3T4ZA

Crystal structure of nak2k channel y55w mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALWFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Protein interactions central to stabilizing the K+ channel selectivity filter in a four-sited configuration for selective K+ permeation.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
total genus 35
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3t4zA00
3SYOA 2WLNA 2QKSA 3T2MA 4KFMA 2YEVA 3SYQA 2ITCC 2HFEC 2H8PC 4OXSA 1KKDA 3GB7C 4RO2A 4WFFA 2QTOA 3AG1C 1P7BA 1XL6A 3PJSK 2Y69C 3SPHA 3OGCC 2Q68A 3OUFA 4G28B 3ZJZA 5EBMC 3F7VC 5B1BC 3TETA 3E8FA 1J95A 2WLKA 2X6BA 2WLJA 3IGAC 2P7TC 5KUMA 3UM7A 1JVMA 2IH1C 2WLLB 3LDDA 5EC1C 4PDLA 2Q69A 4MVQA 4PA9A 2WLIB 2BOBC 5J9PC 3SPJA 2EIKC 3BEHA 3WG7C 3X2QC 2WLMA 4LCUC 4MVMA 2EINC 4UUJC 2HJFC 2AHZA 5EK0A 4MTFA 2HVJC 3F5WC 3HPLC 4JTCB 3ABLC 2WLLA 3K03A 4MVOA 1ORQC 1S5HC 4H37A 4X88A 2NLJC 3OUSA 3FB6C 3OR6C 2WLIA 4MS2A 4MW3A 5IY5C 2EILC 3LDEA 2A9HA 2K1EA 1R3KC 4ZBMA 5EBWC 3RBZA 4GX0A 2ATKC 4CBCA 5CBFA 2EIJC 4G27B 1OCOC 1R3LC 4PA4A 4TWKA 1QLEC 2X6CA 4PDMA 1M56C 4RUEA 4XDKA 4QNHB 1OCRC 2DYSC 4LP8A 3JYCA 4MVUA 2A79B 3E83A 2A0LA 2ZXWC 3ZRSA 3SYAA 2Q6AA 4P9PA 1R3IC 4P9OA 3SJQC 3T1CA 4P30A 5B1AC 2DWEC 3K06A 2HVKC 1M57C 3AG4C 4WFHA 3ASOC 3SYCA 4H33A 1OCCC 4PDVA 2X6AA 3RVYA 4JTDB 4MVSA 5BZBA 4X89A 2BOCC 1V54C 3SPIA 3F7YC 3LNMB 3E8GA 4F4LA 3K0GA 2EIMC 3IFXA 4GX2A 4XDLA 3K0DA 2OCCC 4HYOA 1OCZC 3LDCA 1BL8A 4LBEC 3FB8C 1V55C 3K08A 3R65A 4QE9A 4R50A 3ABMC 2WLHA 4J9YB 5EBLC 2DWDC 4RUFA 2Q67A 3ABKC 3UKMA 4HZ3A 3EFFK 4DXWA 1K4CC 3T4DA 5CBGA 2IH3C 3STZC 3ASNC 3KG2A 4GX1A 4PA3A 2AHYA 3AG3C 4JTAB 4EKWA 1ZWIC 2ZD9A 3E8HA 3T4ZA 4P2ZA 5EC2C 3SYPA 3E89A 3FB5C 3OR7C 4GX5A 4MTOA 2KB1A 4PA7A 5KUKA 4XDJA 4PA6A 3STLC 4WFGA 4J9ZB 4MW8A 1XL4A 3AG2C 3E8BA 1K4DC 3TCUA 4I9WA 2W0FC 1R3JC 1LNQA 4MSWC 4R7CA 4X8AA 3RVZA 5B3SC 4MVRA 3FB7C 3K04A 4BW5A 5CBHA 5E1AC 3VOUA 4R6ZA 2R9RB 3SPGA 4WFEA 4R8CA 3SPCA 1G4YB 3E86A 4RAIA 2HG5C 2JK5C 2ITDC 4MTGA 4QE7A 2DYRC 4PDRA 3RW0A 4MVZA 3LUTB
chains in the Genus database with same CATH superfamily
4ABMA 1GO3F 1NI8A 1Y76B 5KA5A 3H01A 1AI7A 1RSOB 4NR1A 3QVNA 3OMNB 2DE0X 2ADQB 3F7VC 2ZDIC 1I5XA 5IWAB 1XUQA 3LDDA 1KP2A 1KYOF 2A06H 4X64B 2DYSB 4GCZA 1VF7A 4KP4A 2HP8A 2JEXA 4MVOA 3UO3A 3UQ8A 3CCUV 2JJ1G 1VQLV 1F23A 5KHIA 1BHAA 2Z3YA 4ICGA 3RBZA 3AK3A 4TWKA 2Q7HA 2EIMB 3JAWB 4AILC 2XASA 1Z2GA 2W0XA 3ZRWB 3P3NA 4PHZA 1JFFA 2PY5A 2UXNA 2XUMA 1BCCH 4JYCA 4LFCO 2Q9LA 3JAWA 2PI4A 3CCVV 1FXKB 5B1AB 3F7YC 3E8GA 3IFXA 4GX2A 1CP9A 3FD9A 4JYYA 1K33A 4HYOA 1OCZC 4IL6Z 1IBKB 2F95B 4GKKO 2JJ2G 3OTOB 4B3TB 1VQNV 2XTAA 5EYPB 1P49A 1Q6IA 1F7YA 2GDSA 1BSMA 5K1PA 2LFSA 2QTSA 4DUZB 4D7SA 2ZE5A 1ZUQA 5EYPA 3CHXA 4R7CA 2OT5A 3THOA 1K5QA 3FYEB 4DR7B 5L3DA 5CA1B 4XBFA 1AI6A 4JYBA 1PV0A 1GN2A 5JJNB 3JD3A 2ZM6B 3K59A 2UXCO 4X1IB 4KFMA 4NXNB 1LUWA 2GUZB 3ICXA 4JI3B 1QVGU 3U11A 3H1LH 4J80A 1GN3A 4JI1O 4CH6A 1EBOA 4X1IA 3ZMVA 2GUZA 4FM2A 1V9PA 1AP5A 3KCXA 3ETQA 4YXWG 1HWYA 4LH7A 2WLIB 3BEHA 3JARB 1OZ0A 4O2AB 4RWUA 2HVJC 3HKCA 4JTCB 4O4LB 1DTOA 5IWAO 4YJ2B 4QIWF 3FB6C 2WLIA 4MW3A 3RFRA 1L1FA 4X64O 3JARA 4O2AA 2B9ZA 1Q90D 5D5QA 3BVOA 3G4SV 4O4LA 1OCOC 1PP9H 1WA8B 1JQ0A 4YJ2A 2WWWA 4UCTA 2XNDG 3M8AA 3U0ZA 2ZIMA 4O4IB 1SQBH 4P9OA 1I5YA 1JPXA 4UV9A 1WA8A 2WAMA 2ZR3A 2QM7A 1HNWB 1OJHA 1NT2B 3L71H 3LNNA 4O4IA 4FJCC 1SKVA 3LNMB 4DR3B 1AJNA 1QHTA 1KC8W 3R65A 1SERA 3CWBH 3DGEA 3LSUA 4LC1A 3T4DA 3STZC 1R6KA 1HP8A 5KAFZ 4CS2A 4I50B 1H2LA 4KUMA 2DYRB 1IBKO 3RYFB 4AQYB 4FFBA 1H2NA 2GHYA 3M7MX 4UCRA 4WFGA 3CS5A 1NTKH 3OTOO 4B3TO 1TA8A 4J41A 3AG1B 2QWOB 1BE3H 1Q43A 2YEVB 2D3OW 4DUZO 5LOVB 2HG5C 4QE7A 3OT7A 2WA3A 4UCUA 3LUTB 2NR5A 3SYOA 1N36B 2YEVA 4DR7O 2HFEC 1KP3A 1SQPH 5LOVA 3BPZA 1P7BA 3QO8A 3SPHA 2ZM6O 4DR5B 1GH6A 3E8FA 1JA8A 4NXNO 1Q86W 5KHGA 5LMUB 4JAAA 1SQQH 4JI3O 1VQKV 4PELA 4EB6B 5GTHZ 2EZOA 1S5HC 5B1OA 5DEDA 3OR6C 3N2GB 2CGOA 3A0HZ 4UVBA 1ZAUA 5IYBO 4FLXA 2X6CA 2DYSC 1AVMA 5CA3A 2RQ6A 3SJQC 2ZCEA 4EFEA 4TSFG 1H38A 2UU9B 3ASOC 1Q8IA 3CYOA 3P32A 3SGIA 3JASA 5JVDB 4DR4O 5H9CA 2EIMC 1WNSA 4W4KA 1V54B 1B6QA 4LBEC 4B3SB 1HNWO 4J9YB 5EBLC 2VWJA 3K58A 4FM0A 4DR3O 2XHBA 3KG2A 4PA3A 4JTAB 3ZMTA 4OPAA 1FXKC 1MA1A 2DW4A 3BA8A 4JI8B 2PZSA 4UCVA 3J7AU 1LNQA 4MSWC 4K0KB 3A0BZ 3K9SA 2ZE7A 5H6RA 2RN9A 1S72V 1GRJA 1VIBA 1DGSA 1SS3A 1G4YB 3J80N 1HW7A 2JK5C 4JPRA 4U3JA 2WA4A 3EHBB 2HEPA 4OXSA 1U97A 1WP8A 5H6QA 3RGBA 2QTOA 1RFYA 1H2SB 2L6LA 2Q68A 1N36O 3CPWU 2JDIG 2WLJA 2P7TC 3E2EA 1JVMA 4EFBA 4PDLA 2N05A 5DM6V 3W7UA 5JH7B 5C93A 4F6RB 4DR5O 2ZE6A 4UCSA 4I55B 3B8MA 5LMUO 3AG4B 2ZDIA 2NLJC 1NR1A 1Q3EA 5EBWC 3JSNA 3K5MA 2X7RB 3L74H 1NH2B 3BY6A 3ETEA 4LP8A 1NKDA 3ZRSA 3OEHG 2AGAA 1S5LZ 1YI2V 3D8CA 3K06A 1MG1A 5CN0A 3DTUB 1FXHA 3A0RA 1X4TA 5B5EZ 3OE7G 3OD4A 2UU9O 2V4DA 4LF7B 1VP7A 3ZHSA 4QE9A 1OCZB 3JAKB 2Z0AA 3GWKC 2W6IG 2QWQB 1AILA 4B3SO 2KB1A 1N4CA 5KUKA 1PL4A 4BIUA 3E8BA 1K4DC 4K35A 1URFA 2DQ3A 4JV5B 1FAFA 2P6JA 2Y4TA 2ZT9B 1SZTA 1Y67A 3VOUA 5EIBC 3SPGA 2YC0A 4DR2B 3CEIA 1K3EA 1NQTA 2DYRC 4CH5A 1SQVH 1TGOA 3HKEB 1H2KA 3TXQA 2EJ7A 3AG1C 3BHPA 4JI6B 1RM1B 5LGTA 1M90W 3JD0A 4JZGA 2QM4A 1S0VA 5IJ9B 4JGSA 1Y6XA 3CRQA 1NVPD 1Q6UA 2H94A 4YJ3B 4DV5O 1N34B 4WBNB 2A9HA 4OPHA 1R3KC 3JSLA 2ATKC 4LR3A 1M4UA 3HKDB 4WBNA 1Z5WA 1BMFG 5JQGB 2ZXWC 1OCOB 3ZS8C 2UUAB 3ETGA 4BIOA 3HKDA 3OMIB 4PDVA 4J7ZA 5JQGA 1KKCA 4DR1O 5BZBA 3CE2A 3SPIA 4LF6O 1KBHA 5L3FA 2N04A 4TV8B 2ZNIA 1TUBA 1YF2A 3AG2B 3IC7A 4OGQB 3MD0A 2UUCB 2VQFB 2X0LA 2ZNJA 1CXZB 4CS4A 3CC2V 2F43G 3HKBB 3K57A 3N2KB 4O4JB 1PL0A 5JJEB 4LF7O 4MTOA 4J10A 2UXBB 1AI4A 2Q0OC 3Q4HB 3HKBA 3N2KA 4X62B 4O4JA 2QM8A 5CBHA 4EEQA 1DF4A 1XEQA 2NN4A 1LR1A 2PF4E 4JV5O 4N23A 3T2MA 2BCCH 2RJZA 5FLXN 2K9PA 3RYHB 1XL6A 4DV2B 3MHHC 5IYZB 4UVAA 2LW7A 2CH7B 2YXLA 1B06A 4JI7B 2IH1C 4J42A 5LMNB 3RYHA 1VQ4V 1QLEB 1Q7YW 2ZQMA 3OFNG 5GW7A 4JI6O 1PD3A 1YZBA 2AHZA 2A7WA 4DV6O 4FLUA 1ORQC 2FYUH 1VARA 2P06A 1MNGA 1M1KW 3E35A 2JGUA 4BAYA 1FYJA 1TVKA 2CDYA 1YCIA 4DV1B 4RUEA 4DK1A 1Y76A 1RSOA 1JCHA 2A79B 1N34O 3CCEV 2CTRA 1F4NA 3AG4C 2Q5ZA 4X20B 3CC7V 5LP6B 5LHHA 4Z2WA 3SR2C 3ASOB 1EZVH 2JEUA 3QTCA 2UUAO 2FB5A 2OCCC 4X20A 1NJIW 3FB8C 5LP6A 3G71V 4X65O 1E79G 1L0NH 3CRCA 1MMMA 3G67A 4WFAV 5CBGA 2ZE8A 3D36C 1W2BU 3T4ZA 1XHXA 4NB5A 2M6YA 2UUCO 2VQFO 4FZ1A 3ZRWA 1XILA 4J9ZB 4YIPA 2P4KA 3JD1A 3ZMUA 1IXMA 1FXKA 3ETDA 4R8CA 1AJQA 3APOA 1TUEB 1N32B 5J2TB 2ITDC 1D5AA 4X62O 3RW0A 4F6EA 4U7NA 2CE4A 3O65A 2CTWA 1VF6A 1SA0B 2FMLA 1KECA 4GLXA 3ZBHA 3CX5F 5J2TA 1T5EA 1IX9A 3CCRV 1SETA 1YDXA 2YIBD 4OX9B 3VQYA 5IY5B 4GT1A 5A2QN 1SA0A 3IGAC 3LSSA 3IJ4A 1Q81W 5EC1C 4TT3G 4BW9A 4DV2O 2QWNB 2NNUA 3BABA 4UB8Z 4MVMA 3B09A 1ZL8B 3F5WC 4KL1A 5CA1A 4JI7O 5LMNO 4X88A 4MS2A 5CB4B 1RM1C 3DC5A 4JI0B 4GX0A 1ZL8A 2JGDB 4LF5B 3UT5B 3F5TA 1G1XB 3ZCCA 4X9QA 4PV1B 4GKJB 1QBZA 4JI4B 1K9MW 1V55B 3D3IA 2JGDA 3UT5A 3CRMA 2RCVA 3C3SA 3NXSA 4DV1O 4W4LA 4PD4F 3TK1A 5KLVH 1QR8A 4X89A 5FPRA 2IM9A 1QVFU 2JIZG 2LGWA 1HNXB 5KX5B 1IBMB 4JF3A 4D7TA 1ZX3A 4LF8B 1YTFD 1BGYH 2VRZA 3ZMSA 3B8NA 3G80A 4UFZA 4DXWA 1PNMA 1MOFA 2AHYA 3SJCC 1F51A 5IE9A 1Q5OA 3PN1A 3FB5C 4U3FH 4ZKIA 2A3QA 3ZIAG 5FNVB 3AG2C 5LL6Y 2EX3A 3QG5A 4I9WA 3K04A 3WU2Z 2BE3A 1M9NA 5B1BB 5FNVA 1VQPV 4DV0B 3T1HB 5CMUA 2QKSA 1OHHG 1YJ9V 1M93A 5DECA 2GSMB 4LF4B 4CS3A 1YXBA 1MSDA 1QQCA 3ABLB 2V7QG 1H2GA 1N32O 3QF7A 4I50A 1FFTB 2BTQB 3RYFA 3MAQA 4X66B 3CCQV 4G2KA 4LH6A 2EIJB 5HFLA 5H2FZ 3ZHQA 2PYLA 5BR8B 3GVMA 4OX9O 1MSWD 2BTQA 4B08A 1GAXA 3ZMZA 3CCJV 3K03A 1M57B 2OCHA 3O9OA 1NU1H 3OUSA 2B1GA 2ADPA 2JVDA 3K79A 1I94B 5IDJA 1Z5VA 2Y48A 1QLEC 2O57A 2OTJV 1N0JA 4FZ0A 3K5LA 1GMGA 3B4SA 5JWPA 1QLNA 4JI0O 3FFQA 2R9AA 4LF5O 2ZXWB 4JASA 1WP7A 1K92A 4FLYA 5FPOA 2KKWA 5LGNA 4GKJO 2BSKB 4JI4O 4NYKA 1AR4A 3OMAB 1XHZA 4EB6A 4JAVA 1S3JA 4RQFA 3N2GA 2Q67A 2XAHA 4ZOLB 3AG3C 1HNXO 3DXRB 3SJAC 5LXTB 5LP6C 3S3XA 3BRCA 4FK5C 4H13B 1TAEA 1VQ9V 4LF8O 3STLC 4PA6A 2OYQA 4BR6A 1R1BA 4ZOLA 1A32A 3BFRA 3DXRA 5KHJA 3U10A 2PGGA 5BXZA 4LFBB 4R6ZA 5JVDA 4WFEA 2L35A 2HKOA 2DMXA 4NKGB 1GM9A 1VQOV 5C8YB 1PKXA 3JATB 1YEWA 2ETNA 2EIKB 3ABUA 4U7OA 4TQDA 1B04A 4DV0O 3W7SA 3T1HO 3S3WA 3OGCC 2EILB 1HDJA 1VF6C 1EFRG 2LP7A 2Y4UA 3EVKA 3HB3B 1BQZA 2DOSA 3UM7A 4LF4O 4AQYO 4AHCA 2P90A 1GN6A 2BOBC 3X2QC 2AZ0A 1WJZA 1NVPB 3RWRD 2E76B 4UXNA 2EINC 2E5LB 3WFVA 1S5JA 4X66O 4BIZA 5IY5C 4JAUA 4DK0A 5BR8O 4ZBMA 4MT8A 1N33B 1JR9A 2KG7B 4G27B 4L8JA 5CBFA 1OCRC 2UXXA 5CA0B 1CPYA 3TGUH 2DWEC 2KG7A 4ZI7B 1F4MA 1MZEA 5L3CA 1X59A 5JH7A 1S77D 1FFXB 4F6RA 1VQ7V 3C3TA 4I55A 1R6TA 3CP1A 1V55C 5B3SB 4I9QA 2WLHA 2OCCB 1EM1A 5EZYB 3KCYA 2LGQA 4JYAB 1FFXA 1GKFA 1YVWA 4EKWA 1MZFA 1DF5A 4CH3A 4DUYB 4UVCA 2IU3A 3ZRVA 2Y0IA 3ZRXA 2E75B 3RVZA 3ZN0A 4QGPA 4MVRA 3FB7C 1AROP 2Y69B 3D36A 4PJ0Z 1P7GA 4BWAA 5LBQA 3VQXA 5IYDO 4QPJA 3JD2A 1D2DA 2FL4A 4O2BB 4LFBO 4JI2B 2YDEA 2JS5A 1K8AW 3JAKA 1KKDA 4HBNA 2VS0A 2EZPA 1Q82W 3CMEV 5EBMC 5B1BC 1KMIZ 4DV3B 3TETA 1SQXH 2Q7EA 5KMGB 3L72H 4JI8O 2Q69A 2C2AA 3AK2A 1J5EB 1E1QG 1MABG 2IBZH 5JJJB 3W7WA 1THZA 4K0KO 1UPGA 3ABLC 4YY3B 2F1MA 3ABTA 1XNRB 2EJRA 2XOKG 4FFKA 1W0KG 3K3WA 2E5LO 2EIJC 1VQMV 4LF9B 4ZIBA 3HKEA 1GTOA 4HNAB 1WN7A 3IC9A 4MVUA 2A0LA 2EBOA 2HJDA 2E3CA 2VQEB 1M57C 4HNAA 2QJ1A 4QJFB 5BMVB 2B1IA 2CTPA 5IT9N 5IJ9A 2ZINA 1PM9A 4DO2A 3JAMN 5E79Z 2XT9A 2ARHA 3VQWA 4YJ3A 1GK9A 1QNMA 1M5IA 2QSAA 3K9AA 4RUFA 2F4VB 1FXVA 1K34A 2Q73A 4DYLA 2LW1A 3D3QA 2EULA 2WPDG 3APQA 3OR7C 3FAVB 4JYAO 2P22C 2W0FC 4PI0A 2RNBA 2P67A 4H0LB 4DUYO 3JALB 4GUNA 3CSXA 4TV9B 3W7XA 1WPXA 3SPCA 2ZIOA 3HR0A 2AXTZ 5ITZB 4TV8A 5L3GA 3KZIZ 1EN5A 1BQ0A 4PI2A 4TV9A 3MDSA 4TUYB 2IJIA 2H8PC 5H5NA 4WCEV 1ROPA 5ITZA 4LWSB 4QPKA 3H1IH 2Z5UA 2MW2B 4JI5B 3KKYA 1WAZA 5JCOC 3R66A 4TUYA 4CZZA 4I0XB 4JI2O 1J95A 4DR6B 2YIBA 1NH2D 3Q4HA 3GWOA 1SF9A 2EIKC 1BS3A 2IJJA 5AG2A 2R70A 1VF5B 4NXMB 4DR2O 1OCCB 1J5EO 2EILC 2K1EA 3AK1A 4IHJB 2Q8VA 4J11A 3H9VA 1UJWB 1AI5A 2WSSG 4XDKA 1BZKA 4IYIA 4YY3O 2YXHA 2F23A 3IAYA 4IHJA 1JJOA 1XNRO 4YIOA 1NTMH 1IURA 3FX7A 5IYZA 3ABKB 4X1KB 4WFHA 1YSCA 1VMGA 2CH7A 4Z1MG 1UFIA 2R9IA 1GM8A 1VQ6V 4FLTA 1OV9A 4MVSA 3ZX6A 5IJ0B 3BA9A 1R6NA 5KHKA 4X1KA 2VQEO 1HR0B 2F93B 1KQSU 1YTFB 1YIJV 5IJ0A 4J7KA 2ODMA 3EFFK 3CCSV 4GX1A 2RDCA 2MK3A 3ML0A 3I5DA 2UUBB 2OIEA 4K8XA 1SC5B 3AG3B 1YJWV 4MW8A 2F4VO 3CB2A 5B3SC 3JD4A 1D5NA 2YIAA 3ZHTA 1WB7A 1RPOA 3MHSC 4CH4A 4FIPC 2YI8A 5GONB 4IT5A 1S76D 4WFFA 1K73W 1JFFB 2JS3A 4Z1VA 1PNLA 2Y69C 1O9GA 2GTSA 2OTLV 5GONA 1G6UA 5KUMA 2WLLB 2UXBO 1JOYA 4JI5O 4UV8A 3SPJA 1I08A 2WLMA 4E4EA 1IZ3A 2CGNA 4TOIA 1U96A 4NTWA 2WLLA 4DR6O 3X2QB 4H37A 2GBOA 4DV7B 1W0JG 1WB8A 2EINB 2LO1A 3J81N 3C90A 1R3LC 4PA4A 3I56V 4QNHB 3OTFA 2W6JG 3OGIB 4Q20A 4NXMO 3WB1A 3DSQA 3SYAA 1SQGA 4FMTA 1OCRB 5TISZ 2CK3G 1SZXA 2BTOA 3SYCA 4H33A 3NR7A 4JZ2A 2OWOA 5J2UB 4FLWA 1ENVA 1IVSA 3ZN1A 2HLDG 4FLZA 5J2UA 3M99B 3B77A 4R50A 2LQTA 1FJGB 5CB4A 2DWDC 1HR0O 4DW1A 1DK1A 4P2ZA 4GX5A 2CTQA 1XL4A 3P3PA 3SJBC 4FM1A 4YHHB 1XBLA 3HKCB 3ZHVA 2UUBO 2YI9A 2UXDB 2QA4V 1HNZB 2R72A 4AI8A 1FD9A 2JRIA 3AEIA 5KX5A 1IBLB 5GTIZ 3WG7B 4NTYA 5K1XA 4UB6Z 1VEWA 2KSDA 3GB7C 4FLVA 3PJSK 4B3RB 1NZ6A 3JCUZ 5LA6B 2AW9A 2WLKA 4LFAB 1EN4A 1NTZH 4DR4B 1H8EG 1M56B 2QKCA 5J9PC 5LA6A 2LJ2A 5D5PA 5LGUA 2IW5A 1JMKC 2IU0A 3BAAA 1L0LH 3OW2U 1PPJH 5HFMA 1XMQB 1XMOB 4Q6GA 1Y4MA 1SRYA 3AG7A 4FFBB 1JJ2U 4DV7O 1H8HG 4NTXA 1YHQV 2QE7G 1RP3B 1OCCC 3ASNB 4E2LA 3RVYA 1XNQB 4JTDB 2BOCC 4F4LA 2N74A 2PUSA 4XDLA 3L70H 3LDCA 1BL8A 3CXCU 2F66C 2RMKB 3OEEG 3CMAV 3B40A 2YUAA 3ABKC 4A5UB 4K3AA 4RQEA 2IH3C 4FPPA 3ZHUA 5EC2C 3TXSA 4PA7A 3L9DA 1FJGO 4K8ZA 3CRRA 2HHHB 3TCUA 2YS8A 4BW5A 2FTKA 3A2FA 1W59A 2R9RB 1GN4A 2QR4A 2BSKA 2Q7GA 5KA6A 4KHPB 1Y66A 3WB2A 2IJKA 1G8MA 3B2EE 3RT3C 1AP6A 2XAQA 4MVZA 4X8AA 2QKAA 4YHHO 1NBMG 3SYQA 1IBMO 4IGGA 1Y74B 5A9GA 4I4TB 2UXDO 4D6TH 1HNZO 3LSQA 4I5SA 1XOUA 2HR3A 3OUFA 1IBLO 5LXTA 1Y74A 2X6BA 1KUQA 4I4TA 3JASB 1RPRA 1VQ8V 1QCEA 1XREA 4B3RO 4IYHA 4UUJC 2HJFC 4MTFA 2XAJA 5JCOA 4DRXB 4LFAO 2QWPB 2H3OA 4GYCB 5C8YA 3K5NA 2YICA 1EZJA 3JATA 3FKSG 4DRXA 4CBCA 1JX9A 1COWG 4PDMA 3JYCA 4UCOA 5BY1A 5LHGA 4I7ZB 3ABMB 1XDCA 1AR1B 1XMOO 1XMQO 5B1AC 5L3EA 4C7UA 1P4RA 4KXRA 2PYJA 2M7WA 1KB9F 2X6AA 2XAGA 1VQ5V 3P30A 4MTXA 4CC5A 2D2CB 3K0GA 4U3JB 3K0DA 3G6EV 1IDSA 1XNQO 3TJTA 1IXBA 5L3BA 2YXYA 5DN6G 1N0NA 3UCSC 5KAIZ 5EIBD 2ZD9A 2GV9A 3E8HA 3SYPA 3E89A 1YJNV 1I94O 2CUGA 1L8DA 1ZTEA 5KHHA 5CA0A 1K5SA 3H1KH 4ZI7A 1NS1A 1EN6A 4DV5B 1GM7A 1KD1W 2HHHO 4GZRB 3E22B 1QU7A 4PDRA 3CRAA 3ZEDA 2FKXA 2DQ0A 5EZYA 4RO2A 2DN9A 4KHPO 3E22A 4J7JA 2G38A 3ZJZA 3L73H 1FKAO 4DR1B 4LF6B 2AZ2A 2LFRA 3A8TA 3WG7C 1PNKA 1B3QA 5EK0A 3HPLC 4B3MB 4WF9V 4N21A 3CC4V 3QO7A 2E74B 3LDEA 4DV4B 2Y0PA 2B5UA 4O2BA 1XQ8A 1QR9A 1M56C 3FYIB 3E83A 2Q6AA 4P9PA 1AJPA 1BHBA 1R3IC 3EXAA 4DW0A 5LHIA 4O4HB 1AR5A 5KMGA 4IIJB 2OIGA 3RYCB 2V1DA 3H1HH 3BCCH 3RYIB 1R73A 4O4HA 2P5OA 3K08A 4IIJA 3RYCA 4NVPA 5B1NA 3UKMA 4HZ3A 3RYIA 3ASNC 3OM3B 2CAZC 4ZHQB 1XI1A 1N33O 3CXHF 3L75H 3K5OA 4XDJA 3T1YB 1NR7A 4ZHQA 4DV6B 5E1AC 1WLEA 5BMVA 3ZHRA 3QNEA 4H44B 4CC6A 1KU9A 5LYJB 5IYCO 3E86A 4RAIA 2ZR2A 4ASUG 4MTGA 1H2MA 2QDOA 1LUVA 2WLNA 2DJVA 3DC6A 2ITCC 2IJHA 5LYJA 3RN4A 2YSUB 2VWKA 1N8RW 4G28B 2QEXV 1FS0G 1SESA 4L87A 3FAVA 4MVQA 1AB3A 2Q4PA 4PA9A 1YITV 4B7EA 4LCUC 1I0HA 1TUBB 2GTAA 3JALA 3I55V 4B7KA 2ZKOA 4FVMA 4X65B 2PI5A 1K97A 3CD6V 1WPBA 2KQXA 2XAFA 4LFCB 4B3MO 5FL7G 2PTMA 3OAAG 3CJHB 1SQFA 3JCZA 4LWSA 4DV4O 2ILMA 3T1CA 4WFBV 2Q0AA 4P30A 1CEZA 4TQFA 2HVKC 1BT8A 1I7FA 4I0XA 1ZLZA 4DV3O 3CJHA 3CCMV 4GKKB 2QWRB 4LNUB 2P4VA 1V54C 5B66Z 3QO5A 1O9HA 1E1RG 4HAMA 3UO2A 3G6BA 3ABMC 4LNUA 4X1YB 3SDLA 1P84F 5F2VO 3W7TA 1K4CC 3CCLV 3H1JH 1ZWIC 1K7DA 4LF9O 4X1YA 1DLBA 1R3JC 3VQVA 3WB0A 1FPOA 2UXCB 3T1YO 3VBBA 1Q6HA 3N27A 2QGNA 1ZSPA 1US6A 4JI1B 2YIDA 1TVKB
chains in the Genus database with same CATH topology
1GO3F 2EIKB 3ABUA 3WG7B 4U7OA 5KA5A 3H01A 1AI7A 3GB7C 3W7SA 3OMNB 3AG1C 3PJSK 3OGCC 1RM1B 2EILB 3F7VC 3HB3B 1EFRG 2LP7A 5LGTA 1M90W 2ZDIC 3JD0A 1I5XA 2WLKA 3UM7A 3LDDA 1KP2A 2P90A 1S0VA 1H8EG 1M56B 4JGSA 2DYSB 2BOBC 4GCZA 5J9PC 3X2QC 4KP4A 1NVPB 4UXNA 2EINC 3WFVA 5LGUA 1NVPD 2IW5A 2JEXA 4MVOA 3CCUV 2H94A 2JJ1G 2IU0A 1VQLV 4BIZA 5IY5C 4JAUA 1F23A 2A9HA 3OW2U 1R3KC 4ZBMA 1BHAA 2Z3YA 5HFMA 3RBZA 4MT8A 2ATKC 5CBFA 4TWKA 4G27B 2EIMB 1Y4MA 1SRYA 2XASA 1OCRC 2UXXA 1JJ2U 3ZRWB 1BMFG 2ZXWC 1H8HG 1OCOB 1YHQV 2UXNA 1CPYA 2QE7G 3ETGA 4JYCA 2DWEC 1F4MA 2PI4A 1OCCC 3ASNB 3CCVV 3OMIB 4PDVA 4E2LA 1FXKB 3RVYA 4JTDB 5B1AB 5L3CA 5BZBA 2BOCC 3SPIA 3F7YC 5L3FA 3E8GA 4F4LA 1S77D 3IFXA 1VQ7V 4GX2A 1CP9A 4XDLA 1K33A 4HYOA 3AG2B 1OCZC 3LDCA 1BL8A 3IC7A 3CXCU 3MD0A 3CP1A 1V55C 5B3SB 2X0LA 2JJ2G 3OEEG 3CMAV 2WLHA 2OCCB 3ABKC 3CC2V 1GKFA 2F43G 4RQEA 1VQNV 2IH3C 4FPPA 4EKWA 1PL0A 5EC2C 1DF5A 4MTOA 4PA7A 2LFSA 4UVCA 2IU3A 3ZRVA 1AI4A 3ZRXA 3TCUA 4R7CA 3RVZA 2OT5A 3ZN0A 2QM8A 4MVRA 3FB7C 4BW5A 5CBHA 1K5QA 1AROP 2FTKA 2Y69B 3D36A 3FYEB 5L3DA 1DF4A 2R9RB 4XBFA 1AI6A 4JYBA 5KA6A 5LBQA 1Y66A 2IJKA 1G8MA 4QPJA 3JD2A 5IYDO 4N23A 2XAQA 4MVZA 4X8AA 3JD3A 3T2MA 1NBMG 4KFMA 3SYQA 1K8AW 1KKDA 2EZPA 1QVGU 1Q82W 3LSQA 4I5SA 1XL6A 3MHHC 2HR3A 3OUFA 3CMEV 1EBOA 4UVAA 5EBMC 5B1BC 3TETA 3ZMVA 2X6BA 2IH1C 1RPRA 1VQ4V 4YXWG 1VQ8V 2Q69A 1HWYA 2C2AA 1QLEB 1E1QG 1Q7YW 2WLIB 1MABG 1QCEA 2ZQMA 3BEHA 3OFNG 1OZ0A 5GW7A 3W7WA 1PD3A 1THZA 4UUJC 2HJFC 2AHZA 4MTFA 2HVJC 2XAJA 3ABLC 4JTCB 1DTOA 1ORQC 4QIWF 3FB6C 3ABTA 2WLIA 4MW3A 3E35A 1L1FA 1M1KW 4BAYA 2EJRA 2XOKG 1EZJA 1W0KG 3K3WA 3G4SV 3FKSG 2EIJC 1OCOC 1JX9A 4CBCA 1VQMV 1COWG 4PDMA 4RUEA 1JQ0A 1GTOA 2WWWA 2XNDG 3JYCA 4MVUA 1JCHA 2A79B 5LHGA 2A0LA 3CCEV 2EBOA 3ABMB 4P9OA 1I5YA 1JPXA 4UV9A 1F4NA 1AR1B 5B1AC 5L3EA 1M57C 3AG4C 1P4RA 2WAMA 2ZR3A 2QM7A 4QJFB 2M7WA 2X6AA 2XAGA 3CC7V 1VQ5V 5LHHA 2B1IA 3P30A 4FJCC 3ASOB 2JEUA 4MTXA 3LNMB 4DO2A 3K0GA 1AJNA 3K0DA 2OCCC 1KC8W 1NJIW 3FB8C 3G6EV 3R65A 3G71V 1SERA 1GK9A 3DGEA 1E79G 5L3BA 3K9AA 4RUFA 1FXVA 1K34A 4WFAV 4LC1A 5DN6G 3T4DA 5CBGA 3STZC 1R6KA 2ZD9A 3E8HA 1W2BU 2WPDG 3T4ZA 3SYPA 3E89A 4KUMA 3OR7C 1YJNV 2DYRB 3ZRWA 2GHYA 4WFGA 4J9ZB 1K5SA 2W0FC 3JD1A 3AG1B 3ZMUA 1IXMA 2P67A 1FXKA 2YEVB 2D3OW 3W7XA 3ETDA 1WPXA 4R8CA 3SPCA 1AJQA 1GM7A 1KD1W 1TUEB 2HG5C 2ITDC 4QE7A 5L3GA 4PDRA 3RW0A 3LUTB 4U7NA 3SYOA 2YEVA 2HFEC 2IJIA 2H8PC 1KP3A 1KECA 2DQ0A 1ROPA 4WCEV 4RO2A 4QPKA 3CCRV 2Z5UA 1P7BA 1SETA 3QO8A 3SPHA 3ZJZA 5IY5B 4GT1A 3E8FA 4CZZA 1J95A 3IGAC 3LSSA 1Q86W 1NH2D 1Q81W 5EC1C 4TT3G 2LFRA 3GWOA 1VQKV 2EIKC 4PELA 2NNUA 3WG7C 2IJJA 4MVMA 1PNKA 2EZOA 5EK0A 3F5WC 3HPLC 4WF9V 4N21A 3CC4V 3QO7A 1S5HC 5B1OA 4X88A 3OR6C 4MS2A 1RM1C 1OCCB 2EILC 3LDEA 2K1EA 1UJWB 4UVBA 2B5UA 1AI5A 4GX0A 2WSSG 1QR9A 5IYBO 4XDKA 2X6CA 1M56C 2DYSC 3ZCCA 3FYIB 1QBZA 3E83A 1K9MW 5CA3A 1V55B 3D3IA 2Q6AA 4P9PA 1AJPA 1BHBA 1R3IC 3SJQC 4TSFG 1H38A 3ABKB 5LHIA 4WFHA 1YSCA 3ASOC 4Z1MG 3NXSA 2R9IA 3CYOA 3P32A 1GM8A 3TK1A 1VQ6V 4MVSA 2V1DA 1QR8A 4X89A 1R6NA 5H9CA 1QVFU 2EIMC 2JIZG 1R73A 1KQSU 4JF3A 1YTFB 1V54B 1B6QA 4LBEC 3K08A 5B1NA 4J9YB 5EBLC 1YIJV 1YTFD 3UKMA 4HZ3A 3ZMSA 3B8NA 3EFFK 4DXWA 3CCSV 1PNMA 3ASNC 3KG2A 1MOFA 3OM3B 2AHYA 4GX1A 4JTAB 1F51A 4PA3A 1FXKC 3ZMTA 2MK3A 3FB5C 3ML0A 2DW4A 3AG3B 1YJWV 4XDJA 4ZKIA 4MW8A 3ZIAG 3AG2C 1NR7A 4I9WA 1LNQA 4MSWC 5B3SC 3JD4A 3K04A 5E1AC 1WLEA 5H6RA 1M9NA 1S72V 5B1BB 3QNEA 5IYCO 1VQPV 1RPOA 1G4YB 3E86A 4RAIA 2JK5C 3MHSC 2ZR2A 4JPRA 4ASUG 4MTGA 3EHBB 4FIPC 5CMUA 2WLNA 2QKSA 1OHHG 2ITCC 2IJHA 1YJ9V 2GSMB 2YSUB 4OXSA 1S76D 4WFFA 5H6QA 2QTOA 3ABLB 1K73W 2V7QG 1N8RW 1H2GA 1PNLA 2Y69C 2Q68A 4G28B 2QEXV 2OTLV 1FS0G 1SESA 4L87A 1FFTB 3CPWU 2JDIG 2WLJA 2P7TC 5KUMA 3E2EA 1JVMA 3CCQV 4G2KA 2WLLB 2EIJB 5HFLA 4PDLA 4MVQA 5DM6V 1JOYA 3W7UA 4PA9A 1YITV 4UV8A 3SPJA 1MSWD 5C93A 2WLMA 4LCUC 3ZMZA 3CCJV 2WLLA 3K03A 3B8MA 3X2QB 3I55V 1M57B 3AG4B 4H37A 1W0JG 2ZDIA 2EINB 2NLJC 3OUSA 2PI5A 1NR1A 2B1GA 1K97A 3CD6V 5EBWC 2XAFA 3K79A 5IDJA 2X7RB 1R3LC 2Y48A 4PA4A 1QLEC 4QNHB 3I56V 1NH2B 2OTJV 5FL7G 2W6JG 3OAAG 1GMGA 3BY6A 3ETEA 4LP8A 4Q20A 1NKDA 3JCZA 3ZRSA 3OEHG 3SYAA 1QLNA 4FMTA 1OCRB 3T1CA 4WFBV 1YI2V 4P30A 1CEZA 3K06A 2HVKC 2CK3G 1MG1A 2ZXWB 5CN0A 3SYCA 4H33A 4JASA 3DTUB 1FXHA 3A0RA 3CCMV 1K92A 5LGNA 1ENVA 1V54C 3ZN1A 3OMAB 2HLDG 3OE7G 3QO5A 1E1RG 4JAVA 4HAMA 1S3JA 3M99B 3B77A 4QE9A 4R50A 3ABMC 4RQFA 1OCZB 2DWDC 2Q67A 2XAHA 3W7TA 1K4CC 2W6IG 3CCLV 3AG3C 1ZWIC 1K7DA 4P2ZA 4FK5C 4GX5A 2KB1A 1VQ9V 5KUKA 3STLC 4PA6A 4BIUA 1XL4A 3E8BA 1DLBA 1K4DC 2DQ3A 1R3JC 2P6JA 1SZTA 3VOUA 4R6ZA 3SPGA 4WFEA 3VBBA 1K3EA 1NQTA 2HKOA 2QA4V 1GM9A 1VQOV 2DYRC 1PKXA 3AEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYO A;  2WLN A;  2QKS A;  3T2M A;  4KFM A;  2YEV A;  3SYQ A;  2ITC C;  2HFE C;  2H8P C;  4OXS A;  1KKD A;  3GB7 C;  4RO2 A;  4WFF A;  2QTO A;  3AG1 C;  1P7B A;  1XL6 A;  3PJS K;  2Y69 C;  3SPH A;  3OGC C;  2Q68 A;  3OUF A;  4G28 B;  3ZJZ A;  5EBM C;  3F7V C;  5B1B C;  3TET A;  3E8F A;  1J95 A;  2WLK A;  2X6B A;  2WLJ A;  3IGA C;  2P7T C;  5KUM A;  3UM7 A;  1JVM A;  2IH1 C;  2WLL B;  3LDD A;  5EC1 C;  4PDL A;  2Q69 A;  4MVQ A;  4PA9 A;  2WLI B;  2BOB C;  5J9P C;  3SPJ A;  2EIK C;  3BEH A;  3WG7 C;  3X2Q C;  2WLM A;  4LCU C;  4MVM A;  2EIN C;  4UUJ C;  2HJF C;  2AHZ A;  5EK0 A;  4MTF A;  2HVJ C;  3F5W C;  3HPL C;  4JTC B;  3ABL C;  2WLL A;  3K03 A;  4MVO A;  1ORQ C;  1S5H C;  4H37 A;  4X88 A;  2NLJ C;  3OUS A;  3FB6 C;  3OR6 C;  2WLI A;  4MS2 A;  4MW3 A;  5IY5 C;  2EIL C;  3LDE A;  2A9H A;  2K1E A;  1R3K C;  4ZBM A;  5EBW C;  3RBZ A;  4GX0 A;  2ATK C;  4CBC A;  5CBF A;  2EIJ C;  4G27 B;  1OCO C;  1R3L C;  4PA4 A;  4TWK A;  1QLE C;  2X6C A;  4PDM A;  1M56 C;  4RUE A;  4XDK A;  4QNH B;  1OCR C;  2DYS C;  4LP8 A;  3JYC A;  4MVU A;  2A79 B;  3E83 A;  2A0L A;  2ZXW C;  3ZRS A;  3SYA A;  2Q6A A;  4P9P A;  1R3I C;  4P9O A;  3SJQ C;  3T1C A;  4P30 A;  5B1A C;  2DWE C;  3K06 A;  2HVK C;  1M57 C;  3AG4 C;  4WFH A;  3ASO C;  3SYC A;  4H33 A;  1OCC C;  4PDV A;  2X6A A;  3RVY A;  4JTD B;  4MVS A;  5BZB A;  4X89 A;  2BOC C;  1V54 C;  3SPI A;  3F7Y C;  3LNM B;  3E8G A;  4F4L A;  3K0G A;  2EIM C;  3IFX A;  4GX2 A;  4XDL A;  3K0D A;  2OCC C;  4HYO A;  1OCZ C;  3LDC A;  1BL8 A;  4LBE C;  3FB8 C;  1V55 C;  3K08 A;  3R65 A;  4QE9 A;  4R50 A;  3ABM C;  2WLH A;  4J9Y B;  5EBL C;  2DWD C;  4RUF A;  2Q67 A;  3ABK C;  3UKM A;  4HZ3 A;  3EFF K;  4DXW A;  1K4C C;  3T4D A;  5CBG A;  2IH3 C;  3STZ C;  3ASN C;  3KG2 A;  4GX1 A;  4PA3 A;  2AHY A;  3AG3 C;  4JTA B;  4EKW A;  1ZWI C;  2ZD9 A;  3E8H A;  3T4Z A;  4P2Z A;  5EC2 C;  3SYP A;  3E89 A;  3FB5 C;  3OR7 C;  4GX5 A;  4MTO A;  2KB1 A;  4PA7 A;  5KUK A;  4XDJ A;  4PA6 A;  3STL C;  4WFG A;  4J9Z B;  4MW8 A;  1XL4 A;  3AG2 C;  3E8B A;  1K4D C;  3TCU A;  4I9W A;  2W0F C;  1R3J C;  1LNQ A;  4MSW C;  4R7C A;  4X8A A;  3RVZ A;  5B3S C;  4MVR A;  3FB7 C;  3K04 A;  4BW5 A;  5CBH A;  5E1A C;  3VOU A;  4R6Z A;  2R9R B;  3SPG A;  4WFE A;  4R8C A;  3SPC A;  1G4Y B;  3E86 A;  4RAI A;  2HG5 C;  2JK5 C;  2ITD C;  4MTG A;  4QE7 A;  2DYR C;  4PDR A;  3RW0 A;  4MVZ A;  3LUT B; 
#chains in the Genus database with same CATH topology
 4ABM A;  1GO3 F;  1NI8 A;  1Y76 B;  5KA5 A;  3H01 A;  1AI7 A;  1RSO B;  4NR1 A;  3QVN A;  3OMN B;  2DE0 X;  2ADQ B;  3F7V C;  2ZDI C;  1I5X A;  5IWA B;  1XUQ A;  3LDD A;  1KP2 A;  1KYO F;  2A06 H;  4X64 B;  2DYS B;  4GCZ A;  1VF7 A;  4KP4 A;  2HP8 A;  2JEX A;  4MVO A;  3UO3 A;  3UQ8 A;  3CCU V;  2JJ1 G;  1VQL V;  1F23 A;  5KHI A;  1BHA A;  2Z3Y A;  4ICG A;  3RBZ A;  3AK3 A;  4TWK A;  2Q7H A;  2EIM B;  3JAW B;  4AIL C;  2XAS A;  1Z2G A;  2W0X A;  3ZRW B;  3P3N A;  4PHZ A;  1JFF A;  2PY5 A;  2UXN A;  2XUM A;  1BCC H;  4JYC A;  4LFC O;  2Q9L A;  3JAW A;  2PI4 A;  3CCV V;  1FXK B;  5B1A B;  3F7Y C;  3E8G A;  3IFX A;  4GX2 A;  1CP9 A;  3FD9 A;  4JYY A;  1K33 A;  4HYO A;  1OCZ C;  4IL6 Z;  1IBK B;  2F95 B;  4GKK O;  2JJ2 G;  3OTO B;  4B3T B;  1VQN V;  2XTA A;  5EYP B;  1P49 A;  1Q6I A;  1F7Y A;  2GDS A;  1BSM A;  5K1P A;  2LFS A;  2QTS A;  4DUZ B;  4D7S A;  2ZE5 A;  1ZUQ A;  5EYP A;  3CHX A;  4R7C A;  2OT5 A;  3THO A;  1K5Q A;  3FYE B;  4DR7 B;  5L3D A;  5CA1 B;  4XBF A;  1AI6 A;  4JYB A;  1PV0 A;  1GN2 A;  5JJN B;  3JD3 A;  2ZM6 B;  3K59 A;  2UXC O;  4X1I B;  4KFM A;  4NXN B;  1LUW A;  2GUZ B;  3ICX A;  4JI3 B;  1QVG U;  3U11 A;  3H1L H;  4J80 A;  1GN3 A;  4JI1 O;  4CH6 A;  1EBO A;  4X1I A;  3ZMV A;  2GUZ A;  4FM2 A;  1V9P A;  1AP5 A;  3KCX A;  3ETQ A;  4YXW G;  1HWY A;  4LH7 A;  2WLI B;  3BEH A;  3JAR B;  1OZ0 A;  4O2A B;  4RWU A;  2HVJ C;  3HKC A;  4JTC B;  4O4L B;  1DTO A;  5IWA O;  4YJ2 B;  4QIW F;  3FB6 C;  2WLI A;  4MW3 A;  3RFR A;  1L1F A;  4X64 O;  3JAR A;  4O2A A;  2B9Z A;  1Q90 D;  5D5Q A;  3BVO A;  3G4S V;  4O4L A;  1OCO C;  1PP9 H;  1WA8 B;  1JQ0 A;  4YJ2 A;  2WWW A;  4UCT A;  2XND G;  3M8A A;  3U0Z A;  2ZIM A;  4O4I B;  1SQB H;  4P9O A;  1I5Y A;  1JPX A;  4UV9 A;  1WA8 A;  2WAM A;  2ZR3 A;  2QM7 A;  1HNW B;  1OJH A;  1NT2 B;  3L71 H;  3LNN A;  4O4I A;  4FJC C;  1SKV A;  3LNM B;  4DR3 B;  1AJN A;  1QHT A;  1KC8 W;  3R65 A;  1SER A;  3CWB H;  3DGE A;  3LSU A;  4LC1 A;  3T4D A;  3STZ C;  1R6K A;  1HP8 A;  5KAF Z;  4CS2 A;  4I50 B;  1H2L A;  4KUM A;  2DYR B;  1IBK O;  3RYF B;  4AQY B;  4FFB A;  1H2N A;  2GHY A;  3M7M X;  4UCR A;  4WFG A;  3CS5 A;  1NTK H;  3OTO O;  4B3T O;  1TA8 A;  4J41 A;  3AG1 B;  2QWO B;  1BE3 H;  1Q43 A;  2YEV B;  2D3O W;  4DUZ O;  5LOV B;  2HG5 C;  4QE7 A;  3OT7 A;  2WA3 A;  4UCU A;  3LUT B;  2NR5 A;  3SYO A;  1N36 B;  2YEV A;  4DR7 O;  2HFE C;  1KP3 A;  1SQP H;  5LOV A;  3BPZ A;  1P7B A;  3QO8 A;  3SPH A;  2ZM6 O;  4DR5 B;  1GH6 A;  3E8F A;  1JA8 A;  4NXN O;  1Q86 W;  5KHG A;  5LMU B;  4JAA A;  1SQQ H;  4JI3 O;  1VQK V;  4PEL A;  4EB6 B;  5GTH Z;  2EZO A;  1S5H C;  5B1O A;  5DED A;  3OR6 C;  3N2G B;  2CGO A;  3A0H Z;  4UVB A;  1ZAU A;  5IYB O;  4FLX A;  2X6C A;  2DYS C;  1AVM A;  5CA3 A;  2RQ6 A;  3SJQ C;  2ZCE A;  4EFE A;  4TSF G;  1H38 A;  2UU9 B;  3ASO C;  1Q8I A;  3CYO A;  3P32 A;  3SGI A;  3JAS A;  5JVD B;  4DR4 O;  5H9C A;  2EIM C;  1WNS A;  4W4K A;  1V54 B;  1B6Q A;  4LBE C;  4B3S B;  1HNW O;  4J9Y B;  5EBL C;  2VWJ A;  3K58 A;  4FM0 A;  4DR3 O;  2XHB A;  3KG2 A;  4PA3 A;  4JTA B;  3ZMT A;  4OPA A;  1FXK C;  1MA1 A;  2DW4 A;  3BA8 A;  4JI8 B;  2PZS A;  4UCV A;  3J7A U;  1LNQ A;  4MSW C;  4K0K B;  3A0B Z;  3K9S A;  2ZE7 A;  5H6R A;  2RN9 A;  1S72 V;  1GRJ A;  1VIB A;  1DGS A;  1SS3 A;  1G4Y B;  3J80 N;  1HW7 A;  2JK5 C;  4JPR A;  4U3J A;  2WA4 A;  3EHB B;  2HEP A;  4OXS A;  1U97 A;  1WP8 A;  5H6Q A;  3RGB A;  2QTO A;  1RFY A;  1H2S B;  2L6L A;  2Q68 A;  1N36 O;  3CPW U;  2JDI G;  2WLJ A;  2P7T C;  3E2E A;  1JVM A;  4EFB A;  4PDL A;  2N05 A;  5DM6 V;  3W7U A;  5JH7 B;  5C93 A;  4F6R B;  4DR5 O;  2ZE6 A;  4UCS A;  4I55 B;  3B8M A;  5LMU O;  3AG4 B;  2ZDI A;  2NLJ C;  1NR1 A;  1Q3E A;  5EBW C;  3JSN A;  3K5M A;  2X7R B;  3L74 H;  1NH2 B;  3BY6 A;  3ETE A;  4LP8 A;  1NKD A;  3ZRS A;  3OEH G;  2AGA A;  1S5L Z;  1YI2 V;  3D8C A;  3K06 A;  1MG1 A;  5CN0 A;  3DTU B;  1FXH A;  3A0R A;  1X4T A;  5B5E Z;  3OE7 G;  3OD4 A;  2UU9 O;  2V4D A;  4LF7 B;  1VP7 A;  3ZHS A;  4QE9 A;  1OCZ B;  3JAK B;  2Z0A A;  3GWK C;  2W6I G;  2QWQ B;  1AIL A;  4B3S O;  2KB1 A;  1N4C A;  5KUK A;  1PL4 A;  4BIU A;  3E8B A;  1K4D C;  4K35 A;  1URF A;  2DQ3 A;  4JV5 B;  1FAF A;  2P6J A;  2Y4T A;  2ZT9 B;  1SZT A;  1Y67 A;  3VOU A;  5EIB C;  3SPG A;  2YC0 A;  4DR2 B;  3CEI A;  1K3E A;  1NQT A;  2DYR C;  4CH5 A;  1SQV H;  1TGO A;  3HKE B;  1H2K A;  3TXQ A;  2EJ7 A;  3AG1 C;  3BHP A;  4JI6 B;  1RM1 B;  5LGT A;  1M90 W;  3JD0 A;  4JZG A;  2QM4 A;  1S0V A;  5IJ9 B;  4JGS A;  1Y6X A;  3CRQ A;  1NVP D;  1Q6U A;  2H94 A;  4YJ3 B;  4DV5 O;  1N34 B;  4WBN B;  2A9H A;  4OPH A;  1R3K C;  3JSL A;  2ATK C;  4LR3 A;  1M4U A;  3HKD B;  4WBN A;  1Z5W A;  1BMF G;  5JQG B;  2ZXW C;  1OCO B;  3ZS8 C;  2UUA B;  3ETG A;  4BIO A;  3HKD A;  3OMI B;  4PDV A;  4J7Z A;  5JQG A;  1KKC A;  4DR1 O;  5BZB A;  3CE2 A;  3SPI A;  4LF6 O;  1KBH A;  5L3F A;  2N04 A;  4TV8 B;  2ZNI A;  1TUB A;  1YF2 A;  3AG2 B;  3IC7 A;  4OGQ B;  3MD0 A;  2UUC B;  2VQF B;  2X0L A;  2ZNJ A;  1CXZ B;  4CS4 A;  3CC2 V;  2F43 G;  3HKB B;  3K57 A;  3N2K B;  4O4J B;  1PL0 A;  5JJE B;  4LF7 O;  4MTO A;  4J10 A;  2UXB B;  1AI4 A;  2Q0O C;  3Q4H B;  3HKB A;  3N2K A;  4X62 B;  4O4J A;  2QM8 A;  5CBH A;  4EEQ A;  1DF4 A;  1XEQ A;  2NN4 A;  1LR1 A;  2PF4 E;  4JV5 O;  4N23 A;  3T2M A;  2BCC H;  2RJZ A;  5FLX N;  2K9P A;  3RYH B;  1XL6 A;  4DV2 B;  3MHH C;  5IYZ B;  4UVA A;  2LW7 A;  2CH7 B;  2YXL A;  1B06 A;  4JI7 B;  2IH1 C;  4J42 A;  5LMN B;  3RYH A;  1VQ4 V;  1QLE B;  1Q7Y W;  2ZQM A;  3OFN G;  5GW7 A;  4JI6 O;  1PD3 A;  1YZB A;  2AHZ A;  2A7W A;  4DV6 O;  4FLU A;  1ORQ C;  2FYU H;  1VAR A;  2P06 A;  1MNG A;  1M1K W;  3E35 A;  2JGU A;  4BAY A;  1FYJ A;  1TVK A;  2CDY A;  1YCI A;  4DV1 B;  4RUE A;  4DK1 A;  1Y76 A;  1RSO A;  1JCH A;  2A79 B;  1N34 O;  3CCE V;  2CTR A;  1F4N A;  3AG4 C;  2Q5Z A;  4X20 B;  3CC7 V;  5LP6 B;  5LHH A;  4Z2W A;  3SR2 C;  3ASO B;  1EZV H;  2JEU A;  3QTC A;  2UUA O;  2FB5 A;  2OCC C;  4X20 A;  1NJI W;  3FB8 C;  5LP6 A;  3G71 V;  4X65 O;  1E79 G;  1L0N H;  3CRC A;  1MMM A;  3G67 A;  4WFA V;  5CBG A;  2ZE8 A;  3D36 C;  1W2B U;  3T4Z A;  1XHX A;  4NB5 A;  2M6Y A;  2UUC O;  2VQF O;  4FZ1 A;  3ZRW A;  1XIL A;  4J9Z B;  4YIP A;  2P4K A;  3JD1 A;  3ZMU A;  1IXM A;  1FXK A;  3ETD A;  4R8C A;  1AJQ A;  3APO A;  1TUE B;  1N32 B;  5J2T B;  2ITD C;  1D5A A;  4X62 O;  3RW0 A;  4F6E A;  4U7N A;  2CE4 A;  3O65 A;  2CTW A;  1VF6 A;  1SA0 B;  2FML A;  1KEC A;  4GLX A;  3ZBH A;  3CX5 F;  5J2T A;  1T5E A;  1IX9 A;  3CCR V;  1SET A;  1YDX A;  2YIB D;  4OX9 B;  3VQY A;  5IY5 B;  4GT1 A;  5A2Q N;  1SA0 A;  3IGA C;  3LSS A;  3IJ4 A;  1Q81 W;  5EC1 C;  4TT3 G;  4BW9 A;  4DV2 O;  2QWN B;  2NNU A;  3BAB A;  4UB8 Z;  4MVM A;  3B09 A;  1ZL8 B;  3F5W C;  4KL1 A;  5CA1 A;  4JI7 O;  5LMN O;  4X88 A;  4MS2 A;  5CB4 B;  1RM1 C;  3DC5 A;  4JI0 B;  4GX0 A;  1ZL8 A;  2JGD B;  4LF5 B;  3UT5 B;  3F5T A;  1G1X B;  3ZCC A;  4X9Q A;  4PV1 B;  4GKJ B;  1QBZ A;  4JI4 B;  1K9M W;  1V55 B;  3D3I A;  2JGD A;  3UT5 A;  3CRM A;  2RCV A;  3C3S A;  3NXS A;  4DV1 O;  4W4L A;  4PD4 F;  3TK1 A;  5KLV H;  1QR8 A;  4X89 A;  5FPR A;  2IM9 A;  1QVF U;  2JIZ G;  2LGW A;  1HNX B;  5KX5 B;  1IBM B;  4JF3 A;  4D7T A;  1ZX3 A;  4LF8 B;  1YTF D;  1BGY H;  2VRZ A;  3ZMS A;  3B8N A;  3G80 A;  4UFZ A;  4DXW A;  1PNM A;  1MOF A;  2AHY A;  3SJC C;  1F51 A;  5IE9 A;  1Q5O A;  3PN1 A;  3FB5 C;  4U3F H;  4ZKI A;  2A3Q A;  3ZIA G;  5FNV B;  3AG2 C;  5LL6 Y;  2EX3 A;  3QG5 A;  4I9W A;  3K04 A;  3WU2 Z;  2BE3 A;  1M9N A;  5B1B B;  5FNV A;  1VQP V;  4DV0 B;  3T1H B;  5CMU A;  2QKS A;  1OHH G;  1YJ9 V;  1M93 A;  5DEC A;  2GSM B;  4LF4 B;  4CS3 A;  1YXB A;  1MSD A;  1QQC A;  3ABL B;  2V7Q G;  1H2G A;  1N32 O;  3QF7 A;  4I50 A;  1FFT B;  2BTQ B;  3RYF A;  3MAQ A;  4X66 B;  3CCQ V;  4G2K A;  4LH6 A;  2EIJ B;  5HFL A;  5H2F Z;  3ZHQ A;  2PYL A;  5BR8 B;  3GVM A;  4OX9 O;  1MSW D;  2BTQ A;  4B08 A;  1GAX A;  3ZMZ A;  3CCJ V;  3K03 A;  1M57 B;  2OCH A;  3O9O A;  1NU1 H;  3OUS A;  2B1G A;  2ADP A;  2JVD A;  3K79 A;  1I94 B;  5IDJ A;  1Z5V A;  2Y48 A;  1QLE C;  2O57 A;  2OTJ V;  1N0J A;  4FZ0 A;  3K5L A;  1GMG A;  3B4S A;  5JWP A;  1QLN A;  4JI0 O;  3FFQ A;  2R9A A;  4LF5 O;  2ZXW B;  4JAS A;  1WP7 A;  1K92 A;  4FLY A;  5FPO A;  2KKW A;  5LGN A;  4GKJ O;  2BSK B;  4JI4 O;  4NYK A;  1AR4 A;  3OMA B;  1XHZ A;  4EB6 A;  4JAV A;  1S3J A;  4RQF A;  3N2G A;  2Q67 A;  2XAH A;  4ZOL B;  3AG3 C;  1HNX O;  3DXR B;  3SJA C;  5LXT B;  5LP6 C;  3S3X A;  3BRC A;  4FK5 C;  4H13 B;  1TAE A;  1VQ9 V;  4LF8 O;  3STL C;  4PA6 A;  2OYQ A;  4BR6 A;  1R1B A;  4ZOL A;  1A32 A;  3BFR A;  3DXR A;  5KHJ A;  3U10 A;  2PGG A;  5BXZ A;  4LFB B;  4R6Z A;  5JVD A;  4WFE A;  2L35 A;  2HKO A;  2DMX A;  4NKG B;  1GM9 A;  1VQO V;  5C8Y B;  1PKX A;  3JAT B;  1YEW A;  2ETN A;  2EIK B;  3ABU A;  4U7O A;  4TQD A;  1B04 A;  4DV0 O;  3W7S A;  3T1H O;  3S3W A;  3OGC C;  2EIL B;  1HDJ A;  1VF6 C;  1EFR G;  2LP7 A;  2Y4U A;  3EVK A;  3HB3 B;  1BQZ A;  2DOS A;  3UM7 A;  4LF4 O;  4AQY O;  4AHC A;  2P90 A;  1GN6 A;  2BOB C;  3X2Q C;  2AZ0 A;  1WJZ A;  1NVP B;  3RWR D;  2E76 B;  4UXN A;  2EIN C;  2E5L B;  3WFV A;  1S5J A;  4X66 O;  4BIZ A;  5IY5 C;  4JAU A;  4DK0 A;  5BR8 O;  4ZBM A;  4MT8 A;  1N33 B;  1JR9 A;  2KG7 B;  4G27 B;  4L8J A;  5CBF A;  1OCR C;  2UXX A;  5CA0 B;  1CPY A;  3TGU H;  2DWE C;  2KG7 A;  4ZI7 B;  1F4M A;  1MZE A;  5L3C A;  1X59 A;  5JH7 A;  1S77 D;  1FFX B;  4F6R A;  1VQ7 V;  3C3T A;  4I55 A;  1R6T A;  3CP1 A;  1V55 C;  5B3S B;  4I9Q A;  2WLH A;  2OCC B;  1EM1 A;  5EZY B;  3KCY A;  2LGQ A;  4JYA B;  1FFX A;  1GKF A;  1YVW A;  4EKW A;  1MZF A;  1DF5 A;  4CH3 A;  4DUY B;  4UVC A;  2IU3 A;  3ZRV A;  2Y0I A;  3ZRX A;  2E75 B;  3RVZ A;  3ZN0 A;  4QGP A;  4MVR A;  3FB7 C;  1ARO P;  2Y69 B;  3D36 A;  4PJ0 Z;  1P7G A;  4BWA A;  5LBQ A;  3VQX A;  5IYD O;  4QPJ A;  3JD2 A;  1D2D A;  2FL4 A;  4O2B B;  4LFB O;  4JI2 B;  2YDE A;  2JS5 A;  1K8A W;  3JAK A;  1KKD A;  4HBN A;  2VS0 A;  2EZP A;  1Q82 W;  3CME V;  5EBM C;  5B1B C;  1KMI Z;  4DV3 B;  3TET A;  1SQX H;  2Q7E A;  5KMG B;  3L72 H;  4JI8 O;  2Q69 A;  2C2A A;  3AK2 A;  1J5E B;  1E1Q G;  1MAB G;  2IBZ H;  5JJJ B;  3W7W A;  1THZ A;  4K0K O;  1UPG A;  3ABL C;  4YY3 B;  2F1M A;  3ABT A;  1XNR B;  2EJR A;  2XOK G;  4FFK A;  1W0K G;  3K3W A;  2E5L O;  2EIJ C;  1VQM V;  4LF9 B;  4ZIB A;  3HKE A;  1GTO A;  4HNA B;  1WN7 A;  3IC9 A;  4MVU A;  2A0L A;  2EBO A;  2HJD A;  2E3C A;  2VQE B;  1M57 C;  4HNA A;  2QJ1 A;  4QJF B;  5BMV B;  2B1I A;  2CTP A;  5IT9 N;  5IJ9 A;  2ZIN A;  1PM9 A;  4DO2 A;  3JAM N;  5E79 Z;  2XT9 A;  2ARH A;  3VQW A;  4YJ3 A;  1GK9 A;  1QNM A;  1M5I A;  2QSA A;  3K9A A;  4RUF A;  2F4V B;  1FXV A;  1K34 A;  2Q73 A;  4DYL A;  2LW1 A;  3D3Q A;  2EUL A;  2WPD G;  3APQ A;  3OR7 C;  3FAV B;  4JYA O;  2P22 C;  2W0F C;  4PI0 A;  2RNB A;  2P67 A;  4H0L B;  4DUY O;  3JAL B;  4GUN A;  3CSX A;  4TV9 B;  3W7X A;  1WPX A;  3SPC A;  2ZIO A;  3HR0 A;  2AXT Z;  5ITZ B;  4TV8 A;  5L3G A;  3KZI Z;  1EN5 A;  1BQ0 A;  4PI2 A;  4TV9 A;  3MDS A;  4TUY B;  2IJI A;  2H8P C;  5H5N A;  4WCE V;  1ROP A;  5ITZ A;  4LWS B;  4QPK A;  3H1I H;  2Z5U A;  2MW2 B;  4JI5 B;  3KKY A;  1WAZ A;  5JCO C;  3R66 A;  4TUY A;  4CZZ A;  4I0X B;  4JI2 O;  1J95 A;  4DR6 B;  2YIB A;  1NH2 D;  3Q4H A;  3GWO A;  1SF9 A;  2EIK C;  1BS3 A;  2IJJ A;  5AG2 A;  2R70 A;  1VF5 B;  4NXM B;  4DR2 O;  1OCC B;  1J5E O;  2EIL C;  2K1E A;  3AK1 A;  4IHJ B;  2Q8V A;  4J11 A;  3H9V A;  1UJW B;  1AI5 A;  2WSS G;  4XDK A;  1BZK A;  4IYI A;  4YY3 O;  2YXH A;  2F23 A;  3IAY A;  4IHJ A;  1JJO A;  1XNR O;  4YIO A;  1NTM H;  1IUR A;  3FX7 A;  5IYZ A;  3ABK B;  4X1K B;  4WFH A;  1YSC A;  1VMG A;  2CH7 A;  4Z1M G;  1UFI A;  2R9I A;  1GM8 A;  1VQ6 V;  4FLT A;  1OV9 A;  4MVS A;  3ZX6 A;  5IJ0 B;  3BA9 A;  1R6N A;  5KHK A;  4X1K A;  2VQE O;  1HR0 B;  2F93 B;  1KQS U;  1YTF B;  1YIJ V;  5IJ0 A;  4J7K A;  2ODM A;  3EFF K;  3CCS V;  4GX1 A;  2RDC A;  2MK3 A;  3ML0 A;  3I5D A;  2UUB B;  2OIE A;  4K8X A;  1SC5 B;  3AG3 B;  1YJW V;  4MW8 A;  2F4V O;  3CB2 A;  5B3S C;  3JD4 A;  1D5N A;  2YIA A;  3ZHT A;  1WB7 A;  1RPO A;  3MHS C;  4CH4 A;  4FIP C;  2YI8 A;  5GON B;  4IT5 A;  1S76 D;  4WFF A;  1K73 W;  1JFF B;  2JS3 A;  4Z1V A;  1PNL A;  2Y69 C;  1O9G A;  2GTS A;  2OTL V;  5GON A;  1G6U A;  5KUM A;  2WLL B;  2UXB O;  1JOY A;  4JI5 O;  4UV8 A;  3SPJ A;  1I08 A;  2WLM A;  4E4E A;  1IZ3 A;  2CGN A;  4TOI A;  1U96 A;  4NTW A;  2WLL A;  4DR6 O;  3X2Q B;  4H37 A;  2GBO A;  4DV7 B;  1W0J G;  1WB8 A;  2EIN B;  2LO1 A;  3J81 N;  3C90 A;  1R3L C;  4PA4 A;  3I56 V;  4QNH B;  3OTF A;  2W6J G;  3OGI B;  4Q20 A;  4NXM O;  3WB1 A;  3DSQ A;  3SYA A;  1SQG A;  4FMT A;  1OCR B;  5TIS Z;  2CK3 G;  1SZX A;  2BTO A;  3SYC A;  4H33 A;  3NR7 A;  4JZ2 A;  2OWO A;  5J2U B;  4FLW A;  1ENV A;  1IVS A;  3ZN1 A;  2HLD G;  4FLZ A;  5J2U A;  3M99 B;  3B77 A;  4R50 A;  2LQT A;  1FJG B;  5CB4 A;  2DWD C;  1HR0 O;  4DW1 A;  1DK1 A;  4P2Z A;  4GX5 A;  2CTQ A;  1XL4 A;  3P3P A;  3SJB C;  4FM1 A;  4YHH B;  1XBL A;  3HKC B;  3ZHV A;  2UUB O;  2YI9 A;  2UXD B;  2QA4 V;  1HNZ B;  2R72 A;  4AI8 A;  1FD9 A;  2JRI A;  3AEI A;  5KX5 A;  1IBL B;  5GTI Z;  3WG7 B;  4NTY A;  5K1X A;  4UB6 Z;  1VEW A;  2KSD A;  3GB7 C;  4FLV A;  3PJS K;  4B3R B;  1NZ6 A;  3JCU Z;  5LA6 B;  2AW9 A;  2WLK A;  4LFA B;  1EN4 A;  1NTZ H;  4DR4 B;  1H8E G;  1M56 B;  2QKC A;  5J9P C;  5LA6 A;  2LJ2 A;  5D5P A;  5LGU A;  2IW5 A;  1JMK C;  2IU0 A;  3BAA A;  1L0L H;  3OW2 U;  1PPJ H;  5HFM A;  1XMQ B;  1XMO B;  4Q6G A;  1Y4M A;  1SRY A;  3AG7 A;  4FFB B;  1JJ2 U;  4DV7 O;  1H8H G;  4NTX A;  1YHQ V;  2QE7 G;  1RP3 B;  1OCC C;  3ASN B;  4E2L A;  3RVY A;  1XNQ B;  4JTD B;  2BOC C;  4F4L A;  2N74 A;  2PUS A;  4XDL A;  3L70 H;  3LDC A;  1BL8 A;  3CXC U;  2F66 C;  2RMK B;  3OEE G;  3CMA V;  3B40 A;  2YUA A;  3ABK C;  4A5U B;  4K3A A;  4RQE A;  2IH3 C;  4FPP A;  3ZHU A;  5EC2 C;  3TXS A;  4PA7 A;  3L9D A;  1FJG O;  4K8Z A;  3CRR A;  2HHH B;  3TCU A;  2YS8 A;  4BW5 A;  2FTK A;  3A2F A;  1W59 A;  2R9R B;  1GN4 A;  2QR4 A;  2BSK A;  2Q7G A;  5KA6 A;  4KHP B;  1Y66 A;  3WB2 A;  2IJK A;  1G8M A;  3B2E E;  3RT3 C;  1AP6 A;  2XAQ A;  4MVZ A;  4X8A A;  2QKA A;  4YHH O;  1NBM G;  3SYQ A;  1IBM O;  4IGG A;  1Y74 B;  5A9G A;  4I4T B;  2UXD O;  4D6T H;  1HNZ O;  3LSQ A;  4I5S A;  1XOU A;  2HR3 A;  3OUF A;  1IBL O;  5LXT A;  1Y74 A;  2X6B A;  1KUQ A;  4I4T A;  3JAS B;  1RPR A;  1VQ8 V;  1QCE A;  1XRE A;  4B3R O;  4IYH A;  4UUJ C;  2HJF C;  4MTF A;  2XAJ A;  5JCO A;  4DRX B;  4LFA O;  2QWP B;  2H3O A;  4GYC B;  5C8Y A;  3K5N A;  2YIC A;  1EZJ A;  3JAT A;  3FKS G;  4DRX A;  4CBC A;  1JX9 A;  1COW G;  4PDM A;  3JYC A;  4UCO A;  5BY1 A;  5LHG A;  4I7Z B;  3ABM B;  1XDC A;  1AR1 B;  1XMO O;  1XMQ O;  5B1A C;  5L3E A;  4C7U A;  1P4R A;  4KXR A;  2PYJ A;  2M7W A;  1KB9 F;  2X6A A;  2XAG A;  1VQ5 V;  3P30 A;  4MTX A;  4CC5 A;  2D2C B;  3K0G A;  4U3J B;  3K0D A;  3G6E V;  1IDS A;  1XNQ O;  3TJT A;  1IXB A;  5L3B A;  2YXY A;  5DN6 G;  1N0N A;  3UCS C;  5KAI Z;  5EIB D;  2ZD9 A;  2GV9 A;  3E8H A;  3SYP A;  3E89 A;  1YJN V;  1I94 O;  2CUG A;  1L8D A;  1ZTE A;  5KHH A;  5CA0 A;  1K5S A;  3H1K H;  4ZI7 A;  1NS1 A;  1EN6 A;  4DV5 B;  1GM7 A;  1KD1 W;  2HHH O;  4GZR B;  3E22 B;  1QU7 A;  4PDR A;  3CRA A;  3ZED A;  2FKX A;  2DQ0 A;  5EZY A;  4RO2 A;  2DN9 A;  4KHP O;  3E22 A;  4J7J A;  2G38 A;  3ZJZ A;  3L73 H;  1FKA O;  4DR1 B;  4LF6 B;  2AZ2 A;  2LFR A;  3A8T A;  3WG7 C;  1PNK A;  1B3Q A;  5EK0 A;  3HPL C;  4B3M B;  4WF9 V;  4N21 A;  3CC4 V;  3QO7 A;  2E74 B;  3LDE A;  4DV4 B;  2Y0P A;  2B5U A;  4O2B A;  1XQ8 A;  1QR9 A;  1M56 C;  3FYI B;  3E83 A;  2Q6A A;  4P9P A;  1AJP A;  1BHB A;  1R3I C;  3EXA A;  4DW0 A;  5LHI A;  4O4H B;  1AR5 A;  5KMG A;  4IIJ B;  2OIG A;  3RYC B;  2V1D A;  3H1H H;  3BCC H;  3RYI B;  1R73 A;  4O4H A;  2P5O A;  3K08 A;  4IIJ A;  3RYC A;  4NVP A;  5B1N A;  3UKM A;  4HZ3 A;  3RYI A;  3ASN C;  3OM3 B;  2CAZ C;  4ZHQ B;  1XI1 A;  1N33 O;  3CXH F;  3L75 H;  3K5O A;  4XDJ A;  3T1Y B;  1NR7 A;  4ZHQ A;  4DV6 B;  5E1A C;  1WLE A;  5BMV A;  3ZHR A;  3QNE A;  4H44 B;  4CC6 A;  1KU9 A;  5LYJ B;  5IYC O;  3E86 A;  4RAI A;  2ZR2 A;  4ASU G;  4MTG A;  1H2M A;  2QDO A;  1LUV A;  2WLN A;  2DJV A;  3DC6 A;  2ITC C;  2IJH A;  5LYJ A;  3RN4 A;  2YSU B;  2VWK A;  1N8R W;  4G28 B;  2QEX V;  1FS0 G;  1SES A;  4L87 A;  3FAV A;  4MVQ A;  1AB3 A;  2Q4P A;  4PA9 A;  1YIT V;  4B7E A;  4LCU C;  1I0H A;  1TUB B;  2GTA A;  3JAL A;  3I55 V;  4B7K A;  2ZKO A;  4FVM A;  4X65 B;  2PI5 A;  1K97 A;  3CD6 V;  1WPB A;  2KQX A;  2XAF A;  4LFC B;  4B3M O;  5FL7 G;  2PTM A;  3OAA G;  3CJH B;  1SQF A;  3JCZ A;  4LWS A;  4DV4 O;  2ILM A;  3T1C A;  4WFB V;  2Q0A A;  4P30 A;  1CEZ A;  4TQF A;  2HVK C;  1BT8 A;  1I7F A;  4I0X A;  1ZLZ A;  4DV3 O;  3CJH A;  3CCM V;  4GKK B;  2QWR B;  4LNU B;  2P4V A;  1V54 C;  5B66 Z;  3QO5 A;  1O9H A;  1E1R G;  4HAM A;  3UO2 A;  3G6B A;  3ABM C;  4LNU A;  4X1Y B;  3SDL A;  1P84 F;  5F2V O;  3W7T A;  1K4C C;  3CCL V;  3H1J H;  1ZWI C;  1K7D A;  4LF9 O;  4X1Y A;  1DLB A;  1R3J C;  3VQV A;  3WB0 A;  1FPO A;  2UXC B;  3T1Y O;  3VBB A;  1Q6H A;  3N27 A;  2QGN A;  1ZSP A;  1US6 A;  4JI1 B;  2YID A;  1TVK B; 
#chains in the Genus database with same CATH homology
 1GO3 F;  2EIK B;  3ABU A;  3WG7 B;  4U7O A;  5KA5 A;  3H01 A;  1AI7 A;  3GB7 C;  3W7S A;  3OMN B;  3AG1 C;  3PJS K;  3OGC C;  1RM1 B;  2EIL B;  3F7V C;  3HB3 B;  1EFR G;  2LP7 A;  5LGT A;  1M90 W;  2ZDI C;  3JD0 A;  1I5X A;  2WLK A;  3UM7 A;  3LDD A;  1KP2 A;  2P90 A;  1S0V A;  1H8E G;  1M56 B;  4JGS A;  2DYS B;  2BOB C;  4GCZ A;  5J9P C;  3X2Q C;  4KP4 A;  1NVP B;  4UXN A;  2EIN C;  3WFV A;  5LGU A;  1NVP D;  2IW5 A;  2JEX A;  4MVO A;  3CCU V;  2H94 A;  2JJ1 G;  2IU0 A;  1VQL V;  4BIZ A;  5IY5 C;  4JAU A;  1F23 A;  2A9H A;  3OW2 U;  1R3K C;  4ZBM A;  1BHA A;  2Z3Y A;  5HFM A;  3RBZ A;  4MT8 A;  2ATK C;  5CBF A;  4TWK A;  4G27 B;  2EIM B;  1Y4M A;  1SRY A;  2XAS A;  1OCR C;  2UXX A;  1JJ2 U;  3ZRW B;  1BMF G;  2ZXW C;  1H8H G;  1OCO B;  1YHQ V;  2UXN A;  1CPY A;  2QE7 G;  3ETG A;  4JYC A;  2DWE C;  1F4M A;  2PI4 A;  1OCC C;  3ASN B;  3CCV V;  3OMI B;  4PDV A;  4E2L A;  1FXK B;  3RVY A;  4JTD B;  5B1A B;  5L3C A;  5BZB A;  2BOC C;  3SPI A;  3F7Y C;  5L3F A;  3E8G A;  4F4L A;  1S77 D;  3IFX A;  1VQ7 V;  4GX2 A;  1CP9 A;  4XDL A;  1K33 A;  4HYO A;  3AG2 B;  1OCZ C;  3LDC A;  1BL8 A;  3IC7 A;  3CXC U;  3MD0 A;  3CP1 A;  1V55 C;  5B3S B;  2X0L A;  2JJ2 G;  3OEE G;  3CMA V;  2WLH A;  2OCC B;  3ABK C;  3CC2 V;  1GKF A;  2F43 G;  4RQE A;  1VQN V;  2IH3 C;  4FPP A;  4EKW A;  1PL0 A;  5EC2 C;  1DF5 A;  4MTO A;  4PA7 A;  2LFS A;  4UVC A;  2IU3 A;  3ZRV A;  1AI4 A;  3ZRX A;  3TCU A;  4R7C A;  3RVZ A;  2OT5 A;  3ZN0 A;  2QM8 A;  4MVR A;  3FB7 C;  4BW5 A;  5CBH A;  1K5Q A;  1ARO P;  2FTK A;  2Y69 B;  3D36 A;  3FYE B;  5L3D A;  1DF4 A;  2R9R B;  4XBF A;  1AI6 A;  4JYB A;  5KA6 A;  5LBQ A;  1Y66 A;  2IJK A;  1G8M A;  4QPJ A;  3JD2 A;  5IYD O;  4N23 A;  2XAQ A;  4MVZ A;  4X8A A;  3JD3 A;  3T2M A;  1NBM G;  4KFM A;  3SYQ A;  1K8A W;  1KKD A;  2EZP A;  1QVG U;  1Q82 W;  3LSQ A;  4I5S A;  1XL6 A;  3MHH C;  2HR3 A;  3OUF A;  3CME V;  1EBO A;  4UVA A;  5EBM C;  5B1B C;  3TET A;  3ZMV A;  2X6B A;  2IH1 C;  1RPR A;  1VQ4 V;  4YXW G;  1VQ8 V;  2Q69 A;  1HWY A;  2C2A A;  1QLE B;  1E1Q G;  1Q7Y W;  2WLI B;  1MAB G;  1QCE A;  2ZQM A;  3BEH A;  3OFN G;  1OZ0 A;  5GW7 A;  3W7W A;  1PD3 A;  1THZ A;  4UUJ C;  2HJF C;  2AHZ A;  4MTF A;  2HVJ C;  2XAJ A;  3ABL C;  4JTC B;  1DTO A;  1ORQ C;  4QIW F;  3FB6 C;  3ABT A;  2WLI A;  4MW3 A;  3E35 A;  1L1F A;  1M1K W;  4BAY A;  2EJR A;  2XOK G;  1EZJ A;  1W0K G;  3K3W A;  3G4S V;  3FKS G;  2EIJ C;  1OCO C;  1JX9 A;  4CBC A;  1VQM V;  1COW G;  4PDM A;  4RUE A;  1JQ0 A;  1GTO A;  2WWW A;  2XND G;  3JYC A;  4MVU A;  1JCH A;  2A79 B;  5LHG A;  2A0L A;  3CCE V;  2EBO A;  3ABM B;  4P9O A;  1I5Y A;  1JPX A;  4UV9 A;  1F4N A;  1AR1 B;  5B1A C;  5L3E A;  1M57 C;  3AG4 C;  1P4R A;  2WAM A;  2ZR3 A;  2QM7 A;  4QJF B;  2M7W A;  2X6A A;  2XAG A;  3CC7 V;  1VQ5 V;  5LHH A;  2B1I A;  3P30 A;  4FJC C;  3ASO B;  2JEU A;  4MTX A;  3LNM B;  4DO2 A;  3K0G A;  1AJN A;  3K0D A;  2OCC C;  1KC8 W;  1NJI W;  3FB8 C;  3G6E V;  3R65 A;  3G71 V;  1SER A;  1GK9 A;  3DGE A;  1E79 G;  5L3B A;  3K9A A;  4RUF A;  1FXV A;  1K34 A;  4WFA V;  4LC1 A;  5DN6 G;  3T4D A;  5CBG A;  3STZ C;  1R6K A;  2ZD9 A;  3E8H A;  1W2B U;  2WPD G;  3T4Z A;  3SYP A;  3E89 A;  4KUM A;  3OR7 C;  1YJN V;  2DYR B;  3ZRW A;  2GHY A;  4WFG A;  4J9Z B;  1K5S A;  2W0F C;  3JD1 A;  3AG1 B;  3ZMU A;  1IXM A;  2P67 A;  1FXK A;  2YEV B;  2D3O W;  3W7X A;  3ETD A;  1WPX A;  4R8C A;  3SPC A;  1AJQ A;  1GM7 A;  1KD1 W;  1TUE B;  2HG5 C;  2ITD C;  4QE7 A;  5L3G A;  4PDR A;  3RW0 A;  3LUT B;  4U7N A;  3SYO A;  2YEV A;  2HFE C;  2IJI A;  2H8P C;  1KP3 A;  1KEC A;  2DQ0 A;  1ROP A;  4WCE V;  4RO2 A;  4QPK A;  3CCR V;  2Z5U A;  1P7B A;  1SET A;  3QO8 A;  3SPH A;  3ZJZ A;  5IY5 B;  4GT1 A;  3E8F A;  4CZZ A;  1J95 A;  3IGA C;  3LSS A;  1Q86 W;  1NH2 D;  1Q81 W;  5EC1 C;  4TT3 G;  2LFR A;  3GWO A;  1VQK V;  2EIK C;  4PEL A;  2NNU A;  3WG7 C;  2IJJ A;  4MVM A;  1PNK A;  2EZO A;  5EK0 A;  3F5W C;  3HPL C;  4WF9 V;  4N21 A;  3CC4 V;  3QO7 A;  1S5H C;  5B1O A;  4X88 A;  3OR6 C;  4MS2 A;  1RM1 C;  1OCC B;  2EIL C;  3LDE A;  2K1E A;  1UJW B;  4UVB A;  2B5U A;  1AI5 A;  4GX0 A;  2WSS G;  1QR9 A;  5IYB O;  4XDK A;  2X6C A;  1M56 C;  2DYS C;  3ZCC A;  3FYI B;  1QBZ A;  3E83 A;  1K9M W;  5CA3 A;  1V55 B;  3D3I A;  2Q6A A;  4P9P A;  1AJP A;  1BHB A;  1R3I C;  3SJQ C;  4TSF G;  1H38 A;  3ABK B;  5LHI A;  4WFH A;  1YSC A;  3ASO C;  4Z1M G;  3NXS A;  2R9I A;  3CYO A;  3P32 A;  1GM8 A;  3TK1 A;  1VQ6 V;  4MVS A;  2V1D A;  1QR8 A;  4X89 A;  1R6N A;  5H9C A;  1QVF U;  2EIM C;  2JIZ G;  1R73 A;  1KQS U;  4JF3 A;  1YTF B;  1V54 B;  1B6Q A;  4LBE C;  3K08 A;  5B1N A;  4J9Y B;  5EBL C;  1YIJ V;  1YTF D;  3UKM A;  4HZ3 A;  3ZMS A;  3B8N A;  3EFF K;  4DXW A;  3CCS V;  1PNM A;  3ASN C;  3KG2 A;  1MOF A;  3OM3 B;  2AHY A;  4GX1 A;  4JTA B;  1F51 A;  4PA3 A;  1FXK C;  3ZMT A;  2MK3 A;  3FB5 C;  3ML0 A;  2DW4 A;  3AG3 B;  1YJW V;  4XDJ A;  4ZKI A;  4MW8 A;  3ZIA G;  3AG2 C;  1NR7 A;  4I9W A;  1LNQ A;  4MSW C;  5B3S C;  3JD4 A;  3K04 A;  5E1A C;  1WLE A;  5H6R A;  1M9N A;  1S72 V;  5B1B B;  3QNE A;  5IYC O;  1VQP V;  1RPO A;  1G4Y B;  3E86 A;  4RAI A;  2JK5 C;  3MHS C;  2ZR2 A;  4JPR A;  4ASU G;  4MTG A;  3EHB B;  4FIP C;  5CMU A;  2WLN A;  2QKS A;  1OHH G;  2ITC C;  2IJH A;  1YJ9 V;  2GSM B;  2YSU B;  4OXS A;  1S76 D;  4WFF A;  5H6Q A;  2QTO A;  3ABL B;  1K73 W;  2V7Q G;  1N8R W;  1H2G A;  1PNL A;  2Y69 C;  2Q68 A;  4G28 B;  2QEX V;  2OTL V;  1FS0 G;  1SES A;  4L87 A;  1FFT B;  3CPW U;  2JDI G;  2WLJ A;  2P7T C;  5KUM A;  3E2E A;  1JVM A;  3CCQ V;  4G2K A;  2WLL B;  2EIJ B;  5HFL A;  4PDL A;  4MVQ A;  5DM6 V;  1JOY A;  3W7U A;  4PA9 A;  1YIT V;  4UV8 A;  3SPJ A;  1MSW D;  5C93 A;  2WLM A;  4LCU C;  3ZMZ A;  3CCJ V;  2WLL A;  3K03 A;  3B8M A;  3X2Q B;  3I55 V;  1M57 B;  3AG4 B;  4H37 A;  1W0J G;  2ZDI A;  2EIN B;  2NLJ C;  3OUS A;  2PI5 A;  1NR1 A;  2B1G A;  1K97 A;  3CD6 V;  5EBW C;  2XAF A;  3K79 A;  5IDJ A;  2X7R B;  1R3L C;  2Y48 A;  4PA4 A;  1QLE C;  4QNH B;  3I56 V;  1NH2 B;  2OTJ V;  5FL7 G;  2W6J G;  3OAA G;  1GMG A;  3BY6 A;  3ETE A;  4LP8 A;  4Q20 A;  1NKD A;  3JCZ A;  3ZRS A;  3OEH G;  3SYA A;  1QLN A;  4FMT A;  1OCR B;  3T1C A;  4WFB V;  1YI2 V;  4P30 A;  1CEZ A;  3K06 A;  2HVK C;  2CK3 G;  1MG1 A;  2ZXW B;  5CN0 A;  3SYC A;  4H33 A;  4JAS A;  3DTU B;  1FXH A;  3A0R A;  3CCM V;  1K92 A;  5LGN A;  1ENV A;  1V54 C;  3ZN1 A;  3OMA B;  2HLD G;  3OE7 G;  3QO5 A;  1E1R G;  4JAV A;  4HAM A;  1S3J A;  3M99 B;  3B77 A;  4QE9 A;  4R50 A;  3ABM C;  4RQF A;  1OCZ B;  2DWD C;  2Q67 A;  2XAH A;  3W7T A;  1K4C C;  2W6I G;  3CCL V;  3AG3 C;  1ZWI C;  1K7D A;  4P2Z A;  4FK5 C;  4GX5 A;  2KB1 A;  1VQ9 V;  5KUK A;  3STL C;  4PA6 A;  4BIU A;  1XL4 A;  3E8B A;  1DLB A;  1K4D C;  2DQ3 A;  1R3J C;  2P6J A;  1SZT A;  3VOU A;  4R6Z A;  3SPG A;  4WFE A;  3VBB A;  1K3E A;  1NQT A;  2HKO A;  2QA4 V;  1GM9 A;  1VQO V;  2DYR C;  1PKX A;  3AEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...