3T4ZA

Crystal structure of nak2k channel y55w mutant
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
b'DKEFQVLFVLTILTLISGTIFYSTVEGLRPIDALWFSVVTLTTVGYGDFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein
publication title Protein interactions central to stabilizing the K+ channel selectivity filter in a four-sited configuration for selective K+ permeation.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Membrane protein
total genus 35
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3t4zA00
3SYPA 3LNMB 5EBWC 1K4DC 3STZC 5CBGA 1ZWIC 2KB1A 2R9RB 4PDRA 3FB6C 4QE7A 4QE9A 4P9OA 4RAIA 5EC1C 5B1AC 3RVZA 3AG3C 2Y69C 2EIJC 2HVJC 4P9PA 4RO2A 1V55C 4PA7A 1OCRC 4R50A 3E86A 3LDCA 1R3JC 5CBFA 4PDLA 1R3IC 3RW0A 3BEHA 4MTOA 3T4ZA 3ZJZA 3E8HA 3F7VC 2WLHA 2ZD9A 4P2ZA 2BOBC 4DXWA 3F7YC 5B1BC 2WLIA 2X6CA 4X88A 4MVMA 2ITCC 3X2QC 3LDEA 1OCZC 2EIKC 2OCCC 2Q6AA 2QTOA 2ZXWC 5B3SC 4R8CA 3AG1C 3FB5C 5BZBA 4GX1A 4MVOA 4WFEA 3GB7C 5KUKA 4XDKA 4XDLA 3SPCA 4MVSA 5EBMC 4EKWA 5KUMA 2DWEC 2EIMC 2HFEC 1K4CC 4X89A 3ABLC 3OUSA 1LNQA 2WLNA 2HG5C 3T4DA 3SJQC 4JTAB 3LDDA 5EBLC 2WLMA 4LBEC 3K08A 4GX5A 4MVQA 4H33A 4P30A 2WLJA 3OUFA 5EC2C 2A9HA 3SYOA 4MVZA 3SPHA 3FB7C 2H8PC 4XDJA 1R3LC 3K0GA 3E8BA 4MTFA 2Q69A 3WG7C 4J9YB 1KKDA 3FB8C 4R7CA 4MVRA 2WLLA 3OR7C 1QLEC 4LCUC 4TWKA 1BL8A 4WFHA 3T2MA 5IY5C 3RVYA 4JTDB 3ASNC 4G27B 3SYCA 4I9WA 2AHZA 2ITDC 2A0LA 2DYSC 2EINC 2NLJC 3K0DA 5E1AC 2WLIB 3SPGA 4R6ZA 1JVMA 1M56C 3ABKC 4PDMA 2IH3C 4UUJC 4RUEA 2IH1C 4OXSA 2BOCC 2A79B 4MSWC 3RBZA 4MTGA 3EFFK 4MW8A 4MS2A 3KG2A 4MW3A 4PA3A 2DWDC 2EILC 3UM7A 4X8AA 1XL4A 3E89A 4HZ3A 3ASOC 4H37A 3IGAC 4KFMA 4GX2A 3SYAA 2HJFC 3E8FA 1S5HC 2HVKC 2Q68A 5J9PC 2QKSA 3ABMC 4PA4A 3IFXA 4JTCB 4HYOA 3VOUA 1P7BA 3OR6C 1V54C 3HPLC 3T1CA 4WFFA 3E8GA 1XL6A 4BW5A 2WLLB 2X6BA 3JYCA 2W0FC 4PA6A 4CBCA 1M57C 2AHYA 1G4YB 3E83A 3LUTB 4LP8A 4WFGA 3STLC 2WLKA 3TCUA 2Q67A 3F5WC 3SYQA 5CBHA 4GX0A 3TETA 2P7TC 3AG2C 3UKMA 3OGCC 5EK0A 3AG4C 3R65A 3PJSK 2DYRC 3K06A 1OCCC 4MVUA 4PA9A 3K03A 2X6AA 4J9ZB 2YEVA 4QNHB 2JK5C 4G28B 3SPIA 1J95A 1R3KC 2ATKC 4PDVA 4ZBMA 1OCOC 3K04A 3ZRSA 3SPJA 1ORQC 4RUFA 2K1EA 4F4LA
chains in the Genus database with same CATH superfamily
3JAKB 4PV1B 2YIAA 2R72A 5KMGA 5LYJA 4TT3G 3FKSG 1X59A 2YUAA 2P22C 1HNWO 2B1IA 2LO1A 3CPWU 1G8MA 4FLXA 2QE7G 5B3SC 4X65B 4DR5O 2PI5A 1SERA 1NVPB 1XMOB 4UCSA 3ABLC 4UCTA 2Q5ZA 2FB5A 3LDDA 1SQPH 3AEIA 3SJBC 4IIJA 4O4IA 1RM1C 1RPRA 5IYCO 1MZEA 1WP7A 3SPHA 1K73W 2QSAA 3JALB 4QIWF 1R3LC 1IX9A 1VQ9V 2UUCO 4I0XA 1GTOA 1NTZH 1NU1H 5CA0A 2FL4A 2DOSA 2E5LB 3U0ZA 1E79G 4G27B 1IZ3A 5E1AC 1WLEA 1IDSA 4GT1A 3T1YB 1SESA 4H0LB 4DUYO 3OD4A 3UM7A 5L3EA 1F7YA 3O9OA 1L0NH 2UU9B 2BSKB 2JDIG 5EIBD 5BY1A 4J7JA 3I55V 5D5QA 1CPYA 2DE0X 2VQEB 5B5EZ 4OPHA 4MTXA 2ODMA 1N0JA 3ZRXA 4EB6B 3DTUB 4AQYO 4D7TA 4JGSA 1VF7A 4LF6O 2HEPA 1M56B 5H2FZ 1KU9A 1I7FA 4Q20A 2V4DA 3BCCH 3K5OA 4F6RA 3S3WA 3G80A 2KB1A 1S76D 1FJGO 3ZMVA 4LF7B 4DV1B 4DK1A 4NXMO 1BGYH 3ABMB 4ZKIA 4MTOA 2BTQB 1S3JA 2UXCO 4ZI7B 4BIUA 2LFRA 1Y6XA 5B1BC 3GWOA 2EIKC 2XUMA 3APQA 5ITZB 1HP8A 2X0LA 1MABG 4JAUA 2YXLA 5KA5A 4X89A 2XASA 1PNKA 2L35A 2Q4PA 4LWSB 1YSCA 2F1MA 3WB2A 2UUAO 4NYKA 2CDYA 2PGGA 3P32A 5KHKA 2ZDIA 3MHHC 1KKDA 1M5IA 3OR7C 4LF5O 3T2MA 1ZTEA 1XILA 5JQGA 1SC5B 1RM1B 3CCMV 2IH1C 3JAWB 2G38A 3W7XA 2LP7A 4BWAA 3WFVA 1ZSPA 4I50B 3VQYA 1JJ2U 4FZ1A 2CTWA 1PD3A 2Q68A 4U3JA 2CH7B 2IJKA 2GSMB 2RN9A 1KC8W 1AJPA 2WLLB 3OM3B 1BQZA 3E83A 3H1HH 4J11A 5GONB 1N32B 3HR0A 2YI9A 2YXYA 3LSQA 1B04A 4UCVA 4DR7O 1WB8A 4DV0B 2Y4UA 4MVUA 4CS3A 2RJZA 3DXRA 3FYIB 4J41A 4ASUG 1HNZB 1R1BA 5BR8O 1KP3A 1ORQC 3ZHSA 2UUBO 2CTPA 4QE7A 5BMVB 1N34B 3ZCCA 5LA6B 2ZM6B 3ETEA 4WFBV 1IBMO 4DYLA 4X1KB 5A9GA 3LDCA 2PUSA 4LH6A 1W0JG 1R3IC 1JJOA 3K5LA 1SA0B 1PP9H 4YJ2A 1VF6A 1YZBA 2EJRA 3FB5C 4B7KA 1M93A 4MVOA 3GB7C 4GKKO 2DWEC 2HHHO 4YJ3A 1IVSA 2UXDO 2ADPA 3BFRA 3OTOB 3E22A 4IGGA 4K0KB 3TJTA 3VQVA 2A9HA 3SYOA 1Q86W 2PI4A 1EZVH 5KMGB 5L3GA 5LYJB 2WPDG 3IAYA 4B7EA 2ILMA 3K0DA 5EZYB 4DV6O 3L70H 3B4SA 1L0LH 4LF4B 4WBNA 2CK3G 1LR1A 4MTGA 5FNVA 4MW8A 1VARA 4NXNB 3WB1A 4BR6A 1SZTA 2BCCH 2F4VB 3ZHRA 1JCHA 1KB9F 4IIJB 1S5HC 2H3OA 1H2LA 4XBFA 4DV5B 2QKSA 4NTWA 4JTCB 4ZHQA 1DF4A 2QWOB 3HPLC 4I0XB 1THZA 5CA0B 4WFGA 3STLC 2Q67A 1WAZA 4LF9O 4B3TB 2HR3A 1LUWA 4JI0O 1NS1A 3K06A 1N33B 1BQ0A 2CGNA 1AJQA 2ZKOA 4UCUA 1OCOC 1EBOA 2N05A 1NR1A 5JH7A 2YC0A 2ZNIA 3JSLA 4QE9A 5B1AC 1KYOF 4DR1B 5LMNO 1AJNA 2EULA 3BEHA 3L72H 4PELA 1QVFU 3DC5A 1XNQO 5L3CA 1M57B 4DK0A 3FD9A 4K8ZA 2OCCC 2ZXWC 3KZIZ 2CTRA 3T1HB 3CS5A 2UXXA 4FPPA 3CXHF 4TV8A 4F6RB 4J7KA 4JTAB 3L74H 3EXAA 4P30A 2B5UA 5EC2C 4K35A 3RN4A 3CJHA 2Z3YA 1GN3A 4JYCA 3MHSC 4LCUC 2QWNB 2F66C 4B3SO 2CE4A 4I7ZB 1Q82W 1JVMA 3JAMN 2HLDG 3ZMTA 1FXKC 4I5SA 4MSWC 1MSWD 4KHPO 1XMQO 1NH2B 1OHHG 4DV4B 4ABMA 1XHXA 2HJFC 1P4RA 2EIMB 2DJVA 2GDSA 4PA4A 3IFXA 1AR1B 3NXSA 3KKYA 4EB6A 3E8GA 3JYCA 4FVMA 4LP8A 4GCZA 1IURA 4LFAO 1FFTB 4JYBA 5JWPA 3AK3A 3PJSK 4DV2O 2P4KA 2VQFB 2Z0AA 3APOA 2ZNJA 1XHZA 1R73A 3QF7A 2BE3A 2QKAA 3AG3C 1HR0O 1SS3A 1EFRG 1OCRC 3O65A 2XOKG 4ZI7A 2B9ZA 2WLHA 3BPZA 5IWAO 4C7UA 5FPOA 1R6TA 2X6CA 4MVMA 2ITCC 2A06H 2QTOA 3AG1C 3JD2A 4QPKA 5H6QA 4LWSA 2YDEA 3RYHA 5EBLC 1I0HA 1W59A 1CXZB 3H1JH 5JJJB 3JCUZ 1H2KA 3JD1A 3THOA 5BXZA 2NNUA 3JARB 3WG7C 4FK5C 2XHBA 1BS3A 1ZUQA 1PNMA 1AR5A 3UCSC 4YJ2B 1U97A 3SR2C 2QM7A 1N36O 2PYLA 3J80N 4JI8B 3IJ4A 2A79B 3RBZA 4I50A 4DW0A 4MW3A 4PA3A 1PL4A 4A5UB 4DR2B 1O9GA 4LR3A 1BHAA 2QR4A 1YITV 4BAYA 2CH7A 1JR9A 3E22B 1AVMA 4CH3A 4U7NA 1T5EA 2ZQMA 4DUZB 3FAVA 2ZR3A 4X20A 4W4LA 4ZOLA 4YHHO 1AILA 1H2GA 1N0NA 3CCQV 1H8EG 2XAQA 4WBNB 4L8JA 4O2BA 4LH7A 4UV8A 3ZRWA 4JI3B 4G28B 5IJ9B 2ATKC 1BMFG 5BMVA 2OWOA 1YVWA 4OX9O 4X62B 2K1EA 5CBGA 3N2GA 1ZWIC 2KG7A 3E2EA 4DV7B 2EIJC 4ZHQB 1B6QA 1V55C 3A0RA 1EN5A 4O2AB 1GMGA 2E76B 3FFQA 3RGBA 1D2DA 4P2ZA 1R6NA 5IYBO 2EZOA 1OCRB 3RT3C 1K33A 4R8CA 1IBLB 1SQGA 5JH7B 2HG5C 4BW9A 3OTFA 4CZZA 4JI4B 4GX5A 3AG1B 3QO7A 5LGUA 1F23A 5GTIZ 4JAVA 2ZIOA 1DK1A 1J5EB 5EZYA 1R6KA 4R7CA 3EVKA 1L8DA 1HWYA 3ETQA 3SYCA 2EINC 4UCRA 3AK1A 4DO2A 4FLYA 2ZR2A 2L6LA 1GAXA 1WN7A 5B66Z 3CMAV 1XNRO 2WSSG 3BAAA 4TV8B 1K7DA 3ASOC 1HNXB 1I5YA 4CH6A 3VQXA 1K3EA 1VIBA 2N74A 3CJHB 3ZMZA 3K5MA 1YJWV 5KHHA 1WA8A 1S72V 1JX9A 3K59A 4CC5A 1XEQA 2LJ2A 3MD0A 4LC1A 1FXHA 2Y4TA 4PA9A 3K03A 2H94A 2EBOA 4J9ZB 1XOUA 3CCVV 1K97A 5CB4A 1H38A 2Q7HA 2P06A 2QWRB 5LMUB 4JI2B 3RVZA 2DW4A 4PDRA 2Y69C 3JD0A 2ADQB 5H5NA 2QGNA 1K5SA 4X64O 2D3OW 3FX7A 4O4JA 4DV3B 5KAIZ 5LXTA 5LOVB 2WA4A 4PHZA 1H8HG 1WJZA 2ZINA 3F7VC 2ZD9A 2BOBC 2EIJB 1K34A 2LW1A 2NN4A 1QBZA 4FZ0A 4FLUA 5EYPA 3X2QC 3LDEA 1OCZC 1VF5B 4E2LA 1H2MA 5JJNB 5BZBA 4KL1A 2UXBB 1YJ9V 1S5JA 4MVSA 4JV5O 1OCCB 3CCLV 3T4DA 3SJQC 4FMTA 4BIOA 2QTSA 3A0BZ 1VQ6V 4I9QA 3K3WA 3PN1A 2LGQA 4J9YB 3FB8C 3JD4A 1G1XB 1NR7A 1BL8A 5C8YB 3RVYA 4H44B 5L3FA 2AHZA 3OTOO 3CP1A 4N23A 2JIZG 3P3NA 2V7QG 3JASB 4UFZA 1YCIA 3DC6A 3QNEA 3QO8A 3ETDA 3BABA 5CN0A 1I94B 3CX5F 3LSUA 3W7UA 4K3AA 5B3SB 2EINB 2Q0OC 3E89A 2QM4A 3RYHB 3H1LH 1FYJA 3ABLB 3K57A 1ZX3A 4DR3B 4HYOA 3DGEA 1HNWB 4IL6Z 1NZ6A 4BW5A 2PTMA 3ZS8C 2OIGA 3H1KH 3F5WC 3SYQA 3TETA 4DR5B 4DV5O 3OMIB 5KX5B 3R65A 3CCEV 3CE2A 3RFRA 2F95B 4QPJA 3JCZA 1NH2D 1Y74B 4QNHB 1EN4A 1BE3H 3SPIA 1R3KC 2XTAA 3SPJA 1OV9A 3W7SA 1AI4A 4LF8O 3SYPA 2YIDA 5K1XA 2UUCB 3ZEDA 2Q7EA 3U11A 3JD3A 2HVJC 4RO2A 3FAVB 1NTKH 4LFBO 4UB8Z 4X20B 1UFIA 3HB3B 4ZOLB 5JVDB 1NQTA 1YXBA 2WAMA 4MT8A 1TAEA 2XAFA 4FLWA 2R9IA 3OT7A 3CRAA 4UV9A 3S3XA 5H6RA 5LHGA 2Q6AA 2VWJA 4O2BB 5KHGA 5KUKA 4LFCO 1VQMV 3ZRWB 5L3BA 1FXVA 1W2BU 1FD9A 3AK2A 3N2GB 2EJ7A 2KKWA 2KG7B 2YS8A 3OGIB 3X2QB 1Q7YW 2DMXA 4G2KA 2WLMA 3JARA 3BA8A 3T1HO 2QDOA 1B06A 4XDJA 4AQYB 4JI7O 2UXNA 1SKVA 4X1IB 3ZX6A 1AI7A 4LF6B 3CCRV 2RCVA 4NKGB 2A7WA 1HDJA 5CMUA 1GK9A 2B1GA 4UVCA 5B1BB 1ROPA 2EIKB 3ETGA 1FXKA 2C2AA 1FJGB 4HZ3A 3OMNB 1IBKO 4GX2A 1XDCA 3H9VA 4NXMB 1YIJV 1AI5A 2E75B 3WU2Z 3A0HZ 1QLNA 2YIBA 1PNLA 2UXCB 3RYIA 1PM9A 4GYCB 3KCYA 3ZHQA 2AHYA 3TCUA 4JYAO 4O4HB 1FKAO 3AG4C 2ZIMA 1GM7A 4OGQB 5LHHA 2DYRC 1PV0A 5IJ9A 2X6AA 2JEXA 4PI0A 2A3QA 5IYDO 4JI6B 4F6EA 2OTJV 1UPGA 2UUAB 3LNMB 3STZC 4TSFG 3BHPA 2GHYA 4HNAA 4DR4O 1JMKC 1FS0G 4DR6O 4JI5O 4TUYA 4P9PA 4O2AA 4LF5B 2YIBD 1R3JC 1WA8B 4PDLA 1OJHA 2VRZA 2JGUA 1B3QA 1K8AW 1Q8IA 4XDLA 1QR8A 5CB4B 4HBNA 4GKJO 3U10A 3CRCA 5FLXN 1EM1A 1KKCA 3QO5A 4KUMA 3K08A 2AW9A 2OYQA 3C90A 4WCEV 1RP3B 1WP8A 2WLJA 3TGUH 4O4JB 2W0XA 3HKDA 1HW7A 2Y0PA 1VQ7V 4N21A 2Q69A 4K8XA 5LXTB 2JEUA 4JYYA 3M99B 4DR7B 3ZIAG 4PI2A 4CH5A 2CTQA 1TVKA 3TXSA 5EYPB 2IH3C 3B2EE 5BR8B 1Z5VA 1VQLV 2JJ1G 2UUBB 4IYHA 3KG2A 2EILC 3C3SA 3D3IA 4D6TH 1IBMB 1JFFA 1OZ0A 4KFMA 1EZJA 4FFBA 1TGOA 1QCEA 1P7BA 3N27A 4U3FH 1V54C 1KD1W 2LGWA 1TUEB 1AROP 3LUTB 4AHCA 2F23A 3M8AA 3AG2C 2Y48A 1RFYA 1E1QG 4GKKB 2EX3A 4X66O 2Y0IA 3OE7G 3JATA 2UXDB 2EZPA 5CA3A 2GTAA 2W6IG 1JPXA 2XNDG 3RYFA 1SQVH 1Z5WA 2PZSA 4X1YA 2F93B 3AG4B 2IW5A 3ICXA 4FFKA 1I5XA 1QU7A 5LOVA 1K9MW 4B3MO 2FYUH 4DV6B 5CBFA 3L71H 3K5NA 4FIPC 1RPOA 4J80A 2O57A 5LP6C 1COWG 4DV7O 2WLIA 4UVBA 4XDKA 3OEHG 5TISZ 1AP5A 4JI1O 3OUSA 2YSUB 2CUGA 4GLXA 4O4LA 4MVQA 1OCOB 4JZ2A 1BSMA 3C3TA 2IJHA 3FB7C 4JF3A 5C8YA 3G67A 5B1AB 5AG2A 4LF9B 4PD4F 4WFHA 3E35A 2QWPB 4JI0B 1YI2V 1DLBA 3JASA 4JTDB 3ASNC 4D7SA 3SJAC 4EFBA 4WFAV 1K5QA 1JQ0A 4RUEA 1UJWB 3CC4V 2Q73A 1J5EO 4YY3B 2GTSA 1MA1A 5HFMA 3IC9A 2OCCB 2ZXWB 2E3CA 3DSQA 4X65O 5LMNB 1XMOO 2HVKC 2ZCEA 1S0VA 1URFA 2AXTZ 3ZMSA 3HKEA 3VOUA 5CA1A 2EILB 3ZN0A 1XBLA 5KX5A 3CMEV 3OAAG 2KSDA 1Y74A 4YIOA 4FLZA 4I4TA 2E5LO 1V54B 3H1IH 1M4UA 3UO2A 2YEVA 5L3DA 2FMLA 3LNNA 1FXKB 1ZL8A 3T1YO 3CXCU 2R9RB 4JPRA 2P67A 3NR7A 3K79A 5JVDA 4PA7A 3IC7A 3RYIB 4B3SB 2UU9O 1NT2B 2IM9A 3E86A 1ZAUA 1PPJH 2R9AA 4FLTA 2ARHA 5LMUO 4KP4A 2VQEO 4KHPB 1XMQB 3CRRA 2HJDA 1P84F 4JASA 3AG7A 2CAZC 1F4NA 2P5OA 5J2UA 4RWUA 1QVGU 2IJJA 3D36C 5D5PA 1VP7A 4B3RB 3MDSA 1LNQA 4HNAB 2XAHA 4TUYB 5LHIA 4H33A 4X1IA 4LFAB 3SDLA 1NI8A 2M6YA 3AG3B 3E8BA 2RMKB 2Q9LA 2WWWA 4TWKA 4TV9A 4BIZA 5H9CA 4LF7O 4DV1O 3B40A 4DV2B 1M56C 4JZGA 1L1FA 5IYZA 2AZ2A 1KECA 1DF5A 2YXHA 3ZBHA 3EFFK 3I56V 2M7WA 4LNUA 1QR9A 2DWDC 3N2KB 3OMAB 1HR0B 3HKCB 4YIPA 3SYAA 4FLVA 3J81N 1VQNV 3MAQA 5J9PC 2OIEA 4NTYA 3ABMC 1KBHA 3HKDB 2VWKA 1I94O 1AR4A 1F4MA 5IWAB 4O4HA 1K92A 3WG7B 1TVKB 5DN6G 4CH4A 3K9AA 4DR3O 2ZE7A 2JVDA 1SQBH 2QM8A 1JFFB 4CS4A 4FFBB 1K4DC 3LSSA 1VQ8V 1XREA 2QWQB 3R66A 3CHXA 1MZFA 1S77D 1Q6IA 2IU3A 1NKDA 4NVPA 2X7RB 1SQQH 4FM1A 3VQWA 1GN6A 1Y67A 3RW0A 2NR5A 1N36B 2GUZB 3L75H 3P30A 2XT9A 4FM0A 1N32O 3ZHVA 2OCHA 4GX1A 3JATB 2HFEC 4B08A 4DV0O 3RYFB 4X1YB 4U7OA 1HNZO 1SZXA 1EN6A 4YHHB 2QEXV 2PY5A 1Y66A 3B8MA 4MVZA 1N4CA 4UB6Z 2H8PC 1N34O 1VEWA 1VQ5V 1FFXA 2ZM6O 1V55B 1QQCA 5J2TB 3L73H 5CBHA 1S5LZ 2ITDC 2NLJC 2WLIB 1KMIZ 1X4TA 3ABKC 1D5AA 3CYOA 5B1NA 4OX9B 1SQFA 2VS0A 3J7AU 2FKXA 5DM6V 3RYCA 1WB7A 1BHBA 1M9NA 3ZRVA 4O4LB 2QA4V 1VQKV 1WPBA 1V9PA 1DTOA 2GV9A 3CCUV 1ZLZA 5LL6Y 1H2NA 4CBCA 4K0KO 4J10A 5IJ0B 1TUBA 2P7TC 4NR1A 3K58A 3UT5B 4EFEA 1MMMA 5FL7G 1VQOV 1D5NA 1P7GA 4LF4O 3ZRSA 2LQTA 4RUFA 2Z5UA 1Q3EA 3TK1A 5KA6A 3TXQA 3I5DA 5EC1C 1Q6UA 1JA8A 4NXNO 3ASOB 3HKEB 3CCSV 2F4VO 1G6UA 1E1RG 5CA1B 2E74B 1YDXA 2KQXA 3CRMA 4I55B 4JI6O 3W7WA 3G4SV 1SQXH 5IT9N 2Q8VA 1YF2A 3WB0A 4I4TB 1XNRB 5K1PA 4X88A 2YI8A 4NB5A 3UO3A 5GW7A 2YEVB 3ZHUA 4B3TO 5EIBC 3SPCA 4EKWA 1ZL8B 5C93A 1RSOB 3G6BA 4DW1A 1N33O 4Q6GA 5HFLA 1Q90D 4LBEC 2DN9A 2W6JG 1QHTA 4MTFA 2Y69B 2LFSA 3HKBB 4JAAA 1MG1A 4DR1O 4DUYB 1N8RW 3ABTA 2ETNA 1W0KG 4I9WA 3ZMUA 1A32A 3SPGA 4R6ZA 4PDMA 2JRIA 5JCOA 3QG5A 4OXSA 3W7TA 2BOCC 4H13B 2JGDA 5J2UB 1AB3A 1M1KW 1OCZB 4Z1VA 2Q0AA 2IJIA 4X8AA 4DRXB 2YICA 1YTFB 4X64B 4NTXA 3ABKB 3CB2A 1P49A 4J42A 5F2VO 3H01A 3KCXA 1XL6A 2X6BA 2OT5A 2W0FC 4PA6A 4TV9B 1M57C 1G4YB 4AILC 4FM2A 5LGTA 1WNSA 2FTKA 2RNBA 3OGCC 5IYZB 1CP9A 1FPOA 4JV5B 1TA8A 4LNUB 4Z2WA 1J95A 4ZIBA 3CC2V 3ABUA 5IDJA 3P3PA 3BY6A 1KUQA 1XUQA 4CC6A 3CCJV 4RAIA 3FB6C 4P9OA 4DV4O 2DQ0A 4FJCC 4R50A 4CS2A 1GRJA 4GZRB 1KP2A 1U96A 3UQ8A 3D3QA 4WF9V 3CWBH 3ZJZA 3E8HA 4OPAA 4RQEA 4QJFB 4PJ0Z 1NBMG 5LP6A 5EBMC 1ENVA 2EIMC 2WLNA 2F43G 3OFNG 2VQFO 2ZDIC 3ML0A 5KHJA 1Y76A 1VMGA 2ZE5A 4HAMA 3GVMA 4O4IB 1GH6A 2GBOA 1VQPV 1M90W 4MVRA 2MK3A 5IY5C 1MSDA 1IXMA 1PL0A 1GM8A 3A8TA 4UUJC 1WPXA 1CEZA 5GTHZ 5B1OA 3N2KA 4LF8B 3HKCA 4IHJA 1LUVA 2ZE8A 2P4VA 4H37A 4LFBB 3Q4HA 2AZ0A 5FPRA 2JS5A 3JAKA 1KQSU 3B09A 3ZHTA 4YY3O 2PF4E 5JCOC 1FFXB 4KXRA 4WFFA 3JSNA 4GX0A 4LFCB 5EK0A 1BCCH 1NJIW 3RYCB 2DQ3A 1SETA 4YXWG 2JK5C 3RWRD 4TQFA 1PKXA 4JI8O 5EBWC 1Q5OA 4IYIA 5DEDA 4DR2O 4JI7B 1DGSA 4TQDA 2GUZA 3JALA 1VF6C 3T4ZA 4DUZO 1TUBB 2HHHB 5KAFZ 4W4KA 1AP6A 4WFEA 1IBKB 2DYRB 5KUMA 1K4CC 1NVPD 4GUNA 4JI3O 2BSKA 3D36A 2QKCA 4X62O 5J2TA 1GKFA 4JYAB 1XI1A 4B3RO 3CSXA 2HP8A 2RDCA 1QLEC 1GN2A 3CRQA 1GO3F 5KLVH 2DYSC 2RQ6A 5JJEB 1I08A 1US6A 2XAJA 1NTMH 5JQGB 2PYJA 3L9DA 5E79Z 4QGPA 5IY5B 3G71V 3K9SA 4DR4B 1QNMA 4DR6B 4JI5B 1IBLO 1XL4A 3IGAC 3CEIA 3E8FA 3VBBA 3EHBB 2JS3A 5LBQA 2N04A 5IJ0A 4JI4O 2K9PA 2MW2B 2BTOA 3FYEB 4U3JB 3A2FA 2JJ2G 2BTQA 1IXBA 1O9HA 3UT5A 3UKMA 2QJ1A 1Q6HA 3OEEG 5DECA 4GKJB 4Z1MG 2CGOA 2JGDB 5ITZA 1YJNV 2ZT9B 4ICGA 3BRCA 3K04A 3DXRB 4F4LA 1AI6A 1XNQB 3QTCA 1F51A 1Z2GA 1BT8A 3QVNA 4I55A 3G6EV 1HNXO 2V1DA 2R70A 5LGNA 3F5TA 2P90A 4DXWA 3F7YC 4E4EA 2IBZH 2D2CB 3BVOA 3AG2B 1RSOA 4UCOA 3JAWA 1VQ4V 3OW2U 3SGIA 2OTLV 2AGAA 2LW7A 1BZKA 4X9QA 4AI8A 1JOYA 1GN4A 4YJ3B 3HKBA 3OUFA 4TOIA 4UXNA 1YEWA 4JI2O 3D8CA 3K0GA 3B8NA 5A2QN 3BA9A 2WLLA 1Y4MA 4X66B 4DV3O 1Q81W 5GONA 1MOFA 2A0LA 1YHQV 1FAFA 4UVAA 1H2SB 5LP6B 1MNGA 4DRXA 1QLEB 5IE9A 3GWKC 4MS2A 4RQFA 4IT5A 2DYSB 5KHIA 5FNVB 1SF9A 2UXBO 4B3MB 2WA3A 1XQ8A 1Y76B 5LA6A 3OR6C 4J7ZA 3SJCC 4X1KA 3T1CA 2IU0A 2P6JA 2WLKA 1SA0A 3M7MX 2XAGA 1Q43A 1GM9A 2HKOA 2ZE6A 3ASNB 4JI1B 1OCCC 3CC7V 4IHJB 4L87A 3B77A 4EEQA 1YTFD 1SRYA 3ZN1A 4PDVA 4ZBMA 3CD6V 2Q7GA 3Q4HB
chains in the Genus database with same CATH topology
3LNMB 3STZC 5KA6A 4TSFG 2GHYA 5EC1C 1FS0G 3AG3C 3ASOB 4P9PA 3CCSV 1EFRG 1OCRC 1E1RG 1R3JC 2XOKG 4TT3G 3FKSG 4PDLA 3W7WA 3G4SV 2WLHA 2B1IA 1K8AW 2X6CA 4X88A 4MVMA 2ITCC 1G8MA 3CPWU 2QE7G 5B3SC 2QTOA 5GW7A 2YEVB 3AG1C 2PI5A 3JD2A 4QPKA 5H6QA 4XDLA 1QR8A 3SPCA 1SERA 1NVPB 4EKWA 5C93A 3ABLC 5HFLA 3LDDA 3QO5A 5EBLC 4KUMA 3AEIA 4LBEC 3K08A 4WCEV 1RM1C 2WLJA 2W6JG 1RPRA 5IYCO 3SPHA 3JD1A 1K73W 4QIWF 1R3LC 2NNUA 1VQ7V 1VQ9V 4MTFA 4N21A 2Q69A 2Y69B 3WG7C 2LFSA 2JEUA 1GTOA 1MG1A 4FK5C 1N8RW 3M99B 3ABTA 3ZIAG 1E79G 4G27B 1PNMA 1W0KG 4I9WA 3ZMUA 5E1AC 3SPGA 4R6ZA 1WLEA 4PDMA 2IH3C 2QM7A 1VQLV 4OXSA 3W7TA 4GT1A 2BOCC 2A79B 3RBZA 2JJ1G 1SESA 1M1KW 1OCZB 3KG2A 4MW3A 4PA3A 2EILC 3UM7A 1BHAA 5L3EA 3D3IA 2IJIA 4X8AA 1YTFB 1YITV 1OZ0A 3ABKB 1EZJA 4KFMA 4BAYA 2JDIG 3I55V 4U7NA 2ZQMA 1QCEA 1CPYA 2ZR3A 1P7BA 1V54C 3H01A 1KD1W 1TUEB 1XL6A 1AROP 2OT5A 2W0FC 2X6BA 4PA6A 1M57C 3LUTB 1G4YB 4MTXA 3ZRXA 1H2GA 3CCQV 3DTUB 5LGTA 2FTKA 3AG2C 3OGCC 1H8EG 2Y48A 1CP9A 2XAQA 4JGSA 1E1QG 1M56B 3OE7G 4UV8A 2EZPA 3ZRWA 4G28B 5CA3A 1J95A 2ATKC 1BMFG 2W6IG 1JPXA 4Q20A 2XNDG 3CC2V 3ABUA 5IDJA 2K1EA 3BY6A 3AG4B 5CBGA 1ZWIC 3CCJV 2KB1A 4RAIA 3FB6C 4P9OA 2IW5A 1S76D 3E2EA 2EIJC 1B6QA 1V55C 3A0RA 3ZMVA 2DQ0A 1I5XA 4FJCC 4R50A 1K9MW 5CBFA 1KP2A 3ABMB 4ZKIA 4MTOA 1S3JA 4FIPC 1GMGA 4WF9V 3ZJZA 3E8HA 1RPOA 4P2ZA 1R6NA 1COWG 4BIUA 2LFRA 5IYBO 4RQEA 5B1BC 2WLIA 2EZOA 1OCRB 4QJFB 3GWOA 2EIKC 1K33A 4R8CA 4UVBA 1NBMG 2X0LA 1MABG 4XDKA 3OEHG 5EBMC 4JAUA 1ENVA 2EIMC 5KA5A 4X89A 3OUSA 2WLNA 2HG5C 2XASA 1PNKA 2F43G 2YSUB 3OFNG 4CZZA 4MVQA 4GX5A 1OCOB 2ZDIC 3AG1B 1YSCA 3ML0A 3QO7A 1F23A 5LGUA 2IJHA 3FB7C 4JAVA 4HAMA 4JF3A 5B1AB 3P32A 1VQPV 1M90W 2ZDIA 1R6KA 3MHHC 1KKDA 4R7CA 4MVRA 3OR7C 4WFHA 2MK3A 3E35A 3T2MA 5IY5C 1HWYA 1DLBA 1YI2V 4JTDB 3ASNC 3SYCA 2EINC 1RM1B 1IXMA 4WFAV 4DO2A 1K5QA 1PL0A 1GM8A 2ZR2A 4UUJC 1JQ0A 1WPXA 3CCMV 1CEZA 4RUEA 2IH1C 1UJWB 5B1OA 3CC4V 3CMAV 2WSSG 3W7XA 2LP7A 5HFMA 2OCCB 2ZXWB 3WFVA 1K7DA 3ASOC 4H37A 1JJ2U 1I5YA 1K3EA 1KQSU 2HVKC 1PD3A 2Q68A 1S0VA 3ZMSA 2IJKA 3ZMZA 2GSMB 3VOUA 1KC8W 2EILB 3ZN0A 1YJWV 4WFFA 1AJPA 2WLLB 3OM3B 1S72V 1JX9A 3E83A 3CMEV 3OAAG 4GX0A 5EK0A 3MD0A 3LSQA 4LC1A 1FXHA 4MVUA 1V54B 4PA9A 3K03A 2H94A 1NJIW 2EBOA 2DQ3A 2YEVA 4J9ZB 1SETA 4YXWG 3FYIB 2JK5C 5L3DA 4ASUG 3CCVV 1FXKB 1K97A 1H38A 1KP3A 1ORQC 1PKXA 5EBWC 3CXCU 4QE7A 2R9RB 2DW4A 4JPRA 4PDRA 3RVZA 3ZCCA 2P67A 2Y69C 3JD0A 3ETEA 4WFBV 3K79A 1K5SA 2D3OW 4PA7A 3IC7A 3E86A 3LDCA 1W0JG 1R3IC 3T4ZA 1H8HG 3F7VC 4KP4A 2ZD9A 2BOBC 2EIJB 1K34A 1QBZA 3X2QC 3LDEA 1OCZC 4E2LA 4JASA 2EJRA 3FB5C 5BZBA 4MVOA 4WFEA 3GB7C 1YJ9V 1F4NA 4MVSA 2DYRB 1QVGU 5KUMA 2DWEC 2IJJA 1K4CC 1OCCB 3CCLV 1NVPD 1LNQA 3T4DA 3SJQC 4FMTA 2XAHA 3D36A 5LHIA 4H33A 1VQ6V 2A9HA 3SYOA 1Q86W 2PI4A 3K3WA 5L3GA 1GKFA 2WPDG 3AG3B 3E8BA 4J9YB 2WWWA 3FB8C 3JD4A 1QLEC 1NR7A 4TWKA 1BL8A 4BIZA 5H9CA 1GO3F 3RVYA 5L3FA 2AHZA 3K0DA 2DYSC 3CP1A 4N23A 2JIZG 1M56C 1L1FA 1KECA 2V7QG 2XAJA 1DF5A 3QNEA 3QO8A 2CK3G 3ETDA 5CN0A 4MTGA 3EFFK 3I56V 2M7WA 4MW8A 5IY5B 3G71V 3W7UA 5B3SB 1QR9A 2DWDC 3OMAB 2EINB 1SZTA 1XL4A 3E89A 3IGAC 1JCHA 3SYAA 3E8FA 3VBBA 1VQNV 3ABLB 1S5HC 4XBFA 3EHBB 5J9PC 2QKSA 3ABMC 5LBQA 4JTCB 1DF4A 4HYOA 3DGEA 1F4MA 3HPLC 4BW5A 3FYEB 1THZA 2JJ2G 4WFGA 3STLC 1K92A 2Q67A 3F5WC 3SYQA 3TETA 3WG7B 3UKMA 3OMIB 3R65A 3OEEG 5DN6G 3CCEV 2HR3A 3K9AA 4QPJA 3K06A 3JCZA 1NH2D 4Z1MG 4QNHB 1YJNV 1AJQA 3SPIA 2QM8A 1R3KC 1OCOC 1EBOA 3K04A 3SPJA 1NR1A 3W7SA 1AI4A 1AI6A 3SYPA 4F4LA 1K4DC 3LSSA 4QE9A 1VQ8V 1F51A 5B1AC 3JD3A 2HVJC 4RO2A 1S77D 2IU3A 1NKDA 3G6EV 2X7RB 1AJNA 3HB3B 2V1DA 3RW0A 3BEHA 1NQTA 5LGNA 2WAMA 4MT8A 4PELA 1QVFU 2XAFA 5L3CA 3P30A 2P90A 2R9IA 4DXWA 1M57B 3F7YC 4UV9A 5H6RA 5LHGA 2OCCC 2Q6AA 2ZXWC 3AG2B 5KUKA 4GX1A 2UXXA 1VQMV 3ZRWB 1VQ4V 5L3BA 1FXVA 3OW2U 4FPPA 1W2BU 2HFEC 2OTLV 4JTAB 4U7OA 3X2QB 1Q7YW 4G2KA 2WLMA 1JOYA 4P30A 2B5UA 2QEXV 3OUFA 5EC2C 4UXNA 1Y66A 3B8MA 4MVZA 2H8PC 4XDJA 2Z3YA 3B8NA 3K0GA 2UXNA 4JYCA 1VQ5V 3MHSC 1V55B 2WLLA 4LCUC 1Y4MA 1AI7A 5CBHA 1Q81W 3CCRV 1MOFA 2A0LA 2ITDC 2NLJC 1Q82W 2WLIB 1JVMA 1YHQV 3ABKC 2HLDG 5CMUA 3ZMTA 1FXKC 1GK9A 3CYOA 4I5SA 4UVAA 5B1NA 2B1GA 4UVCA 4MSWC 1MSWD 5B1BB 5DM6V 1QLEB 1NH2B 4MS2A 1ROPA 4RQFA 2EIKB 1OHHG 3ETGA 1FXKA 2C2AA 2DYSB 1BHBA 4HZ3A 1M9NA 3OMNB 3ZRVA 4GX2A 2HJFC 1P4RA 2EIMB 2QA4V 1VQKV 1YIJV 1AI5A 4PA4A 1QLNA 3IFXA 1PNLA 1AR1B 1DTOA 3NXSA 3OR6C 3CCUV 3T1CA 3E8GA 3JYCA 2IU0A 4CBCA 2AHYA 4LP8A 4GCZA 2P6JA 2WLKA 3TCUA 1FFTB 4JYBA 2P7TC 2XAGA 3AG4C 1GM7A 1GM9A 3PJSK 5LHHA 2DYRC 2HKOA 3ASNB 1OCCC 3CC7V 5FL7G 1VQOV 2X6AA 2JEXA 4L87A 3B77A 1YTFD 1SRYA 3ZN1A 4PDVA 5IYDO 1R73A 4ZBMA 3ZRSA 3CD6V 4RUFA 2OTJV 2Z5UA 3TK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYP A;  3LNM B;  5EBW C;  1K4D C;  3STZ C;  5CBG A;  1ZWI C;  2KB1 A;  2R9R B;  4PDR A;  3FB6 C;  4QE7 A;  4QE9 A;  4P9O A;  4RAI A;  5EC1 C;  5B1A C;  3RVZ A;  3AG3 C;  2Y69 C;  2EIJ C;  2HVJ C;  4P9P A;  4RO2 A;  1V55 C;  4PA7 A;  1OCR C;  4R50 A;  3E86 A;  3LDC A;  1R3J C;  5CBF A;  4PDL A;  1R3I C;  3RW0 A;  3BEH A;  4MTO A;  3T4Z A;  3ZJZ A;  3E8H A;  3F7V C;  2WLH A;  2ZD9 A;  4P2Z A;  2BOB C;  4DXW A;  3F7Y C;  5B1B C;  2WLI A;  2X6C A;  4X88 A;  4MVM A;  2ITC C;  3X2Q C;  3LDE A;  1OCZ C;  2EIK C;  2OCC C;  2Q6A A;  2QTO A;  2ZXW C;  5B3S C;  4R8C A;  3AG1 C;  3FB5 C;  5BZB A;  4GX1 A;  4MVO A;  4WFE A;  3GB7 C;  5KUK A;  4XDK A;  4XDL A;  3SPC A;  4MVS A;  5EBM C;  4EKW A;  5KUM A;  2DWE C;  2EIM C;  2HFE C;  1K4C C;  4X89 A;  3ABL C;  3OUS A;  1LNQ A;  2WLN A;  2HG5 C;  3T4D A;  3SJQ C;  4JTA B;  3LDD A;  5EBL C;  2WLM A;  4LBE C;  3K08 A;  4GX5 A;  4MVQ A;  4H33 A;  4P30 A;  2WLJ A;  3OUF A;  5EC2 C;  2A9H A;  3SYO A;  4MVZ A;  3SPH A;  3FB7 C;  2H8P C;  4XDJ A;  1R3L C;  3K0G A;  3E8B A;  4MTF A;  2Q69 A;  3WG7 C;  4J9Y B;  1KKD A;  3FB8 C;  4R7C A;  4MVR A;  2WLL A;  3OR7 C;  1QLE C;  4LCU C;  4TWK A;  1BL8 A;  4WFH A;  3T2M A;  5IY5 C;  3RVY A;  4JTD B;  3ASN C;  4G27 B;  3SYC A;  4I9W A;  2AHZ A;  2ITD C;  2A0L A;  2DYS C;  2EIN C;  2NLJ C;  3K0D A;  5E1A C;  2WLI B;  3SPG A;  4R6Z A;  1JVM A;  1M56 C;  3ABK C;  4PDM A;  2IH3 C;  4UUJ C;  4RUE A;  2IH1 C;  4OXS A;  2BOC C;  2A79 B;  4MSW C;  3RBZ A;  4MTG A;  3EFF K;  4MW8 A;  4MS2 A;  3KG2 A;  4MW3 A;  4PA3 A;  2DWD C;  2EIL C;  3UM7 A;  4X8A A;  1XL4 A;  3E89 A;  4HZ3 A;  3ASO C;  4H37 A;  3IGA C;  4KFM A;  4GX2 A;  3SYA A;  2HJF C;  3E8F A;  1S5H C;  2HVK C;  2Q68 A;  5J9P C;  2QKS A;  3ABM C;  4PA4 A;  3IFX A;  4JTC B;  4HYO A;  3VOU A;  1P7B A;  3OR6 C;  1V54 C;  3HPL C;  3T1C A;  4WFF A;  3E8G A;  1XL6 A;  4BW5 A;  2WLL B;  2X6B A;  3JYC A;  2W0F C;  4PA6 A;  4CBC A;  1M57 C;  2AHY A;  1G4Y B;  3E83 A;  3LUT B;  4LP8 A;  4WFG A;  3STL C;  2WLK A;  3TCU A;  2Q67 A;  3F5W C;  3SYQ A;  5CBH A;  4GX0 A;  3TET A;  2P7T C;  3AG2 C;  3UKM A;  3OGC C;  5EK0 A;  3AG4 C;  3R65 A;  3PJS K;  2DYR C;  3K06 A;  1OCC C;  4MVU A;  4PA9 A;  3K03 A;  2X6A A;  4J9Z B;  2YEV A;  4QNH B;  2JK5 C;  4G28 B;  3SPI A;  1J95 A;  1R3K C;  2ATK C;  4PDV A;  4ZBM A;  1OCO C;  3K04 A;  3ZRS A;  3SPJ A;  1ORQ C;  4RUF A;  2K1E A;  4F4L A; 
#chains in the Genus database with same CATH topology
 3JAK B;  4PV1 B;  2YIA A;  2R72 A;  5KMG A;  5LYJ A;  4TT3 G;  3FKS G;  1X59 A;  2YUA A;  2P22 C;  1HNW O;  2B1I A;  2LO1 A;  3CPW U;  1G8M A;  4FLX A;  2QE7 G;  5B3S C;  4X65 B;  4DR5 O;  2PI5 A;  1SER A;  1NVP B;  1XMO B;  4UCS A;  3ABL C;  4UCT A;  2Q5Z A;  2FB5 A;  3LDD A;  1SQP H;  3AEI A;  3SJB C;  4IIJ A;  4O4I A;  1RM1 C;  1RPR A;  5IYC O;  1MZE A;  1WP7 A;  3SPH A;  1K73 W;  2QSA A;  3JAL B;  4QIW F;  1R3L C;  1IX9 A;  1VQ9 V;  2UUC O;  4I0X A;  1GTO A;  1NTZ H;  1NU1 H;  5CA0 A;  2FL4 A;  2DOS A;  2E5L B;  3U0Z A;  1E79 G;  4G27 B;  1IZ3 A;  5E1A C;  1WLE A;  1IDS A;  4GT1 A;  3T1Y B;  1SES A;  4H0L B;  4DUY O;  3OD4 A;  3UM7 A;  5L3E A;  1F7Y A;  3O9O A;  1L0N H;  2UU9 B;  2BSK B;  2JDI G;  5EIB D;  5BY1 A;  4J7J A;  3I55 V;  5D5Q A;  1CPY A;  2DE0 X;  2VQE B;  5B5E Z;  4OPH A;  4MTX A;  2ODM A;  1N0J A;  3ZRX A;  4EB6 B;  3DTU B;  4AQY O;  4D7T A;  4JGS A;  1VF7 A;  4LF6 O;  2HEP A;  1M56 B;  5H2F Z;  1KU9 A;  1I7F A;  4Q20 A;  2V4D A;  3BCC H;  3K5O A;  4F6R A;  3S3W A;  3G80 A;  2KB1 A;  1S76 D;  1FJG O;  3ZMV A;  4LF7 B;  4DV1 B;  4DK1 A;  4NXM O;  1BGY H;  3ABM B;  4ZKI A;  4MTO A;  2BTQ B;  1S3J A;  2UXC O;  4ZI7 B;  4BIU A;  2LFR A;  1Y6X A;  5B1B C;  3GWO A;  2EIK C;  2XUM A;  3APQ A;  5ITZ B;  1HP8 A;  2X0L A;  1MAB G;  4JAU A;  2YXL A;  5KA5 A;  4X89 A;  2XAS A;  1PNK A;  2L35 A;  2Q4P A;  4LWS B;  1YSC A;  2F1M A;  3WB2 A;  2UUA O;  4NYK A;  2CDY A;  2PGG A;  3P32 A;  5KHK A;  2ZDI A;  3MHH C;  1KKD A;  1M5I A;  3OR7 C;  4LF5 O;  3T2M A;  1ZTE A;  1XIL A;  5JQG A;  1SC5 B;  1RM1 B;  3CCM V;  2IH1 C;  3JAW B;  2G38 A;  3W7X A;  2LP7 A;  4BWA A;  3WFV A;  1ZSP A;  4I50 B;  3VQY A;  1JJ2 U;  4FZ1 A;  2CTW A;  1PD3 A;  2Q68 A;  4U3J A;  2CH7 B;  2IJK A;  2GSM B;  2RN9 A;  1KC8 W;  1AJP A;  2WLL B;  3OM3 B;  1BQZ A;  3E83 A;  3H1H H;  4J11 A;  5GON B;  1N32 B;  3HR0 A;  2YI9 A;  2YXY A;  3LSQ A;  1B04 A;  4UCV A;  4DR7 O;  1WB8 A;  4DV0 B;  2Y4U A;  4MVU A;  4CS3 A;  2RJZ A;  3DXR A;  3FYI B;  4J41 A;  4ASU G;  1HNZ B;  1R1B A;  5BR8 O;  1KP3 A;  1ORQ C;  3ZHS A;  2UUB O;  2CTP A;  4QE7 A;  5BMV B;  1N34 B;  3ZCC A;  5LA6 B;  2ZM6 B;  3ETE A;  4WFB V;  1IBM O;  4DYL A;  4X1K B;  5A9G A;  3LDC A;  2PUS A;  4LH6 A;  1W0J G;  1R3I C;  1JJO A;  3K5L A;  1SA0 B;  1PP9 H;  4YJ2 A;  1VF6 A;  1YZB A;  2EJR A;  3FB5 C;  4B7K A;  1M93 A;  4MVO A;  3GB7 C;  4GKK O;  2DWE C;  2HHH O;  4YJ3 A;  1IVS A;  2UXD O;  2ADP A;  3BFR A;  3OTO B;  3E22 A;  4IGG A;  4K0K B;  3TJT A;  3VQV A;  2A9H A;  3SYO A;  1Q86 W;  2PI4 A;  1EZV H;  5KMG B;  5L3G A;  5LYJ B;  2WPD G;  3IAY A;  4B7E A;  2ILM A;  3K0D A;  5EZY B;  4DV6 O;  3L70 H;  3B4S A;  1L0L H;  4LF4 B;  4WBN A;  2CK3 G;  1LR1 A;  4MTG A;  5FNV A;  4MW8 A;  1VAR A;  4NXN B;  3WB1 A;  4BR6 A;  1SZT A;  2BCC H;  2F4V B;  3ZHR A;  1JCH A;  1KB9 F;  4IIJ B;  1S5H C;  2H3O A;  1H2L A;  4XBF A;  4DV5 B;  2QKS A;  4NTW A;  4JTC B;  4ZHQ A;  1DF4 A;  2QWO B;  3HPL C;  4I0X B;  1THZ A;  5CA0 B;  4WFG A;  3STL C;  2Q67 A;  1WAZ A;  4LF9 O;  4B3T B;  2HR3 A;  1LUW A;  4JI0 O;  1NS1 A;  3K06 A;  1N33 B;  1BQ0 A;  2CGN A;  1AJQ A;  2ZKO A;  4UCU A;  1OCO C;  1EBO A;  2N05 A;  1NR1 A;  5JH7 A;  2YC0 A;  2ZNI A;  3JSL A;  4QE9 A;  5B1A C;  1KYO F;  4DR1 B;  5LMN O;  1AJN A;  2EUL A;  3BEH A;  3L72 H;  4PEL A;  1QVF U;  3DC5 A;  1XNQ O;  5L3C A;  1M57 B;  4DK0 A;  3FD9 A;  4K8Z A;  2OCC C;  2ZXW C;  3KZI Z;  2CTR A;  3T1H B;  3CS5 A;  2UXX A;  4FPP A;  3CXH F;  4TV8 A;  4F6R B;  4J7K A;  4JTA B;  3L74 H;  3EXA A;  4P30 A;  2B5U A;  5EC2 C;  4K35 A;  3RN4 A;  3CJH A;  2Z3Y A;  1GN3 A;  4JYC A;  3MHS C;  4LCU C;  2QWN B;  2F66 C;  4B3S O;  2CE4 A;  4I7Z B;  1Q82 W;  1JVM A;  3JAM N;  2HLD G;  3ZMT A;  1FXK C;  4I5S A;  4MSW C;  1MSW D;  4KHP O;  1XMQ O;  1NH2 B;  1OHH G;  4DV4 B;  4ABM A;  1XHX A;  2HJF C;  1P4R A;  2EIM B;  2DJV A;  2GDS A;  4PA4 A;  3IFX A;  1AR1 B;  3NXS A;  3KKY A;  4EB6 A;  3E8G A;  3JYC A;  4FVM A;  4LP8 A;  4GCZ A;  1IUR A;  4LFA O;  1FFT B;  4JYB A;  5JWP A;  3AK3 A;  3PJS K;  4DV2 O;  2P4K A;  2VQF B;  2Z0A A;  3APO A;  2ZNJ A;  1XHZ A;  1R73 A;  3QF7 A;  2BE3 A;  2QKA A;  3AG3 C;  1HR0 O;  1SS3 A;  1EFR G;  1OCR C;  3O65 A;  2XOK G;  4ZI7 A;  2B9Z A;  2WLH A;  3BPZ A;  5IWA O;  4C7U A;  5FPO A;  1R6T A;  2X6C A;  4MVM A;  2ITC C;  2A06 H;  2QTO A;  3AG1 C;  3JD2 A;  4QPK A;  5H6Q A;  4LWS A;  2YDE A;  3RYH A;  5EBL C;  1I0H A;  1W59 A;  1CXZ B;  3H1J H;  5JJJ B;  3JCU Z;  1H2K A;  3JD1 A;  3THO A;  5BXZ A;  2NNU A;  3JAR B;  3WG7 C;  4FK5 C;  2XHB A;  1BS3 A;  1ZUQ A;  1PNM A;  1AR5 A;  3UCS C;  4YJ2 B;  1U97 A;  3SR2 C;  2QM7 A;  1N36 O;  2PYL A;  3J80 N;  4JI8 B;  3IJ4 A;  2A79 B;  3RBZ A;  4I50 A;  4DW0 A;  4MW3 A;  4PA3 A;  1PL4 A;  4A5U B;  4DR2 B;  1O9G A;  4LR3 A;  1BHA A;  2QR4 A;  1YIT V;  4BAY A;  2CH7 A;  1JR9 A;  3E22 B;  1AVM A;  4CH3 A;  4U7N A;  1T5E A;  2ZQM A;  4DUZ B;  3FAV A;  2ZR3 A;  4X20 A;  4W4L A;  4ZOL A;  4YHH O;  1AIL A;  1H2G A;  1N0N A;  3CCQ V;  1H8E G;  2XAQ A;  4WBN B;  4L8J A;  4O2B A;  4LH7 A;  4UV8 A;  3ZRW A;  4JI3 B;  4G28 B;  5IJ9 B;  2ATK C;  1BMF G;  5BMV A;  2OWO A;  1YVW A;  4OX9 O;  4X62 B;  2K1E A;  5CBG A;  3N2G A;  1ZWI C;  2KG7 A;  3E2E A;  4DV7 B;  2EIJ C;  4ZHQ B;  1B6Q A;  1V55 C;  3A0R A;  1EN5 A;  4O2A B;  1GMG A;  2E76 B;  3FFQ A;  3RGB A;  1D2D A;  4P2Z A;  1R6N A;  5IYB O;  2EZO A;  1OCR B;  3RT3 C;  1K33 A;  4R8C A;  1IBL B;  1SQG A;  5JH7 B;  2HG5 C;  4BW9 A;  3OTF A;  4CZZ A;  4JI4 B;  4GX5 A;  3AG1 B;  3QO7 A;  5LGU A;  1F23 A;  5GTI Z;  4JAV A;  2ZIO A;  1DK1 A;  1J5E B;  5EZY A;  1R6K A;  4R7C A;  3EVK A;  1L8D A;  1HWY A;  3ETQ A;  3SYC A;  2EIN C;  4UCR A;  3AK1 A;  4DO2 A;  4FLY A;  2ZR2 A;  2L6L A;  1GAX A;  1WN7 A;  5B66 Z;  3CMA V;  1XNR O;  2WSS G;  3BAA A;  4TV8 B;  1K7D A;  3ASO C;  1HNX B;  1I5Y A;  4CH6 A;  3VQX A;  1K3E A;  1VIB A;  2N74 A;  3CJH B;  3ZMZ A;  3K5M A;  1YJW V;  5KHH A;  1WA8 A;  1S72 V;  1JX9 A;  3K59 A;  4CC5 A;  1XEQ A;  2LJ2 A;  3MD0 A;  4LC1 A;  1FXH A;  2Y4T A;  4PA9 A;  3K03 A;  2H94 A;  2EBO A;  4J9Z B;  1XOU A;  3CCV V;  1K97 A;  5CB4 A;  1H38 A;  2Q7H A;  2P06 A;  2QWR B;  5LMU B;  4JI2 B;  3RVZ A;  2DW4 A;  4PDR A;  2Y69 C;  3JD0 A;  2ADQ B;  5H5N A;  2QGN A;  1K5S A;  4X64 O;  2D3O W;  3FX7 A;  4O4J A;  4DV3 B;  5KAI Z;  5LXT A;  5LOV B;  2WA4 A;  4PHZ A;  1H8H G;  1WJZ A;  2ZIN A;  3F7V C;  2ZD9 A;  2BOB C;  2EIJ B;  1K34 A;  2LW1 A;  2NN4 A;  1QBZ A;  4FZ0 A;  4FLU A;  5EYP A;  3X2Q C;  3LDE A;  1OCZ C;  1VF5 B;  4E2L A;  1H2M A;  5JJN B;  5BZB A;  4KL1 A;  2UXB B;  1YJ9 V;  1S5J A;  4MVS A;  4JV5 O;  1OCC B;  3CCL V;  3T4D A;  3SJQ C;  4FMT A;  4BIO A;  2QTS A;  3A0B Z;  1VQ6 V;  4I9Q A;  3K3W A;  3PN1 A;  2LGQ A;  4J9Y B;  3FB8 C;  3JD4 A;  1G1X B;  1NR7 A;  1BL8 A;  5C8Y B;  3RVY A;  4H44 B;  5L3F A;  2AHZ A;  3OTO O;  3CP1 A;  4N23 A;  2JIZ G;  3P3N A;  2V7Q G;  3JAS B;  4UFZ A;  1YCI A;  3DC6 A;  3QNE A;  3QO8 A;  3ETD A;  3BAB A;  5CN0 A;  1I94 B;  3CX5 F;  3LSU A;  3W7U A;  4K3A A;  5B3S B;  2EIN B;  2Q0O C;  3E89 A;  2QM4 A;  3RYH B;  3H1L H;  1FYJ A;  3ABL B;  3K57 A;  1ZX3 A;  4DR3 B;  4HYO A;  3DGE A;  1HNW B;  4IL6 Z;  1NZ6 A;  4BW5 A;  2PTM A;  3ZS8 C;  2OIG A;  3H1K H;  3F5W C;  3SYQ A;  3TET A;  4DR5 B;  4DV5 O;  3OMI B;  5KX5 B;  3R65 A;  3CCE V;  3CE2 A;  3RFR A;  2F95 B;  4QPJ A;  3JCZ A;  1NH2 D;  1Y74 B;  4QNH B;  1EN4 A;  1BE3 H;  3SPI A;  1R3K C;  2XTA A;  3SPJ A;  1OV9 A;  3W7S A;  1AI4 A;  4LF8 O;  3SYP A;  2YID A;  5K1X A;  2UUC B;  3ZED A;  2Q7E A;  3U11 A;  3JD3 A;  2HVJ C;  4RO2 A;  3FAV B;  1NTK H;  4LFB O;  4UB8 Z;  4X20 B;  1UFI A;  3HB3 B;  4ZOL B;  5JVD B;  1NQT A;  1YXB A;  2WAM A;  4MT8 A;  1TAE A;  2XAF A;  4FLW A;  2R9I A;  3OT7 A;  3CRA A;  4UV9 A;  3S3X A;  5H6R A;  5LHG A;  2Q6A A;  2VWJ A;  4O2B B;  5KHG A;  5KUK A;  4LFC O;  1VQM V;  3ZRW B;  5L3B A;  1FXV A;  1W2B U;  1FD9 A;  3AK2 A;  3N2G B;  2EJ7 A;  2KKW A;  2KG7 B;  2YS8 A;  3OGI B;  3X2Q B;  1Q7Y W;  2DMX A;  4G2K A;  2WLM A;  3JAR A;  3BA8 A;  3T1H O;  2QDO A;  1B06 A;  4XDJ A;  4AQY B;  4JI7 O;  2UXN A;  1SKV A;  4X1I B;  3ZX6 A;  1AI7 A;  4LF6 B;  3CCR V;  2RCV A;  4NKG B;  2A7W A;  1HDJ A;  5CMU A;  1GK9 A;  2B1G A;  4UVC A;  5B1B B;  1ROP A;  2EIK B;  3ETG A;  1FXK A;  2C2A A;  1FJG B;  4HZ3 A;  3OMN B;  1IBK O;  4GX2 A;  1XDC A;  3H9V A;  4NXM B;  1YIJ V;  1AI5 A;  2E75 B;  3WU2 Z;  3A0H Z;  1QLN A;  2YIB A;  1PNL A;  2UXC B;  3RYI A;  1PM9 A;  4GYC B;  3KCY A;  3ZHQ A;  2AHY A;  3TCU A;  4JYA O;  4O4H B;  1FKA O;  3AG4 C;  2ZIM A;  1GM7 A;  4OGQ B;  5LHH A;  2DYR C;  1PV0 A;  5IJ9 A;  2X6A A;  2JEX A;  4PI0 A;  2A3Q A;  5IYD O;  4JI6 B;  4F6E A;  2OTJ V;  1UPG A;  2UUA B;  3LNM B;  3STZ C;  4TSF G;  3BHP A;  2GHY A;  4HNA A;  4DR4 O;  1JMK C;  1FS0 G;  4DR6 O;  4JI5 O;  4TUY A;  4P9P A;  4O2A A;  4LF5 B;  2YIB D;  1R3J C;  1WA8 B;  4PDL A;  1OJH A;  2VRZ A;  2JGU A;  1B3Q A;  1K8A W;  1Q8I A;  4XDL A;  1QR8 A;  5CB4 B;  4HBN A;  4GKJ O;  3U10 A;  3CRC A;  5FLX N;  1EM1 A;  1KKC A;  3QO5 A;  4KUM A;  3K08 A;  2AW9 A;  2OYQ A;  3C90 A;  4WCE V;  1RP3 B;  1WP8 A;  2WLJ A;  3TGU H;  4O4J B;  2W0X A;  3HKD A;  1HW7 A;  2Y0P A;  1VQ7 V;  4N21 A;  2Q69 A;  4K8X A;  5LXT B;  2JEU A;  4JYY A;  3M99 B;  4DR7 B;  3ZIA G;  4PI2 A;  4CH5 A;  2CTQ A;  1TVK A;  3TXS A;  5EYP B;  2IH3 C;  3B2E E;  5BR8 B;  1Z5V A;  1VQL V;  2JJ1 G;  2UUB B;  4IYH A;  3KG2 A;  2EIL C;  3C3S A;  3D3I A;  4D6T H;  1IBM B;  1JFF A;  1OZ0 A;  4KFM A;  1EZJ A;  4FFB A;  1TGO A;  1QCE A;  1P7B A;  3N27 A;  4U3F H;  1V54 C;  1KD1 W;  2LGW A;  1TUE B;  1ARO P;  3LUT B;  4AHC A;  2F23 A;  3M8A A;  3AG2 C;  2Y48 A;  1RFY A;  1E1Q G;  4GKK B;  2EX3 A;  4X66 O;  2Y0I A;  3OE7 G;  3JAT A;  2UXD B;  2EZP A;  5CA3 A;  2GTA A;  2W6I G;  1JPX A;  2XND G;  3RYF A;  1SQV H;  1Z5W A;  2PZS A;  4X1Y A;  2F93 B;  3AG4 B;  2IW5 A;  3ICX A;  4FFK A;  1I5X A;  1QU7 A;  5LOV A;  1K9M W;  4B3M O;  2FYU H;  4DV6 B;  5CBF A;  3L71 H;  3K5N A;  4FIP C;  1RPO A;  4J80 A;  2O57 A;  5LP6 C;  1COW G;  4DV7 O;  2WLI A;  4UVB A;  4XDK A;  3OEH G;  5TIS Z;  1AP5 A;  4JI1 O;  3OUS A;  2YSU B;  2CUG A;  4GLX A;  4O4L A;  4MVQ A;  1OCO B;  4JZ2 A;  1BSM A;  3C3T A;  2IJH A;  3FB7 C;  4JF3 A;  5C8Y A;  3G67 A;  5B1A B;  5AG2 A;  4LF9 B;  4PD4 F;  4WFH A;  3E35 A;  2QWP B;  4JI0 B;  1YI2 V;  1DLB A;  3JAS A;  4JTD B;  3ASN C;  4D7S A;  3SJA C;  4EFB A;  4WFA V;  1K5Q A;  1JQ0 A;  4RUE A;  1UJW B;  3CC4 V;  2Q73 A;  1J5E O;  4YY3 B;  2GTS A;  1MA1 A;  5HFM A;  3IC9 A;  2OCC B;  2ZXW B;  2E3C A;  3DSQ A;  4X65 O;  5LMN B;  1XMO O;  2HVK C;  2ZCE A;  1S0V A;  1URF A;  2AXT Z;  3ZMS A;  3HKE A;  3VOU A;  5CA1 A;  2EIL B;  3ZN0 A;  1XBL A;  5KX5 A;  3CME V;  3OAA G;  2KSD A;  1Y74 A;  4YIO A;  4FLZ A;  4I4T A;  2E5L O;  1V54 B;  3H1I H;  1M4U A;  3UO2 A;  2YEV A;  5L3D A;  2FML A;  3LNN A;  1FXK B;  1ZL8 A;  3T1Y O;  3CXC U;  2R9R B;  4JPR A;  2P67 A;  3NR7 A;  3K79 A;  5JVD A;  4PA7 A;  3IC7 A;  3RYI B;  4B3S B;  2UU9 O;  1NT2 B;  2IM9 A;  3E86 A;  1ZAU A;  1PPJ H;  2R9A A;  4FLT A;  2ARH A;  5LMU O;  4KP4 A;  2VQE O;  4KHP B;  1XMQ B;  3CRR A;  2HJD A;  1P84 F;  4JAS A;  3AG7 A;  2CAZ C;  1F4N A;  2P5O A;  5J2U A;  4RWU A;  1QVG U;  2IJJ A;  3D36 C;  5D5P A;  1VP7 A;  4B3R B;  3MDS A;  1LNQ A;  4HNA B;  2XAH A;  4TUY B;  5LHI A;  4H33 A;  4X1I A;  4LFA B;  3SDL A;  1NI8 A;  2M6Y A;  3AG3 B;  3E8B A;  2RMK B;  2Q9L A;  2WWW A;  4TWK A;  4TV9 A;  4BIZ A;  5H9C A;  4LF7 O;  4DV1 O;  3B40 A;  4DV2 B;  1M56 C;  4JZG A;  1L1F A;  5IYZ A;  2AZ2 A;  1KEC A;  1DF5 A;  2YXH A;  3ZBH A;  3EFF K;  3I56 V;  2M7W A;  4LNU A;  1QR9 A;  2DWD C;  3N2K B;  3OMA B;  1HR0 B;  3HKC B;  4YIP A;  3SYA A;  4FLV A;  3J81 N;  1VQN V;  3MAQ A;  5J9P C;  2OIE A;  4NTY A;  3ABM C;  1KBH A;  3HKD B;  2VWK A;  1I94 O;  1AR4 A;  1F4M A;  5IWA B;  4O4H A;  1K92 A;  3WG7 B;  1TVK B;  5DN6 G;  4CH4 A;  3K9A A;  4DR3 O;  2ZE7 A;  2JVD A;  1SQB H;  2QM8 A;  1JFF B;  4CS4 A;  4FFB B;  1K4D C;  3LSS A;  1VQ8 V;  1XRE A;  2QWQ B;  3R66 A;  3CHX A;  1MZF A;  1S77 D;  1Q6I A;  2IU3 A;  1NKD A;  4NVP A;  2X7R B;  1SQQ H;  4FM1 A;  3VQW A;  1GN6 A;  1Y67 A;  3RW0 A;  2NR5 A;  1N36 B;  2GUZ B;  3L75 H;  3P30 A;  2XT9 A;  4FM0 A;  1N32 O;  3ZHV A;  2OCH A;  4GX1 A;  3JAT B;  2HFE C;  4B08 A;  4DV0 O;  3RYF B;  4X1Y B;  4U7O A;  1HNZ O;  1SZX A;  1EN6 A;  4YHH B;  2QEX V;  2PY5 A;  1Y66 A;  3B8M A;  4MVZ A;  1N4C A;  4UB6 Z;  2H8P C;  1N34 O;  1VEW A;  1VQ5 V;  1FFX A;  2ZM6 O;  1V55 B;  1QQC A;  5J2T B;  3L73 H;  5CBH A;  1S5L Z;  2ITD C;  2NLJ C;  2WLI B;  1KMI Z;  1X4T A;  3ABK C;  1D5A A;  3CYO A;  5B1N A;  4OX9 B;  1SQF A;  2VS0 A;  3J7A U;  2FKX A;  5DM6 V;  3RYC A;  1WB7 A;  1BHB A;  1M9N A;  3ZRV A;  4O4L B;  2QA4 V;  1VQK V;  1WPB A;  1V9P A;  1DTO A;  2GV9 A;  3CCU V;  1ZLZ A;  5LL6 Y;  1H2N A;  4CBC A;  4K0K O;  4J10 A;  5IJ0 B;  1TUB A;  2P7T C;  4NR1 A;  3K58 A;  3UT5 B;  4EFE A;  1MMM A;  5FL7 G;  1VQO V;  1D5N A;  1P7G A;  4LF4 O;  3ZRS A;  2LQT A;  4RUF A;  2Z5U A;  1Q3E A;  3TK1 A;  5KA6 A;  3TXQ A;  3I5D A;  5EC1 C;  1Q6U A;  1JA8 A;  4NXN O;  3ASO B;  3HKE B;  3CCS V;  2F4V O;  1G6U A;  1E1R G;  5CA1 B;  2E74 B;  1YDX A;  2KQX A;  3CRM A;  4I55 B;  4JI6 O;  3W7W A;  3G4S V;  1SQX H;  5IT9 N;  2Q8V A;  1YF2 A;  3WB0 A;  4I4T B;  1XNR B;  5K1P A;  4X88 A;  2YI8 A;  4NB5 A;  3UO3 A;  5GW7 A;  2YEV B;  3ZHU A;  4B3T O;  5EIB C;  3SPC A;  4EKW A;  1ZL8 B;  5C93 A;  1RSO B;  3G6B A;  4DW1 A;  1N33 O;  4Q6G A;  5HFL A;  1Q90 D;  4LBE C;  2DN9 A;  2W6J G;  1QHT A;  4MTF A;  2Y69 B;  2LFS A;  3HKB B;  4JAA A;  1MG1 A;  4DR1 O;  4DUY B;  1N8R W;  3ABT A;  2ETN A;  1W0K G;  4I9W A;  3ZMU A;  1A32 A;  3SPG A;  4R6Z A;  4PDM A;  2JRI A;  5JCO A;  3QG5 A;  4OXS A;  3W7T A;  2BOC C;  4H13 B;  2JGD A;  5J2U B;  1AB3 A;  1M1K W;  1OCZ B;  4Z1V A;  2Q0A A;  2IJI A;  4X8A A;  4DRX B;  2YIC A;  1YTF B;  4X64 B;  4NTX A;  3ABK B;  3CB2 A;  1P49 A;  4J42 A;  5F2V O;  3H01 A;  3KCX A;  1XL6 A;  2X6B A;  2OT5 A;  2W0F C;  4PA6 A;  4TV9 B;  1M57 C;  1G4Y B;  4AIL C;  4FM2 A;  5LGT A;  1WNS A;  2FTK A;  2RNB A;  3OGC C;  5IYZ B;  1CP9 A;  1FPO A;  4JV5 B;  1TA8 A;  4LNU B;  4Z2W A;  1J95 A;  4ZIB A;  3CC2 V;  3ABU A;  5IDJ A;  3P3P A;  3BY6 A;  1KUQ A;  1XUQ A;  4CC6 A;  3CCJ V;  4RAI A;  3FB6 C;  4P9O A;  4DV4 O;  2DQ0 A;  4FJC C;  4R50 A;  4CS2 A;  1GRJ A;  4GZR B;  1KP2 A;  1U96 A;  3UQ8 A;  3D3Q A;  4WF9 V;  3CWB H;  3ZJZ A;  3E8H A;  4OPA A;  4RQE A;  4QJF B;  4PJ0 Z;  1NBM G;  5LP6 A;  5EBM C;  1ENV A;  2EIM C;  2WLN A;  2F43 G;  3OFN G;  2VQF O;  2ZDI C;  3ML0 A;  5KHJ A;  1Y76 A;  1VMG A;  2ZE5 A;  4HAM A;  3GVM A;  4O4I B;  1GH6 A;  2GBO A;  1VQP V;  1M90 W;  4MVR A;  2MK3 A;  5IY5 C;  1MSD A;  1IXM A;  1PL0 A;  1GM8 A;  3A8T A;  4UUJ C;  1WPX A;  1CEZ A;  5GTH Z;  5B1O A;  3N2K A;  4LF8 B;  3HKC A;  4IHJ A;  1LUV A;  2ZE8 A;  2P4V A;  4H37 A;  4LFB B;  3Q4H A;  2AZ0 A;  5FPR A;  2JS5 A;  3JAK A;  1KQS U;  3B09 A;  3ZHT A;  4YY3 O;  2PF4 E;  5JCO C;  1FFX B;  4KXR A;  4WFF A;  3JSN A;  4GX0 A;  4LFC B;  5EK0 A;  1BCC H;  1NJI W;  3RYC B;  2DQ3 A;  1SET A;  4YXW G;  2JK5 C;  3RWR D;  4TQF A;  1PKX A;  4JI8 O;  5EBW C;  1Q5O A;  4IYI A;  5DED A;  4DR2 O;  4JI7 B;  1DGS A;  4TQD A;  2GUZ A;  3JAL A;  1VF6 C;  3T4Z A;  4DUZ O;  1TUB B;  2HHH B;  5KAF Z;  4W4K A;  1AP6 A;  4WFE A;  1IBK B;  2DYR B;  5KUM A;  1K4C C;  1NVP D;  4GUN A;  4JI3 O;  2BSK A;  3D36 A;  2QKC A;  4X62 O;  5J2T A;  1GKF A;  4JYA B;  1XI1 A;  4B3R O;  3CSX A;  2HP8 A;  2RDC A;  1QLE C;  1GN2 A;  3CRQ A;  1GO3 F;  5KLV H;  2DYS C;  2RQ6 A;  5JJE B;  1I08 A;  1US6 A;  2XAJ A;  1NTM H;  5JQG B;  2PYJ A;  3L9D A;  5E79 Z;  4QGP A;  5IY5 B;  3G71 V;  3K9S A;  4DR4 B;  1QNM A;  4DR6 B;  4JI5 B;  1IBL O;  1XL4 A;  3IGA C;  3CEI A;  3E8F A;  3VBB A;  3EHB B;  2JS3 A;  5LBQ A;  2N04 A;  5IJ0 A;  4JI4 O;  2K9P A;  2MW2 B;  2BTO A;  3FYE B;  4U3J B;  3A2F A;  2JJ2 G;  2BTQ A;  1IXB A;  1O9H A;  3UT5 A;  3UKM A;  2QJ1 A;  1Q6H A;  3OEE G;  5DEC A;  4GKJ B;  4Z1M G;  2CGO A;  2JGD B;  5ITZ A;  1YJN V;  2ZT9 B;  4ICG A;  3BRC A;  3K04 A;  3DXR B;  4F4L A;  1AI6 A;  1XNQ B;  3QTC A;  1F51 A;  1Z2G A;  1BT8 A;  3QVN A;  4I55 A;  3G6E V;  1HNX O;  2V1D A;  2R70 A;  5LGN A;  3F5T A;  2P90 A;  4DXW A;  3F7Y C;  4E4E A;  2IBZ H;  2D2C B;  3BVO A;  3AG2 B;  1RSO A;  4UCO A;  3JAW A;  1VQ4 V;  3OW2 U;  3SGI A;  2OTL V;  2AGA A;  2LW7 A;  1BZK A;  4X9Q A;  4AI8 A;  1JOY A;  1GN4 A;  4YJ3 B;  3HKB A;  3OUF A;  4TOI A;  4UXN A;  1YEW A;  4JI2 O;  3D8C A;  3K0G A;  3B8N A;  5A2Q N;  3BA9 A;  2WLL A;  1Y4M A;  4X66 B;  4DV3 O;  1Q81 W;  5GON A;  1MOF A;  2A0L A;  1YHQ V;  1FAF A;  4UVA A;  1H2S B;  5LP6 B;  1MNG A;  4DRX A;  1QLE B;  5IE9 A;  3GWK C;  4MS2 A;  4RQF A;  4IT5 A;  2DYS B;  5KHI A;  5FNV B;  1SF9 A;  2UXB O;  4B3M B;  2WA3 A;  1XQ8 A;  1Y76 B;  5LA6 A;  3OR6 C;  4J7Z A;  3SJC C;  4X1K A;  3T1C A;  2IU0 A;  2P6J A;  2WLK A;  1SA0 A;  3M7M X;  2XAG A;  1Q43 A;  1GM9 A;  2HKO A;  2ZE6 A;  3ASN B;  4JI1 B;  1OCC C;  3CC7 V;  4IHJ B;  4L87 A;  3B77 A;  4EEQ A;  1YTF D;  1SRY A;  3ZN1 A;  4PDV A;  4ZBM A;  3CD6 V;  2Q7G A;  3Q4H B; 
#chains in the Genus database with same CATH homology
 3LNM B;  3STZ C;  5KA6 A;  4TSF G;  2GHY A;  5EC1 C;  1FS0 G;  3AG3 C;  3ASO B;  4P9P A;  3CCS V;  1EFR G;  1OCR C;  1E1R G;  1R3J C;  2XOK G;  4TT3 G;  3FKS G;  4PDL A;  3W7W A;  3G4S V;  2WLH A;  2B1I A;  1K8A W;  2X6C A;  4X88 A;  4MVM A;  2ITC C;  1G8M A;  3CPW U;  2QE7 G;  5B3S C;  2QTO A;  5GW7 A;  2YEV B;  3AG1 C;  2PI5 A;  3JD2 A;  4QPK A;  5H6Q A;  4XDL A;  1QR8 A;  3SPC A;  1SER A;  1NVP B;  4EKW A;  5C93 A;  3ABL C;  5HFL A;  3LDD A;  3QO5 A;  5EBL C;  4KUM A;  3AEI A;  4LBE C;  3K08 A;  4WCE V;  1RM1 C;  2WLJ A;  2W6J G;  1RPR A;  5IYC O;  3SPH A;  3JD1 A;  1K73 W;  4QIW F;  1R3L C;  2NNU A;  1VQ7 V;  1VQ9 V;  4MTF A;  4N21 A;  2Q69 A;  2Y69 B;  3WG7 C;  2LFS A;  2JEU A;  1GTO A;  1MG1 A;  4FK5 C;  1N8R W;  3M99 B;  3ABT A;  3ZIA G;  1E79 G;  4G27 B;  1PNM A;  1W0K G;  4I9W A;  3ZMU A;  5E1A C;  3SPG A;  4R6Z A;  1WLE A;  4PDM A;  2IH3 C;  2QM7 A;  1VQL V;  4OXS A;  3W7T A;  4GT1 A;  2BOC C;  2A79 B;  3RBZ A;  2JJ1 G;  1SES A;  1M1K W;  1OCZ B;  3KG2 A;  4MW3 A;  4PA3 A;  2EIL C;  3UM7 A;  1BHA A;  5L3E A;  3D3I A;  2IJI A;  4X8A A;  1YTF B;  1YIT V;  1OZ0 A;  3ABK B;  1EZJ A;  4KFM A;  4BAY A;  2JDI G;  3I55 V;  4U7N A;  2ZQM A;  1QCE A;  1CPY A;  2ZR3 A;  1P7B A;  1V54 C;  3H01 A;  1KD1 W;  1TUE B;  1XL6 A;  1ARO P;  2OT5 A;  2W0F C;  2X6B A;  4PA6 A;  1M57 C;  3LUT B;  1G4Y B;  4MTX A;  3ZRX A;  1H2G A;  3CCQ V;  3DTU B;  5LGT A;  2FTK A;  3AG2 C;  3OGC C;  1H8E G;  2Y48 A;  1CP9 A;  2XAQ A;  4JGS A;  1E1Q G;  1M56 B;  3OE7 G;  4UV8 A;  2EZP A;  3ZRW A;  4G28 B;  5CA3 A;  1J95 A;  2ATK C;  1BMF G;  2W6I G;  1JPX A;  4Q20 A;  2XND G;  3CC2 V;  3ABU A;  5IDJ A;  2K1E A;  3BY6 A;  3AG4 B;  5CBG A;  1ZWI C;  3CCJ V;  2KB1 A;  4RAI A;  3FB6 C;  4P9O A;  2IW5 A;  1S76 D;  3E2E A;  2EIJ C;  1B6Q A;  1V55 C;  3A0R A;  3ZMV A;  2DQ0 A;  1I5X A;  4FJC C;  4R50 A;  1K9M W;  5CBF A;  1KP2 A;  3ABM B;  4ZKI A;  4MTO A;  1S3J A;  4FIP C;  1GMG A;  4WF9 V;  3ZJZ A;  3E8H A;  1RPO A;  4P2Z A;  1R6N A;  1COW G;  4BIU A;  2LFR A;  5IYB O;  4RQE A;  5B1B C;  2WLI A;  2EZO A;  1OCR B;  4QJF B;  3GWO A;  2EIK C;  1K33 A;  4R8C A;  4UVB A;  1NBM G;  2X0L A;  1MAB G;  4XDK A;  3OEH G;  5EBM C;  4JAU A;  1ENV A;  2EIM C;  5KA5 A;  4X89 A;  3OUS A;  2WLN A;  2HG5 C;  2XAS A;  1PNK A;  2F43 G;  2YSU B;  3OFN G;  4CZZ A;  4MVQ A;  4GX5 A;  1OCO B;  2ZDI C;  3AG1 B;  1YSC A;  3ML0 A;  3QO7 A;  1F23 A;  5LGU A;  2IJH A;  3FB7 C;  4JAV A;  4HAM A;  4JF3 A;  5B1A B;  3P32 A;  1VQP V;  1M90 W;  2ZDI A;  1R6K A;  3MHH C;  1KKD A;  4R7C A;  4MVR A;  3OR7 C;  4WFH A;  2MK3 A;  3E35 A;  3T2M A;  5IY5 C;  1HWY A;  1DLB A;  1YI2 V;  4JTD B;  3ASN C;  3SYC A;  2EIN C;  1RM1 B;  1IXM A;  4WFA V;  4DO2 A;  1K5Q A;  1PL0 A;  1GM8 A;  2ZR2 A;  4UUJ C;  1JQ0 A;  1WPX A;  3CCM V;  1CEZ A;  4RUE A;  2IH1 C;  1UJW B;  5B1O A;  3CC4 V;  3CMA V;  2WSS G;  3W7X A;  2LP7 A;  5HFM A;  2OCC B;  2ZXW B;  3WFV A;  1K7D A;  3ASO C;  4H37 A;  1JJ2 U;  1I5Y A;  1K3E A;  1KQS U;  2HVK C;  1PD3 A;  2Q68 A;  1S0V A;  3ZMS A;  2IJK A;  3ZMZ A;  2GSM B;  3VOU A;  1KC8 W;  2EIL B;  3ZN0 A;  1YJW V;  4WFF A;  1AJP A;  2WLL B;  3OM3 B;  1S72 V;  1JX9 A;  3E83 A;  3CME V;  3OAA G;  4GX0 A;  5EK0 A;  3MD0 A;  3LSQ A;  4LC1 A;  1FXH A;  4MVU A;  1V54 B;  4PA9 A;  3K03 A;  2H94 A;  1NJI W;  2EBO A;  2DQ3 A;  2YEV A;  4J9Z B;  1SET A;  4YXW G;  3FYI B;  2JK5 C;  5L3D A;  4ASU G;  3CCV V;  1FXK B;  1K97 A;  1H38 A;  1KP3 A;  1ORQ C;  1PKX A;  5EBW C;  3CXC U;  4QE7 A;  2R9R B;  2DW4 A;  4JPR A;  4PDR A;  3RVZ A;  3ZCC A;  2P67 A;  2Y69 C;  3JD0 A;  3ETE A;  4WFB V;  3K79 A;  1K5S A;  2D3O W;  4PA7 A;  3IC7 A;  3E86 A;  3LDC A;  1W0J G;  1R3I C;  3T4Z A;  1H8H G;  3F7V C;  4KP4 A;  2ZD9 A;  2BOB C;  2EIJ B;  1K34 A;  1QBZ A;  3X2Q C;  3LDE A;  1OCZ C;  4E2L A;  4JAS A;  2EJR A;  3FB5 C;  5BZB A;  4MVO A;  4WFE A;  3GB7 C;  1YJ9 V;  1F4N A;  4MVS A;  2DYR B;  1QVG U;  5KUM A;  2DWE C;  2IJJ A;  1K4C C;  1OCC B;  3CCL V;  1NVP D;  1LNQ A;  3T4D A;  3SJQ C;  4FMT A;  2XAH A;  3D36 A;  5LHI A;  4H33 A;  1VQ6 V;  2A9H A;  3SYO A;  1Q86 W;  2PI4 A;  3K3W A;  5L3G A;  1GKF A;  2WPD G;  3AG3 B;  3E8B A;  4J9Y B;  2WWW A;  3FB8 C;  3JD4 A;  1QLE C;  1NR7 A;  4TWK A;  1BL8 A;  4BIZ A;  5H9C A;  1GO3 F;  3RVY A;  5L3F A;  2AHZ A;  3K0D A;  2DYS C;  3CP1 A;  4N23 A;  2JIZ G;  1M56 C;  1L1F A;  1KEC A;  2V7Q G;  2XAJ A;  1DF5 A;  3QNE A;  3QO8 A;  2CK3 G;  3ETD A;  5CN0 A;  4MTG A;  3EFF K;  3I56 V;  2M7W A;  4MW8 A;  5IY5 B;  3G71 V;  3W7U A;  5B3S B;  1QR9 A;  2DWD C;  3OMA B;  2EIN B;  1SZT A;  1XL4 A;  3E89 A;  3IGA C;  1JCH A;  3SYA A;  3E8F A;  3VBB A;  1VQN V;  3ABL B;  1S5H C;  4XBF A;  3EHB B;  5J9P C;  2QKS A;  3ABM C;  5LBQ A;  4JTC B;  1DF4 A;  4HYO A;  3DGE A;  1F4M A;  3HPL C;  4BW5 A;  3FYE B;  1THZ A;  2JJ2 G;  4WFG A;  3STL C;  1K92 A;  2Q67 A;  3F5W C;  3SYQ A;  3TET A;  3WG7 B;  3UKM A;  3OMI B;  3R65 A;  3OEE G;  5DN6 G;  3CCE V;  2HR3 A;  3K9A A;  4QPJ A;  3K06 A;  3JCZ A;  1NH2 D;  4Z1M G;  4QNH B;  1YJN V;  1AJQ A;  3SPI A;  2QM8 A;  1R3K C;  1OCO C;  1EBO A;  3K04 A;  3SPJ A;  1NR1 A;  3W7S A;  1AI4 A;  1AI6 A;  3SYP A;  4F4L A;  1K4D C;  3LSS A;  4QE9 A;  1VQ8 V;  1F51 A;  5B1A C;  3JD3 A;  2HVJ C;  4RO2 A;  1S77 D;  2IU3 A;  1NKD A;  3G6E V;  2X7R B;  1AJN A;  3HB3 B;  2V1D A;  3RW0 A;  3BEH A;  1NQT A;  5LGN A;  2WAM A;  4MT8 A;  4PEL A;  1QVF U;  2XAF A;  5L3C A;  3P30 A;  2P90 A;  2R9I A;  4DXW A;  1M57 B;  3F7Y C;  4UV9 A;  5H6R A;  5LHG A;  2OCC C;  2Q6A A;  2ZXW C;  3AG2 B;  5KUK A;  4GX1 A;  2UXX A;  1VQM V;  3ZRW B;  1VQ4 V;  5L3B A;  1FXV A;  3OW2 U;  4FPP A;  1W2B U;  2HFE C;  2OTL V;  4JTA B;  4U7O A;  3X2Q B;  1Q7Y W;  4G2K A;  2WLM A;  1JOY A;  4P30 A;  2B5U A;  2QEX V;  3OUF A;  5EC2 C;  4UXN A;  1Y66 A;  3B8M A;  4MVZ A;  2H8P C;  4XDJ A;  2Z3Y A;  3B8N A;  3K0G A;  2UXN A;  4JYC A;  1VQ5 V;  3MHS C;  1V55 B;  2WLL A;  4LCU C;  1Y4M A;  1AI7 A;  5CBH A;  1Q81 W;  3CCR V;  1MOF A;  2A0L A;  2ITD C;  2NLJ C;  1Q82 W;  2WLI B;  1JVM A;  1YHQ V;  3ABK C;  2HLD G;  5CMU A;  3ZMT A;  1FXK C;  1GK9 A;  3CYO A;  4I5S A;  4UVA A;  5B1N A;  2B1G A;  4UVC A;  4MSW C;  1MSW D;  5B1B B;  5DM6 V;  1QLE B;  1NH2 B;  4MS2 A;  1ROP A;  4RQF A;  2EIK B;  1OHH G;  3ETG A;  1FXK A;  2C2A A;  2DYS B;  1BHB A;  4HZ3 A;  1M9N A;  3OMN B;  3ZRV A;  4GX2 A;  2HJF C;  1P4R A;  2EIM B;  2QA4 V;  1VQK V;  1YIJ V;  1AI5 A;  4PA4 A;  1QLN A;  3IFX A;  1PNL A;  1AR1 B;  1DTO A;  3NXS A;  3OR6 C;  3CCU V;  3T1C A;  3E8G A;  3JYC A;  2IU0 A;  4CBC A;  2AHY A;  4LP8 A;  4GCZ A;  2P6J A;  2WLK A;  3TCU A;  1FFT B;  4JYB A;  2P7T C;  2XAG A;  3AG4 C;  1GM7 A;  1GM9 A;  3PJS K;  5LHH A;  2DYR C;  2HKO A;  3ASN B;  1OCC C;  3CC7 V;  5FL7 G;  1VQO V;  2X6A A;  2JEX A;  4L87 A;  3B77 A;  1YTF D;  1SRY A;  3ZN1 A;  4PDV A;  5IYD O;  1R73 A;  4ZBM A;  3ZRS A;  3CD6 V;  4RUF A;  2OTJ V;  2Z5U A;  3TK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...