3T4ZA

Crystal structure of nak2k channel y55w mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALWFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein interactions central to stabilizing the K+ channel selectivity filter in a four-sited configuration for selective K+ permeation.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
molecule keywords Potassium channel protein
total genus 35
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3t4zA00
1OCZC 4PDRA 4RUEA 2WLIB 3E8HA 1OCRC 4QNHB 2EIMC 3T4ZA 4QE9A 3SPJA 4MTOA 3SJQC 3E8GA 3FB8C 3ZJZA 5J9PC 2AHZA 2IH3C 4MS2A 3IFXA 4JTDB 2Q67A 4QE7A 4RAIA 1JVMA 1OCOC 3AG4C 2Q68A 4H33A 3RBZA 3VOUA 3RVYA 4WFHA 1BL8A 3UM7A 3X2QC 2ZXWC 4MTGA 4R8CA 4H37A 1M57C 5E1AC 3E89A 3SPGA 4MVUA 2KB1A 5EBMC 3AG3C 2R9RB 2DWDC 3FB7C 2BOCC 3HPLC 4P2ZA 3SYQA 4BW5A 3K0DA 2WLLB 2Q69A 2X6AA 1V54C 1V55C 2HG5C 3ASOC 3E83A 2W0FC 4EKWA 5EBWC 4XDKA 3RVZA 1OCCC 3FB6C 4MSWC 1R3IC 1G4YB 4G28B 1QLEC 1K4DC 2OCCC 2X6CA 3E8BA 4F4LA 1J95A 4P30A 1LNQA 2YEVA 3ABKC 2BOBC 3F7VC 3SPIA 3STZC 2EIKC 4XDJA 3WG7C 3LDEA 3F7YC 1XL4A 3EFFK 4PA3A 4GX5A 4DXWA 3PJSK 3ABLC 3UKMA 5CBHA 3OR6C 2X6BA 3OR7C 4J9ZB 4MVQA 4UUJC 2K1EA 4XDLA 1ORQC 4P9PA 4CBCA 4MW8A 2HVJC 3BEHA 5KUMA 4LP8A 4GX2A 4X8AA 2QTOA 2DYRC 2AHYA 2ITCC 2JK5C 5CBGA 3TCUA 3SYAA 5CBFA 4TWKA 4MVOA 3K03A 4J9YB 3SPCA 2DWEC 5KUKA 3ABMC 5B1BC 5B3SC 3SYCA 3JYCA 4GX1A 4PA9A 4LCUC 4PA6A 4MVZA 4PDVA 5EC1C 4MVSA 5EBLC 2EIJC 3SPHA 4WFGA 4R50A 3RW0A 4HYOA 4LBEC 2P7TC 3AG2C 3ASNC 5EC2C 2NLJC 4MW3A 1KKDA 3AG1C 5BZBA 4MVRA 2HVKC 1R3LC 5EK0A 1M56C 3LDCA 2Q6AA 3T2MA 2H8PC 2WLKA 1S5HC 5IY5C 4GX0A 4I9WA 4PA4A 4OXSA 1R3JC 1K4CC 3F5WC 4X89A 3SYOA 4PDMA 2A0LA 2A9HA 2WLIA 3GB7C 4ZBMA 2ZD9A 3K04A 2A79B 3OGCC 2WLMA 2HJFC 2IH1C 3LDDA 2WLJA 3KG2A 4P9OA 4R7CA 4PA7A 2WLLA 4X88A 2WLNA 4PDLA 4R6ZA 3OUFA 3LNMB 4RO2A 2QKSA 4JTCB 1P7BA 2Y69C 3IGAC 4JTAB 3OUSA 4KFMA 2EILC 2ITDC 2ATKC 1R3KC 2DYSC 4MVMA 3SYPA 3TETA 3T4DA 4RUFA 2HFEC 1ZWIC 3K08A 3R65A 3E86A 5B1AC 2EINC 3E8FA 4MTFA 2WLHA 3LUTB 3T1CA 3FB5C 3K0GA 1XL6A 3K06A 4WFFA 3STLC 3ZRSA 4WFEA 4HZ3A 4G27B
chains in the Genus database with same CATH superfamily
1OCZC 3BCCH 4PDRA 3OEEG 3ZN0A 1VQ6V 2LFSA 4B3RO 2Q4PA 5CA1A 1GRJA 2IH3C 3OEHG 3RN4A 4I55A 1QU7A 5ITZB 3ZMUA 3CCEV 2F4VB 3RT3C 1NU1H 2ZXWC 1VQ7V 2FKXA 1FAFA 2DN9A 4X66O 3RVZA 1N8RW 4GCZA 1EM1A 1OCZB 4OX9O 3AG2B 2LFRA 2WA4A 1J5EO 1OCRB 1YEWA 4B08A 1QR8A 1KP3A 4JI1O 5CA0B 4JZGA 1AJQA 2LP7A 1H2GA 1DF5A 4P9PA 1WB7A 2PF4E 4FJCC 1ZL8B 1Z5VA 5KUMA 1HNZO 2AHYA 1SA0B 4TV9A 2VQFB 3FKSG 1JFFB 2H3OA 1ZAUA 3JD4A 2D2CB 2QKCA 3CCUV 2F23A 4F6RA 3HKCA 4MVRA 1K5QA 2Q6AA 2QE7G 2Y4TA 2UUCO 3QF7A 3ZRWA 2QA4V 2XAJA 1WB8A 1THZA 4GT1A 3NR7A 1M57B 4OX9B 1BQ0A 2EINC 1GN4A 3L71H 4QIWF 4WFFA 5KA5A 4U3FH 4JI1B 5LL6Y 3HKBA 1OCRC 4QNHB 3T4ZA 3G6EV 4RWUA 4NTYA 4X65O 4KL1A 2A7WA 2QWQB 2XAFA 3ZHVA 4LF8B 1TUEB 5IYBO 4FFBB 4MVUA 1JOYA 5DEDA 4TV8B 4WBNB 3ASOC 3D8CA 2AXTZ 2F66C 3APOA 3LSQA 2P90A 2PI5A 1VQOV 3NXSA 3HKBB 1R6TA 4UCOA 3WG7C 1YDXA 2R9IA 5CBHA 1VF7A 4TQFA 3IAYA 4UUJC 1MA1A 1KD1W 4GKJB 3I5DA 5FNVB 4BR6A 2CAZC 2DMXA 1XQ8A 3SYAA 2QWNB 3CX5F 2VQEB 2QWOB 2BSKB 5IE9A 1PNLA 4I7ZB 2B1IA 2EIKB 4O4IA 3RW0A 4DV0B 1M56C 1OCCB 5JQGB 1BCCH 4Z2WA 4L8JA 3P3PA 1QR9A 3TK1A 2AGAA 4FZ1A 1D2DA 3KG2A 1FJGO 1H2NA 3RYHB 3A8TA 1HNWB 1IBKB 3ETDA 3ZS8C 4JTAB 5EIBD 3R66A 1K73W 1VF6A 4HBNA 1ENVA 4FFKA 5IWAO 1VQPV 3FB5C 1XOUA 1XL6A 4UVAA 1W59A 1TVKB 2X0LA 4JAAA 1FXKB 4QGPA 5H5NA 2WLIB 1Y74A 3ZRVA 1N0NA 2ZDIA 5J9PC 1AILA 4YIPA 1N0JA 1VQLV 2JVDA 2Q68A 2RQ6A 1N33B 1Q81W 5LP6C 4YJ2B 2N05A 4FLTA 2ADPA 2GV9A 2G38A 5IJ0A 4GKJO 4ZI7A 3GWOA 5KHHA 3VQXA 4UV8A 1Q8IA 1XUQA 1TAEA 3OD4A 2X6CA 4TUYB 2P06A 1H2MA 4I50B 3OFNG 3M99B 3CCMV 1RM1C 2P4VA 2BTOA 3W7UA 3CS5A 1VP7A 4DV4B 3J7AU 4LR3A 4LP8A 4QJFB 1NR7A 3K58A 1ZTEA 5GONB 1G1XB 4FLWA 5B1BC 2GUZA 2B5UA 2PUSA 2JEXA 3O9OA 4K0KO 4WFGA 4LBEC 2P5OA 4FLZA 1PL4A 3KCYA 5C8YA 1WP8A 2HJFC 4YJ3B 2Y0IA 2Y48A 2YICA 4R6ZA 5IYDO 4LFBO 2LO1A 2DYSC 1DK1A 4RUFA 1ZWIC 2WA3A 1B6QA 3L73H 5L3DA 4FVMA 4E4EA 4MTXA 1Q3EA 4RUEA 2Q0AA 4PI2A 4DW1A 2XASA 4JYAB 2CH7A 1E1RG 1D5NA 1YJ9V 1N32B 3VBBA 1LUVA 1NTMH 2ZR2A 2E76B 4NKGB 3L72H 3N2GA 4X66B 4X1IA 4YHHB 2F1MA 1P84F 3SYQA 5GTHZ 4LWSA 3C90A 2WLLB 1V55C 2KQXA 4XDKA 2YIDA 3BAAA 4GUNA 2UXDB 4G28B 4DW0A 3T1YO 1EZJA 4F4LA 3JAWB 3SDLA 5B66Z 1ZL8A 1LNQA 3CC4V 4DV5O 2DQ0A 2IW5A 3ZX6A 3ABLC 3MDSA 3UT5B 3CCQV 4J9ZB 3ZBHA 4LFCB 3OT7A 3K5OA 4UB6Z 4BAYA 2KG7B 5FL7G 5B3SC 4LWSB 5JCOA 1M93A 4Q20A 3AEIA 3CCSV 1XNRB 4JI3O 2Q7EA 1M4UA 4OPAA 2Z5UA 2HHHO 1SQGA 1P4RA 4FM2A 4X89A 3K04A 2OTJV 1T5EA 5IT9N 1G6UA 3RYIA 4DV3O 1KUQA 1QCEA 3OUSA 1GMGA 1IX9A 2JRIA 3CWBH 4O2AB 4BWAA 4YIOA 3E8FA 4DR5B 2IJHA 3K0GA 1Q86W 2P67A 3JSNA 2A06H 2EIMB 3TGUH 3K3WA 2QJ1A 1RPOA 3IC9A 4LF7B 2EINB 1HDJA 1JA8A 3HKDA 4H33A 2W0XA 2AZ0A 4WFBV 1QVFU 3E2EA 3WU2Z 5BXZA 1JMKC 4DUYB 4NTXA 2DWDC 4FLVA 2ETNA 5JJNB 4EKWA 5CB4B 5IYZB 4DR1B 1M90W 2RNBA 3CCVV 2VS0A 1B04A 2MW2B 5GTIZ 1XBLA 1XEQA 2W6JG 4IIJA 4JI5B 2EILB 4PA3A 1WJZA 1XNRO 3DXRB 1KU9A 1YSCA 2JEUA 3AK1A 5B1AB 1SQBH 2UU9B 1NVPB 4LFAO 4CBCA 2MK3A 3ZHTA 1S72V 2LW1A 3B09A 2PGGA 4AHCA 1AI7A 1KMIZ 1M56B 1WLEA 3JD0A 4ZIBA 3JYCA 1I5XA 4FZ0A 5LHHA 5EC1C 1M9NA 5JH7B 3LSUA 1YTFB 1BSMA 5EC2C 3AG1B 3FD9A 2YDEA 4TQDA 2W6IG 4UVCA 3G6BA 3OMIB 1K4CC 3H01A 3GB7C 3CEIA 3QG5A 1OZ0A 1P7GA 1BHBA 4ICGA 4X1YA 2WLNA 3ETEA 1H2KA 3B77A 3WB2A 2VWJA 2QKSA 4CS3A 3K9SA 1HNZB 1DF4A 1YHQV 2IJKA 2YI8A 2YEVB 4BIUA 4UVBA 4UCSA 4X62O 1PD3A 2OTLV 5TISZ 3CPWU 2YXYA 4JI2B 1XMOO 1VIBA 3G71V 3AK3A 1AR5A 1Y4MA 1QLEB 2Q67A 1JVMA 2UXCO 1BS3A 3MD0A 4UXNA 5KX5A 3D3QA 4LH6A 1PNKA 4MTGA 4H37A 5BR8B 1JJOA 2EZOA 3A2FA 4HNAA 3A0RA 5FLXN 4NYKA 4UCUA 1AI5A 4NVPA 2V4DA 1BE3H 1MZFA 1J95A 1O9GA 3CCRV 3SPIA 1MMMA 3EFFK 4GX5A 3JCUZ 4X62B 3APQA 3JATB 2BCCH 3DGEA 2DYRB 3VQYA 4ABMA 4K8ZA 5KA6A 1NBMG 5LXTA 3U0ZA 4DV6B 2AW9A 3DC6A 1F23A 3BFRA 2ZDIC 5CBFA 4LF5O 3SYCA 4B7KA 5LGNA 1SF9A 1QHTA 2YIAA 4JASA 4DR3B 4E2LA 1KQSU 1SKVA 2JGDB 1FYJA 3QO5A 2ADQB 3J80N 4Z1MG 4X9QA 2Z0AA 3OMNB 5IY5C 4PELA 4I9WA 3K59A 2X7RB 1NVPD 1U96A 2IH1C 5F2VO 3JATA 2JGDA 4RO2A 4JI7B 2DE0X 1K34A 3G67A 2P4KA 2OIGA 2LJ2A 3K08A 5A9GA 2N04A 3CMEV 4NXNB 1JCHA 3K06A 1K8AW 3N2GB 2BTQA 4FMTA 2NN4A 4JYYA 5L3BA 3FX7A 1JPXA 1Q7YW 4DRXB 1BMFG 1ROPA 2PYLA 2Y69B 3FB8C 4K3AA 2IM9A 2AHZA 4DV6O 4B3SO 1CEZA 4DYLA 3AG4C 4H44B 1BL8A 1V9PA 3X2QC 4W4LA 4NXMB 1M5IA 3E89A 4K35A 3P32A 1WN7A 2QM7A 1NS1A 4LFAB 2CTPA 1VQ4V 3DC5A 1GM9A 5IJ9A 2ZKOA 2R9AA 4UCRA 2LW7A 3FB6C 4JYCA 5J2TB 4LF5B 2EX3A 3ASNB 4LF6B 3C3SA 1AR4A 4X1IB 4X64B 3F7YC 1PL0A 3PJSK 1JX9A 2R70A 1HNXO 3W7TA 1FPOA 3HR0A 4MVQA 4UCVA 3ZHUA 2YUAA 5KHKA 3ZEDA 3P3NA 1EZVH 1XMQO 1YJNV 4EEQA 5CBGA 4B3MO 3BA9A 5KUKA 2DQ3A 1YVWA 2GDSA 2WAMA 4AQYO 3SPHA 4JI4B 1V55B 3BPZA 3K5MA 3JARA 1Y76B 3AG1C 3CJHA 3ABMB 5DM6V 1IBLB 4LF9B 1S5JA 2H8PC 2EIJB 5L3EA 2HJDA 2A3QA 2A0LA 2A9HA 2ZE7A 2KG7A 3ZMTA 4EB6A 5KLVH 4X88A 1LUWA 1K7DA 1JFFA 5CB4A 5IYZA 3KCXA 1P7BA 2ITDC 2BE3A 3Q4HB 2Q7GA 4MTFA 3ZN1A 4YY3B 1FXHA 5L3GA 3STLC 5H2FZ 2ZNJA 4GYCB 2QSAA 1K5SA 4PD4F 4KP4A 2JJ1G 3DXRA 4DV3B 2GHYA 1XMQB 5EYPB 4JTDB 4RAIA 1K9MW 3VOUA 5D5PA 4DR1O 2DJVA 4JYBA 1Q5OA 1HNXB 4D7TA 2DW4A 1R73A 2OT5A 4DK1A 5LBQA 4CC5A 4YHHO 2W0FC 4GLXA 4JGSA 4MSWC 3E35A 4B3TB 3OM3B 1NH2B 4JAUA 3Q4HA 3AG7A 1SQFA 1X4TA 5ITZA 1F4MA 1HR0B 3JAKB 3CSXA 1S5LZ 3S3WA 1N34B 1XL4A 1YJWV 4DR2B 2P22C 3UKMA 4CS2A 1E1QG 5LMUO 2X6BA 3BA8A 3B2EE 1EN6A 3B40A 3SJAC 2UUBB 4JI8B 3OTFA 2RJZA 1CPYA 2JK5C 4DR3O 5KAFZ 1IZ3A 3SPCA 2DWEC 5IJ0B 4JYAO 3CP1A 2IU0A 1L8DA 4IIJB 3CRQA 5CA0A 3JASB 2EZPA 3CCJV 4NXNO 4HYOA 4O4LB 1YF2A 1N36B 3BHPA 1DGSA 2M6YA 5LP6B 4B3SB 4X20B 3B4SA 2BSKA 5BY1A 4J80A 1VQKV 3T4DA 1OCOB 5KHIA 2HLDG 3H1JH 4CC6A 2Z3YA 3B8MA 2KSDA 4DUZB 1KB9F 3CHXA 4QE9A 1FFTB 2XOKG 4HNAB 1I0HA 4MS2A 5KHJA 5A2QN 1SERA 3H1LH 1PKXA 4O4HB 4PI0A 4X65B 4ZHQA 1MOFA 5GW7A 4J7JA 3ZHSA 3QNEA 1YCIA 3B8NA 4LC1A 5HFLA 2BOCC 1GAXA 2PYJA 1HW7A 3O65A 1KC8W 2ZE5A 4F6RB 4IYHA 1AROP 1H2LA 3KZIZ 1VQNV 3E8BA 2B9ZA 3L70H 2N74A 5IDJA 2L35A 1P49A 2WPDG 3ETGA 4XBFA 5K1PA 2CH7B 4TOIA 4DV1O 5IWAB 4JV5B 4ZI7B 1GN6A 2PZSA 2K1EA 5J2UB 3FAVA 2M7WA 3ZMZA 2OIEA 2FYUH 2VRZA 4X8AA 4WFAV 2B1GA 3KKYA 1UJWB 1US6A 5JCOC 1K97A 4MT8A 3ASNC 3FFQA 1AI4A 2CTWA 2WLKA 5EZYB 4CH4A 3W7SA 4DV7B 2IJIA 4PDMA 1RSOA 5B1BB 2WLMA 4LH7A 2FB5A 5H6QA 2YS8A 1GM7A 3LNMB 1FJGB 2FTKA 4AILC 4KFMA 1H8EG 2WWWA 1ZSPA 5JVDA 3R65A 1DLBA 1Q43A 3BABA 4WFEA 1BQZA 3E8HA 2UXXA 2ZCEA 3CYOA 4DR4O 4GKKO 2UXNA 1R6NA 1I08A 1S77D 1HR0O 3OW2U 1XMOB 2ZIMA 3F5TA 3H1IH 1AVMA 3G80A 3UM7A 1ZX3A 1U97A 1Q6UA 2EJ7A 3QO8A 2Q7HA 1I94B 3SPGA 5DECA 1D5AA 3FB7C 2R72A 3LSSA 5LYJB 5BR8O 4KXRA 4A5UB 5LMNB 2NNUA 2CGNA 5JVDB 3A0BZ 1PV0A 1WA8A 1K4DC 4FLYA 1L0LH 3OGIB 1L0NH 2UXBO 5AG2A 3ABKC 2E3CA 2KKWA 4IHJB 3ABTA 1F7YA 1DTOA 2UUBO 1N36O 4JI8O 1R6KA 2AZ2A 1MSDA 3RYHA 2XTAA 1TA8A 4RQEA 3BY6A 2Y0PA 3CRMA 1ORQC 3ZMSA 1XNQB 4DV0O 2C2AA 1K33A 3BEHA 4I0XA 2DYRC 1RSOB 2F43G 3TXQA 4GKKB 4W4KA 3ABMC 1TGOA 4GX1A 3W7WA 4LCUC 1SS3A 4MVZA 3GWKC 1ZLZA 2QWPB 2P7TC 1V54B 4MW3A 5DN6G 5JJJB 4DUZO 1H8HG 2QTSA 1IXBA 1S5HC 4D6TH 2CTRA 5GONA 2EBOA 4DK0A 2OYQA 1JJ2U 3TJTA 4JTCB 3SJCC 3N2KA 1R3KC 5C93A 5LA6A 4WF9V 4I0XB 3RYCB 1Y76A 3FYIB 2UUCB 1FFXB 1JQ0A 4U3JB 1B06A 5JJEB 2JDIG 3IC7A 1SRYA 1HNWO 3SJQC 1G8MA 3ZRXA 4GZRB 4QE7A 4BIZA 4I9QA 1FFXA 5L3CA 3RBZA 4IYIA 1TUBA 4O2AA 4O4JB 4NB5A 1XDCA 2F93B 1X59A 5D5QA 2E5LO 4JI6O 5E1AC 3HPLC 4J42A 2BTQB 2GUZB 2YIBA 1VMGA 5CN0A 4NXMO 4DV2O 1V54C 1VQ8V 3FAVB 4FPPA 4WCEV 4AI8A 1G4YB 4B7EA 4Q6GA 1Q90D 4JI2O 3CCLV 1FXKA 3ZMVA 1KYOF 5LP6A 1Q82W 1AB3A 4DXWA 4LF4O 4FM1A 2HKOA 1EN5A 5LGTA 3WB0A 4JI3B 4MW8A 5EZYA 3SJBC 3ABKB 2ITCC 3HKEB 5H6RA 2OWOA 2QM8A 1UPGA 4PA9A 3RYFA 3CRRA 3H9VA 1S0VA 2EIJC 2LGQA 2ZE6A 1PPJH 4BIOA 2NLJC 3RYCA 4I55B 5EK0A 4JI6B 3SGIA 3G4SV 3ZIAG 2JJ2G 4OGQB 2VQEO 2V1DA 1Y74B 2ILMA 3JALB 1Q6HA 4D7SA 2PY5A 2WLLA 4PDLA 1BHAA 2JGUA 5B1OA 1NT2B 3IGAC 1MNGA 3JASA 1IBLO 4LF9O 4IT5A 3TETA 2H94A 1AI6A 2ODMA 4DV2B 4DR7O 2DOSA 4DR6B 3VQWA 4DUYO 2EIMC 5IJ9B 1J5EB 1IBKO 4MTOA 3UT5A 3P30A 3RYIB 1N33O 3U10A 2UXDO 1IDSA 4LF7O 2XAQA 3DTUB 1W0KG 4R8CA 1O9HA 3ZCCA 1E79G 2R9RB 4YJ3A 3JALA 1SETA 1KBHA 4BW5A 1S76D 4JI4O 1K92A 2Q69A 2ZXWB 2Q73A 3X2QB 3I55V 1IBMB 1WPXA 1ZUQA 2QM4A 1QVGU 4UFZA 1JR9A 4O4HA 1F4NA 4X1KA 3K5LA 1XNQO 4CZZA 5HFMA 2E74B 4XDLA 1SQVH 3HKCB 4GX2A 2QKAA 4DO2A 1QBZA 4L87A 1AJPA 2GTAA 5LHIA 3ABLB 1YI2V 1HP8A 1PM9A 3IJ4A 5EBLC 2CE4A 2ZT9B 2ZM6B 2HEPA 1GK9A 1KECA 3DSQA 4JAVA 2CGOA 1KKCA 1S3JA 5BZBA 2FMLA 5EIBC 1I7FA 2NR5A 3T2MA 4X64O 4GX0A 2CTQA 1R3JC 5FPRA 4DR2O 3L74H 4FFBA 4LF8O 2ZD9A 4IGGA 3E22A 3WFVA 2QR4A 4PA7A 2ZR3A 3L9DA 2IJJA 2XNDG 2XUMA 3OUFA 3K57A 2ZNIA 4IL6Z 2EILC 4O4JA 4MVMA 2RMKB 3UO3A 3RFRA 1GO3F 3ZRSA 2RCVA 4H13B 2PI4A 4FLXA 3JD3A 4N23A 2VQFO 1NTKH 1W2BU 3H1HH 3CC2V 4LFBB 5LYJA 4TV8A 2F4VO 2IU3A 3JARB 3D3IA 2YXHA 4I5SA 4I50A 1Z5WA 1WA8B 4DR5O 2WSSG 5KMGB 1SC5B 4HAMA 1LR1A 2YXLA 4P2ZA 4JI5O 1VQ9V 3D36A 2X6AA 3HB3B 2HG5C 5EBWC 3HKDB 2Q5ZA 5J2UA 5CA1B 5B1NA 3T1YB 1CXZB 1QLEC 1GN3A 1OV9A 1N4CA 2OCCC 3S3XA 5KMGA 2ZE8A 5KX5B 5LHGA 4ZHQB 3ETQA 3JD1A 4TV9B 3STZC 4J7ZA 4XDJA 3LDEA 2YI9A 3CB2A 1QQCA 5LMNO 4U7NA 5KAIZ 1R1BA 2EJRA 3EHBB 4UB8Z 1H38A 2CDYA 2OCHA 4DV1B 3T1HO 2XAHA 1MSWD 2ZQMA 5IYCO 1AJNA 1HWYA 3CMAV 5C8YB 1N32O 1WNSA 1IXMA 1B3QA 4U3JA 1COWG 3UQ8A 1Q6IA 1NTZH 1NZ6A 1NJIW 3THOA 4IHJA 4PDVA 4BW9A 1GH6A 1GN2A 2V7QG 1WAZA 1KKDA 3CD6V 1RPRA 3K79A 1AR1B 2ARHA 4PJ0Z 4C7UA 3C3TA 3LDCA 4F6EA 3N2KB 2QWRB 3F5WC 3SYOA 2E75B 4O2BA 4R7CA 4JI0B 2GBOA 3FYEB 1SQXH 1NI8A 5E79Z 5B1AC 3CRAA 4TUYA 3T1CA 3LUTB 1TUBB 3ICXA 2EULA 1YIJV 2YC0A 4FK5C 4JZ2A 4CH6A 3A0HZ 1VQ5V 3N27A 4JF3A 1MZEA 4G2KA 1H2SB 4FIPC 4YXWG 1OCOC 1VQMV 3QTCA 4WFHA 1YXBA 4X1KB 1A32A 4OPHA 5EBMC 3AG3C 1EN4A 2HHHB 4O2BB 3K0DA 4LNUB 3E83A 2RN9A 1NR1A 4ZKIA 1OCCC 3AK2A 4UV9A 1YZBA 3QVNA 1MG1A 3ZHRA 4P30A 2XAGA 4B3MB 2YEVA 2BOBC 4JI0O 1M1KW 4YJ2A 2EIKC 4LNUA 3D36C 2DYSB 1SESA 2HR3A 4FLUA 3UCSC 2ZIOA 3JCZA 3OR6C 4TT3G 4WBNA 1Y6XA 2HVJC 4I4TB 2XHBA 2UXBB 2ZM6O 2CK3G 4J9YB 3K5NA 4NTWA 1NH2D 4PA6A 2Y4UA 3EVKA 4J10A 2GTSA 1URFA 1NKDA 1VF6C 1TVKA 1SQQH 3ASOB 2WLIA 3HKEA 5B3SB 3OGCC 3AG4B 1FXVA 3UO2A 4KUMA 5H9CA 2LQTA 3WB1A 2JS5A 2FL4A 2Y69C 2ATKC 2RDCA 1AP5A 5J2TA 4O4LA 5LXTB 1XHXA 1QNMA 3JAWA 4QPJA 3ZRWB 5B5EZ 1SZXA 5KHGA 5LMUB 3CXCU 3CE2A 5L3FA 3M7MX 1OHHG 1MABG 3PN1A 4N21A 3I56V 3ZJZA 1WP7A 3BRCA 3IFXA 3JD2A 4J7KA 1FKAO 3MHHC 5BMVB 1QLNA 2GSMB 4DV7O 5LA6B 3RVYA 2YIBD 1BT8A 1M57C 3M8AA 4DRXA 5IY5B 3AG3B 4RQFA 1N34O 4CS4A 2E5LB 3GVMA 3RGBA 1UFIA 3K9AA 4PV1B 5BMVA 2JIZG 2UXCB 1VEWA 1R3IC 1F51A 2K9PA 4EFBA 2LGWA 1K3EA 4Z1VA 2YSUB 4B3RB 2VWKA 3CC7V 5CMUA 3LNNA 4DR4B 3F7VC 4O4IB 1NQTA 3E22B 3OTOO 1RP3B 3OR7C 2JS3A 1I94O 3QO7A 3OMAB 4J41A 2QTOA 1IURA 1VARA 3TCUA 3L75H 4TWKA 3K03A 5FPOA 2P6JA 3EXAA 3TXSA 4MVSA 3MAQA 1CP9A 4R50A 3OE7G 5FNVA 3AG2C 2HVKC 4TSFG 4QPKA 2QGNA 3H1KH 1W0JG 2PTMA 4KHPO 4ZOLB 3LDDA 4AQYB 4P9OA 2HP8A 2Q9LA 2WLJA 3RYFB 5JWPA 3VQVA 1FS0G 1KP2A 1Y66A 5JQGA 1PNMA 2QEXV 4LFCO 3WG7B 2HFEC 3E86A 1GKFA 2WLHA 2IBZH 3JSLA 4JV5O 3OAAG 1RM1B 4HZ3A 3OTOB 2UUAO 4LF4B 4DV5B 4JPRA 3SPJA 1RFYA 3E8GA 4JI7O 2OCCB 1EBOA 3CJHB 4B3TO 1BGYH 2UU9O 4DR7B 4DR6O 4YY3O 2KB1A 1XI1A 3JAKA 1VF5B 1SQPH 2ZINA 3ABUA 4EB6B 1XREA 1BZKA 2Q0OC 4PHZA 1AP6A 5CA3A 1XHZA 4I4TA 4EFEA 4KHPB 4LF6O 1IBMO 1PP9H 4J11A 1GM8A 3T1HB 4ASUG 3CRCA 1FXKC 2XT9A 1YITV 1IVSA 5K1XA 1EFRG 1FD9A 4X20A 2UUAB 2QDOA 4K0KB 3ZHQA 2CUGA 4CH3A 4H0LB 5EYPA 3MHSC 3CXHF 4ZOLA 5LOVA 2D3OW 4MVOA 3J81N 3JAMN 2Q8VA 3U11A 4NR1A 1Z2GA 4DV4O 1L1FA 1SZTA 4FM0A 4X1YB 3SR2C 4U7OA 1R3LC 4K8XA 4PA4A 4OXSA 3RWRD 2O57A 4ZBMA 3W7XA 1SA0A 2A79B 2F95B 4CH5A 4UCTA 1WPBA 3ML0A 1I5YA 1XILA 3BVOA 5JH7A 1OJHA 3SYPA 1GTOA 1Y67A 5LOVB 1YTFD 5LGUA 2L6LA 4G27B
chains in the Genus database with same CATH topology
1OCZC 2EIMB 4PDRA 3JD3A 3OEEG 4N23A 3ZN0A 1VQ6V 4QE9A 1W2BU 2LFSA 1FFTB 3CC2V 2XOKG 3K3WA 2IH3C 2IU3A 3OEHG 1RPOA 4MS2A 2EINB 1SERA 1PKXA 3D3IA 4H33A 4I5SA 3ZMUA 4WFBV 3CCEV 1QVFU 3E2EA 1MOFA 5GW7A 2ZXWC 1VQ7V 3QNEA 2WSSG 4HAMA 3B8NA 4LC1A 5HFLA 2DWDC 2BOCC 4P2ZA 1VQ9V 3D36A 2X6AA 3HB3B 2HG5C 4EKWA 5EBWC 1KC8W 1M90W 3RVZA 1N8RW 5B1NA 4GCZA 1AROP 1OCZB 1QLEC 1VQNV 2OCCC 3CCVV 3E8BA 3AG2B 2LFRA 5LHGA 3JD1A 2W6JG 1OCRB 3STZC 5IDJA 4XDJA 3LDEA 1QR8A 2WPDG 2EILB 3ETGA 4XBFA 1KP3A 4PA3A 1YSCA 1AJQA 2JEUA 4U7NA 2LP7A 1H2GA 2EJRA 3EHBB 1DF5A 5B1AB 2K1EA 1H38A 1NVPB 4P9PA 4FJCC 2M7WA 2XAHA 3ZMZA 4CBCA 2MK3A 2ZQMA 1MSWD 5IYCO 1AJNA 1S72V 5KUMA 1HWYA 4X8AA 3CMAV 2AHYA 1IXMA 1AI7A 1M56B 1WLEA 3JD0A 1COWG 4WFAV 2B1GA 1NJIW 3JYCA 1I5XA 3FKSG 1UJWB 5LHHA 4PDVA 5EC1C 3JD4A 1M9NA 1YTFB 1K97A 4MT8A 3CCUV 2V7QG 3ASNC 1KKDA 5EC2C 3CD6V 1AI4A 3AG1B 1RPRA 4MVRA 3K79A 1AR1B 1K5QA 2W6IG 3LDCA 2Q6AA 4UVCA 2QE7G 2WLKA 3OMIB 1K4CC 3W7SA 3F5WC 3H01A 2IJIA 4PDMA 3SYOA 3GB7C 1OZ0A 5B1BB 3ZRWA 2WLMA 2QA4V 2XAJA 4R7CA 1BHBA 5H6QA 1THZA 4GT1A 2WLNA 3ETEA 2PI4A 3B77A 1GM7A 1M57B 3LNMB 2QKSA 2FTKA 4KFMA 3FYEB 1H8EG 2WWWA 5B1AC 3R65A 2EINC 1DF4A 1DLBA 1YHQV 2IJKA 4QIWF 3T1CA 3LUTB 4WFFA 5KA5A 4WFEA 2YEVB 4BIUA 4UVBA 2OTLV 1PD3A 3E8HA 2UXXA 3CPWU 4FK5C 1OCRC 1YIJV 3CYOA 4QNHB 3T4ZA 3G71V 1VQ5V 2UXNA 3G6EV 4JF3A 1R6NA 1Y4MA 1S77D 4G2KA 3OW2U 1QLEB 2Q67A 4FIPC 1JVMA 1OCOC 4YXWG 2XAFA 3MD0A 4UXNA 1VQMV 4WFHA 3UM7A 1TUEB 1PNKA 4MTGA 4H37A 3QO8A 5IYBO 3SPGA 2EZOA 4MVUA 5EBMC 1JOYA 3AG3C 3FB7C 3LSSA 3K0DA 3A0RA 3ASOC 3E83A 2NNUA 1AI5A 1NR1A 4ZKIA 1OCCC 4UV9A 1K4DC 3LSQA 1J95A 2P90A 2PI5A 1MG1A 4P30A 1VQOV 2XAGA 3NXSA 3CCRV 3SPIA 2YEVA 3ABKC 2BOBC 1M1KW 2EIKC 3WG7C 3ABTA 2DYSB 2R9IA 1DTOA 1SESA 3EFFK 4GX5A 1R6KA 2HR3A 5CBHA 3DGEA 3JCZA 3OR6C 4TT3G 2DYRB 4RQEA 3BY6A 4UUJC 1KD1W 1ORQC 3ZMSA 2C2AA 1K33A 2HVJC 1NBMG 3BEHA 5KA6A 1F23A 2CK3G 2DYRC 3SYAA 2F43G 2ZDIC 5CBFA 4J9YB 3ABMC 3SYCA 5LGNA 3W7WA 4GX1A 1NH2D 4LCUC 4PA6A 1PNLA 4MVZA 2B1IA 2EIKB 4JASA 4E2LA 3RW0A 1KQSU 2P7TC 1V54B 1NKDA 4MW3A 3QO5A 5DN6G 4Z1MG 1M56C 1H8HG 1OCCB 1S5HC 3OMNB 5IY5C 4PELA 4I9WA 3ASOB 2WLIA 1QR9A 2X7RB 5B3SB 3OGCC 3TK1A 1NVPD 2IH1C 2EBOA 3AG4B 3KG2A 1FXVA 4KUMA 1JJ2U 5H9CA 3ETDA 4RO2A 4JTCB 2Y69C 4JTAB 1K34A 2ATKC 1R3KC 5C93A 1K73W 4WF9V 3K08A 3FYIB 1ENVA 3CMEV 1VQPV 1JCHA 4QPJA 3ZRWB 3FB5C 3K06A 1XL6A 4UVAA 1JQ0A 1K8AW 2X0LA 3CXCU 4FMTA 1FXKB 5L3FA 2WLIB 5L3BA 2JDIG 1JPXA 1OHHG 1MABG 3IC7A 4N21A 1Q7YW 1SRYA 3I56V 1BMFG 1ROPA 3SJQC 2Y69B 2ZDIA 3FB8C 3ZJZA 1G8MA 3ZRVA 5J9PC 2AHZA 3ZRXA 3IFXA 3JD2A 4QE7A 4BIZA 1VQLV 1CEZA 3MHHC 1QLNA 3AG4C 2GSMB 2Q68A 3RBZA 5L3CA 1Q81W 3RVYA 1BL8A 3X2QC 1M57C 5E1AC 3E89A 3P32A 5IY5B 2QM7A 3AG3B 3HPLC 4RQFA 5CN0A 3GWOA 3K9AA 1V54C 1VQ4V 1VQ8V 1GM9A 4FPPA 4UV8A 4WCEV 2JIZG 3FB6C 1R3IC 1F51A 1G4YB 4JYCA 1K3EA 2X6CA 2YSUB 3ASNB 3CC7V 5CMUA 3OFNG 3F7VC 3CCLV 1FXKA 3ZMVA 3F7YC 3M99B 1NQTA 1PL0A 3CCMV 1RM1C 1Q82W 4DXWA 3W7UA 3PJSK 1JX9A 2HKOA 3W7TA 3OR7C 4MVQA 5LGTA 4MW8A 3QO7A 4LP8A 3OMAB 4QJFB 2QTOA 1YJNV 1NR7A 2ITCC 3ABKB 5CBGA 5H6RA 3TCUA 2QM8A 4TWKA 5KUKA 2DQ3A 3K03A 2P6JA 5B1BC 2WAMA 4PA9A 2B5UA 2JEXA 4MVSA 1S0VA 2EIJC 3SPHA 4WFGA 1CP9A 4R50A 3OE7G 4LBEC 3AG2C 1V55B 2NLJC 3AG1C 2HVKC 3ABMB 5EK0A 4TSFG 5DM6V 4QPKA 2H8PC 3G4SV 3ZIAG 2EIJB 5L3EA 1W0JG 2JJ2G 2A0LA 2A9HA 2V1DA 3LDDA 2HJFC 2WLJA 4P9OA 2Y48A 3ZMTA 4X88A 2WLLA 1K7DA 4PDLA 4R6ZA 1BHAA 5B1OA 1FS0G 1KP2A 1Y66A 5IYDO 1P7BA 3IGAC 2ITDC 1PNMA 2DYSC 3TETA 2QEXV 2H94A 4RUFA 2HFEC 1ZWIC 1AI6A 3WG7B 3E86A 1GKFA 4MTFA 1B6QA 3ZN1A 2WLHA 5L3DA 1FXHA 5L3GA 3STLC 3OAAG 1RM1B 4HZ3A 4MTXA 4RUEA 1K5SA 2XASA 2EIMC 4JPRA 4KP4A 2JJ1G 3SPJA 1E1RG 4MTOA 3E8GA 1YJ9V 2GHYA 2OCCB 3P30A 1EBOA 4JTDB 3VBBA 4RAIA 1K9MW 2ZR2A 2XAQA 3VOUA 3DTUB 1W0KG 4R8CA 4JYBA 2DW4A 1R73A 2KB1A 2OT5A 3ZCCA 1E79G 2R9RB 3SYQA 5LBQA 1SETA 3ABUA 4BW5A 2WLLB 1S76D 1K92A 2Q69A 2ZXWB 1V55C 3X2QB 2W0FC 5CA3A 4XDKA 4JGSA 3I55V 4MSWC 3E35A 1WPXA 3OM3B 4G28B 4JAUA 1NH2B 1QVGU 1EZJA 4F4LA 1F4MA 1F4NA 1LNQA 3CC4V 2DQ0A 1GM8A 4ASUG 2IW5A 1FXKC 1XL4A 1YITV 1YJWV 4CZZA 1EFRG 3ABLC 3UKMA 5HFMA 1E1QG 3CCQV 2X6BA 4J9ZB 4XDLA 3MHSC 4GX2A 4DO2A 1CPYA 2JK5C 1QBZA 4L87A 4BAYA 2D3OW 1AJPA 4MVOA 3SPCA 2DWEC 5FL7G 5LHIA 3ABLB 1YI2V 5B3SC 3CP1A 2IU0A 1L1FA 1SZTA 5EBLC 2EZPA 1GK9A 1KECA 3CCJV 4JAVA 4Q20A 3AEIA 4HYOA 1S3JA 4U7OA 3CCSV 5BZBA 1R3LC 2Z5UA 3T2MA 4GX0A 4PA4A 4OXSA 1P4RA 1R3JC 4X89A 4ZBMA 3W7XA 2ZD9A 3K04A 2A79B 3WFVA 2OTJV 4PA7A 2ZR3A 2IJJA 1I5YA 3ML0A 2XNDG 3OUFA 1QCEA 3OUSA 1GMGA 2EILC 1VQKV 4MVMA 3SYPA 1GTOA 3T4DA 1OCOB 1GO3F 3E8FA 2HLDG 1Q86W 2IJHA 3K0GA 1YTFD 2Z3YA 3ZRSA 3B8MA 5LGUA 2P67A 4G27B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCZ C;  4PDR A;  4RUE A;  2WLI B;  3E8H A;  1OCR C;  4QNH B;  2EIM C;  3T4Z A;  4QE9 A;  3SPJ A;  4MTO A;  3SJQ C;  3E8G A;  3FB8 C;  3ZJZ A;  5J9P C;  2AHZ A;  2IH3 C;  4MS2 A;  3IFX A;  4JTD B;  2Q67 A;  4QE7 A;  4RAI A;  1JVM A;  1OCO C;  3AG4 C;  2Q68 A;  4H33 A;  3RBZ A;  3VOU A;  3RVY A;  4WFH A;  1BL8 A;  3UM7 A;  3X2Q C;  2ZXW C;  4MTG A;  4R8C A;  4H37 A;  1M57 C;  5E1A C;  3E89 A;  3SPG A;  4MVU A;  2KB1 A;  5EBM C;  3AG3 C;  2R9R B;  2DWD C;  3FB7 C;  2BOC C;  3HPL C;  4P2Z A;  3SYQ A;  4BW5 A;  3K0D A;  2WLL B;  2Q69 A;  2X6A A;  1V54 C;  1V55 C;  2HG5 C;  3ASO C;  3E83 A;  2W0F C;  4EKW A;  5EBW C;  4XDK A;  3RVZ A;  1OCC C;  3FB6 C;  4MSW C;  1R3I C;  1G4Y B;  4G28 B;  1QLE C;  1K4D C;  2OCC C;  2X6C A;  3E8B A;  4F4L A;  1J95 A;  4P30 A;  1LNQ A;  2YEV A;  3ABK C;  2BOB C;  3F7V C;  3SPI A;  3STZ C;  2EIK C;  4XDJ A;  3WG7 C;  3LDE A;  3F7Y C;  1XL4 A;  3EFF K;  4PA3 A;  4GX5 A;  4DXW A;  3PJS K;  3ABL C;  3UKM A;  5CBH A;  3OR6 C;  2X6B A;  3OR7 C;  4J9Z B;  4MVQ A;  4UUJ C;  2K1E A;  4XDL A;  1ORQ C;  4P9P A;  4CBC A;  4MW8 A;  2HVJ C;  3BEH A;  5KUM A;  4LP8 A;  4GX2 A;  4X8A A;  2QTO A;  2DYR C;  2AHY A;  2ITC C;  2JK5 C;  5CBG A;  3TCU A;  3SYA A;  5CBF A;  4TWK A;  4MVO A;  3K03 A;  4J9Y B;  3SPC A;  2DWE C;  5KUK A;  3ABM C;  5B1B C;  5B3S C;  3SYC A;  3JYC A;  4GX1 A;  4PA9 A;  4LCU C;  4PA6 A;  4MVZ A;  4PDV A;  5EC1 C;  4MVS A;  5EBL C;  2EIJ C;  3SPH A;  4WFG A;  4R50 A;  3RW0 A;  4HYO A;  4LBE C;  2P7T C;  3AG2 C;  3ASN C;  5EC2 C;  2NLJ C;  4MW3 A;  1KKD A;  3AG1 C;  5BZB A;  4MVR A;  2HVK C;  1R3L C;  5EK0 A;  1M56 C;  3LDC A;  2Q6A A;  3T2M A;  2H8P C;  2WLK A;  1S5H C;  5IY5 C;  4GX0 A;  4I9W A;  4PA4 A;  4OXS A;  1R3J C;  1K4C C;  3F5W C;  4X89 A;  3SYO A;  4PDM A;  2A0L A;  2A9H A;  2WLI A;  3GB7 C;  4ZBM A;  2ZD9 A;  3K04 A;  2A79 B;  3OGC C;  2WLM A;  2HJF C;  2IH1 C;  3LDD A;  2WLJ A;  3KG2 A;  4P9O A;  4R7C A;  4PA7 A;  2WLL A;  4X88 A;  2WLN A;  4PDL A;  4R6Z A;  3OUF A;  3LNM B;  4RO2 A;  2QKS A;  4JTC B;  1P7B A;  2Y69 C;  3IGA C;  4JTA B;  3OUS A;  4KFM A;  2EIL C;  2ITD C;  2ATK C;  1R3K C;  2DYS C;  4MVM A;  3SYP A;  3TET A;  3T4D A;  4RUF A;  2HFE C;  1ZWI C;  3K08 A;  3R65 A;  3E86 A;  5B1A C;  2EIN C;  3E8F A;  4MTF A;  2WLH A;  3LUT B;  3T1C A;  3FB5 C;  3K0G A;  1XL6 A;  3K06 A;  4WFF A;  3STL C;  3ZRS A;  4WFE A;  4HZ3 A;  4G27 B; 
#chains in the Genus database with same CATH topology
 1OCZ C;  3BCC H;  4PDR A;  3OEE G;  3ZN0 A;  1VQ6 V;  2LFS A;  4B3R O;  2Q4P A;  5CA1 A;  1GRJ A;  2IH3 C;  3OEH G;  3RN4 A;  4I55 A;  1QU7 A;  5ITZ B;  3ZMU A;  3CCE V;  2F4V B;  3RT3 C;  1NU1 H;  2ZXW C;  1VQ7 V;  2FKX A;  1FAF A;  2DN9 A;  4X66 O;  3RVZ A;  1N8R W;  4GCZ A;  1EM1 A;  1OCZ B;  4OX9 O;  3AG2 B;  2LFR A;  2WA4 A;  1J5E O;  1OCR B;  1YEW A;  4B08 A;  1QR8 A;  1KP3 A;  4JI1 O;  5CA0 B;  4JZG A;  1AJQ A;  2LP7 A;  1H2G A;  1DF5 A;  4P9P A;  1WB7 A;  2PF4 E;  4FJC C;  1ZL8 B;  1Z5V A;  5KUM A;  1HNZ O;  2AHY A;  1SA0 B;  4TV9 A;  2VQF B;  3FKS G;  1JFF B;  2H3O A;  1ZAU A;  3JD4 A;  2D2C B;  2QKC A;  3CCU V;  2F23 A;  4F6R A;  3HKC A;  4MVR A;  1K5Q A;  2Q6A A;  2QE7 G;  2Y4T A;  2UUC O;  3QF7 A;  3ZRW A;  2QA4 V;  2XAJ A;  1WB8 A;  1THZ A;  4GT1 A;  3NR7 A;  1M57 B;  4OX9 B;  1BQ0 A;  2EIN C;  1GN4 A;  3L71 H;  4QIW F;  4WFF A;  5KA5 A;  4U3F H;  4JI1 B;  5LL6 Y;  3HKB A;  1OCR C;  4QNH B;  3T4Z A;  3G6E V;  4RWU A;  4NTY A;  4X65 O;  4KL1 A;  2A7W A;  2QWQ B;  2XAF A;  3ZHV A;  4LF8 B;  1TUE B;  5IYB O;  4FFB B;  4MVU A;  1JOY A;  5DED A;  4TV8 B;  4WBN B;  3ASO C;  3D8C A;  2AXT Z;  2F66 C;  3APO A;  3LSQ A;  2P90 A;  2PI5 A;  1VQO V;  3NXS A;  3HKB B;  1R6T A;  4UCO A;  3WG7 C;  1YDX A;  2R9I A;  5CBH A;  1VF7 A;  4TQF A;  3IAY A;  4UUJ C;  1MA1 A;  1KD1 W;  4GKJ B;  3I5D A;  5FNV B;  4BR6 A;  2CAZ C;  2DMX A;  1XQ8 A;  3SYA A;  2QWN B;  3CX5 F;  2VQE B;  2QWO B;  2BSK B;  5IE9 A;  1PNL A;  4I7Z B;  2B1I A;  2EIK B;  4O4I A;  3RW0 A;  4DV0 B;  1M56 C;  1OCC B;  5JQG B;  1BCC H;  4Z2W A;  4L8J A;  3P3P A;  1QR9 A;  3TK1 A;  2AGA A;  4FZ1 A;  1D2D A;  3KG2 A;  1FJG O;  1H2N A;  3RYH B;  3A8T A;  1HNW B;  1IBK B;  3ETD A;  3ZS8 C;  4JTA B;  5EIB D;  3R66 A;  1K73 W;  1VF6 A;  4HBN A;  1ENV A;  4FFK A;  5IWA O;  1VQP V;  3FB5 C;  1XOU A;  1XL6 A;  4UVA A;  1W59 A;  1TVK B;  2X0L A;  4JAA A;  1FXK B;  4QGP A;  5H5N A;  2WLI B;  1Y74 A;  3ZRV A;  1N0N A;  2ZDI A;  5J9P C;  1AIL A;  4YIP A;  1N0J A;  1VQL V;  2JVD A;  2Q68 A;  2RQ6 A;  1N33 B;  1Q81 W;  5LP6 C;  4YJ2 B;  2N05 A;  4FLT A;  2ADP A;  2GV9 A;  2G38 A;  5IJ0 A;  4GKJ O;  4ZI7 A;  3GWO A;  5KHH A;  3VQX A;  4UV8 A;  1Q8I A;  1XUQ A;  1TAE A;  3OD4 A;  2X6C A;  4TUY B;  2P06 A;  1H2M A;  4I50 B;  3OFN G;  3M99 B;  3CCM V;  1RM1 C;  2P4V A;  2BTO A;  3W7U A;  3CS5 A;  1VP7 A;  4DV4 B;  3J7A U;  4LR3 A;  4LP8 A;  4QJF B;  1NR7 A;  3K58 A;  1ZTE A;  5GON B;  1G1X B;  4FLW A;  5B1B C;  2GUZ A;  2B5U A;  2PUS A;  2JEX A;  3O9O A;  4K0K O;  4WFG A;  4LBE C;  2P5O A;  4FLZ A;  1PL4 A;  3KCY A;  5C8Y A;  1WP8 A;  2HJF C;  4YJ3 B;  2Y0I A;  2Y48 A;  2YIC A;  4R6Z A;  5IYD O;  4LFB O;  2LO1 A;  2DYS C;  1DK1 A;  4RUF A;  1ZWI C;  2WA3 A;  1B6Q A;  3L73 H;  5L3D A;  4FVM A;  4E4E A;  4MTX A;  1Q3E A;  4RUE A;  2Q0A A;  4PI2 A;  4DW1 A;  2XAS A;  4JYA B;  2CH7 A;  1E1R G;  1D5N A;  1YJ9 V;  1N32 B;  3VBB A;  1LUV A;  1NTM H;  2ZR2 A;  2E76 B;  4NKG B;  3L72 H;  3N2G A;  4X66 B;  4X1I A;  4YHH B;  2F1M A;  1P84 F;  3SYQ A;  5GTH Z;  4LWS A;  3C90 A;  2WLL B;  1V55 C;  2KQX A;  4XDK A;  2YID A;  3BAA A;  4GUN A;  2UXD B;  4G28 B;  4DW0 A;  3T1Y O;  1EZJ A;  4F4L A;  3JAW B;  3SDL A;  5B66 Z;  1ZL8 A;  1LNQ A;  3CC4 V;  4DV5 O;  2DQ0 A;  2IW5 A;  3ZX6 A;  3ABL C;  3MDS A;  3UT5 B;  3CCQ V;  4J9Z B;  3ZBH A;  4LFC B;  3OT7 A;  3K5O A;  4UB6 Z;  4BAY A;  2KG7 B;  5FL7 G;  5B3S C;  4LWS B;  5JCO A;  1M93 A;  4Q20 A;  3AEI A;  3CCS V;  1XNR B;  4JI3 O;  2Q7E A;  1M4U A;  4OPA A;  2Z5U A;  2HHH O;  1SQG A;  1P4R A;  4FM2 A;  4X89 A;  3K04 A;  2OTJ V;  1T5E A;  5IT9 N;  1G6U A;  3RYI A;  4DV3 O;  1KUQ A;  1QCE A;  3OUS A;  1GMG A;  1IX9 A;  2JRI A;  3CWB H;  4O2A B;  4BWA A;  4YIO A;  3E8F A;  4DR5 B;  2IJH A;  3K0G A;  1Q86 W;  2P67 A;  3JSN A;  2A06 H;  2EIM B;  3TGU H;  3K3W A;  2QJ1 A;  1RPO A;  3IC9 A;  4LF7 B;  2EIN B;  1HDJ A;  1JA8 A;  3HKD A;  4H33 A;  2W0X A;  2AZ0 A;  4WFB V;  1QVF U;  3E2E A;  3WU2 Z;  5BXZ A;  1JMK C;  4DUY B;  4NTX A;  2DWD C;  4FLV A;  2ETN A;  5JJN B;  4EKW A;  5CB4 B;  5IYZ B;  4DR1 B;  1M90 W;  2RNB A;  3CCV V;  2VS0 A;  1B04 A;  2MW2 B;  5GTI Z;  1XBL A;  1XEQ A;  2W6J G;  4IIJ A;  4JI5 B;  2EIL B;  4PA3 A;  1WJZ A;  1XNR O;  3DXR B;  1KU9 A;  1YSC A;  2JEU A;  3AK1 A;  5B1A B;  1SQB H;  2UU9 B;  1NVP B;  4LFA O;  4CBC A;  2MK3 A;  3ZHT A;  1S72 V;  2LW1 A;  3B09 A;  2PGG A;  4AHC A;  1AI7 A;  1KMI Z;  1M56 B;  1WLE A;  3JD0 A;  4ZIB A;  3JYC A;  1I5X A;  4FZ0 A;  5LHH A;  5EC1 C;  1M9N A;  5JH7 B;  3LSU A;  1YTF B;  1BSM A;  5EC2 C;  3AG1 B;  3FD9 A;  2YDE A;  4TQD A;  2W6I G;  4UVC A;  3G6B A;  3OMI B;  1K4C C;  3H01 A;  3GB7 C;  3CEI A;  3QG5 A;  1OZ0 A;  1P7G A;  1BHB A;  4ICG A;  4X1Y A;  2WLN A;  3ETE A;  1H2K A;  3B77 A;  3WB2 A;  2VWJ A;  2QKS A;  4CS3 A;  3K9S A;  1HNZ B;  1DF4 A;  1YHQ V;  2IJK A;  2YI8 A;  2YEV B;  4BIU A;  4UVB A;  4UCS A;  4X62 O;  1PD3 A;  2OTL V;  5TIS Z;  3CPW U;  2YXY A;  4JI2 B;  1XMO O;  1VIB A;  3G71 V;  3AK3 A;  1AR5 A;  1Y4M A;  1QLE B;  2Q67 A;  1JVM A;  2UXC O;  1BS3 A;  3MD0 A;  4UXN A;  5KX5 A;  3D3Q A;  4LH6 A;  1PNK A;  4MTG A;  4H37 A;  5BR8 B;  1JJO A;  2EZO A;  3A2F A;  4HNA A;  3A0R A;  5FLX N;  4NYK A;  4UCU A;  1AI5 A;  4NVP A;  2V4D A;  1BE3 H;  1MZF A;  1J95 A;  1O9G A;  3CCR V;  3SPI A;  1MMM A;  3EFF K;  4GX5 A;  3JCU Z;  4X62 B;  3APQ A;  3JAT B;  2BCC H;  3DGE A;  2DYR B;  3VQY A;  4ABM A;  4K8Z A;  5KA6 A;  1NBM G;  5LXT A;  3U0Z A;  4DV6 B;  2AW9 A;  3DC6 A;  1F23 A;  3BFR A;  2ZDI C;  5CBF A;  4LF5 O;  3SYC A;  4B7K A;  5LGN A;  1SF9 A;  1QHT A;  2YIA A;  4JAS A;  4DR3 B;  4E2L A;  1KQS U;  1SKV A;  2JGD B;  1FYJ A;  3QO5 A;  2ADQ B;  3J80 N;  4Z1M G;  4X9Q A;  2Z0A A;  3OMN B;  5IY5 C;  4PEL A;  4I9W A;  3K59 A;  2X7R B;  1NVP D;  1U96 A;  2IH1 C;  5F2V O;  3JAT A;  2JGD A;  4RO2 A;  4JI7 B;  2DE0 X;  1K34 A;  3G67 A;  2P4K A;  2OIG A;  2LJ2 A;  3K08 A;  5A9G A;  2N04 A;  3CME V;  4NXN B;  1JCH A;  3K06 A;  1K8A W;  3N2G B;  2BTQ A;  4FMT A;  2NN4 A;  4JYY A;  5L3B A;  3FX7 A;  1JPX A;  1Q7Y W;  4DRX B;  1BMF G;  1ROP A;  2PYL A;  2Y69 B;  3FB8 C;  4K3A A;  2IM9 A;  2AHZ A;  4DV6 O;  4B3S O;  1CEZ A;  4DYL A;  3AG4 C;  4H44 B;  1BL8 A;  1V9P A;  3X2Q C;  4W4L A;  4NXM B;  1M5I A;  3E89 A;  4K35 A;  3P32 A;  1WN7 A;  2QM7 A;  1NS1 A;  4LFA B;  2CTP A;  1VQ4 V;  3DC5 A;  1GM9 A;  5IJ9 A;  2ZKO A;  2R9A A;  4UCR A;  2LW7 A;  3FB6 C;  4JYC A;  5J2T B;  4LF5 B;  2EX3 A;  3ASN B;  4LF6 B;  3C3S A;  1AR4 A;  4X1I B;  4X64 B;  3F7Y C;  1PL0 A;  3PJS K;  1JX9 A;  2R70 A;  1HNX O;  3W7T A;  1FPO A;  3HR0 A;  4MVQ A;  4UCV A;  3ZHU A;  2YUA A;  5KHK A;  3ZED A;  3P3N A;  1EZV H;  1XMQ O;  1YJN V;  4EEQ A;  5CBG A;  4B3M O;  3BA9 A;  5KUK A;  2DQ3 A;  1YVW A;  2GDS A;  2WAM A;  4AQY O;  3SPH A;  4JI4 B;  1V55 B;  3BPZ A;  3K5M A;  3JAR A;  1Y76 B;  3AG1 C;  3CJH A;  3ABM B;  5DM6 V;  1IBL B;  4LF9 B;  1S5J A;  2H8P C;  2EIJ B;  5L3E A;  2HJD A;  2A3Q A;  2A0L A;  2A9H A;  2ZE7 A;  2KG7 A;  3ZMT A;  4EB6 A;  5KLV H;  4X88 A;  1LUW A;  1K7D A;  1JFF A;  5CB4 A;  5IYZ A;  3KCX A;  1P7B A;  2ITD C;  2BE3 A;  3Q4H B;  2Q7G A;  4MTF A;  3ZN1 A;  4YY3 B;  1FXH A;  5L3G A;  3STL C;  5H2F Z;  2ZNJ A;  4GYC B;  2QSA A;  1K5S A;  4PD4 F;  4KP4 A;  2JJ1 G;  3DXR A;  4DV3 B;  2GHY A;  1XMQ B;  5EYP B;  4JTD B;  4RAI A;  1K9M W;  3VOU A;  5D5P A;  4DR1 O;  2DJV A;  4JYB A;  1Q5O A;  1HNX B;  4D7T A;  2DW4 A;  1R73 A;  2OT5 A;  4DK1 A;  5LBQ A;  4CC5 A;  4YHH O;  2W0F C;  4GLX A;  4JGS A;  4MSW C;  3E35 A;  4B3T B;  3OM3 B;  1NH2 B;  4JAU A;  3Q4H A;  3AG7 A;  1SQF A;  1X4T A;  5ITZ A;  1F4M A;  1HR0 B;  3JAK B;  3CSX A;  1S5L Z;  3S3W A;  1N34 B;  1XL4 A;  1YJW V;  4DR2 B;  2P22 C;  3UKM A;  4CS2 A;  1E1Q G;  5LMU O;  2X6B A;  3BA8 A;  3B2E E;  1EN6 A;  3B40 A;  3SJA C;  2UUB B;  4JI8 B;  3OTF A;  2RJZ A;  1CPY A;  2JK5 C;  4DR3 O;  5KAF Z;  1IZ3 A;  3SPC A;  2DWE C;  5IJ0 B;  4JYA O;  3CP1 A;  2IU0 A;  1L8D A;  4IIJ B;  3CRQ A;  5CA0 A;  3JAS B;  2EZP A;  3CCJ V;  4NXN O;  4HYO A;  4O4L B;  1YF2 A;  1N36 B;  3BHP A;  1DGS A;  2M6Y A;  5LP6 B;  4B3S B;  4X20 B;  3B4S A;  2BSK A;  5BY1 A;  4J80 A;  1VQK V;  3T4D A;  1OCO B;  5KHI A;  2HLD G;  3H1J H;  4CC6 A;  2Z3Y A;  3B8M A;  2KSD A;  4DUZ B;  1KB9 F;  3CHX A;  4QE9 A;  1FFT B;  2XOK G;  4HNA B;  1I0H A;  4MS2 A;  5KHJ A;  5A2Q N;  1SER A;  3H1L H;  1PKX A;  4O4H B;  4PI0 A;  4X65 B;  4ZHQ A;  1MOF A;  5GW7 A;  4J7J A;  3ZHS A;  3QNE A;  1YCI A;  3B8N A;  4LC1 A;  5HFL A;  2BOC C;  1GAX A;  2PYJ A;  1HW7 A;  3O65 A;  1KC8 W;  2ZE5 A;  4F6R B;  4IYH A;  1ARO P;  1H2L A;  3KZI Z;  1VQN V;  3E8B A;  2B9Z A;  3L70 H;  2N74 A;  5IDJ A;  2L35 A;  1P49 A;  2WPD G;  3ETG A;  4XBF A;  5K1P A;  2CH7 B;  4TOI A;  4DV1 O;  5IWA B;  4JV5 B;  4ZI7 B;  1GN6 A;  2PZS A;  2K1E A;  5J2U B;  3FAV A;  2M7W A;  3ZMZ A;  2OIE A;  2FYU H;  2VRZ A;  4X8A A;  4WFA V;  2B1G A;  3KKY A;  1UJW B;  1US6 A;  5JCO C;  1K97 A;  4MT8 A;  3ASN C;  3FFQ A;  1AI4 A;  2CTW A;  2WLK A;  5EZY B;  4CH4 A;  3W7S A;  4DV7 B;  2IJI A;  4PDM A;  1RSO A;  5B1B B;  2WLM A;  4LH7 A;  2FB5 A;  5H6Q A;  2YS8 A;  1GM7 A;  3LNM B;  1FJG B;  2FTK A;  4AIL C;  4KFM A;  1H8E G;  2WWW A;  1ZSP A;  5JVD A;  3R65 A;  1DLB A;  1Q43 A;  3BAB A;  4WFE A;  1BQZ A;  3E8H A;  2UXX A;  2ZCE A;  3CYO A;  4DR4 O;  4GKK O;  2UXN A;  1R6N A;  1I08 A;  1S77 D;  1HR0 O;  3OW2 U;  1XMO B;  2ZIM A;  3F5T A;  3H1I H;  1AVM A;  3G80 A;  3UM7 A;  1ZX3 A;  1U97 A;  1Q6U A;  2EJ7 A;  3QO8 A;  2Q7H A;  1I94 B;  3SPG A;  5DEC A;  1D5A A;  3FB7 C;  2R72 A;  3LSS A;  5LYJ B;  5BR8 O;  4KXR A;  4A5U B;  5LMN B;  2NNU A;  2CGN A;  5JVD B;  3A0B Z;  1PV0 A;  1WA8 A;  1K4D C;  4FLY A;  1L0L H;  3OGI B;  1L0N H;  2UXB O;  5AG2 A;  3ABK C;  2E3C A;  2KKW A;  4IHJ B;  3ABT A;  1F7Y A;  1DTO A;  2UUB O;  1N36 O;  4JI8 O;  1R6K A;  2AZ2 A;  1MSD A;  3RYH A;  2XTA A;  1TA8 A;  4RQE A;  3BY6 A;  2Y0P A;  3CRM A;  1ORQ C;  3ZMS A;  1XNQ B;  4DV0 O;  2C2A A;  1K33 A;  3BEH A;  4I0X A;  2DYR C;  1RSO B;  2F43 G;  3TXQ A;  4GKK B;  4W4K A;  3ABM C;  1TGO A;  4GX1 A;  3W7W A;  4LCU C;  1SS3 A;  4MVZ A;  3GWK C;  1ZLZ A;  2QWP B;  2P7T C;  1V54 B;  4MW3 A;  5DN6 G;  5JJJ B;  4DUZ O;  1H8H G;  2QTS A;  1IXB A;  1S5H C;  4D6T H;  2CTR A;  5GON A;  2EBO A;  4DK0 A;  2OYQ A;  1JJ2 U;  3TJT A;  4JTC B;  3SJC C;  3N2K A;  1R3K C;  5C93 A;  5LA6 A;  4WF9 V;  4I0X B;  3RYC B;  1Y76 A;  3FYI B;  2UUC B;  1FFX B;  1JQ0 A;  4U3J B;  1B06 A;  5JJE B;  2JDI G;  3IC7 A;  1SRY A;  1HNW O;  3SJQ C;  1G8M A;  3ZRX A;  4GZR B;  4QE7 A;  4BIZ A;  4I9Q A;  1FFX A;  5L3C A;  3RBZ A;  4IYI A;  1TUB A;  4O2A A;  4O4J B;  4NB5 A;  1XDC A;  2F93 B;  1X59 A;  5D5Q A;  2E5L O;  4JI6 O;  5E1A C;  3HPL C;  4J42 A;  2BTQ B;  2GUZ B;  2YIB A;  1VMG A;  5CN0 A;  4NXM O;  4DV2 O;  1V54 C;  1VQ8 V;  3FAV B;  4FPP A;  4WCE V;  4AI8 A;  1G4Y B;  4B7E A;  4Q6G A;  1Q90 D;  4JI2 O;  3CCL V;  1FXK A;  3ZMV A;  1KYO F;  5LP6 A;  1Q82 W;  1AB3 A;  4DXW A;  4LF4 O;  4FM1 A;  2HKO A;  1EN5 A;  5LGT A;  3WB0 A;  4JI3 B;  4MW8 A;  5EZY A;  3SJB C;  3ABK B;  2ITC C;  3HKE B;  5H6R A;  2OWO A;  2QM8 A;  1UPG A;  4PA9 A;  3RYF A;  3CRR A;  3H9V A;  1S0V A;  2EIJ C;  2LGQ A;  2ZE6 A;  1PPJ H;  4BIO A;  2NLJ C;  3RYC A;  4I55 B;  5EK0 A;  4JI6 B;  3SGI A;  3G4S V;  3ZIA G;  2JJ2 G;  4OGQ B;  2VQE O;  2V1D A;  1Y74 B;  2ILM A;  3JAL B;  1Q6H A;  4D7S A;  2PY5 A;  2WLL A;  4PDL A;  1BHA A;  2JGU A;  5B1O A;  1NT2 B;  3IGA C;  1MNG A;  3JAS A;  1IBL O;  4LF9 O;  4IT5 A;  3TET A;  2H94 A;  1AI6 A;  2ODM A;  4DV2 B;  4DR7 O;  2DOS A;  4DR6 B;  3VQW A;  4DUY O;  2EIM C;  5IJ9 B;  1J5E B;  1IBK O;  4MTO A;  3UT5 A;  3P30 A;  3RYI B;  1N33 O;  3U10 A;  2UXD O;  1IDS A;  4LF7 O;  2XAQ A;  3DTU B;  1W0K G;  4R8C A;  1O9H A;  3ZCC A;  1E79 G;  2R9R B;  4YJ3 A;  3JAL A;  1SET A;  1KBH A;  4BW5 A;  1S76 D;  4JI4 O;  1K92 A;  2Q69 A;  2ZXW B;  2Q73 A;  3X2Q B;  3I55 V;  1IBM B;  1WPX A;  1ZUQ A;  2QM4 A;  1QVG U;  4UFZ A;  1JR9 A;  4O4H A;  1F4N A;  4X1K A;  3K5L A;  1XNQ O;  4CZZ A;  5HFM A;  2E74 B;  4XDL A;  1SQV H;  3HKC B;  4GX2 A;  2QKA A;  4DO2 A;  1QBZ A;  4L87 A;  1AJP A;  2GTA A;  5LHI A;  3ABL B;  1YI2 V;  1HP8 A;  1PM9 A;  3IJ4 A;  5EBL C;  2CE4 A;  2ZT9 B;  2ZM6 B;  2HEP A;  1GK9 A;  1KEC A;  3DSQ A;  4JAV A;  2CGO A;  1KKC A;  1S3J A;  5BZB A;  2FML A;  5EIB C;  1I7F A;  2NR5 A;  3T2M A;  4X64 O;  4GX0 A;  2CTQ A;  1R3J C;  5FPR A;  4DR2 O;  3L74 H;  4FFB A;  4LF8 O;  2ZD9 A;  4IGG A;  3E22 A;  3WFV A;  2QR4 A;  4PA7 A;  2ZR3 A;  3L9D A;  2IJJ A;  2XND G;  2XUM A;  3OUF A;  3K57 A;  2ZNI A;  4IL6 Z;  2EIL C;  4O4J A;  4MVM A;  2RMK B;  3UO3 A;  3RFR A;  1GO3 F;  3ZRS A;  2RCV A;  4H13 B;  2PI4 A;  4FLX A;  3JD3 A;  4N23 A;  2VQF O;  1NTK H;  1W2B U;  3H1H H;  3CC2 V;  4LFB B;  5LYJ A;  4TV8 A;  2F4V O;  2IU3 A;  3JAR B;  3D3I A;  2YXH A;  4I5S A;  4I50 A;  1Z5W A;  1WA8 B;  4DR5 O;  2WSS G;  5KMG B;  1SC5 B;  4HAM A;  1LR1 A;  2YXL A;  4P2Z A;  4JI5 O;  1VQ9 V;  3D36 A;  2X6A A;  3HB3 B;  2HG5 C;  5EBW C;  3HKD B;  2Q5Z A;  5J2U A;  5CA1 B;  5B1N A;  3T1Y B;  1CXZ B;  1QLE C;  1GN3 A;  1OV9 A;  1N4C A;  2OCC C;  3S3X A;  5KMG A;  2ZE8 A;  5KX5 B;  5LHG A;  4ZHQ B;  3ETQ A;  3JD1 A;  4TV9 B;  3STZ C;  4J7Z A;  4XDJ A;  3LDE A;  2YI9 A;  3CB2 A;  1QQC A;  5LMN O;  4U7N A;  5KAI Z;  1R1B A;  2EJR A;  3EHB B;  4UB8 Z;  1H38 A;  2CDY A;  2OCH A;  4DV1 B;  3T1H O;  2XAH A;  1MSW D;  2ZQM A;  5IYC O;  1AJN A;  1HWY A;  3CMA V;  5C8Y B;  1N32 O;  1WNS A;  1IXM A;  1B3Q A;  4U3J A;  1COW G;  3UQ8 A;  1Q6I A;  1NTZ H;  1NZ6 A;  1NJI W;  3THO A;  4IHJ A;  4PDV A;  4BW9 A;  1GH6 A;  1GN2 A;  2V7Q G;  1WAZ A;  1KKD A;  3CD6 V;  1RPR A;  3K79 A;  1AR1 B;  2ARH A;  4PJ0 Z;  4C7U A;  3C3T A;  3LDC A;  4F6E A;  3N2K B;  2QWR B;  3F5W C;  3SYO A;  2E75 B;  4O2B A;  4R7C A;  4JI0 B;  2GBO A;  3FYE B;  1SQX H;  1NI8 A;  5E79 Z;  5B1A C;  3CRA A;  4TUY A;  3T1C A;  3LUT B;  1TUB B;  3ICX A;  2EUL A;  1YIJ V;  2YC0 A;  4FK5 C;  4JZ2 A;  4CH6 A;  3A0H Z;  1VQ5 V;  3N27 A;  4JF3 A;  1MZE A;  4G2K A;  1H2S B;  4FIP C;  4YXW G;  1OCO C;  1VQM V;  3QTC A;  4WFH A;  1YXB A;  4X1K B;  1A32 A;  4OPH A;  5EBM C;  3AG3 C;  1EN4 A;  2HHH B;  4O2B B;  3K0D A;  4LNU B;  3E83 A;  2RN9 A;  1NR1 A;  4ZKI A;  1OCC C;  3AK2 A;  4UV9 A;  1YZB A;  3QVN A;  1MG1 A;  3ZHR A;  4P30 A;  2XAG A;  4B3M B;  2YEV A;  2BOB C;  4JI0 O;  1M1K W;  4YJ2 A;  2EIK C;  4LNU A;  3D36 C;  2DYS B;  1SES A;  2HR3 A;  4FLU A;  3UCS C;  2ZIO A;  3JCZ A;  3OR6 C;  4TT3 G;  4WBN A;  1Y6X A;  2HVJ C;  4I4T B;  2XHB A;  2UXB B;  2ZM6 O;  2CK3 G;  4J9Y B;  3K5N A;  4NTW A;  1NH2 D;  4PA6 A;  2Y4U A;  3EVK A;  4J10 A;  2GTS A;  1URF A;  1NKD A;  1VF6 C;  1TVK A;  1SQQ H;  3ASO B;  2WLI A;  3HKE A;  5B3S B;  3OGC C;  3AG4 B;  1FXV A;  3UO2 A;  4KUM A;  5H9C A;  2LQT A;  3WB1 A;  2JS5 A;  2FL4 A;  2Y69 C;  2ATK C;  2RDC A;  1AP5 A;  5J2T A;  4O4L A;  5LXT B;  1XHX A;  1QNM A;  3JAW A;  4QPJ A;  3ZRW B;  5B5E Z;  1SZX A;  5KHG A;  5LMU B;  3CXC U;  3CE2 A;  5L3F A;  3M7M X;  1OHH G;  1MAB G;  3PN1 A;  4N21 A;  3I56 V;  3ZJZ A;  1WP7 A;  3BRC A;  3IFX A;  3JD2 A;  4J7K A;  1FKA O;  3MHH C;  5BMV B;  1QLN A;  2GSM B;  4DV7 O;  5LA6 B;  3RVY A;  2YIB D;  1BT8 A;  1M57 C;  3M8A A;  4DRX A;  5IY5 B;  3AG3 B;  4RQF A;  1N34 O;  4CS4 A;  2E5L B;  3GVM A;  3RGB A;  1UFI A;  3K9A A;  4PV1 B;  5BMV A;  2JIZ G;  2UXC B;  1VEW A;  1R3I C;  1F51 A;  2K9P A;  4EFB A;  2LGW A;  1K3E A;  4Z1V A;  2YSU B;  4B3R B;  2VWK A;  3CC7 V;  5CMU A;  3LNN A;  4DR4 B;  3F7V C;  4O4I B;  1NQT A;  3E22 B;  3OTO O;  1RP3 B;  3OR7 C;  2JS3 A;  1I94 O;  3QO7 A;  3OMA B;  4J41 A;  2QTO A;  1IUR A;  1VAR A;  3TCU A;  3L75 H;  4TWK A;  3K03 A;  5FPO A;  2P6J A;  3EXA A;  3TXS A;  4MVS A;  3MAQ A;  1CP9 A;  4R50 A;  3OE7 G;  5FNV A;  3AG2 C;  2HVK C;  4TSF G;  4QPK A;  2QGN A;  3H1K H;  1W0J G;  2PTM A;  4KHP O;  4ZOL B;  3LDD A;  4AQY B;  4P9O A;  2HP8 A;  2Q9L A;  2WLJ A;  3RYF B;  5JWP A;  3VQV A;  1FS0 G;  1KP2 A;  1Y66 A;  5JQG A;  1PNM A;  2QEX V;  4LFC O;  3WG7 B;  2HFE C;  3E86 A;  1GKF A;  2WLH A;  2IBZ H;  3JSL A;  4JV5 O;  3OAA G;  1RM1 B;  4HZ3 A;  3OTO B;  2UUA O;  4LF4 B;  4DV5 B;  4JPR A;  3SPJ A;  1RFY A;  3E8G A;  4JI7 O;  2OCC B;  1EBO A;  3CJH B;  4B3T O;  1BGY H;  2UU9 O;  4DR7 B;  4DR6 O;  4YY3 O;  2KB1 A;  1XI1 A;  3JAK A;  1VF5 B;  1SQP H;  2ZIN A;  3ABU A;  4EB6 B;  1XRE A;  1BZK A;  2Q0O C;  4PHZ A;  1AP6 A;  5CA3 A;  1XHZ A;  4I4T A;  4EFE A;  4KHP B;  4LF6 O;  1IBM O;  1PP9 H;  4J11 A;  1GM8 A;  3T1H B;  4ASU G;  3CRC A;  1FXK C;  2XT9 A;  1YIT V;  1IVS A;  5K1X A;  1EFR G;  1FD9 A;  4X20 A;  2UUA B;  2QDO A;  4K0K B;  3ZHQ A;  2CUG A;  4CH3 A;  4H0L B;  5EYP A;  3MHS C;  3CXH F;  4ZOL A;  5LOV A;  2D3O W;  4MVO A;  3J81 N;  3JAM N;  2Q8V A;  3U11 A;  4NR1 A;  1Z2G A;  4DV4 O;  1L1F A;  1SZT A;  4FM0 A;  4X1Y B;  3SR2 C;  4U7O A;  1R3L C;  4K8X A;  4PA4 A;  4OXS A;  3RWR D;  2O57 A;  4ZBM A;  3W7X A;  1SA0 A;  2A79 B;  2F95 B;  4CH5 A;  4UCT A;  1WPB A;  3ML0 A;  1I5Y A;  1XIL A;  3BVO A;  5JH7 A;  1OJH A;  3SYP A;  1GTO A;  1Y67 A;  5LOV B;  1YTF D;  5LGU A;  2L6L A;  4G27 B; 
#chains in the Genus database with same CATH homology
 1OCZ C;  2EIM B;  4PDR A;  3JD3 A;  3OEE G;  4N23 A;  3ZN0 A;  1VQ6 V;  4QE9 A;  1W2B U;  2LFS A;  1FFT B;  3CC2 V;  2XOK G;  3K3W A;  2IH3 C;  2IU3 A;  3OEH G;  1RPO A;  4MS2 A;  2EIN B;  1SER A;  1PKX A;  3D3I A;  4H33 A;  4I5S A;  3ZMU A;  4WFB V;  3CCE V;  1QVF U;  3E2E A;  1MOF A;  5GW7 A;  2ZXW C;  1VQ7 V;  3QNE A;  2WSS G;  4HAM A;  3B8N A;  4LC1 A;  5HFL A;  2DWD C;  2BOC C;  4P2Z A;  1VQ9 V;  3D36 A;  2X6A A;  3HB3 B;  2HG5 C;  4EKW A;  5EBW C;  1KC8 W;  1M90 W;  3RVZ A;  1N8R W;  5B1N A;  4GCZ A;  1ARO P;  1OCZ B;  1QLE C;  1VQN V;  2OCC C;  3CCV V;  3E8B A;  3AG2 B;  2LFR A;  5LHG A;  3JD1 A;  2W6J G;  1OCR B;  3STZ C;  5IDJ A;  4XDJ A;  3LDE A;  1QR8 A;  2WPD G;  2EIL B;  3ETG A;  4XBF A;  1KP3 A;  4PA3 A;  1YSC A;  1AJQ A;  2JEU A;  4U7N A;  2LP7 A;  1H2G A;  2EJR A;  3EHB B;  1DF5 A;  5B1A B;  2K1E A;  1H38 A;  1NVP B;  4P9P A;  4FJC C;  2M7W A;  2XAH A;  3ZMZ A;  4CBC A;  2MK3 A;  2ZQM A;  1MSW D;  5IYC O;  1AJN A;  1S72 V;  5KUM A;  1HWY A;  4X8A A;  3CMA V;  2AHY A;  1IXM A;  1AI7 A;  1M56 B;  1WLE A;  3JD0 A;  1COW G;  4WFA V;  2B1G A;  1NJI W;  3JYC A;  1I5X A;  3FKS G;  1UJW B;  5LHH A;  4PDV A;  5EC1 C;  3JD4 A;  1M9N A;  1YTF B;  1K97 A;  4MT8 A;  3CCU V;  2V7Q G;  3ASN C;  1KKD A;  5EC2 C;  3CD6 V;  1AI4 A;  3AG1 B;  1RPR A;  4MVR A;  3K79 A;  1AR1 B;  1K5Q A;  2W6I G;  3LDC A;  2Q6A A;  4UVC A;  2QE7 G;  2WLK A;  3OMI B;  1K4C C;  3W7S A;  3F5W C;  3H01 A;  2IJI A;  4PDM A;  3SYO A;  3GB7 C;  1OZ0 A;  5B1B B;  3ZRW A;  2WLM A;  2QA4 V;  2XAJ A;  4R7C A;  1BHB A;  5H6Q A;  1THZ A;  4GT1 A;  2WLN A;  3ETE A;  2PI4 A;  3B77 A;  1GM7 A;  1M57 B;  3LNM B;  2QKS A;  2FTK A;  4KFM A;  3FYE B;  1H8E G;  2WWW A;  5B1A C;  3R65 A;  2EIN C;  1DF4 A;  1DLB A;  1YHQ V;  2IJK A;  4QIW F;  3T1C A;  3LUT B;  4WFF A;  5KA5 A;  4WFE A;  2YEV B;  4BIU A;  4UVB A;  2OTL V;  1PD3 A;  3E8H A;  2UXX A;  3CPW U;  4FK5 C;  1OCR C;  1YIJ V;  3CYO A;  4QNH B;  3T4Z A;  3G71 V;  1VQ5 V;  2UXN A;  3G6E V;  4JF3 A;  1R6N A;  1Y4M A;  1S77 D;  4G2K A;  3OW2 U;  1QLE B;  2Q67 A;  4FIP C;  1JVM A;  1OCO C;  4YXW G;  2XAF A;  3MD0 A;  4UXN A;  1VQM V;  4WFH A;  3UM7 A;  1TUE B;  1PNK A;  4MTG A;  4H37 A;  3QO8 A;  5IYB O;  3SPG A;  2EZO A;  4MVU A;  5EBM C;  1JOY A;  3AG3 C;  3FB7 C;  3LSS A;  3K0D A;  3A0R A;  3ASO C;  3E83 A;  2NNU A;  1AI5 A;  1NR1 A;  4ZKI A;  1OCC C;  4UV9 A;  1K4D C;  3LSQ A;  1J95 A;  2P90 A;  2PI5 A;  1MG1 A;  4P30 A;  1VQO V;  2XAG A;  3NXS A;  3CCR V;  3SPI A;  2YEV A;  3ABK C;  2BOB C;  1M1K W;  2EIK C;  3WG7 C;  3ABT A;  2DYS B;  2R9I A;  1DTO A;  1SES A;  3EFF K;  4GX5 A;  1R6K A;  2HR3 A;  5CBH A;  3DGE A;  3JCZ A;  3OR6 C;  4TT3 G;  2DYR B;  4RQE A;  3BY6 A;  4UUJ C;  1KD1 W;  1ORQ C;  3ZMS A;  2C2A A;  1K33 A;  2HVJ C;  1NBM G;  3BEH A;  5KA6 A;  1F23 A;  2CK3 G;  2DYR C;  3SYA A;  2F43 G;  2ZDI C;  5CBF A;  4J9Y B;  3ABM C;  3SYC A;  5LGN A;  3W7W A;  4GX1 A;  1NH2 D;  4LCU C;  4PA6 A;  1PNL A;  4MVZ A;  2B1I A;  2EIK B;  4JAS A;  4E2L A;  3RW0 A;  1KQS U;  2P7T C;  1V54 B;  1NKD A;  4MW3 A;  3QO5 A;  5DN6 G;  4Z1M G;  1M56 C;  1H8H G;  1OCC B;  1S5H C;  3OMN B;  5IY5 C;  4PEL A;  4I9W A;  3ASO B;  2WLI A;  1QR9 A;  2X7R B;  5B3S B;  3OGC C;  3TK1 A;  1NVP D;  2IH1 C;  2EBO A;  3AG4 B;  3KG2 A;  1FXV A;  4KUM A;  1JJ2 U;  5H9C A;  3ETD A;  4RO2 A;  4JTC B;  2Y69 C;  4JTA B;  1K34 A;  2ATK C;  1R3K C;  5C93 A;  1K73 W;  4WF9 V;  3K08 A;  3FYI B;  1ENV A;  3CME V;  1VQP V;  1JCH A;  4QPJ A;  3ZRW B;  3FB5 C;  3K06 A;  1XL6 A;  4UVA A;  1JQ0 A;  1K8A W;  2X0L A;  3CXC U;  4FMT A;  1FXK B;  5L3F A;  2WLI B;  5L3B A;  2JDI G;  1JPX A;  1OHH G;  1MAB G;  3IC7 A;  4N21 A;  1Q7Y W;  1SRY A;  3I56 V;  1BMF G;  1ROP A;  3SJQ C;  2Y69 B;  2ZDI A;  3FB8 C;  3ZJZ A;  1G8M A;  3ZRV A;  5J9P C;  2AHZ A;  3ZRX A;  3IFX A;  3JD2 A;  4QE7 A;  4BIZ A;  1VQL V;  1CEZ A;  3MHH C;  1QLN A;  3AG4 C;  2GSM B;  2Q68 A;  3RBZ A;  5L3C A;  1Q81 W;  3RVY A;  1BL8 A;  3X2Q C;  1M57 C;  5E1A C;  3E89 A;  3P32 A;  5IY5 B;  2QM7 A;  3AG3 B;  3HPL C;  4RQF A;  5CN0 A;  3GWO A;  3K9A A;  1V54 C;  1VQ4 V;  1VQ8 V;  1GM9 A;  4FPP A;  4UV8 A;  4WCE V;  2JIZ G;  3FB6 C;  1R3I C;  1F51 A;  1G4Y B;  4JYC A;  1K3E A;  2X6C A;  2YSU B;  3ASN B;  3CC7 V;  5CMU A;  3OFN G;  3F7V C;  3CCL V;  1FXK A;  3ZMV A;  3F7Y C;  3M99 B;  1NQT A;  1PL0 A;  3CCM V;  1RM1 C;  1Q82 W;  4DXW A;  3W7U A;  3PJS K;  1JX9 A;  2HKO A;  3W7T A;  3OR7 C;  4MVQ A;  5LGT A;  4MW8 A;  3QO7 A;  4LP8 A;  3OMA B;  4QJF B;  2QTO A;  1YJN V;  1NR7 A;  2ITC C;  3ABK B;  5CBG A;  5H6R A;  3TCU A;  2QM8 A;  4TWK A;  5KUK A;  2DQ3 A;  3K03 A;  2P6J A;  5B1B C;  2WAM A;  4PA9 A;  2B5U A;  2JEX A;  4MVS A;  1S0V A;  2EIJ C;  3SPH A;  4WFG A;  1CP9 A;  4R50 A;  3OE7 G;  4LBE C;  3AG2 C;  1V55 B;  2NLJ C;  3AG1 C;  2HVK C;  3ABM B;  5EK0 A;  4TSF G;  5DM6 V;  4QPK A;  2H8P C;  3G4S V;  3ZIA G;  2EIJ B;  5L3E A;  1W0J G;  2JJ2 G;  2A0L A;  2A9H A;  2V1D A;  3LDD A;  2HJF C;  2WLJ A;  4P9O A;  2Y48 A;  3ZMT A;  4X88 A;  2WLL A;  1K7D A;  4PDL A;  4R6Z A;  1BHA A;  5B1O A;  1FS0 G;  1KP2 A;  1Y66 A;  5IYD O;  1P7B A;  3IGA C;  2ITD C;  1PNM A;  2DYS C;  3TET A;  2QEX V;  2H94 A;  4RUF A;  2HFE C;  1ZWI C;  1AI6 A;  3WG7 B;  3E86 A;  1GKF A;  4MTF A;  1B6Q A;  3ZN1 A;  2WLH A;  5L3D A;  1FXH A;  5L3G A;  3STL C;  3OAA G;  1RM1 B;  4HZ3 A;  4MTX A;  4RUE A;  1K5S A;  2XAS A;  2EIM C;  4JPR A;  4KP4 A;  2JJ1 G;  3SPJ A;  1E1R G;  4MTO A;  3E8G A;  1YJ9 V;  2GHY A;  2OCC B;  3P30 A;  1EBO A;  4JTD B;  3VBB A;  4RAI A;  1K9M W;  2ZR2 A;  2XAQ A;  3VOU A;  3DTU B;  1W0K G;  4R8C A;  4JYB A;  2DW4 A;  1R73 A;  2KB1 A;  2OT5 A;  3ZCC A;  1E79 G;  2R9R B;  3SYQ A;  5LBQ A;  1SET A;  3ABU A;  4BW5 A;  2WLL B;  1S76 D;  1K92 A;  2Q69 A;  2ZXW B;  1V55 C;  3X2Q B;  2W0F C;  5CA3 A;  4XDK A;  4JGS A;  3I55 V;  4MSW C;  3E35 A;  1WPX A;  3OM3 B;  4G28 B;  4JAU A;  1NH2 B;  1QVG U;  1EZJ A;  4F4L A;  1F4M A;  1F4N A;  1LNQ A;  3CC4 V;  2DQ0 A;  1GM8 A;  4ASU G;  2IW5 A;  1FXK C;  1XL4 A;  1YIT V;  1YJW V;  4CZZ A;  1EFR G;  3ABL C;  3UKM A;  5HFM A;  1E1Q G;  3CCQ V;  2X6B A;  4J9Z B;  4XDL A;  3MHS C;  4GX2 A;  4DO2 A;  1CPY A;  2JK5 C;  1QBZ A;  4L87 A;  4BAY A;  2D3O W;  1AJP A;  4MVO A;  3SPC A;  2DWE C;  5FL7 G;  5LHI A;  3ABL B;  1YI2 V;  5B3S C;  3CP1 A;  2IU0 A;  1L1F A;  1SZT A;  5EBL C;  2EZP A;  1GK9 A;  1KEC A;  3CCJ V;  4JAV A;  4Q20 A;  3AEI A;  4HYO A;  1S3J A;  4U7O A;  3CCS V;  5BZB A;  1R3L C;  2Z5U A;  3T2M A;  4GX0 A;  4PA4 A;  4OXS A;  1P4R A;  1R3J C;  4X89 A;  4ZBM A;  3W7X A;  2ZD9 A;  3K04 A;  2A79 B;  3WFV A;  2OTJ V;  4PA7 A;  2ZR3 A;  2IJJ A;  1I5Y A;  3ML0 A;  2XND G;  3OUF A;  1QCE A;  3OUS A;  1GMG A;  2EIL C;  1VQK V;  4MVM A;  3SYP A;  1GTO A;  3T4D A;  1OCO B;  1GO3 F;  3E8F A;  2HLD G;  1Q86 W;  2IJH A;  3K0G A;  1YTF D;  2Z3Y A;  3ZRS A;  3B8M A;  5LGU A;  2P67 A;  4G27 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...