1ZE3C 1BFTA 1UM5H 4LDOB 5JMOC 3DVGB 2KZWA 4Z7NF 4EOWL 2NW2A 3RGVD 7FABL 4PJGE 2I5YH 2X4RA 5IB2B 5GZOD 1X5HA 4PJDF 3O6MH 1MJ8H 4OI9A 3MXWL 2AV1A 4G8GE 3P0YH 3O6LL 4Y4FC 1XGYL 1BGXL 5CP7A 5E2TL 3U46B 3VFRB 4I5BA 5ESVA 4U6XA 4RMTA 1KTKE 3CNKA 3BRGC 1G9EA 3MRFA 2XZAL 1I8KB 4H20L 1A6ZB 1FO0B 4I2XE 3QRGH 2Z91A 2BNUB 4JG1H 5KSAD 1D5MB 4KHXL 3EW3B 3LS4H 3ULSA 5EOCJ 1JPTH 4RFEA 3PHOB 4PG2C 5JLZA 4RNRB 5JW5B 3DMMC 4NO2A 2O26U 1WWBX 1T04B 3B9KA 4AQOA 2DLHA 2WBJB 1BQSA 2IADA 4QT5A 3TH4T 1T3FB 2P45B 3CAFA 1JGDB 3U0TB 4HKBB 4RAHA 3VMNA 5KAQG 3K4DA 3SDAB 4YHPB 2DJ4A 5MERA 3MUY1 4PLJD 2CDGA 3ULUF 4X6CE 3OJMB 3VG9C 3FB7B 1P7KA 4EEEA 1UCBH 3I75A 4KKBC 3V7MA 3HRPA 1TLKA 4UT9H 2QTEA 3C5ZB 2E9BA 4OM1H 3VD3A 4WHTA 3UJJH 5DJ8B 4ERSH 3QUXB 4EXKA 3ARWA 3S4SA 4BQ8A 2BP3A 5EC2B 5EIQA 2Y23A 3K81A 1L7IH 4PB0H 4M7LH 3MBXH 3D18A 3EDFA 4G7VL 4G6FD 3B9KC 5LGHH 4HUWB 4FABL 4ZO6A 4ZS7L 4HZLA 1B6UA 4C56D 2YD2A 2YPVH 5E00A 2EDNA 1ND0B 1H3GA 5I1EL 1Z0MA 2ATKA 4Z7OE 3G08A 4AG4H 1IBGH 2R0KH 5GSVB 1NAMH 1SJVA 1NCWL 4UQ2B 2YSSB 1YQ2A 2DL9A 3FMGH 4GO6B 4XCCL 4GXUM 5D96C 3EYSH 4B5EA 4QRRE 3QJHA 4Y4FD 3VFWA 5I8CB 4I0CC 3BEWA 4TSAH 1KIRA 3VW3H 1KPRB 2NW2B 12E8H 4X98A 1L9NA 3RAJH 2X4RB 4LCWA 4V2BA 1JTTA 1KTLA 1UEMA 4U1JA 2AV1B 3LPWA 5CP7B 2VLRD 2I5YL 4I5BB 4U0RC 4QRPD 4QRTA 4U6XB 3LAFA 3O6ML 3LQMA 3P0YL 4HMCA 5ADPL 1EGJA 4KKNA 2IQ9H 3MRFB 4Y4KC 1UEYA 1IM9A 2GUOA 3GRWH 3DMMD 4JQVA 2Z91B 2ZG3A 4XWGL 4XB8A 3MNZA 5FYLE 5D2LA 3RPIB 3PHSA 3QRGL 4QXTB 3B8SA 3ULSB 4RFEB 5JLZB 4NQTA 2ZUXA 3LS4L 5AAWA 4WV1B 1UH4A 2P46B 4UNTA 3RQ3A 2IMNA 3TO4C 1A14H 4AK1A 1JV5A 4KKBD 2MQCA 2OTWB 3PABA 2R2BA 1OP3K 4O4YH 1HHIA 3GGWA 4QOKB 2WSKA 3DX7A 3KLSA 4XVSH 3U7AA 3N1QC 3AS1A 5MERB 1I85C 3BT2L 4KVCH 3DUHA 4XVJH 2CDGB 1XF1A 4LHQB 5DF0A 1LK2A 1CVSC 4S2SA 4QRPE 1P7KB 1C8PA 2YA2A 4URTB 4WHTB 1UCBL 4LOUC 3VGAC 3S4SB 4IJ3B 3O41A 3UJJL 4ERSL 3D18B 3RVUC 3S37X 4LMQI 3TT3L 3PWVA 1XGTB 1L7IL 4PB0L 4M7LL 3MBXL 4QXUH 5CEYA 4HUVA 1RMFH 1L6XA 3C60C 3ARQA 5E00B 5LGHL 3O9WC 1NBYB 2ATKB 2AKRA 2E6PA 3FL7A 4HJ0C 1C1EH 4AG4L 1AE6H 1IBGL 2R0KL 1NAML 5BVJA 3GSUA 3QJHB 3VFWB 3DURA 4GLRH 1EAPB 3BEWB 1TJGH 2I9LB 4IRJA 3ZTNH 2QBWA 3FMGL 1N6QH 1KIRB 2JK5A 3GKWH 4LVNC 2Y9RT 3ZE0E 1BF2A 3MREA 2JF1A 4HJGA 3EYSL 2JIXA 3HI5H 4XHJC 2DQIH 4X98B 4TSAL 3N9GH 1A64A 2B20A 3QG6A 4Q6IC 3I50L 4LCWB 4Y4KD 3VW3L 5I30H 1KTLB 4U1JB 5AZEH 4XMPL 3RAJL 2P24A 4M6MH 2OS7A 4QRTB 5C0FA 4UIMA 2EYRA 5HHXH 4MDIA 4OAWA 4FN0A 1IM9B 4M7KH 2GUOB 1I1AC 1A1MA 2NR6C 4CAGA 2IQ9L 4AMKH 4IMLA 3MNZB 3GRWL 5D2LB 4IRJC 3TO4D 1ETZA 2P5EA 1I9JH 2VDQH 4NZRH 2R4RH 4CVUA 3IDXL 4XBPB 1V7NL 4GQPH 1LVEA 1VFOA 1OP5H 1C5BH 3NPZB 4RMWA 4UUJA 3T0BA 3L6FA 1IZKA 1JV5B 1AQDA 2QQNH 3PABB 5SWQA 1HHIB 4TSBH 4FFZL 3DX7B 4K9EH 4YBLC 5K93A 1A14L 3FQUA 1BFSA 4AENB 4LOUD 1DJSA 2JB5H 1I7TA 4O4YL 1LK2B 4XVSL 4PJIA 4S2SB 4YXKH 5LWYH 3OKLA 4G6AC 2OX5A 4U0QB 4KVCL 4XVJL 3RVUD 4YGVA 3QG7H 3MRHA 1BLNA 3BKYH 2AV7B 3BN9D 4RCAA 3C60D 3O9WD 3O41B 4YEFA 4J23A 5KVGL 1BD2D 4LHUA 4HJ0D 5CEYB 1HSBA 4HUVB 3SN6N 2DQDH 1D6EB 2AEIT 4LF3A 5KZCB 2AKRB 4QXUL 4N1EA 1RMFL 3W82A 4NCC2 4FP8L 3V79C 2BHUA 3ZDZE 5BVJB 3EUUA 3MUZ1 4KJYA 5BO1H 3DURB 1WBXA 1C1EL 1AE6L 5TQ2H 2IBZX 2DM7A 1T1XB 1WICA 2JIXB 4PV8A 4JFDA 1TJGL 3QG6B 1N6QL 3GKWL 3RL2A 3DXAA 3LRHA 1I1AD 3VDAA 3HI5L 2DQIL 2NR6D 1J88A 1KUMA 2P24B 4JCLA 3RBSA 5I8OH 3MV9A 4OBSA 3P0VL 5AZEL 4UIMB 4U1IA 2EYRB 5L2KD 3ZYOA 2L7UA 5HHOA 4MDIB 5AD0A 4OAWB 5EH1A 4MAYA 5TH2B 1A1MB 1G7MA 5HHXL 2QSVA 1Z5LA 4IMLB 2EYSB 1UA6H 4P4KD 4HXBH 1EJOH 1JK8B 2P5EB 4HCRL 3P9WB 4F37F 5E5RB 3IJSA 4MNHA 2DLFL 2Q8BH 4DUWA 1YEFH 5J11B 2VDQL 3H9HA 1CGUA 3MCG1 4NZRL 2R4RL 3RKPA 3VU2A 4JN2A 4UUJB 4G6AD 4HPYH 5BQ7A 5IB4A 1AQDB 4G9FB 3L3IA 1C5BL 1UYWL 5SWQB 1KTDA 2X9WA 5CUSH 3QUYA 3FQUB 3X11A 5HPOA 2DYPD 1I7TB 2RAMA 4LRIC 3C2SA 2Y07H 4PJIB 5JDSA 3WO4B 3OKLB 5HPMB 5FYKU 3U7YH 4XT1C 3G6JA 4YGVB 2FJHA 4YWGH 3MRHB 2C4XA 4YXKL 2NNAB 4QRQA 3U4EA 5LWYL 4QRSA 1BLNB 3L3GA 2PKDA 5LAXA 3QG7L 1PEWA 2CO6B 3ELAT 3BKYL 3NACH 3R4DA 5C0NC 4A6YH 4LHUB 1KB5A 4F2MA 1ZLWK 5INCB 1N6VA 2DQJL 1HSBB 3D1MC 3ZYJA 1UACH 4LF3B 4MVBC 4BSWB 3QUYC 5IK3A 4E42A 5DJAA 3RZCA 1D6VH 5JW4Q 4XPBH 4NSKB 1M4KA 1ZOXA 2W1NA 4HG4K 5FOBA 2E7HA 3ARFD 1ACZA 2C1OA 4KJYB 1KT2A 5LVEA 5CJBA 4LLQA 1WBXB 5JOPE 3ZKMD 3T0VA 1WZLA 4KQ3H 5BO1L 4PV8B 3H8NA 1YN7A 4JFDB 1ZAGA 3RL2B 4KMLB 2CIIA 3DXAB 5HY9B 4LPUA 1TQCC 1GGIH 3QWOA 1GSMA 3BH9A 3OSKA 3MV9B 2X44D 5IW1B 2EKJA 2RFXA 1CVRA 4U1IB 1HDMA 3HNTH 3MGTA 5HVGB 5I8OL 4F15C 1OP9A 4PJIE 4MAYB 1A6VH 3BJ91 2ILLA 4Z6AT 1JNNH 1NC4B 4MD0A 5DDHA 1C7TA 3SQBA 1J1XH 4OZHF 2DM2A 4N5UA 4O5LL 1FL6B 5JORA 1S9YA 3PWLA 4XP1L 4B7IA 3IFOA 1MRFH 1UA6L 4MNHB 4LSUL 4N90D 4HXBL 3H9HB 3RPKA 5CZXC 1RZIB 2Q8BL 2WZPD 1YEFL 5BQ7B 3CLFH 5IB4B 3L3IB 3F65A 5IJKA 2A6JA 1L0YA 1GGYA 2V7HA 4CMMA 1CFQA 5EDXA 4HPYL 4ONFH 2W91A 1NDMB 3AMLA 1UKSA 2YPLD 2ZSWB 5JDSB 5CUSL 5FYJU 1DDHB 3I3DA 1EHLH 5C0ND 3N1GC 3G6JB 2FJHB 5DEGA 2Y07L 4QRQB 5AAMA 4QRSB 1RV6X 2UZYB 2VLLA 3NFPA 3U7YL 4JFDE 4TRPL 3L3GB 4MVBD 5LAXB 4YWGL 2BSED 2QJDA 3L5IA 3DXAE 4MXVF 4I13B 4KPHH 1A21A 2XACC 4F2MB 4JZJA 3MV9E 1INQA 3NACL 5BXFA 3RWGA 4A6YL 5A1AA 3MFGB 3SKMA 5EU4A 5HHOE 4MZ3A 4N90E 4XBGA 5EBGA 5IK3B 4E42B 5DJAB 4ODWA 3RZCB 3VFTA 4PJBE 1UACL 5H35A 5C1MB 4OZGA 4PRHD 2XTLA 5FOBB 1IFHH 1D6VL 1KT2B 4L8SA 3LV3A 4LLQB 2VQUA 1YEEH 1FC2D 4Z0BL 4N0CC 1OB1A 5K59E 2R1XA 4RGMB 3L3OA 2XKSA 3NGBC 5AG9A 1F4XH 3BI9X 4KV5E 1XGUB 5JTWA 1YN7B 1NMAH 2BX5A 2CIIB 1XF5B 1WFTA 3OXSA 1YEKH 1HKLH 4KQ3L 1UB5A 3UZVB 1A8JH 3QWOB 3QUZC 1SY6H 3BH9B 4NHUA 1GGIL 3L9RA 5EO1A 5EOQH 1HDMB 4K7PH 3MGTB 4KTDH 4WGWB 3IYLW 3LH2H 3MJ6A 5F7HA 1GPOH 4PRPD 4GUPA 4TOYH 4RX4A 3TIDA 3L5WA 1K6QH 4OCNC 2PN5A 3G6JE 5CZXD 4UBDC 2YXFA 4L8SC 4MD0B 5D7IA 1U92A 5DDHB 1A6VL 3T3MF 4J4PC 5JORB 1S9YB 1JNNL 3PWLB 4UOJA 1QQDA 5EUOF 3IFOB 1H3XA 2H32A 4NP4H 1J1XL 4CMHC 4PJ5A 5CJXC 2QSTA 1YEHH 2WWKO 2Z8SA 3VWKB 5FECA 1MRFL 3S88H 3KYMA 1ZKAA 2X09A 4NQEB 3AXLA 1GOFA 2A6JB 4RFOH 2ED8A 5DC4B 3IDYB 2B7DT 4CMMB 3NFNA 4XAKE 1IJ9A 1CFQB 3CLFL 3EJYC 1G0DA 2QHRL 1FVDB 4YH6A 2LU4A 3N85H 1P7HL 3CVHL 4S1DD 2X05A 1R3LA 1FCCA 4GG6F 4ONFL 1N6UA 1XF4A 1TTFA 4JDVA 3CCHA 1I4FA 4BZ2H 1EHLL 5I0DA 2VLLB 4WI7A 4DGIH 3DVNA 3S35X 5BS0A 2FJFA 4KKCC 1A9EB 1YPZF 1LEGA 4DFHA 4E9LA 1QFWL 3E3QC 4JZJB 5SWSA 3VD4A 4J3VA 5BXFB 3RWGB 1SYSA 3SKMB 5EU4B 2WMPA 4N0CD 4XBGB 5BZDB 3MBEC 3VFTB 4ODWB 4U33A 4BQCA 5J7CC 4JFHD 1BEYH 3EYVB 2V2WA 5H35B 4OZGB 1D3CA 4W4OA 5K9JL 1FIEA 4Z8FH 3AGVA 4QY8A 3TF7C 1BJ1H 4WI4A 1OB1B 3QUZD 1WZ1L 1IFHL 2R1XB 3QUMB 1P84J 1YEEL 4XNYH 1KTRL 5GGVY 4PJ7E 4PJHA 1F4XL 5J9PA 1TJHH 3OXSB 1UB5B 1T4KA 3WIHA 1XR9A 1AO7D 4GS7C 4AIXA 1RIUH 5DMYA 1BWMA 1NMAL 3JTSA 4D9QD 3QPXH 4UBDD 2NX5D 1HKLL 3UYPA 4J4PD 3L9RB 5EO1B 4PRBA 3S8WA 1SY6L 2WWKT 3S34H 1CD0A 3UTQA 5EOQL 3TIDB 3L5WB 4K7PL 3E0GA 4KTDL 5J13C 2WLYA 1C12A 3VD5A 3LH2L 1EO5A 1GPOL 1UH3A 5D7IB 1U92B 4TOYL 1K6QL 2ZCKH 2O93L 4E41D 1QQDB 1VB9A 2BOCB 1OAUH 2H32B 3KLHC 1QSFA 3RDTC 2FBOJ 3O11B 3EJYD 1N2RA 5FECB 4NP4L 4XCFH 5FGCB 5E6IA 3KYMB 1YEHL 3I6GA 2OJEA 1XT5A 2A77H 3AXLB 3S88L 3NFNB 4PP2A 2DI8A 5ICYA 1NEZA 5ITFA 4MNQD 2G75B 1AO7E 1R3LB 4KKCD 3QULA 4AY0A 3N85L 4JDVB 5F72S 3U30B 5DEFA 1FZOB 3CCHB 1I4FB 2COQA 2EEAA 1U6AH 2ZUWA 3DVNB 5T3ZH 4BZ2L 2FJFB 3MBED 1F3JA 5FUCC 1LEGB 4DGIL 2HAZA 4GKNA 3NTCL 5IQ7H 4TNVK 5SWSB 4E41E 5HGHB 3WFZA 5DI8A 1SYSB 4F7TA 1BZ7A 2EDRA 1OAKH 4KMTH 4H1LA 5E24E 1IC4H 1FFRA 4ZPVA 1AD0A 4HBQA 4BJLA 1U91B 2N7BA 2V2WB 3O6FC 3P9LA 1CGYA 4XI5C 2APVA 5D7IE 5F9OH 5F21B 4HUNB 1S7QA 3U0PA 2R4SH 1BEYL 3VXSA 1I8MA 4OGYH 1IC7L 3NPSC 3RWEA 3VFNA 2Y1VA 3HKFA 4PJ5E 2A6DA 1F6FB 3C9NA 1KEMH 3QUKA 3VFOA 4KZEH 4C57C 3LQZA 5D72L 3BRFA 3E3QE 1CL7H 1CR9H 4PJHB 5J9PB 4KJPC 4EDWH 1T4KB 4CJ1A 2O5XH 1XR9B 2VXVH 4W6XB 1R6VA 4L3EB 4WJ5B 4XNYL 3SDCA 1TJHL 4LVHB 4OFIA 1T20A 5BW7A 2VDMH 2VDNL 4PRBB 1RIUL 1LE9B 3OKDA 4MJ4A 3QPXL 2CK2A 4OLUH 5CJ8A 3UTQB 3RDTD 2MCPH 1XGPA 1WIOA 1C12B 3S34L 2NY0C 2O5YH 1P4LA 1PKOA 1FO0H 4MD4A 3MZTA 4JFXA 1C16A 4L4VD 2F58H 4BH8B 2PYFA 2EIZA 5BS0E 5IBLC 5CBAA 3D85A 2OR8A 2ZCKL 4XP5H 5GGQH 1N2RB 4JRYD 4R2GB 5C3TA 4JHAH 1OAUL 3EJJX 5SWSE 1FH5H 3RRQA 2XZQH 5FGSA 5E6IB 3R06A 3I6GB 5TGBB 2MWCA 4I77L 2E7LC 1EHXA 1CT8A 1FDLH 2OJEB 2VYRE 3BN3B 4XCFL 4FQQA 4YPGB 4M3JA 1BJ8A 2R1YA 4XP9H 4PP2B 5FGBC 2VLMD 1NEZB 3QCUH 2A77L 5ITFB 4MQXC 4F7EB 1KYOK 4OCLC 3QULB 4OSUH 2ITDA 5HBBA 1VGKB 5DEFB 5IOPA 1MIMH 3KHQA 3WNPA 4LSTH 4K7FB 4LGRB 5IWLA 1OHQA 4RMSA 1J87A 5MI0B 5CFHA 3CXDH 3A6CL 1F3JB 1U6AL 1ZTXL 5FYLH 3KPSA 4JFOA 2FD6H 4GKNB 5T3ZL 2K7QA 1NUFA 3O6FD 5FM5M 2EZ0C 4XI5D 3RJDA 4F7TB 3WSQH 4M8QA 1BZ7B 2QADC 4LGPB 4H1LB 2FWOB 5IQ7L 4JRYE 1QSZA 1AC6A 3P4OB 1AD0B 4M5YH 1LEKB 2LVCA 1LO3H 1OAKL 4CJ0A 5D93C 1IC4L 3P9LB 5D2NB 2VLKA 2ICEA 3VRLF 4JR9H 4KJPD 1CBVH 1S7QB 2HLFC 3VXSB 1KJ2A 5D7JC 5EC1A 1I8MB 3AM8A 5F9OL 3RWEB 1QSFE 1B2WL 5IWLC 2GJ6B 4DW2H 2A6DB 4HH9A 2R4SL 4IRSC 4LIQE 3LDBC 5FUCE 3VFOB 3V5HA 4LPVA 5ITBH 3LQZB 1F3RB 4TUKH 4GKOA 4OGYL 1TVDA 3UTZA 1KEML 5IVXA 3SY0A 4KZEL 1QR4A 3SDCB 4X7CC 3K74B 1CL7L 1CR9L 1J5OH 2NY0D 2ZCHH 4EI6B 2O5XL 2P47B 2VXVL 1SYVA 2X4QB 3DYOA 3OKDB 3T2OA 5TF1H 1U58A 1UM6H 5HHMD 1X5XA 3BD3A 3KGRA 3K1KC 2VDML 4F9LA 2H2PC 1XGPB 5L2JA 4LU5H 2BSRA 4EZMA 1OSPH 1J7VR 1P4LB 4OLUL 1NGPL 3LOWA 1GXEA 1KG0A 2ICCA 4MD4B 5CGYC 2MCPL 1CXIA 1C16B 1CDHA 3AB0C 1B4JH 2PYFB 1IGTA 2EIZB 3ETBF 4G42A 3NCMA 5CBAB 1P69B 2RB8A 1FO0L 3K0WA 5C0AB 3D85B 2A73A 3RY5A 4NO0A 3V4VH 5ID1A 2F58L 4MQXD 1GOGA 5I76A 3BH8A 4UV4H 3R06B 4UU9A 4KUZH 4XP5L 5GGQL 3A0OA 3GZKA 4JHAL 3O2VH 1TJIH 1FH5L 4FQQB 2XZQL 1C08A 2R1YB 4GAGH 3VGBA 4WWKC 3V6OC 1RZJH 4BFEA 1RAMA 1FDLL 1ZVSB 5DJCA 1PD6A 43C9A 1A1OA 4MSWA 1Q0XH 4P5TB 4PBXA 3QCUL 1U3YA 5KS9F 1D9KC 3VXSE 2EZ0D 5IOPB 4ODSH 3R8QA 4OSUL 1MWAA 5IESL 2YC1A 2QADD 3X12A 1BBDH 1CZ8H 2GTZB 3OHXA 4GMTH 1MIML 3CZJA 2RGSA 3DUUA 2HJFB 4OCXH 4LLWA 3KPSB 4LSTL 1H5BA 2D7OA 4FQXC 3CXDL 4QF1B 4WUKL 2OZ4A 2UZXB 1YZZA 2FD6L 5JA9A 2HLFD 3FB6A 5C3LD 5D7JD 3WSQL 4OB5H 3O0RH 4IRSD 1J0IA 4RWYL 3C2AH 2EDJA 5FV2A 2VLKB 2ICEB 8FABB 4WO4A 3WDHA 1AR2A 3MA9H 1KJ2B 5EC1B 1B90A 4JR9L 2FEDC 4U7SA 1CBVL 4YHNA 3WLBA 4HH9B 1I3GH 5HI3C 3V5HB 4JVWA 3OF6D 2ZUYA 2X4UA 4Z7UA 1CFTA 5E6YA 4DW2L 1N59A 4OM0H 2APFA 3V7AG 2H2PD 3Q6FA 5ITBL 3MLUH 4MLSA 4TUKL 4PJGF 5IB1B 3U1SH 4B7LA 5CGYD 1SYVB 1U58B 3BHBB 1J5OL 4D0CA 2ZCHL 1NCTA 3WHXA 1HQ4A 4FRWA 5C07D 1MCRA 3KDMA 5EBMA 4IIQC 4LPXA 5TF1L 1UM6L 1JPGA 5L2JB 2BSRB 5JR1H 3DO3A 2WUCH 3RHWF 4LLVB 1KG0B 1VFUA 5D1ZC 4LU5L 4U3XA 3KPRD 1OSPL 1IGTB 4G42B 1U95A 3ZZ1A 3NZHH 2A73B 2GAZA 3NZ8A 5FKAA 4NO0B 4WWKD 1EFXB 1JN6A 5GISH 5ID1B 4B50A 5I76B 4JE4B 5E1AA 3BH8B 4PTUA 4R9HA 4UU9B 4F3FA 3V4VL 1NGZB 1D9KD 3SPVA 4DVBA 3PQYA 4E0RA 1C08B 4DJMA 4UV4L 4KUZL 3HE7A 3O2VL 1BECA 1TJIL 5ISZD 3ARBC 1I9IH 1ACYH 5DJCB 4GAGL 2UUDK 2BSSB 2VLKE 43C9B 2F5BL 5L8LB 5CWSA 1A1OB 4MSWB 2CQVA 1SEQL 1RZJL 4M02A 3S3SA 3U4BH 4FQXD 5DK3A 2Q3ZA 3B43A 3OV6A 1WBZA 4X6CF 1Q0XL 1MWAB 1T7WA 3GEWB 1W72A 4HUUA 4ENEC 1IQWH 1OTTD 3B9DA 5F9AC 4ODSL 3OHXB 3DUUB 1VFAA 4LLWB 3KYOB 1B9ZA 1H5BB 5IVXE 4BFBD 4WV1C 1BBDL 1CZ8L 1CDBA 2BSTA 3FKUS 4OCXL 4G5ZL 1H8SA 5GGRA 5DRWB 5ESAA 3FB6B 5FYJE 5J8OA 5F9WB 2EDBA 2FEDD 1FIGH 1VKXA 1KPUA 2Z8VC 3W0WD 3MRLA 1D5IH 4FXLA 5HI3D 4F58H 4Z7OF 3O0RL 4WO4B 5F44A 4CNIA 3E8UL 5KN5A 3DUSA 1S7WA 5CSBA 1TETL 3WLBB 3UCRA 4AEIH 4YHNB 1HXMA 2XG5A 2AJYH 3MA9L 2G60H 2X4UB 4Z7UB 1CFTB 4Z7QE 2G9HA 1N59B 2BVUA 2WIIA 4NC2B 4DUXA 3Q6FB 2MFNA 5ERWA 4BK4A 1OWRM 3WFEH 3Q5YA 2DF3A 3R0NA 5CLWA 4OM0L 3PDOB 3KPLA 3MLUL 5D1ZD 1BJMA 3GJEA 2HT3C 5FAAA 4X6DA 3U1SL 3WHXB 3P9MA 2BMKA 1HQ4B 2XWBA 3MRNB 5FK9A 5EBMB 1JPGB 1XIWA 1Z0NA 2X1PA 5I75C 1J0JA 3H3KA 1LDSA 4W70A 5JR1L 2WUCL 3W0WE 3H42H 2GAZB 3NZ8B 3HNVH 4M7ZC 1JN6B 2BHZA 4XXCC 1XCTA 4U7MA 3ARBD 3S5LG 4V2CB 5I1IH 5E1AB 3NZHL 4PTUB 5CEZH 4F3FB 1CL7I 5GISL 4HSQA 3SPVB 1U3JA 4DVBB 3PQYB 4E0RB 2A38A 2R15A 1JE6A 3H6JA 3MFFB 4D94A 3HE7B 5DO2D 5CEXA 1CGSH 2BJML 5EORL 4ENED 3DWTA 5CWSB 3SDDC 4MA1B 1K3IA 4KWUA 1I9IL 1ACYL 1B0WA 3JWOC 2B2XH 4YE4H 1CXFA 2A83B 1WBZB 4DEPC 3HB3C 1W72B 4G80B 4HUUB 5KSBA 3U4BL 4Z7UE 1WWAX 4QOKD 3VWJC 1KPVA 1VFAB 4HIJA 1IQWL 1WAAA 3QIUA 1WTLA 5HGAA 3ARVA 4JKKA 3SEPA 2BSTB 3LB6C 1DQML 3BQUA 5GGRB 1I1RA 5ESAB 2R0WH 2VUYA 4F8TA 1VKXB 1KPUB 3S98A 1F2XK 3T8XA 1XH3A 3B3IA 1FIGL 1T80A 3MOBH 2HT4C 3QDMA 4Z7WA 1D5IL 3UC0H 3KXFA 2EDKA 4CNIB 4F58L 4JFYA 5KN5B 3DUSB 4R0LA 4BFIA 5IVNA 4M00A 3QIBA 4YFEA 4ZPTA 1PQZA 3CGTA 3AAZA 1RUMH 3ZE0F 4TNVF 4AEIL 1FP5A 2WIIB 2AJYL 2R8SH 2G60L 3KPLB 4IMKC 5HI5C 5E2UH 3DSFH 3V2AR 2KQMA 4X6DB 1RJCA 3LD8C 3P9MB 2BMKB 5IM7A 2UUDH 2XWBB 5ESQB 1XIWB 2R69H 5MHSD 1JZ5A 3NCJH 4NRYB 3BDXA 2Q3AA 1K4DA 1N7MH 4UTBH 4F9PA 1DN0B 3UBXA 3B83A 1PAMA 4GH7B 5C0BD 4P2OB 5I1DA 5E8PA 2UVEA 3TC9A 1HKFA 2NLJA 5GGTA 1XCTB 3MRGA 2MCG1 4MB4A 4KK6C 1JF6A 3VXOA 3I6LD 3H42L 4NZTH 1L6ZA 3HNVL 3SDDD 5FM8A 2W0PA 3DX9B 5CEZL 3GMOA 4LCUA 3PGDA 1ZT4A 2XXMB 3HB3D 5CEXB 5DYOA 5F7MC 2QKIB 1TDQA 2N7AA 1AH1A 3VWJD 2CIKB 5C8JA 1CGSL 1E4KC 2F19H 3FJTA 1U8LA 4KVNH 2EDLA 3LB6D 2CUMA 1Q1JH 1Q0YH 4H0IA 1AKJA 1NCBH 5I66B 5BOPA 4KI5D 2B2XL 4YE4L 3VFUB 1KPVB 4MA7H 4KRPB 3P4LA 3QIUB 5HGAB 3SCMB 3PWPA 1R3KA 3NBNA 5C0BE 5C2BH 4RGNB 2HT4D 5E4EB 3BQUB 4MS8C 4XNQA 3WN5C 2OM5A 4JFEA 4X6DE 3S36X 3UYOD 4IDJL 3X14A 2PTVA 3I6LE 1FL5A 1N64H 3T8XB 4JY5H 2R0WL 3LN4A 1XH3B 3C6SA 1DVFC 1KCKA 2C5DC 2XA3A 5MEOB 3TN0C 3QDMB 3FQXA 3KXFB 5DRNA 4Y89A 4BFIB 2VOTA 3MOBL 3QIBB 5D2LF 3VXMA 3ZDZF 5LXGH 5HDOA 1A7QH 3UC0L 1PQZB 5HI5D 4HX1B 4MJID 5JIKA 1H8NA 5IHLB 1SEBA 1F97A 4LBEA 2X6MA 1JWMA 4JKMA 4JPKH 5J57B 5B38G 3K46A 1RUML 4DTGH 4ZFOB 2DLTA 1JCKA 3QEQA 2R8SL 4RMVA 4P59H 2MOVA 5I74C 3UBXG 5IM7B 5DC0A 4DGYH 3QP3A 4HW6A 5E2UL 3DSFL 3FHQA 4KK6D 1LP9A 2ZKHH 5FXCH 2NY1B 2V9RA 4O02H 5KSBE 3NCJL 4PLOB 1JWSB 3O4OB 1N7ML 2WIMA 4JO2H 4UTBL 5I1DB 4HGKC 3IU4H 4W81A 2NLJB 4MXQC 7CGTA 3O2DL 3MRGB 1P53A 1MH5B 3VXOB 1HH9A 4NKDB 3ARTA 1MCWW 2G2RA 3AMKA 3MRIA 4NZTL 4MJIE 3GMOB 3T09A 1YQVH 4LCUB 3PGDB 3UAJC 1ZT4B 1KLUA 3AS3A 2HVKA 2CR6A 2XQBH 5DYOB 2W0KA 4KDTC 3BPOC 3PWJA 1HN1A 3QDME 4ODXA 4Z7WE 5IFJA 1HE7A 4AT6B 5C8JB 4UINH 5CEZD 1GGCH 1U8LB 2E7MA 4JQIL 4BQ9A 4Y16A 2WWMC 1TCRA 1FFOA 1AKJB 3CH8A 4MS8D 1L0XA 2F19L 1DBMH 3WXVH 5C6TH 4KVNL 4G9FD 3O4LA 1Q1JL 1Q0YL 1U93A 2I26N 3PHQA 5GXBB 1NCBL 1VACA 4PJ8B 1DVFD 3PWPB 1R3KB 5EULV 4F7MB 3TN0D 1CG9A 4XNQB 4HKZA 1HHKA 2YOCA 5BV7C 3X14B 2EDFA 5C2BL 1FL5B 2IPTH 4OF8A 2ESVA 3C6SB 3HC3H 5I71C 4FTVA 2V17H 3CH1A 4LEXH 1N64L 4LCCA 1YNLH 1IAOA 1WT5C 1J8HD 1A7PH 3EOTH 1FNEA 3VXMB 2PYED 5DTFB 1YC7A 1RFDL 3TBVA 5ADOH 3HN3A 3QUMH 4HS8H 5LXGL 2R1WA 1SEBB 4LBEB 1A7QL 3VMOA 3QQ4A 4M43H 2C3XA 1JTOA 5FCUH 5I9QB 9CGTA 2WQ8A 3GMLA 5DD5H 1EPFA 3QEQB 4KDVA 1BIHA 1T2QH 4JPKL 2F8VA 5E8EA 4DTGL 3L3JA 4JJHA 1MAMH 4YX2H 3IJYA 4P59L 5HYEA 4MXQD 3CDCA 3D3VD 3MUHL 1LP9B 1U8IA 1U8KB 4PJIF 4OD2A 5JO5A 3VXQA 1JPSH 3FO0H 2H1PH 4OF7A 4DOHB 3IS0X 1DBAH 4PD4J 2ZKHL 3WE6B 4P46A 4YFDB 4L4JA 1T83A 5CILH 1YEIH 4O02L 4Y5YC 3UAJD 4ZOCA 2H32H 3PWPE 4JO2L 3IU4L 1I8IA 1HH9B 3CXHK 3BFOA 3F58L 4LSQH 1PG7X 2G2RB 4JFEE 4F8QA 1T03L 1CFSA 1NC4D 5HYQA 3NAAL 2WWMD 2V9TA 1KLUB 4XGZA 2HVKB 3VH8G 2CUHA 5FCSH 2DDQH 1YQVL 4PGDA 1A3QA 3PWJB 1EBAA 4ODXB 5F7LB 3QFDA 4UOW0 2KQNA 2J4WH 1EEQA 2XQBL 3GBNH 4Y16B 1TCRB