3T51B

Crystal structures of the pre-extrusion and extrusion states of the cusba adaptor-transporter complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
322
structure length
322
Chain Sequence
ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Charged Amino Acids (R83, E567, D617, E625, R669, and K678) of CusA Are Required for Metal Ion Transport in the Cus Efflux System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Cation efflux system protein CusB
total genus 48
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3t51B02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3t51B03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3t51B01
1SMYC 2K7VA 4XTCS 5BN4A 2AWOA 1H9JA 1Q90A 2E75C 2EVBA 4IQZA 4JBWA 2NN6H 3VR6A 5A35A 4KHZA 2A68D 1FR3A 3A7LA 2A69D 4LJZC 1E2VA 4KKUA 1TU2B 1OXTA 2CW0C 3A8JE 3I73A 1GHKA 3DXJC 3W3AA 1QJOA 2LMCB 3N6RA 4DK0A 4KKTA 2D5DA 1VF5C 3VR3A 1IW7D 1Y8NB 1Y8OB 5K36H 1GUSA 1ZYRC 3KLRA 2BE5C 3P20A 3SE0A 2B8FA 5C0XG 3A8IE 1OXUA 1T5EA 2JEBI 2KA7A 3IFTA 3CRLC 3GQBA 4PV1C 1DXMA 2JE6I 2JXMB 2A6HD 3BG3A 1TKWB 1O7LA 2IT1A 4IFDH 3FMCA 3SDZA 3AB9A 3FPPA 1Q1BA 4BA1I 5C0XH 3T53B 3IKJA 5JEAG 1I6VC 3VR4A 5BN3A 4I7ZC 1GUOA 1ONLA 2JEAI 4L8JA 1G291 2E76C 1H9RA 2BE5D 4H0LC 2D2CC 3VR5A 2BA0A 1IW7C 1GHJA 2PNRC 2F1MA 1PMRA 2E74C 3A7AB 3M4YA 1H9SB 3QIAA 4JK1C 2EJFC 4G7ZC 3H94A 3CRKC 4KMUC 3I72A 3MFYA 4KN4C 1H9MA 3A8KE 4H13C 2B8GA 4KN7C 3TZUA 2QF7A 2R6GA 2Q8IB 4LK1C 3VR2A 3WDNA 1IYUA 5BN5A 5JEAH 3D4RA 1E2ZA 3OOCA 2EJMA 2K33A 2D62A 3HGBA 4RCNA 2EJGC 4TQUS 1GUNA 1HTPA 2DNCA 2ZT9C 3VA7A 3T51B 2O5IC 1BDOA 1EWHA 1GUGA 1VDZA 4IFDG 3M85A 3LNNA 2A6HC 2AUJD 4XIGS 2BDOA 2K32A 2YYZA 2A6ED 1LACA 3OPOA 3D31A 2O5JC 4DNRB 1Z7TA 2NN6I 1IYVA 3EQLC 1GJXA 4OO1H 3PV0A 2PPBC 1V43A 3NE5B 1H9KA 2BA1A 4GZYC 3I4LA 3BDOA 1O78A 5KNBA 1YNJC 4H44C 4HR7B 1B9NA 1Y69U 4BA2I 2V4DA 1E2WA 3QG1A 2A69C 3MXUA 1DCZA 1HCZA 1A6XA 2A68C 1Z6HA 3U9SA 1HQMC 3OW7A 3PUXA 3QJYA 1CTMA 1Y8PB 5K36G 1B9MA 2NN6G 5KNCA 4KI0A 1ZKOA 1FYCA 1VF7A 1V8QA 1VCIA 2DNEA 1OXVA 3ND8A 4G7OC 2PCFB 2A6EC 3L7ZC 1GUTA 4G7HC 4TKOB 3PUZA 2AUKA 2L5TA 3PUWA 4OO1G 3RLFA 5KNDA 1CFMA 3M7NA 1LABA 4DNTB 3LWUA 4KKSA 3PUVA 2KCCA 1K8OA 1Q1EA 2EDGA 1OXSC 3GD7A 1K8MA 1CI3M 3ND9A 1OXXK 1Q12A 1H9SA 1DD2A 1HPCA 3T56B 1YNNC 2DN8A 3PUYA 4DK1A 4OGQC
chains in the Genus database with same CATH superfamily
2ZL7A 4PZ7A 3GTOB 2K28A 4FP5D 4UZFA 5A35A 5M3MB 1HR0Q 1B2RA 1PDQA 2BSAA 1FR3A 5IP9H 3TS2A 2VBVA 2OCEA 5M5YH 2C9OA 1I18A 2ALYB 3BS1A 1N32L 2C2WA 4JOIA 2NVTB 1PRTF 5K36H 2VUMG 4E0FA 1U4LA 1JICA 2Z4HA 2GJPA 1QE6A 3MHBA 1OXUA 3JAML 4DV0Q 5JPNC 1YNJD 2Q6KA 3IFTA 3ERSX 1DXMA 2B2UC 2X69A 3KBGA 4QJFA 1IBMQ 2HHHL 4XYOA 5C5LA 3GTQB 4A3GG 3K5NA 4POFA 3IKJA 2VJIA 4C3JG 3FEWX 3RY8A 1LTTD 2XIWA 4J15A 3D4DA 1GUOA 5JVH3 4LBVA 3ZBTA 5JEAJ 3TRZA 4BBRB 1FRQA 4BPRA 2F0TA 4DAMA 3HOXG 4IURA 2V7QA 5LMNW 1DDGA 1BJKA 1NRKA 1AE2A 1J6QA 2EJFC 1A15A 4Z4WA 2JA7B 2NVXH 4XT1B 1AIPA 3O13A 5IP9G 5T1IA 3AFPA 1EY7A 4H9GA 3W5HA 1BCPC 1Q8IA 2F3VA 4UP9A 3STBC 2HD3A 2L11A 3NTHA 1EP1B 4C3JH 3K5MA 2H5XA 2K04A 4FF1A 3I4NG 3K7AB 4IOCA 4I65A 2B2YC 2O5IC 1F9QA 4K5WA 4IOAA 3S2HB 2ZBUA 3KEWA 5FJ8G 4XYQA 4RD3A 1RCVD 2R7DA 4P6VF 3I4NB 4DAYA 3NQTA 2O5JC 1EFRA 5D3DA 1BUVT 4P75A 4ZLTF 1B70B 2E8GA 2PPBC 5ELNA 4A3JB 4KK7A 1WTHD 1XE1A 4HIMA 3C2QA 2BPOA 1E3XA 3URYA 1BBUA 2Z6KC 3ZC3A 2B63B 3F2DA 1VQCA 3KF8A 4K0KL 2ZXHA 1JJ2B 2DNEA 3S15H 3HOXB 2PI2E 3CC4A 2HLDA 1GO3E 1YITB 3CC2A 4OO1G 2K5DA 3RLFA 2SEBD 1WYDA 3BC9A 2VQFQ 3VO1A 3JAME 3DHQA 4ULLA 1I50H 1AE3A 5C4ZA 4P72A 3RD4A 3TZDA 2X8KA 4GOPC 4JI1L 4IPHA 3HFZB 3M4PA 1ILQA 1BKBA 3TP8A 4AQYQ 3PF5A 1E79A 2GA4B 3KL9A 3NQIA 5KGUA 2Q6LA 3MCAA 2V1CC 3CP0A 1IKLA 5TSSA 3AVUA 4OIKA 1PTOC 1X3FA 5FL7A 3ZJYC 4DV3L 2GJKA 4XLCA 3RN5A 1KK1A 3ES9A 4A3GB 2LMCB 5IGCA 1MD2D 2D5DA 5C3EB 3G71A 3VR3A 2XZOA 4DR3L 2WAQB 3I90A 1W6KA 2QCPX 3J80i 4X64Q 3A35A 1EFID 4O2DA 3EROA 1TIID 4BBSG 4OX9Q 2B2WA 4PC7A 2A19A 1VQNB 4TMVA 1CNFA 2BM0A 1SR3A 5C0XI 1ZXTA 2NVXB 4OOVA 2OEOA 3VR4A 3NBHA 1SYCA 1BO0A 4IFDI 1B2TA 3AFQA 5M3MH 2KQ3A 3GSIA 3I4MG 4GKKQ 3A1PA 5KNLA 4NXNQ 4MIUA 1UNSA 3FHWA 1TWGB 4KD4A 4LWCA 3RZDB 3BY2A 2K52A 3GTGH 1AMOA 3CCEB 5C44B 2GVBA 2IWHA 1WTQA 3CD6A 1JWSD 1Y1VG 1S5BD 1V1PA 2VBSA 3OJXA 1A3VA 1L1OB 4PG3A 1JC7A 1CKNA 4L5TA 2JA7G 4A3KG 1CZWA 4UAJA 4DNIA 1TLLA 3SK8A 3VA7A 5TRDA 1IBML 4PZ6A 4IFDG 1G7RA 3M9BA 4WJ4A 1QILA 2F43A 1T6ZA 3A74A 1LACA 4PAAA 5JPMC 1BBWA 1SXTA 1KAWA 3BU2A 3HEJA 2OK7A 1XWEA 4PZ8A 4S3SA 1XTCD 2Q6IA 2WACA 2CFMA 3OWEB 2V7WA 4HIDA 1R4PB 2V4DA 4JBKA 1CHPD 5LMNQ 4IUVA 1D8TA 4OELB 5M5XB 1X3EA 3OJWA 4XONA 3PUXA 3QJYA 5CV4A 5D65A 2B2UA 4IPDA 3CW2A 4DV5Q 4OOXA 2YTYA 1PJ7A 3K0YA 1M1KC 4EQPA 2OTJB 4YWKA 4OXPA 1TS2A 4YALA 3T1YL 3K57A 1EL0A 2N8NA 1X9NA 3OMCA 1K8MA 1TWCH 4A3FH 2KOLA 4ALPA 2JA8G 1DD2A 2C4UA 4K1XA 1VMCA 1YNNC 5CV6A 4YEJA 1NJID 4B3SQ 3KBXA 1EWIA 1JJGA 4NW2A 4EQNA 3M4OB 1WTPA 3OEHA 2P5ZX 4EQ5A 4KKUA 1TU2B 3A8JE 2L15A 4HMJA 3VA5A 1EUJA 3N6RA 3PSIA 3E1YE 2QGGA 4YWLA 5BR8L 2CCZA 1FJGQ 2B2YA 4QB4A 2K5WA 4EH1A 2TSSA 2BM1A 3G05A 4EX5A 2JA8B 5EKIA 3CCSA 1GXDC 2N49A 4PV1C 5DSZA 4ODGA 3SHLA 1HNWL 2JE6I 3P26A 1EY0A 4HMIA 3BG3A 4A93G 2V7UA 4PABA 5EGTA 4DR6L 2N78A 2F52A 4LBZA 3V96A 4Z4VA 4Z1MA 3AQQA 5JEAG 2X53S 2WJYA 5I6WA 1FNWA 4X07A 2EY1A 3S2DH 3KLSX 1EOVA 1LO5D 2XWJB 4X62L 2BE5D 1YJWB 3SKBA 2J7ZA 2B2VC 1VMPA 2K5NA 1I4PA 2KHSA 3PMFA 1I7PA 2OWOA 1EEFD 4JI3L 1VLOA 4AIMA 2PQEA 2KJXA 2CVRA 3KLSA 3J7AF 2XTIA 1N33L 3TREA 1L0XB 1TQOA 4JPBW 3D8GA 5F4JA 5JEAH 2XVSA 4JI4Q 4LNQA 1D7QA 4I7AA 4JI2L 1Y1VB 1UWVA 4GLXA 3UDGA 5COYA 4XM3A 2HIVA 2R93B 4A93H 3S1NH 1HR0L 3P27A 1B8AA 1EZ8A 2Q2IA 1I4GA 1KHIA 2XRQD 3FP9A 4DFAA 3QFRA 3HOVG 2NN6I 4A3FB 1FGBD 3MEHA 4RJLA 5DN6A 1U5KA 1E1TA 3FKIG 4N8X1 5GROA 3ZUGA 2GK7A 1EIGA 1G7CA 5C3XA 2LXJA 4YELA 3MXUA 4DF7A 1AP0A 1PTOD 5GV7A 3OZVA 1TTTA 1ZKOA 1RDPD 3TMEA 1K28D 4DR6Q 3KDFA 3R2TA 4DKAC 2F0WA 4RD0A 4G7HC 1IBKQ 1ENAA 3U50C 2UXCQ 2K01A 2LKVA 3RUZA 4OIJA 5KNDA 1SBBB 4JI0L 1ZM4A 1YJNB 4NB3A 3IAYA 3D26A 1W3SA 2NB0A 3OFNA 4YCWA 1QZGA 2ASBA 3M7GA 4KTAA 1G51A 2LY7A 4DR1L 1IJFA 3CCVA 2IW3A 3T56B 2KCMA 2F0JA 2GK6A 2NVYB 4DV1L 2AWOA 1H9JA 2D9RA 2NN6H 4M1KA 2NZ1D 4MN3A 1M90D 4EQOA 3K7AH 5IOCA 2L55A 4XR6A 3BCDA 1OXTA 2B3GA 4ZCKA 3W2GA 2V7XA 1D8LA 1JCKB 3CMEA 5E4WC 3J7AV 3WBKA 3W1BA 4C0SA 4R4CA 1I3QH 5JJLA 2CHBD 2MQHA 3ERQA 2ID0A 4GOPB 4MHEA 3LO8A 1YHQB 2AHOB 5M5XH 3F2CA 3ZBUA 5H59A 5L46A 1ESRA 2ZL6A 1B3QA 4IZ8A 1E64A 5DEHA 4JYAQ 4WZEA 1VQOA 1LTRD 3T1HL 1KJZA 3KDFB 4BA1I 5C0XH 5I9PA 1IBLQ 1PA6A 3ASPA 1I6VC 3S17H 4IALA 1B1ZA 4FXDA 1JOKA 3NUCA 2MGSA 4QFMA 1WFQA 2A1AA 2E2JH 1H9RA 2E1BA 4P73A 3ITPA 1W0JA 4Z9CB 4FXGC 3CCQA 2CK3A 1SEBD 1Q7YD 2OXPA 5EPJA 1J8IA 4NP5A 3U2QA 4KMUC 3VDYA 1H9MA 4WZTA 1SLJA 2EQSA 4LFAQ 3H9NA 1E2ZA 1IJEA 3CP2A 4P9SA 4CQJA 3Q0AA 4XLFA 4KHPQ 1BDOA 2QILA 4QUFA 3K80C 2AQ1B 3AVYA 1VQ6A 2BDOA 4RCOA 3A5ZB 3HRZC 3E20A 1EYGA 3S9WA 3G48A 3TEHB 4PGOA 1BQQT 2K05A 2FFKB 4ZRZA 3ONYA 3F2BA 1PFSA 2FVGA 1HFNA 1R5BA 3CCSB 1JQYD 1V43A 2E2HB 2BF4A 4A3EB 4G4KA 4DAYB 4FK8A 4K8IA 2K03A 3CC2B 2LXKA 1YITA 3CC4B 4R4IA 3S24A 3Q23A 4JI3Q 3S2HH 2UXDQ 1STHA 4LF9Q 1WVLA 5I6YA 5KYIA 3JQPA 3VYTA 1I5FA 3ULPA 4C3JB 4OPOA 1RD9D 3VYUA 1B3AA 2IL8A 4XQJA 4JI2Q 3ASTA 4XD7A 1LABA 2L1BA 1E43A 1K3BC 2KCCA 1JWUD 4HAEA 2RDHA 3OEEA 3NEMA 2GN5A 4ZUJA 5IP7H 3HKZE 4X8IA 4OL7A 4L5SA 3LVBA 5A88A 2JN4A 5IYCG 1YJ9A 3S1QB 2R7FA 5HZBA 4AYBB 5I2YA 3M3YB 1Q90A 2PZUA 4NMZA 1SKYB 2LZJA 4FVMA 1R9TH 1NE3A 1ICFB 4ABNA 1I50B 5CR3A 4XMYA 3CCLB 2KECA 4X7EA 3GTLB 2FX3A 2H1EA 1YLOA 5M3MG 3K0XA 3G6JB 4XOTA 3CRZA 2EZVA 1STBA 2R9VA 2UU9L 1E7ZA 3J81c 3HAGA 4IUPA 3A8IE 1TWFB 2LSSA 4LFBQ 4P3YA 1FNMA 3BJUA 2C4TA 4X64L 2AQ3B 2KA7A 2BH2A 4JI0Q 1PYBA 4TMWA 3C1EA 1HJPA 1GKHA 4ME5A 1WU8A 4A3GH 3GIRA 4LFCQ 4JI5L 3MC0B 2JA5G 2B29A 1R9TB 4A3IB 2VBUA 5KEEA 3GTQH 2JA6H 3J81k 2ZITA 5HKKA 4FYDA 1F2ZA 2Q8RE 2VUMH 3F1ZA 3MEFA 3A7AB 3QIAA 4HN7A 1PH9A 1F20A 3K81C 1N9WA 2FXQA 3TP7A 1HA6A 1I8DA 3WYAA 2OYNA 2WJVA 3A8KE 1K73D 2Q2TA 4K6LA 2ZJRA 1HZBA 1EP2B 4BBSB 5LL6S 1FRNA 3K58A 2IX1A 1EIHA 1ZM2A 4RCNA 3JQQA 2F4NA 5EJWA 2WPDA 2ZT9C 5E4XA 5DLQE 1HVXA 1HZCA 1KQSA 4K0KQ 4YCVA 2A6HC 2CKZB 2GVAA 4HJ5A 4CDDC 3K6OA 3OYYA 2N55A 4X65Q 1VQLB 3S1QH 1IBKL 2TMPA 3X3NA 2CC2A 1KL9A 3R2IA 5M5WB 1CZGA 5T1GA 2CBXA 1E62A 3MAQA 4U68A 3AGQA 1RIPA 2Z6KA 4GZYC 3BDOA 3OP1A 5GAHC 3J81j 4ACBA 3EA6A 1O7YA 4LUZA 4DR1Q 2A69C 4YWMA 5A8AA 1MBYA 1KDAA 1Q82D 1VQ9A 1VQBA 3ND8A 4IJHA 4B9XA 1SMYD 2F0UA 5IWAQ 3RN2A 4B3TQ 4LF7L 5IYPA 3PUWA 3JC66 2Q2HA 4QIWB 1WPCA 4QQBX 1PH3A 1B23P 3K8AA 1LT5D 1LLRD 2NWGA 1WJJA 2E1RA 3PUVA 1OTCA 3K5OA 3RNUA 1YX2A 4RPBA 3G6EB 3CC7B 3G4SB 2CWPA 1CI3M 4ZUIA 4QVAA 4EGVA 2Z6BA 4OX9L 2QKIC 2EY2A 4BBRH 1WSRA 3VR6A 2EVBA 4IQZA 1TS3A 2A68D 1V9PA 2A69D 1S5FD 3DEPA 2JA6G 1G7SA 3R6KA 4RHRA 4OWTB 4GQNA 4N3NA 1N05A 2NTTA 4A3BG 3Q8DA 1QNKA 2QDLA 3Q38A 4RWSC 5IT9L 4WZKA 4KY7A 1I3QB 1UMKA 4XLAA 2IPKD 1K0RA 1KRTA 2A6HD 2RC6A 2OQKA 1W0KA 1E22A 2EIFA 2MNAA 2UUBQ 2M00A 1ET6A 1ASYA 3AGPA 2G9DA 3QO2A 1TUIA 3W2EA 2QTLA 5E1FA 5BN3A 3NXWA 1K73C 2F0KA 4G1VA 1J5EL 2JA6B 2F1MA 4R9WA 1P16A 3JAMi 1EYAA 3S17B 1KNAA 4C3IH 4DUZL 1CT1D 1OGJA 1HZ9A 1DM0B 1S72A 2IHFA 2R92H 3UDFA 1SFOH 4Y9RA 1U9RA 3EN2A 3PIPA 4ROXA 1K9MD 1UD3A 2FMMA 4ACAA 2DJFC 1DOLA 5J35A 3IRBA 4JI4L 4B3RQ 3W5OA 1GUNA 2A8VA 1TWHB 3OW2A 1CSQA 1ICWA 4A3DH 5IYBG 4DR2L 1Y14B 4DPGA 1HUMA 4II3A 2DY1A 4XNFA 1H8EA 1CQFA 3DWQA 3LGJA 2Q8TA 2ZXRA 1XNRL 1XPUA 2FJ2A 2I5MX 4PMCA 1SROA 2F4IA 4DV5L 4X66L 1L1OA 4RD2A 4L63B 3C1FA 4R4OA 3D0FA 1ZM9A 2QDBA 2EY5A 1O78A 2K5VA 5FLXL 3UE1A 3AVWA 4PC6A 2RBMA 4BXXH 4DV4Q 3CF5A 1EIFA 4H02A 3U9SA 5FLXc 1J9ZA 1SYGA 2IJ0A 3NSWA 4TMXA 1CNEA 3PUNA 1H85A 3PA2A 3P7JA 5IY0A 4YXWA 2HQLA 1PH1A 3CC7A 3PIO3 3DDYA 1NAPA 5C3WA 1IYJB 1QVCA 3U6KA 2UXCL 2QN6A 2RHQB 4GS3A 3HOZH 4P1VA 1Q81D 4L6TB 4FN5A 3H3VH 3AYHB 1RTOA 3GD7A 1GR1A 2AMCB 1S5ED 1TWAB 3BZDB 4DV2L 2EXDA 3L9AX 4LC0A 1TXYA 1TVCA 1N0VC 3MMPA 4DK1A 3H0GH 1BCPB 3FKIB 4P71A 4CDFC 4EVOA 5BN4A 3HOZG 3BDCA 4KHZA 2ZTEA 2PZTA 4ID6A 1KK2A 3OTOQ 1WTOA 1KLUD 3D6CA 4TVAB 1KTVA 1BBXC 3NELA 1GM5A 1QVFA 2DETA 3TN2A 1WTWA 3SVMA 2RC5A 2VZLA 1VQGA 3NBIA 3VYSA 1BNZA 5C0XG 1PLFA 2F0HA 4ZCLA 2DGYA 2B8FA 2JP1A 3GP7A 2OBSA 5C44H 2UXBL 3VNUA 5A2QL 3I55B 3CRLC 2VNUD 2PQAB 2VNJA 2ZTCA 3MHPA 4AYBE 3W5UA 2IT1A 3OIQA 2GJRA 3SDZA 1I4XA 1CKNB 1LTSD 1ZYRD 4XQFA 1SE2A 2JYOA 1WD1A 4QVJA 1HXYD 3CXCB 1QVGB 5TR9A 1C48A 1HH2P 2PNHA 3OE7A 1EY6A 3CD6B 3GO5A 3TP5A 2B2VA 4QHYA 3CCEA 4NXML 1YI2A 3QFCA 1E0BA 2L12A 1PRTB 4G5GA 3UE0A 1GHJA 2PNRC 3HKSA 4DV4L 2E74C 4AQYL 1HHVA 1PH6A 1TWHH 4A3KB 1L0WA 2R92G 1F9PA 4X7FA 1QFZA 1KC8C 3RZOB 4TMTA 2WKCA 1YNND 4YY3L 4KN4C 4N9TA 4LFAL 5I9OA 4C1NI 1D1NA 1QGAA 3I55A 3C3LA 3OW2B 3B6YA 3OZWA 1KRSA 1X6OA 1FNBA 2CQAA 3TBIB 3HOUH 1WTXA 2XNJA 4B47A 1HTPA 2CQOA 2DNCA 5C4JB 1HNZL 3GTGB 1QVFB 2K50A 3NPPA 3KF6A 4IPCA 3CCJB 3R93A 3KF8B 2OF1A 2BDNA 3OPOA 4NBSA 4GNXA 4DR5L 5IWAL 3SK4A 1LUZA 3W5VA 1VQEA 1N8RC 3Q22A 3QR8A 3CCMA 4QCLA 2EY6A 1HUNA 4WWVA 3CAMA 5F2DA 2JN9A 1Y69U 3FKIH 1FGUA 1D2BA 2UUCL 1XNQQ 2LS01 4A3MH 1MJCA 2NZOA 1PZID 4Z4YA 2A68C 4P6YA 3S16B 1HQMC 5C6AA 2R93H 3FJOA 1Y8PB 5I2XA 1G91A 3I4MB 5C4JH 4CBVA 5ELFA 2KHIA 4HJ7A 2PCFB 4HIKA 4XQQA 1C4QA 1SAPA 4TKOB 5FLMH 2QEXA 3PVDA 2EYFA 4DAPA 4B44A 2C5CA 4RDJA 1OB5A 1K8GA 3TP6A 4Y7NB 4DNTB 1UD4A 3SLDA 1FX0A 1UE6A 5FK9C 5IODA 1Q1EA 4NXMQ 3SLNA 1LTGD 4U9UA 2Z4IA 1DOMA 3E9IA 4LAAA 4RFBA 3QOLA 3QB3A 1SMYC 4QV2A 1E1QA 4JBWA 4C2MB 1Q82C 5GV8A 2YWEA 1ENFA 3A56A 1XPRA 1WCMH 3RLNA 3A7LA 1GHKA 4QIWE 3H91A 1G8ZD 2X6XA 4NCNA 4DK0A 3U58A 2PMDA 2K6AA 1GUSA 5LL6X 4DR4Q 3P20A 2UU9Q 4AYBG 2X6WA 1QUFA 5BSXA 1EQRA 1ML0D 1T9HA 1QFJA 2JSOA 3K7UC 1RJTA 2XSCA 4O0AA 3GTMB 1VQ5B 4GN4B 2VY3A 1O7LA 5C4XH 4LFCL 1VQ9B 3AB9A 3RR5A 1ELOA 3W2FA 2DEUA 5EQ0A 4M8AA 3UDIA 1PYSB 3RZDH 4HE5A 1LM0A 1NDHA 4NNJA 5IYRA 5A89A 3KK7A 4HCEA 3HOVB 4WFN3 1DONA 4GOPA 4V190 3CCJA 2D2CC 1E63A 3CPXA 2Y0SE 1XNRQ 4B48A 2HIXA 2Z6BD 3DEOA 1JOQA 1EU3A 1SDFA 3CB4A 4XN3A 1D5MC 1LT3D 4X3UA 1JB9A 2QF7A 2RQXA 4LK1C 3BQJA 1X3QA 1YIJA 2ZXPA 2WV6D 5GQOA 3P1HA 1IBLL 2R92B 1VQ8B 4X05A 3WY9A 3ZZTA 3OOCA 2RSNA 1F60A 3FKSA 3Q6RA 4N9PA 2RF4A 5GADC 1FVIA 1NJIC 3IFDA 3B78A 4GKKL 5KW9A 4YCUA 3NENA 1EWHA 4F7XA 1XMQL 3PO3G 1OHHA 1DDIA 2KEDA 1JB7A 1AZQA 1A3UA 1KD1C 2E2IH 1BX0A 4A3CH 1NMGA 3J80E 1AZPA 4R8IA 5FIUA 3D31A 5CORA 3E3XA 1V0FA 2ZM6Q 3EQLC 4GKJQ 2QE7A 1V5VA 4GLVB 2BA1A 1JA0A 5JBQA 4JOIC 4HR7B 2JQOA 2PIAA 1VQIA 2R3ZA 2PQAA 1A8PA 1HCZA 2HCIA 4POGA 3FPKA 5E6TA 4DV6Q 2VJJA 1A0IA 5IYWA 4BY7G 4ZAIA 1IZ6A 4A3DB 4DR4L 2XZPA 5KSWB 3J7ZC 3P75A 3E0JA 2ZZGA 3QSYA 3HOWH 5DNFA 2NVQB 5IGEA 1JJ2A 2B63H 4N3GA 5TV2A 1SFOB 5M5YB 3M7NA 4RKLA 3HKZG 4QL5A 1Y1WH 3KUPA 4LF8Q 2JA7H 3S15B 2VNKA 1OXSC 3ND9A 1EYCA 1STGA 5M5WH 5IP7G 3S1RH 3TQYA 2W6IA 1HZEA 4OGQC 1E1OA 1N34Q 1Y1WG 1WD0A 3MXGA 2GREA 2E75C 5EKLA 4C3HG 1VQNA 2YU9B 1N0UA 4WZLA 3WNCA 4NPSA 1II3A 1UEAB 4WJ3M 1N08A 1SNOA 3CCUB 3GV3A 1W34A 2A5HA 1VQFA 4ZKBB 4LF4Q 1RHPA 3DM1A 3OWFA 5CC4A 4JC0A 1CM9A 2QW7A 1ZYRC 3KLRA 5CV5A 4X7CA 1SYEA 1YZ6A 1PFBA 2JJ2A 4MYUA 1PH5A 4ME3A 1PXUA 1HNXL 5FNZA 4Z4TA 4RKBA 4UDUC 4JI8L 2OT2A 4BBSH 1NBMA 4L5QA 3K5LA 2C78A 4R4QA 2NPFA 4A3LH 1Q1BA 2VBTA 2DY7A 3GTLH 4KHVA 4Y9UA 4M2LA 1G6PA 5IE8A 4C56C 5IYDH 4FXKC 4AVZA 2QDXA 4K6DA 4LBYA 4B3GA 1EYDA 2FMCA 4OO1I 1VQPB 4RM0A 1SNCA 5IGGA 4A3IH 4PMWA 3S1MH 1TWFH 1N06A 4B08A 1Y1WB 1PZJD 1OGIA 1U4PA 1M90C 5EAYA 1QFYA 3WQZA 4B43A 2CW5A 4B9WA 5IYDG 1WOPA 3D4RA 1SKQA 2WB1G 4MTKA 1YHBA 2EJGC 5M3FH 3MVVA 2IHEA 1I6HB 3BDLA 2YU9H 1A2UA 2DYIA 5JOBA 2VB3X 1CHQD 3DWAA 4K5XA 4LW1A 4G7XA 4B3SL 3L0OA 2B63G 1GO2A 1D6EC 1H42A 5EBCA 3WOEA 1EQQA 3NE5B 4B3FX 5THXA 1QWYA 3GTOH 4N8FA 4BA2I 1IL2A 2B2TA 4APVA 2KCTA 2F0IA 4BY7H 1A6XA 4JMQA 3V7AA 4ZV4A 1B9MA 4A3JG 1RL2A 2OTLB 1MHWC 2HHHQ 2WIIB 1E1RA 2WB1B 4RD1A 4DUYQ 1EFCA 2WAQG 1D1KA 3I91A 3OHXC 5IIFA 3BYTB 4IFDJ 1CFMA 5C0XJ 1K9MC 3AEVA 4Z4UA 1V1QA 4YHHQ 4C2MH 5DM63 5E3FA 2RDGA 2DN8A 4IN3A 3WNDA 3A8KA 2JK8A 2AWNA 2SNSA 1YEZA 2E2HH 3A3GA 2WYRA 1BMFA 1QOHA 1QNUA 4J6HA 3OTOL 3DXJC 1OB2A 4Y7NH 2MO1A 5FO7B 2JA5B 1B7YB 1IW7D 1Y8NB 1DOKA 4H7BA 5D14A 3KJOA 2ATWA 1RQPA 3SE0A 3TS0A 4ZQ3A 3MWYW 1J5EQ 1WOSA 5M3FB 4A3CG 3W1GA 5IGBA 2AKWB 1CKOA 4O42A 4DUZQ 4FWTA 4AF6A 3C2PA 3HZXA 1TKWB 1EOTA 3PO2G 3G6EA 2F4VQ 1KDCA 3HOVH 3A55A 5C4XG 4DV7L 1XMOL 4UP8A 3D6WA 2PW5A 4K2KA 3CP8A 1XQBA 4J0QA 4OPSA 1LTBD 2F1LA 1ONLA 2GQFA 1W35A 1XXGA 2RDFA 4DU9A 2YV5A 1QGYA 4FF4A 2E2IB 1DARA 5C4XB 4XOPA 1XFOA 1QVGA 1C7YA 2XNDA 3NWSA 3RLOA 1EIYB 1G6ZA 2KEEA 1JA1A 1W2BB 1E3PA 5LMUQ 2MO0A 3J80L 3FPUB 1EY8A 1KDBA 2I1LA 1QUQA 2F0GA 4U673 1JMCA 1HFGA 3VR2A 4K5VA 2B8GA 4KN7C 4JI7L 1I4QA 4PC1A 5A2QE 3OZUA 5FO0A 3GVJA 4FXUA 1MSHA 1M8AA 1H95A 2WINB 3ER0A 3H09A 1PFMA 1VQ5A 1C0AA 4YAOA 5J3BA 1QX4A 5BR8Q 1FJGL 4GLAC 2Q2UA 1S3OA 4A3BB 4XIGS 4ZK9B 4BY1H 4M53A 3AVVA 2V7TA 3LQEA 2K32A 2YYZA 1SYDA 1NB9A 4X3KA 3GTPH 4A3EH 3S2DB 1D5ZC 1IYVA 4DNRB 1S4ZA 2ICIA 1HA3A 1FL0A 3CTAA 3MXPA 4UPAA 1UD2A 4JVZA 1W2BA 1KLGD 5KNBA 5HY6A 3CMAA 2UUCQ 3I56B 1E3ZA 4LF8L 4OP7A 4JCVE 5C44G 2I5HA 4II2A 2O2LD 5ELDA 1UAPA 1EY4A 3TDQA 2YWGA 4DV2Q 1IKMA 3S1RB 2K5HA 3E5SA 1S72B 2WAQE 4BS9A 4X62Q 1D2EA 1SE3A 1VCIA 2RKSA 2A74C 4B3TL 1Q8KA 3EIVA 1KK0A 2I46A 4LF7Q 1N33Q 2RVLA 3CPWB 2K1BA 2L5TA 1ENCA 1U4MA 2NVQH 3OSOA 2HCJB 2KVOA 1NR4A 2JA9A 4ZKCB 4L5RC 1K8OA 4X06A 5GAEC 1WCMB 5EPKA 4ZCIA 5IGFA 1KNEA 3PIOA 1H9SA 1IHZA 1CQVA 1B44D 1LT6D 2Z1CA 1PZKD 2Z0SA 3J7YW 2MFIA 3HS0C 1R5NA 2CH4W 3S1NB 4BY1B 1JE4A 4OWWB 4NDXA 1SRUA 2R93G 4HIZA 4F7DA 1CSPA 2F0PA 5CV7A 4KY6A 4F8MA 5HXBA 1V1OA 1QJOA 2EYOA 1VF5C 2YTVA 3L3OC 1X65A 5CV8A 3SK5A 1UD6A 3PGZA 4LBWA 4HJ8A 1PKVA 3CCQB 4BXXG 2JEBI 1FD7D 2ZJPA 1EFUA 3ULLA 1U2RA 3ONUA 3AVXA 2E2DC 2XOKA 4GKJL 1DYQA 3CW2C 2JJ1A 3GTKB 1A2TA 1K83B 1U4RA 5J1ZA 1VQ4A 1NUCA 5L37A 2XNAC 4RGNA 3I1FA 2UUBL 3CESA 1DZ1A 4RPDA 1K83H 2M2LA 3KFUA 4A3DG 1PVOA 2NUCA 3GTPB 3H0GB 4H0LC 3EVQA 5J22A 3CCUA 2CF4A 1SYBA 2BA0A 1IW7C 2ZXOA 3U4ZA 3L2PA 1H9SB 2XRSD 1EWCA 2ICEC 1KK3A 2ZZQA 1EEID 1PTOF 3S14H 3WBJA 1Y1VH 5IYNA 1RTNA 2BGIA 3T1YQ 1EQVA 2H4OA 3D4WA 1I94L 1HZAA 5BN5A 1KMHA 2PMZE 3C46A 1STAA 1Q81C 2D62A 1F2LA 3ISXA 2PLFA 1KAAA 1SMXA 4C3IB 1O80A 1QB5D 2X85A 3BZCA 1JB3A 5KRUA 3E6ZX 2YTXA 2WZPP 2MP1A 2A6ED 2HUGA 5K5PA 1H8HA 1UD5A 3H3VI 3I56A 1S5CD 3PCOB 1YVCA 1MRZA 4GNXC 1ZEQX 4RG1A 4H44C 4OONA 4ZCMA 1BOSA 5FO1A 1E2WA 4A76A 3CPWA 1PJ5A 2AHOA 3A3BA 1LT4D 4DV0L 1YHQA 3PUMA 1GVHA 4Y7CA 3JAMc 1VQ7A 4XLHA 1HNWQ 4DV6L 1V8QA 1VF7A 2VXWA 1GUTA 1X55A 1BPLA 4IUUA 2KBNA 4BY7B 4HE6A 5C3EH 2NV4A 3BNWA 1AEXA 1VJSA 3U9OA 3R6JA 1VQOB 3SK6A 4RDKA 3T13A 3CCRA 2F0LA 2OTLA 2L9HA 3MZ5A 2J0TD 4XLEA 2XGJA 1VQMA 1VQDA 4YAFA 2UUAQ 3PUYA 4KHPL 1PJ6A 1YBYA 5FOBB 5JJZA 2M9VA 1CK1A 2K7VA 2J4XA 2KENA 5KYLA 1M1KD 4K8JA 4RAUC 3MA2B 4J8QA 1WORA 4Q7JB 1VLYA 4DV7Q 1XMOQ 3BVMA 1UE1A 1BLIA 2D3LA 2EPBA 4C3IG 4KKTA 3PO3B 3DM3A 4TN1A 4X7DA 1UUPA 1QUQB 1VHOA 3KJPA 4A3EG 2CH4A 3T16A 1PFNA 2NTSA 2EIXA 1V1PB 5EBDA 2ES2A 4JI8Q 4DXFA 2VUMB 3DMUA 2XNCA 1Z47A 2A73B 2JXMB 2HQEA 1LYLA 2WKDA 1U0LA 5IYBH 3V76A 2BH8A 1EFWA 1DG1G 1T6YA 5LHY1 4AH6A 1PH7A 5E7NA 2B7BA 4DR7Q 5FJ8H 4HJAA 2X3UA 1SJHD 1BCPD 3STBD 3M4OH 4Q0FA 1IXRA 1ET9A 1TWGH 4HTHA 4IUNA 1BXTA 1VQKA 5CBEE 3LX0A 1WOCA 2C5HA 4A3BH 4ASUA 3PIP3 1TWCB 4RGOS 1EY9A 1O7IA 4A4IA 2G9HD 3KOJA 2EXZA 2Y0SG 2X6GA 4KD3A 1MI2A 2KHJA 5JJIA 4RGMA 3OAAA 4CJ1B 4YY3Q 5NUCA 3Q3AA 1TS5A 2IX0A 4OPVA 4X3TA 5IGDA 2OK8A 3A54A 4YHHL 3CHBD 3CU7A 4JV5L 4Z4ZA 1O7ZA 3HGBA 3KLWA 4LFBL 2NZHA 1HRJA 3HOXH 1CUKA 2F3IA 4R8NA 2KCNA 3G71B 1GUGA 1VDZA 3PO2H 1IB0A 4G57A 1HA5A 1YJWA 1NNXA 3CCLA 1XJVA 1MJEA 3FDTA 4IUTA 2EYMA 2JA5H 1PRTD 2O4XA 1TR5A 3NP8A 1TY0A 2VQEQ 5D3IB 4YHBA 1SE8A 4JI5Q 3SEJA 2VNHA 2QA4B 3MXNA 3QWNA 1MGSA 4DR2Q 4HJ9A 1EP3B 1C9OA 2VZAA 1FYCA 2NYZD 1VQKB 1VQ4B 4G7OC 1T5XD 1W87A 1IHMA 3NK9A 1IL8A 2FINB 1NSNS 1XYIA 4BY1G 4OEMB 3DUZA 4KY5A 2K5QA 4Q5VA 4IO9A 1F9RA 4DQLA 1YI2B 1GOZA 2L0CA 1EU4A 3GV6A 5FLXE 4NXNL 5IYCH 1WSVA 1YHAA 4DR7L 4AC9A 1S4MA 2OBRA 1FNUA 2E5LL 2MHVA 1X3PA 5M3FG 4A75A 3EJIA 5HGTA 1HNZQ 4ZGQB 1HNXQ 2DUDA 3RMHA 4XTCS 1XB2A 5TY0A 4A3JH 4G7WA 4UP7A 2MJ8A 2QA4A 2CRVA 3ONAB 2C77A 1V0EA 1P8LA 2HDMA 5M9OA 4JI6L 4B4DA 1RF2D 4A3IG 2PW7A 4FO2A 3QFTA 4E6IA 4XKVA 1SNQA 1KZLA 3E9HA 3CXCA 5HGQA 1R5OA 3CMAB 1I6HH 4JV5Q 1VQMB 2XGTA 2VNIA 3GQBA 3CCMB 2Z9HA 1GAWA 3B8HA 2CWAA 2F0EA 1VQPA 1Y0YA 2F4VL 2HCCA 3NBHB 1EY5A 3FMCA 3OIPA 3V2TA 3KF6B 1NCVA 1JR0D 3S1MB 2EYLA 4LF4L 4IJLA 4L8JA 2E76C 1KIXA 5G3LD 4LF9L 4P3IA 4WJWA 2DIEA 5IT9c 2UXBQ 2M5SA 2ZL5A 3VR5A 5AN9A 3A5UA 3CKIB 3M4YA 4XT3B 1SE4A 4FDBA 4UAIA 3AMUA 1SJED 4PC2A 1TY2A 2HMAA 2CW0D 4RCZA 4JW0A 3TZUA 3J7A5 5I4DA 2KUMA 4Y52H 2R6GA 4O1NA 1DGSA 1VQAA 5GAGC 4RLZA 1QH0A 1LTAD 4JI7Q 2XWBB 3ULJA 1BF4A 2ZTGA 1XTDA 3NTIA 4A3LG 3T51B 4GN5A 2F0SA 1YJNA 1JJCB 4JYAL 1QG7A 3NTKA 1EQTA 2JJQA 2E5LQ 2VYQA 3VMFA 5CMDA 3ZZ0A 4CGYB 3G4SA 1QG0A 1X54A 1NB0A 1JE5A 4UY8C 4C43A 1NR2A 4FNFA 2FHTA 2ZM6L 2B2TC 1LTLA 1A63A 3LQ6A 3M3YH 1X3GA 1PV4A 3W2HA 1F2MA 2B7CA 4DGZA 2B5OA 4M0LA 4WQMA 5EMNA 3AVTA 3BZKA 5EKKA 4TSFA 2X6YA 1UE5A 4IW3B 1CTMA 5LMNL 1N36L 1YNXA 2BGJA 4C3HH 4XDXA 1BCPF 3HKZB 3R3OA 3SEBA 2EYJA 3HOYG 4UHVA 3V05A 4F87A 4TT3A 1W6JA 2F3WA 1E24A 1WTHA 4CJ2C 4RD6A 3Q6QA 2OQ0A 4XL9A 4PQXA 2QGQA 1F9SA 1QCBD 3CPFA 1A3TA 5AFWA 3PQIA 3CQZH 2WR8A 2EDGA 3QOJA 5CBAE 2ZZEA 5FO9B 1R4QB 4B3RL 3SGIA 2F0QA 3UI2A 4CKCA 1AFPA 3BVZA 3NWTA 5FA6A 4X66Q 1AW7A 2E2JB 4LMQD 1AN8A 1XPOA 1X32A 4P25A 4CDEC 1STNA 4QF4A 2JIZA 2R7ZH 1B53A 1ZM3A 4QMGA 2ZZFA 2D0OA 4DQKA 3A0JA 5H5JA 1WI5A 3W3AA 2PE3A 1Y8OB 4JI1Q 4CDCC 2B2WC 1MIUA 3RZOH 1CA6A 2SNMA 4XN0A 4ILWA 3H6MA 3GVKA 4ZYSA 1SYFA 1K28A 1JORA 5LMUL 1Q86D 3HP3A 1S0UA 2D0PA 2HT1A 1P4MA 3PO3H 3SJZA 1QUEA 4HIOA 3FPPA 4F88A 2D74A 1MSGA 4PC3A 3T53B 4JBJA 1SN8A 1K3RA 3W2DA 1J9OA 2QEXB 4QY7A 1K8AC 1SNMA 2RHSB 4X6AH 5FO8B 1RODA 4K2LA 4DAVA 2N3SA 1G291 2BV3A 1G7TA 3F8TA 4B3MQ 1BX1A 3WXMA 1DJRD 1Q46A 1XNQL 3BVGA 2BOSA 4QUCA 4LF5L 1AH9A 4TMZA 4Z4RA 4J1MA 1UEBA 1G2SA 2ZBVA 5EPLA 2WZNA 2PYKA 4M1UB 1VS0A 2GPJA 2K75A 3TSSA 4H13C 4RGTA 5IT9E 3B82A 1WCMG 4R1JA 4P2CB 3WDNA 4FF2A 1IYUA 3DLLA 1CQXA 4QUZA 4GNXB 1N32Q 1PH4A 3PENA 2K4KA 3W2IA 3JQRA 2D9UA 3U4VA 1TS4A 2VW9A 2UXDL 1Q3LA 2OTJA 2AUJD 4KJNA 3Q24A 3HOWG 3S16H 4R4TA 2NVTH 4RMFA 1JT8A 1K0SA 4P2NA 4RCYA 4HCSA 1Z7TA 3EBEA 3M4QA 2F03A 5KIXA 1GJXA 1EXMA 1FNVA 3ZPNA 2I5LX 3D3RA 1H9KA 2G5DA 2I07B 3FRPB 5FLMG 3I4LA 1LTID 2DERA 2IX3A 1GJRA 5DS0A 4TSSA 1S40A 1FNCA 5H1SE 1DCZA 3LWEA 2JDIA 1Z6HA 1ZUNB 3BH4A 1XMQQ 3IL8A 2D3NA 3GTJH 2NN6G 4PMBA 4DUYL 1OXVA 2A6EC 4WORA 5CYUA 4DN4M 2AQ2B 3OKXA 3PUZA 2VQFL 1GD7A 1SNDA 4AF7A 4HEDA 2RCFA 4A3MB 1BQEA 4LF6L 3ASSA 4JI6Q 1FDRA 3HOWB 1WP6A 5F4MA 3G7LA 4KKSA 4GN3B 4LUOA 4MTNA 5AJ3Q 1ASZA 2X6LA 2DCUA 3ASRA 2F0OA 4MZ9A 4XORA 4R71A 1B4OA 1CA5A 1L2FA 4B3ML 2N88A 1X56A 3N52A 2VB2X 1F2YA 1JWMD 2MUYA 5CGKA 1BR9A 1HPCA 2NVYH 5B6IA 4A3FG 4X3SA 1UD8A 4P26A 2EE1A 2KVMA 3R8BA 4G1BA 2PMZB 2QTZA 1SM4A 5J39A 1SNPA 4DV1Q 3VO2A 1EZ6A 3CMEB 1NY4A 4LJZC 1E2VA 3I73A 4A3MG 3F2UA 3T4AC 1M4VA 1HR0W 1VHEA 1N07A 3PO2B 2XZLA 4DR3Q 4OOSA 3K59A 2PO4A 1PTOB 2BMWA 2BVNA 2EYHA 1K8AD 3GTJB 5DM73 4BWGB 4WRDA 3T1HQ 4CKEA 2V31A 3CMMA 5JJKA 1YJ9B 5HURA 3UDXA 2WSSA 1VQ7B 1WOOA 1UE7A 4B3XA 3FVQA 3H15A 2JEAI 3PF4A 1QZHA 1PHJA 3GTKH 2L4NA 4P22A 2R61A 5ELCA 3SR1A 3HG9A 2W6JA 4YAWA 5JAVA 4CHTB 1KTKA 4OWXB 4A93B 2NBFA 1PMRA 1Q7YC 1QGZA 1PTOH 1JOOA 3H94A 2WP8J 2BN4A 2VL6A 1Q9SA 3SXHA 1MKHA 2EOTA 1ILPA 1HQRD 2DY8A 2Q8IB 5AJ3L 2YWFA 1CKMA 4MYTA 4DV3Q 4IPGA 5F4OA 2IY5B 1WTVA 4LF6Q 3GTMH 2QMUA 3H0GG 2Y0SB 3S14B 3Q6SA 3WNBA 4TQUS 1STYA 1Y0RA 3U6BA 1OB0A 3A8JA 3EFXD 5CDFA 5LMZA 5C3EG 3J81L 3J81i 2JA8H 3I4MH 1VQ8A 3M85A 3LNNA 3VNVA 3BY1A 1HTLD 1Q86C 1RQRA 4Z4SA 3CCVB 4RHSA 1N34L 1KXLA 2DOGA 4C1NK 3HOYB 1VQ6B 5DAUA 3QE2A 1GVPA 3ZYYX 4RD4A 4DXGA 1F77A 1B50A 1YNJC 4XKWA 1S5DD 2F0NA 5CV9A 3ZZUA 3QG1A 3OW7A 5C4HA 4KI0A 1I4HA 4ZGNB 3GVLA 2ZTDA 1GAQA 2Z8LA 3MFGA 3MXNB 4FF3A 2R7ZG 2AUKA 3NHHA 4V0BA 2ZJQA 4DK3C 3BCFA 2ENBA 1ESFA 2X0KA 1NBWA 3AU7A 4HSVA 3HOUG 2Q6OA 1C8CA 1MABA 3MTSA 4CJ0B 1COWA 4PNYA 4UZUA 1OXXK 4DK6C 1NMFA 4YAUA 3LWUA 1JNYA 3QFSA 1BVSA 1GUWA 2BCOA 5ELBA 3J80c 4X0CA 2K14A 3PA1A 3I8ZA 1LV9A 2R6HA 2CW0C 1WDTA 4YIJA 3HOYH 4K14A 5HZAA 1TVXA 1EFTA 1STEA 5C5MA 5BSYA 1L0YB 5ELEA 2YWHA 2PZWA 2RA4A 4RDLA 4XXEA 2BE5C 3JU4A 3WOFA 1T5EA 3SJPA 4C3HB 3WWVA 4LF5Q 1FNDA 3HOUB 2QEJC 1NTGA 2DJGC 4KV6A 1L1OC 3OMGA 4IFDH 5ISRA 2I0QA 2XN9C 3I7FA 4DR5Q 2R7ZB 1KD1D 4DA2A 2WFWA 4HSPA 4A3KH 1Z9FA 2P3MA 1VQJA 2EYPA 4I7ZC 1KABA 2ZTNA 4MNOA 3ASQA 3J81E 1D5XC 4P12A 1WTRA 4NKLA 4G7ZC 1TWAH 5J3OA 4JK1C 2EFGA 4JBMA 2SDFA 5JVG3 3CRKC 3CQZB 4QGUA 3I72A 3MFYA 2F0VA 4TRDA 3A8IA 2F0DA 2MPMA 3I3CA 1W9XA 2SOBA 3VYRA 4BBRG 5ELOA 5IYQA 2EJMA 2K33A 1VQLA 1SSOA 3ICEA 4KLKA 3I70A 2HDNB 4CKBA 1PYWD 4LUVA 3E0EA 4X65L 4IUQA 1OO9B 3DWPA 1XX8A 1A62A 2C5BA 1D1IA 1YIJB 3I4OA 1VQHA 4OO1H 3PV0A 2CNDA 2OBTA 4JG2A 4G6IA 2ZXIA 4KJOA 1B9NA 1I4RA 4UZEA 4P74A 2J7KA 5IK2A 2B39A 1A8VA 2F0MA 2HDLA 2VS1A 5G3LF 1TT2A 5K36G 1N8RD 5KNCA 4XQNA 2LFNA 1KQSB 2PI2A 1N36Q 4M4SA 2F0FA 3L7ZC 4OHJA 5FKAC 3KYHC 1PH2A 3HOZB 3CCRB 2V7VA 4RA8A 2VQEL 1T6XA 2XEXA 3GDEA 1PH8A 1G2TA 1PRTC 2C35B 3I2ZA 2RCNA 1I94Q 3ZIAA 3BYYB 1EWYA 3Q39A 4RH6A 2RSOA 1KRHA 3X3MA 3H3VC 1Q12A 2WB1E 1RKNA 3I4NH 2UUAL 1KC8D
chains in the Genus database with same CATH topology
3GTOB 2K28A 4FP5D 5A35A 5M3MB 1PDQA 1FR3A 2C9OA 1I18A 3BS1A 2NVTB 1PRTF 5K36H 4E0FA 1U4LA 1JICA 2Z4HA 2GJPA 1QE6A 3MHBA 1OXUA 3JAML 5JPNC 1YNJD 3IFTA 3KBGA 1DXMA 2B2UC 2X69A 4XYOA 5C5LA 3GTQB 3K5NA 3IKJA 2VJIA 4C3JG 3FEWX 1LTTD 2XIWA 3D4DA 1GUOA 5JVH3 5JEAJ 4BBRB 2F0TA 4IURA 2V7QA 1NRKA 2EJFC 1A15A 2JA7B 4XT1B 3O13A 5T1IA 1EY7A 1BCPC 1Q8IA 2F3VA 2L11A 3NTHA 3K5MA 2K04A 4FF1A 3K7AB 4I65A 2B2YC 2O5IC 1F9QA 4K5WA 3S2HB 3KEWA 4XYQA 1RCVD 3I4NB 4DAYA 3NQTA 2O5JC 1EFRA 5D3DA 1BUVT 4ZLTF 2PPBC 4A3JB 4KK7A 1WTHD 1E3XA 3URYA 2B63B 3KF8A 2ZXHA 2DNEA 3HOXB 2HLDA 4OO1G 2K5DA 3RLFA 2SEBD 3BC9A 3JAME 3DHQA 4ULLA 5C4ZA 3RD4A 3TZDA 2X8KA 1ILQA 3TP8A 1E79A 2GA4B 5KGUA 3NQIA 1IKLA 5TSSA 4OIKA 1PTOC 5FL7A 2GJKA 4XLCA 4A3GB 2LMCB 5IGCA 1MD2D 2D5DA 5C3EB 3VR3A 2XZOA 2WAQB 3I90A 1W6KA 2QCPX 3A35A 1EFID 3EROA 1TIID 2B2WA 5C0XI 1ZXTA 2NVXB 2OEOA 3VR4A 3NBHA 1BO0A 1SYCA 4IFDI 1B2TA 2KQ3A 5KNLA 4MIUA 1UNSA 1TWGB 4KD4A 3RZDB 5C44B 2IWHA 1WTQA 1JWSD 1S5BD 1A3VA 1V1PA 1JC7A 1CZWA 3SK8A 3VA7A 4IFDG 1QILA 2F43A 1LACA 5JPMC 1SXTA 3HEJA 1XWEA 4S3SA 1XTCD 2WACA 3OWEB 1R4PB 2V4DA 1CHPD 4IUVA 5M5XB 5CV4A 3QJYA 4XONA 3PUXA 5D65A 2B2UA 3K0YA 4EQPA 1TS2A 3K57A 1EL0A 3OMCA 1K8MA 2KOLA 1DD2A 1VMCA 1YNNC 5CV6A 4YEJA 3KBXA 4NW2A 4EQNA 3M4OB 1WTPA 3OEHA 4KKUA 1TU2B 3A8JE 4HMJA 3VA5A 3N6RA 2B2YA 4QB4A 2K5WA 2TSSA 3G05A 2JA8B 5EKIA 1GXDC 4PV1C 3SHLA 4ODGA 2JE6I 1EY0A 4HMIA 3BG3A 5EGTA 3V96A 4Z1MA 5JEAG 2X53S 2WJYA 5I6WA 1FNWA 2EY1A 3KLSX 1LO5D 2XWJB 2BE5D 2J7ZA 2B2VC 1VMPA 1I4PA 2KHSA 3PMFA 1EEFD 2PQEA 2KJXA 2CVRA 3KLSA 3J7AF 1L0XB 1TQOA 3D8GA 5JEAH 2XVSA 1Y1VB 5COYA 4XM3A 2R93B 1EZ8A 1I4GA 2XRQD 4DFAA 2NN6I 4A3FB 1FGBD 3MEHA 5DN6A 2GK7A 1EIGA 5C3XA 4YELA 3MXUA 4DF7A 1AP0A 1PTOD 1ZKOA 1RDPD 3TMEA 1K28D 3R2TA 2F0WA 4G7HC 1ENAA 2K01A 2LKVA 3RUZA 4OIJA 5KNDA 1SBBB 3IAYA 2NB0A 3OFNA 3M7GA 4KTAA 2LY7A 2IW3A 3T56B 2F0JA 2GK6A 2NVYB 2AWOA 1H9JA 2NN6H 2NZ1D 4MN3A 4EQOA 5IOCA 2L55A 4XR6A 3BCDA 1OXTA 1JCKB 5E4WC 3J7AV 2CHBD 3ERQA 2ID0A 4MHEA 1ESRA 4IZ8A 5DEHA 1LTRD 4BA1I 5C0XH 5I9PA 1I6VC 4IALA 1B1ZA 4FXDA 1JOKA 3NUCA 2MGSA 1H9RA 2E1BA 3ITPA 1W0JA 4Z9CB 4FXGC 2CK3A 1SEBD 5EPJA 2OXPA 1J8IA 4NP5A 4KMUC 1H9MA 1E2ZA 3CP2A 3Q0AA 4XLFA 1BDOA 2QILA 4QUFA 2AQ1B 2BDOA 4RCOA 3HRZC 3S9WA 1BQQT 2K05A 2FFKB 4ZRZA 1HFNA 1V43A 1JQYD 2E2HB 4A3EB 4G4KA 4K8IA 2K03A 3Q23A 1STHA 1WVLA 5I6YA 5KYIA 3VYTA 4C3JB 1RD9D 3VYUA 1B3AA 2IL8A 4XQJA 4XD7A 1LABA 2L1BA 1E43A 2KCCA 1JWUD 4HAEA 2RDHA 3OEEA 4ZUJA 4OL7A 3S1QB 4AYBB 5I2YA 3M3YB 1Q90A 2PZUA 4NMZA 1SKYB 2LZJA 4FVMA 4ABNA 1I50B 5CR3A 4XMYA 2KECA 3GTLB 2H1EA 3G6JB 4XOTA 2EZVA 1STBA 2R9VA 3HAGA 4IUPA 3A8IE 1TWFB 2AQ3B 2KA7A 3C1EA 4ME5A 3MC0B 1R9TB 4A3IB 5KEEA 5HKKA 4FYDA 1F2ZA 2Q8RE 3QIAA 3A7AB 4HN7A 3TP7A 1HA6A 1I8DA 2WJVA 3A8KE 4K6LA 4BBSB 5LL6S 1EIHA 3K58A 2IX1A 4RCNA 5EJWA 2WPDA 2ZT9C 5E4XA 1HVXA 2A6HC 3K6OA 2N55A 2TMPA 3X3NA 3R2IA 5M5WB 1CZGA 5T1GA 3MAQA 4U68A 4GZYC 3BDOA 3EA6A 1O7YA 2A69C 1MBYA 1KDAA 3ND8A 4B9XA 1SMYD 2F0UA 3PUWA 4QIWB 1WPCA 1LT5D 1LLRD 2NWGA 3PUVA 3K5OA 1CI3M 4ZUIA 4EGVA 2QKIC 2EY2A 3VR6A 2EVBA 4IQZA 1TS3A 2A68D 2A69D 3DEPA 1S5FD 4RHRA 4GQNA 2NTTA 1QNKA 4RWSC 5IT9L 4KY7A 1I3QB 4XLAA 2IPKD 2A6HD 1W0KA 2M00A 1ET6A 2G9DA 3QO2A 5E1FA 5BN3A 3NXWA 2F0KA 2JA6B 2F1MA 4R9WA 1EYAA 3S17B 1KNAA 1CT1D 1DM0B 1U9RA 1UD3A 2FMMA 1DOLA 1GUNA 1TWHB 1ICWA 4II3A 1HUMA 2Q8TA 4XNFA 1H8EA 1CQFA 3DWQA 2ZXRA 2FJ2A 4PMCA 2F4IA 4L63B 3C1FA 2QDBA 2EY5A 1O78A 5FLXL 2RBMA 3U9SA 1SYGA 2IJ0A 3NSWA 3P7JA 4YXWA 3PIO3 3DDYA 1NAPA 5C3WA 4L6TB 1RTOA 3GD7A 1S5ED 1TWAB 3BZDB 3L9AX 4DK1A 1BCPB 3FKIB 4EVOA 5BN4A 3BDCA 4KHZA 2PZTA 4ID6A 1WTOA 1KLUD 3D6CA 1BBXC 3TN2A 1WTWA 3SVMA 3VYSA 3NBIA 1BNZA 5C0XG 1PLFA 2F0HA 2B8FA 2JP1A 3GP7A 5A2QL 3CRLC 2VNUD 2IT1A 3OIQA 2GJRA 3SDZA 1I4XA 1LTSD 1ZYRD 4XQFA 1SE2A 2JYOA 1WD1A 1HXYD 1C48A 3OE7A 1EY6A 3TP5A 3GO5A 2B2VA 1E0BA 2L12A 1PRTB 1GHJA 2PNRC 2E74C 1HHVA 4A3KB 1F9PA 3RZOB 2WKCA 1YNND 4KN4C 4N9TA 5I9OA 4C1NI 3C3LA 2CQAA 3TBIB 1WTXA 1HTPA 2DNCA 5C4JB 3GTGB 3NPPA 3R93A 2OF1A 2BDNA 3OPOA 3SK4A 3Q22A 4QCLA 2EY6A 1HUNA 5F2DA 1Y69U 1D2BA 2LS01 1PZID 2A68C 3S16B 1HQMC 5C6AA 1G91A 5I2XA 1Y8PB 3I4MB 4CBVA 5ELFA 2PCFB 4XQQA 1C4QA 1SAPA 4TKOB 2EYFA 4DAPA 2C5CA 3TP6A 4Y7NB 4DNTB 1UD4A 1FX0A 5FK9C 5IODA 1Q1EA 1LTGD 2Z4IA 1DOMA 4LAAA 4RFBA 3QOLA 3QB3A 1SMYC 1E1QA 4JBWA 4C2MB 1ENFA 3A56A 3A7LA 1GHKA 3H91A 1G8ZD 2X6XA 4DK0A 2K6AA 1GUSA 5LL6X 3P20A 2X6WA 1ML0D 2JSOA 1RJTA 2XSCA 3GTMB 1O7LA 3AB9A 5EQ0A 4M8AA 4NNJA 3HOVB 4HCEA 3KK7A 1DONA 4WFN3 4V190 2D2CC 3DEOA 2Z6BD 1JOQA 1EU3A 1SDFA 4XN3A 1D5MC 1LT3D 4X3UA 2QF7A 2RQXA 4LK1C 1X3QA 2ZXPA 2WV6D 3P1HA 2R92B 2RSNA 3OOCA 3FKSA 4N9PA 3IFDA 1EWHA 4F7XA 1OHHA 2KEDA 1AZQA 1A3UA 3J80E 1AZPA 4R8IA 3D31A 5CORA 1V0FA 3EQLC 2QE7A 2BA1A 4HR7B 2R3ZA 1HCZA 2HCIA 2VJJA 4ZAIA 4A3DB 2XZPA 3P75A 3E0JA 2ZZGA 5DNFA 2NVQB 5IGEA 1SFOB 5M5YB 3M7NA 4RKLA 3KUPA 3S15B 1OXSC 3ND9A 1EYCA 1STGA 4OGQC 2W6IA 1HZEA 1WD0A 3MXGA 2E75C 5EKLA 4C3HG 2YU9B 1II3A 1UEAB 1SNOA 3GV3A 2A5HA 4ZKBB 1RHPA 3DM1A 3OWFA 5CC4A 1CM9A 5CV5A 1ZYRC 3KLRA 1SYEA 1PFBA 2JJ2A 1PXUA 4RKBA 4UDUC 2OT2A 1NBMA 3K5LA 1Q1BA 2DY7A 4KHVA 4C56C 4FXKC 4AVZA 4K6DA 4B3GA 1EYDA 2FMCA 4OO1I 1SNCA 5IGGA 4PMWA 1Y1WB 4B08A 1PZJD 1U4PA 3WQZA 4B9WA 3D4RA 2EJGC 3MVVA 1I6HB 3BDLA 1A2UA 5JOBA 2VB3X 1CHQD 3DWAA 4K5XA 4G7XA 1D6EC 3WOEA 5EBCA 3NE5B 4B3FX 1QWYA 4BA2I 2B2TA 2F0IA 1A6XA 4JMQA 1B9MA 2WIIB 1E1RA 2WB1B 1D1KA 3I91A 3OHXC 5IIFA 3BYTB 4IFDJ 1CFMA 5C0XJ 5DM63 5E3FA 2RDGA 2DN8A 4IN3A 2SNSA 2AWNA 3A3GA 1BMFA 1QOHA 1QNUA 4J6HA 3DXJC 5FO7B 2JA5B 1IW7D 1Y8NB 1DOKA 4H7BA 5D14A 3SE0A 4ZQ3A 3MWYW 5M3FB 5IGBA 4O42A 3C2PA 3HZXA 1TKWB 1EOTA 1KDCA 3A55A 3D6WA 2PW5A 4K2KA 3CP8A 1LTBD 1XXGA 2RDFA 1ONLA 4DU9A 5C4XB 4FF4A 2E2IB 4XOPA 2XNDA 3NWSA 1G6ZA 2KEEA 3J80L 3FPUB 1EY8A 1KDBA 2F0GA 4U673 1HFGA 3VR2A 4K5VA 2B8GA 4KN7C 1I4QA 5A2QE 3GVJA 4FXUA 1MSHA 1M8AA 2WINB 3H09A 1PFMA 4A3BB 4XIGS 4ZK9B 2K32A 2YYZA 1SYDA 4X3KA 3S2DB 1D5ZC 1IYVA 4DNRB 1S4ZA 2ICIA 3MXPA 1UD2A 1KLGD 5KNBA 1E3ZA 4II2A 2O2LD 5ELDA 1UAPA 1EY4A 3TDQA 1IKMA 3S1RB 3E5SA 4BS9A 1SE3A 1VCIA 2RKSA 2A74C 2I46A 2RVLA 2K1BA 2L5TA 1ENCA 1U4MA 3OSOA 2KVOA 1NR4A 4ZKCB 1K8OA 1WCMB 5EPKA 5IGFA 1KNEA 2Z1CA 1H9SA 1CQVA 1B44D 1IHZA 1LT6D 1PZKD 3J7YW 3HS0C 3S1NB 4BY1B 1JE4A 4NDXA 4HIZA 2F0PA 5CV7A 4KY6A 4F8MA 1V1OA 1QJOA 2EYOA 1VF5C 3L3OC 5CV8A 3SK5A 1UD6A 1PKVA 2JEBI 1FD7D 2E2DC 2XOKA 1DYQA 2JJ1A 3GTKB 1A2TA 1K83B 1U4RA 5J1ZA 1NUCA 2XNAC 4RGNA 3CESA 1DZ1A 2M2LA 2NUCA 3GTPB 3H0GB 4H0LC 3EVQA 5J22A 1SYBA 2BA0A 1IW7C 2ZXOA 1H9SB 2XRSD 1EWCA 2ICEC 1EEID 2ZZQA 1PTOF 1RTNA 1EQVA 2H4OA 3D4WA 5BN5A 1KMHA 3C46A 1STAA 2D62A 1F2LA 1KAAA 4C3IB 1O80A 1QB5D 2X85A 5KRUA 1JB3A 3E6ZX 2WZPP 2MP1A 2A6ED 2HUGA 5K5PA 1H8HA 1UD5A 1S5CD 1ZEQX 4H44C 1BOSA 1E2WA 3A3BA 1LT4D 4XLHA 1V8QA 1VF7A 2VXWA 1GUTA 1BPLA 4IUUA 4BY7B 1AEXA 1VJSA 3U9OA 3T13A 3SK6A 2F0LA 2L9HA 3MZ5A 2J0TD 4XLEA 2XGJA 3PUYA 5JJZA 5FOBB 2M9VA 1CK1A 2K7VA 2J4XA 5KYLA 4K8JA 4RAUC 3MA2B 4J8QA 1VLYA 3BVMA 1BLIA 2D3LA 2EPBA 4C3IG 4KKTA 3PO3B 1UUPA 3T16A 1PFNA 2NTSA 1V1PB 5EBDA 4DXFA 2VUMB 3DMUA 2A73B 1Z47A 2JXMB 2WKDA 2HQEA 5LHY1 1SJHD 1BCPD 4Q0FA 1ET9A 4HTHA 4IUNA 1BXTA 5CBEE 3LX0A 4ASUA 3PIP3 1TWCB 4RGOS 1EY9A 2G9HD 2EXZA 4KD3A 2X6GA 1MI2A 4RGMA 3OAAA 4CJ1B 5NUCA 1TS5A 2IX0A 4X3TA 5IGDA 3A54A 3CHBD 3CU7A 1O7ZA 3HGBA 1HRJA 4R8NA 2KCNA 1GUGA 1VDZA 4G57A 1HA5A 3FDTA 4IUTA 2EYMA 1PRTD 2O4XA 1TR5A 3NP8A 1TY0A 5D3IB 3MXNA 3QWNA 1MGSA 1FYCA 2NYZD 4G7OC 1T5XD 3NK9A 1IL8A 2FINB 1NSNS 1XYIA 3DUZA 4KY5A 2K5QA 4Q5VA 1F9RA 1GOZA 2L0CA 1EU4A 3GV6A 5FLXE 1FNUA 2MHVA 1X3PA 3EJIA 5HGTA 3RMHA 4XTCS 4G7WA 2MJ8A 3ONAB 1V0EA 5M9OA 2HDMA 1RF2D 2PW7A 4FO2A 4E6IA 4XKVA 1SNQA 1KZLA 3GQBA 2F0EA 2HCCA 1EY5A 3FMCA 3OIPA 3V2TA 1NCVA 1JR0D 3S1MB 2EYLA 4L8JA 2E76C 5G3LD 4WJWA 2DIEA 2M5SA 3VR5A 3CKIB 3M4YA 4XT3B 1SE4A 4UAIA 3AMUA 1SJED 1TY2A 2CW0D 3TZUA 5I4DA 2KUMA 2R6GA 4O1NA 1LTAD 2XWBB 1BF4A 2ZTGA 3NTIA 3T51B 2F0SA 1QG7A 3NTKA 1EQTA 5CMDA 4CGYB 1NR2A 4FNFA 2FHTA 2B2TC 1F2MA 4DGZA 5EKKA 4TSFA 2X6YA 1CTMA 4XDXA 1BCPF 3HKZB 3R3OA 3SEBA 2EYJA 3V05A 4F87A 4TT3A 1W6JA 2F3WA 4CJ2C 4XL9A 4PQXA 1F9SA 1QCBD 1A3TA 5AFWA 2EDGA 3QOJA 5CBAE 2ZZEA 5FO9B 1R4QB 2F0QA 3UI2A 4CKCA 1AFPA 3BVZA 3NWTA 1AW7A 2E2JB 4LMQD 1AN8A 1X32A 1STNA 4QF4A 2JIZA 1B53A 4QMGA 2ZZFA 3W3AA 1Y8OB 2B2WC 1CA6A 2SNMA 4XN0A 4ILWA 3H6MA 3GVKA 4ZYSA 1SYFA 1JORA 3HP3A 3FPPA 4F88A 1MSGA 3T53B 3W2DA 1J9OA 1SNMA 5FO8B 1RODA 4K2LA 4DAVA 1G291 1DJRD 3BVGA 2BOSA 4QUCA 4J1MA 1G2SA 5EPLA 2PYKA 4M1UB 3TSSA 4H13C 4RGTA 5IT9E 4P2CB 3WDNA 4FF2A 1IYUA 2D9UA 1TS4A 1Q3LA 2AUJD 4KJNA 3Q24A 4HCSA 1Z7TA 2F03A 5KIXA 1GJXA 1FNVA 3ZPNA 3D3RA 1H9KA 2I07B 3FRPB 3I4LA 1LTID 2IX3A 4TSSA 1DCZA 3LWEA 2JDIA 1Z6HA 3BH4A 3IL8A 2D3NA 2NN6G 4PMBA 1OXVA 2A6EC 4WORA 5CYUA 4DN4M 2AQ2B 3PUZA 1SNDA 4HEDA 4A3MB 3HOWB 1WP6A 3G7LA 4KKSA 2X6LA 2F0OA 1CA5A 4XORA 1B4OA 2N88A 3N52A 2VB2X 1F2YA 2MUYA 1JWMD 5CGKA 1BR9A 1HPCA 4X3SA 1UD8A 2EE1A 2KVMA 3R8BA 2PMZB 5J39A 1SNPA 1EZ6A 4LJZC 1E2VA 3I73A 3F2UA 3T4AC 1M4VA 3PO2B 2XZLA 3K59A 2PO4A 1PTOB 3GTJB 2EYHA 5DM73 4BWGB 4WRDA 4CKEA 2V31A 3CMMA 5HURA 2WSSA 3FVQA 2JEAI 2L4NA 4P22A 2R61A 5ELCA 3SR1A 3HG9A 2W6JA 5JAVA 4CHTB 1KTKA 4A93B 2NBFA 1PMRA 1PTOH 1JOOA 3H94A 2WP8J 3SXHA 2EOTA 1ILPA 1HQRD 2DY8A 2Q8IB 1WTVA 3S14B 2Y0SB 3Q6SA 4TQUS 1STYA 3J81L 1OB0A 3EFXD 5CDFA 3M85A 3LNNA 1HTLD 4RHSA 4C1NK 3HOYB 5DAUA 3ZYYX 4DXGA 1F77A 1B50A 1YNJC 4XKWA 1S5DD 2F0NA 5CV9A 3QG1A 3OW7A 5C4HA 4KI0A 1I4HA 3GVLA 2Z8LA 3MFGA 4FF3A 2AUKA 3NHHA 4V0BA 3BCFA 2ENBA 1ESFA 3AU7A 4HSVA 1C8CA 1MABA 3MTSA 4CJ0B 1COWA 4PNYA 4UZUA 1OXXK 3LWUA 1GUWA 2BCOA 5ELBA 3I8ZA 1LV9A 2CW0C 4YIJA 4K14A 1TVXA 1STEA 5C5MA 1L0YB 5ELEA 2PZWA 2RA4A 4XXEA 2BE5C 3JU4A 3WOFA 1T5EA 4C3HB 3HOUB 2QEJC 4KV6A 3OMGA 4IFDH 5ISRA 2XN9C 2R7ZB 4DA2A 4HSPA 2EYPA 4I7ZC 1KABA 2ZTNA 3J81E 1D5XC 1WTRA 4NKLA 4G7ZC 4JK1C 2SDFA 5JVG3 3CRKC 3CQZB 3I72A 3MFYA 2F0VA 4TRDA 2F0DA 2MPMA 3I3CA 1W9XA 2SOBA 3VYRA 2EJMA 2K33A 1SSOA 3I70A 4CKBA 1PYWD 4IUQA 1OO9B 3DWPA 1XX8A 1D1IA 4OO1H 3PV0A 4G6IA 2ZXIA 4KJOA 1B9NA 1I4RA 5IK2A 2B39A 2F0MA 2HDLA 5G3LF 1TT2A 5K36G 5KNCA 4XQNA 2LFNA 5FKAC 2F0FA 3L7ZC 4OHJA 3HOZB 4RA8A 1G2TA 1PRTC 3ZIAA 3BYYB 4RH6A 2RSOA 3X3MA 3H3VC 1Q12A 1RKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SMY C;  2K7V A;  4XTC S;  5BN4 A;  2AWO A;  1H9J A;  1Q90 A;  2E75 C;  2EVB A;  4IQZ A;  4JBW A;  2NN6 H;  3VR6 A;  5A35 A;  4KHZ A;  2A68 D;  1FR3 A;  3A7L A;  2A69 D;  4LJZ C;  1E2V A;  4KKU A;  1TU2 B;  1OXT A;  2CW0 C;  3A8J E;  3I73 A;  1GHK A;  3DXJ C;  3W3A A;  1QJO A;  2LMC B;  3N6R A;  4DK0 A;  4KKT A;  2D5D A;  1VF5 C;  3VR3 A;  1IW7 D;  1Y8N B;  1Y8O B;  5K36 H;  1GUS A;  1ZYR C;  3KLR A;  2BE5 C;  3P20 A;  3SE0 A;  2B8F A;  5C0X G;  3A8I E;  1OXU A;  1T5E A;  2JEB I;  2KA7 A;  3IFT A;  3CRL C;  3GQB A;  4PV1 C;  1DXM A;  2JE6 I;  2JXM B;  2A6H D;  3BG3 A;  1TKW B;  1O7L A;  2IT1 A;  4IFD H;  3FMC A;  3SDZ A;  3AB9 A;  3FPP A;  1Q1B A;  4BA1 I;  5C0X H;  3T53 B;  3IKJ A;  5JEA G;  1I6V C;  3VR4 A;  5BN3 A;  4I7Z C;  1GUO A;  1ONL A;  2JEA I;  4L8J A;  1G29 1;  2E76 C;  1H9R A;  2BE5 D;  4H0L C;  2D2C C;  3VR5 A;  2BA0 A;  1IW7 C;  1GHJ A;  2PNR C;  2F1M A;  1PMR A;  2E74 C;  3A7A B;  3M4Y A;  1H9S B;  3QIA A;  4JK1 C;  2EJF C;  4G7Z C;  3H94 A;  3CRK C;  4KMU C;  3I72 A;  3MFY A;  4KN4 C;  1H9M A;  3A8K E;  4H13 C;  2B8G A;  4KN7 C;  3TZU A;  2QF7 A;  2R6G A;  2Q8I B;  4LK1 C;  3VR2 A;  3WDN A;  1IYU A;  5BN5 A;  5JEA H;  3D4R A;  1E2Z A;  3OOC A;  2EJM A;  2K33 A;  2D62 A;  3HGB A;  4RCN A;  2EJG C;  4TQU S;  1GUN A;  1HTP A;  2DNC A;  2ZT9 C;  3VA7 A;  3T51 B;  2O5I C;  1BDO A;  1EWH A;  1GUG A;  1VDZ A;  4IFD G;  3M85 A;  3LNN A;  2A6H C;  2AUJ D;  4XIG S;  2BDO A;  2K32 A;  2YYZ A;  2A6E D;  1LAC A;  3OPO A;  3D31 A;  2O5J C;  4DNR B;  1Z7T A;  2NN6 I;  1IYV A;  3EQL C;  1GJX A;  4OO1 H;  3PV0 A;  2PPB C;  1V43 A;  3NE5 B;  1H9K A;  2BA1 A;  4GZY C;  3I4L A;  3BDO A;  1O78 A;  5KNB A;  1YNJ C;  4H44 C;  4HR7 B;  1B9N A;  1Y69 U;  4BA2 I;  2V4D A;  1E2W A;  3QG1 A;  2A69 C;  3MXU A;  1DCZ A;  1HCZ A;  1A6X A;  2A68 C;  1Z6H A;  3U9S A;  1HQM C;  3OW7 A;  3PUX A;  3QJY A;  1CTM A;  1Y8P B;  5K36 G;  1B9M A;  2NN6 G;  5KNC A;  4KI0 A;  1ZKO A;  1FYC A;  1VF7 A;  1V8Q A;  1VCI A;  2DNE A;  1OXV A;  3ND8 A;  4G7O C;  2PCF B;  2A6E C;  3L7Z C;  1GUT A;  4G7H C;  4TKO B;  3PUZ A;  2AUK A;  2L5T A;  3PUW A;  4OO1 G;  3RLF A;  5KND A;  1CFM A;  3M7N A;  1LAB A;  4DNT B;  3LWU A;  4KKS A;  3PUV A;  2KCC A;  1K8O A;  1Q1E A;  2EDG A;  1OXS C;  3GD7 A;  1K8M A;  1CI3 M;  3ND9 A;  1OXX K;  1Q12 A;  1H9S A;  1DD2 A;  1HPC A;  3T56 B;  1YNN C;  2DN8 A;  3PUY A;  4DK1 A;  4OGQ C; 
#chains in the Genus database with same CATH topology
 2ZL7 A;  4PZ7 A;  3GTO B;  2K28 A;  4FP5 D;  4UZF A;  5A35 A;  5M3M B;  1HR0 Q;  1B2R A;  1PDQ A;  2BSA A;  1FR3 A;  5IP9 H;  3TS2 A;  2VBV A;  2OCE A;  5M5Y H;  2C9O A;  1I18 A;  2ALY B;  3BS1 A;  1N32 L;  2C2W A;  4JOI A;  2NVT B;  1PRT F;  5K36 H;  2VUM G;  4E0F A;  1U4L A;  1JIC A;  2Z4H A;  2GJP A;  1QE6 A;  3MHB A;  1OXU A;  3JAM L;  4DV0 Q;  5JPN C;  1YNJ D;  2Q6K A;  3IFT A;  3ERS X;  1DXM A;  2B2U C;  2X69 A;  3KBG A;  4QJF A;  1IBM Q;  2HHH L;  4XYO A;  5C5L A;  3GTQ B;  4A3G G;  3K5N A;  4POF A;  3IKJ A;  2VJI A;  4C3J G;  3FEW X;  3RY8 A;  1LTT D;  2XIW A;  4J15 A;  3D4D A;  1GUO A;  5JVH 3;  4LBV A;  3ZBT A;  5JEA J;  3TRZ A;  4BBR B;  1FRQ A;  4BPR A;  2F0T A;  4DAM A;  3HOX G;  4IUR A;  2V7Q A;  5LMN W;  1DDG A;  1BJK A;  1NRK A;  1AE2 A;  1J6Q A;  2EJF C;  1A15 A;  4Z4W A;  2JA7 B;  2NVX H;  4XT1 B;  1AIP A;  3O13 A;  5IP9 G;  5T1I A;  3AFP A;  1EY7 A;  4H9G A;  3W5H A;  1BCP C;  1Q8I A;  2F3V A;  4UP9 A;  3STB C;  2HD3 A;  2L11 A;  3NTH A;  1EP1 B;  4C3J H;  3K5M A;  2H5X A;  2K04 A;  4FF1 A;  3I4N G;  3K7A B;  4IOC A;  4I65 A;  2B2Y C;  2O5I C;  1F9Q A;  4K5W A;  4IOA A;  3S2H B;  2ZBU A;  3KEW A;  5FJ8 G;  4XYQ A;  4RD3 A;  1RCV D;  2R7D A;  4P6V F;  3I4N B;  4DAY A;  3NQT A;  2O5J C;  1EFR A;  5D3D A;  1BUV T;  4P75 A;  4ZLT F;  1B70 B;  2E8G A;  2PPB C;  5ELN A;  4A3J B;  4KK7 A;  1WTH D;  1XE1 A;  4HIM A;  3C2Q A;  2BPO A;  1E3X A;  3URY A;  1BBU A;  2Z6K C;  3ZC3 A;  2B63 B;  3F2D A;  1VQC A;  3KF8 A;  4K0K L;  2ZXH A;  1JJ2 B;  2DNE A;  3S15 H;  3HOX B;  2PI2 E;  3CC4 A;  2HLD A;  1GO3 E;  1YIT B;  3CC2 A;  4OO1 G;  2K5D A;  3RLF A;  2SEB D;  1WYD A;  3BC9 A;  2VQF Q;  3VO1 A;  3JAM E;  3DHQ A;  4ULL A;  1I50 H;  1AE3 A;  5C4Z A;  4P72 A;  3RD4 A;  3TZD A;  2X8K A;  4GOP C;  4JI1 L;  4IPH A;  3HFZ B;  3M4P A;  1ILQ A;  1BKB A;  3TP8 A;  4AQY Q;  3PF5 A;  1E79 A;  2GA4 B;  3KL9 A;  3NQI A;  5KGU A;  2Q6L A;  3MCA A;  2V1C C;  3CP0 A;  1IKL A;  5TSS A;  3AVU A;  4OIK A;  1PTO C;  1X3F A;  5FL7 A;  3ZJY C;  4DV3 L;  2GJK A;  4XLC A;  3RN5 A;  1KK1 A;  3ES9 A;  4A3G B;  2LMC B;  5IGC A;  1MD2 D;  2D5D A;  5C3E B;  3G71 A;  3VR3 A;  2XZO A;  4DR3 L;  2WAQ B;  3I90 A;  1W6K A;  2QCP X;  3J80 i;  4X64 Q;  3A35 A;  1EFI D;  4O2D A;  3ERO A;  1TII D;  4BBS G;  4OX9 Q;  2B2W A;  4PC7 A;  2A19 A;  1VQN B;  4TMV A;  1CNF A;  2BM0 A;  1SR3 A;  5C0X I;  1ZXT A;  2NVX B;  4OOV A;  2OEO A;  3VR4 A;  3NBH A;  1SYC A;  1BO0 A;  4IFD I;  1B2T A;  3AFQ A;  5M3M H;  2KQ3 A;  3GSI A;  3I4M G;  4GKK Q;  3A1P A;  5KNL A;  4NXN Q;  4MIU A;  1UNS A;  3FHW A;  1TWG B;  4KD4 A;  4LWC A;  3RZD B;  3BY2 A;  2K52 A;  3GTG H;  1AMO A;  3CCE B;  5C44 B;  2GVB A;  2IWH A;  1WTQ A;  3CD6 A;  1JWS D;  1Y1V G;  1S5B D;  1V1P A;  2VBS A;  3OJX A;  1A3V A;  1L1O B;  4PG3 A;  1JC7 A;  1CKN A;  4L5T A;  2JA7 G;  4A3K G;  1CZW A;  4UAJ A;  4DNI A;  1TLL A;  3SK8 A;  3VA7 A;  5TRD A;  1IBM L;  4PZ6 A;  4IFD G;  1G7R A;  3M9B A;  4WJ4 A;  1QIL A;  2F43 A;  1T6Z A;  3A74 A;  1LAC A;  4PAA A;  5JPM C;  1BBW A;  1SXT A;  1KAW A;  3BU2 A;  3HEJ A;  2OK7 A;  1XWE A;  4PZ8 A;  4S3S A;  1XTC D;  2Q6I A;  2WAC A;  2CFM A;  3OWE B;  2V7W A;  4HID A;  1R4P B;  2V4D A;  4JBK A;  1CHP D;  5LMN Q;  4IUV A;  1D8T A;  4OEL B;  5M5X B;  1X3E A;  3OJW A;  4XON A;  3PUX A;  3QJY A;  5CV4 A;  5D65 A;  2B2U A;  4IPD A;  3CW2 A;  4DV5 Q;  4OOX A;  2YTY A;  1PJ7 A;  3K0Y A;  1M1K C;  4EQP A;  2OTJ B;  4YWK A;  4OXP A;  1TS2 A;  4YAL A;  3T1Y L;  3K57 A;  1EL0 A;  2N8N A;  1X9N A;  3OMC A;  1K8M A;  1TWC H;  4A3F H;  2KOL A;  4ALP A;  2JA8 G;  1DD2 A;  2C4U A;  4K1X A;  1VMC A;  1YNN C;  5CV6 A;  4YEJ A;  1NJI D;  4B3S Q;  3KBX A;  1EWI A;  1JJG A;  4NW2 A;  4EQN A;  3M4O B;  1WTP A;  3OEH A;  2P5Z X;  4EQ5 A;  4KKU A;  1TU2 B;  3A8J E;  2L15 A;  4HMJ A;  3VA5 A;  1EUJ A;  3N6R A;  3PSI A;  3E1Y E;  2QGG A;  4YWL A;  5BR8 L;  2CCZ A;  1FJG Q;  2B2Y A;  4QB4 A;  2K5W A;  4EH1 A;  2TSS A;  2BM1 A;  3G05 A;  4EX5 A;  2JA8 B;  5EKI A;  3CCS A;  1GXD C;  2N49 A;  4PV1 C;  5DSZ A;  4ODG A;  3SHL A;  1HNW L;  2JE6 I;  3P26 A;  1EY0 A;  4HMI A;  3BG3 A;  4A93 G;  2V7U A;  4PAB A;  5EGT A;  4DR6 L;  2N78 A;  2F52 A;  4LBZ A;  3V96 A;  4Z4V A;  4Z1M A;  3AQQ A;  5JEA G;  2X53 S;  2WJY A;  5I6W A;  1FNW A;  4X07 A;  2EY1 A;  3S2D H;  3KLS X;  1EOV A;  1LO5 D;  2XWJ B;  4X62 L;  2BE5 D;  1YJW B;  3SKB A;  2J7Z A;  2B2V C;  1VMP A;  2K5N A;  1I4P A;  2KHS A;  3PMF A;  1I7P A;  2OWO A;  1EEF D;  4JI3 L;  1VLO A;  4AIM A;  2PQE A;  2KJX A;  2CVR A;  3KLS A;  3J7A F;  2XTI A;  1N33 L;  3TRE A;  1L0X B;  1TQO A;  4JPB W;  3D8G A;  5F4J A;  5JEA H;  2XVS A;  4JI4 Q;  4LNQ A;  1D7Q A;  4I7A A;  4JI2 L;  1Y1V B;  1UWV A;  4GLX A;  3UDG A;  5COY A;  4XM3 A;  2HIV A;  2R93 B;  4A93 H;  3S1N H;  1HR0 L;  3P27 A;  1B8A A;  1EZ8 A;  2Q2I A;  1I4G A;  1KHI A;  2XRQ D;  3FP9 A;  4DFA A;  3QFR A;  3HOV G;  2NN6 I;  4A3F B;  1FGB D;  3MEH A;  4RJL A;  5DN6 A;  1U5K A;  1E1T A;  3FKI G;  4N8X 1;  5GRO A;  3ZUG A;  2GK7 A;  1EIG A;  1G7C A;  5C3X A;  2LXJ A;  4YEL A;  3MXU A;  4DF7 A;  1AP0 A;  1PTO D;  5GV7 A;  3OZV A;  1TTT A;  1ZKO A;  1RDP D;  3TME A;  1K28 D;  4DR6 Q;  3KDF A;  3R2T A;  4DKA C;  2F0W A;  4RD0 A;  4G7H C;  1IBK Q;  1ENA A;  3U50 C;  2UXC Q;  2K01 A;  2LKV A;  3RUZ A;  4OIJ A;  5KND A;  1SBB B;  4JI0 L;  1ZM4 A;  1YJN B;  4NB3 A;  3IAY A;  3D26 A;  1W3S A;  2NB0 A;  3OFN A;  4YCW A;  1QZG A;  2ASB A;  3M7G A;  4KTA A;  1G51 A;  2LY7 A;  4DR1 L;  1IJF A;  3CCV A;  2IW3 A;  3T56 B;  2KCM A;  2F0J A;  2GK6 A;  2NVY B;  4DV1 L;  2AWO A;  1H9J A;  2D9R A;  2NN6 H;  4M1K A;  2NZ1 D;  4MN3 A;  1M90 D;  4EQO A;  3K7A H;  5IOC A;  2L55 A;  4XR6 A;  3BCD A;  1OXT A;  2B3G A;  4ZCK A;  3W2G A;  2V7X A;  1D8L A;  1JCK B;  3CME A;  5E4W C;  3J7A V;  3WBK A;  3W1B A;  4C0S A;  4R4C A;  1I3Q H;  5JJL A;  2CHB D;  2MQH A;  3ERQ A;  2ID0 A;  4GOP B;  4MHE A;  3LO8 A;  1YHQ B;  2AHO B;  5M5X H;  3F2C A;  3ZBU A;  5H59 A;  5L46 A;  1ESR A;  2ZL6 A;  1B3Q A;  4IZ8 A;  1E64 A;  5DEH A;  4JYA Q;  4WZE A;  1VQO A;  1LTR D;  3T1H L;  1KJZ A;  3KDF B;  4BA1 I;  5C0X H;  5I9P A;  1IBL Q;  1PA6 A;  3ASP A;  1I6V C;  3S17 H;  4IAL A;  1B1Z A;  4FXD A;  1JOK A;  3NUC A;  2MGS A;  4QFM A;  1WFQ A;  2A1A A;  2E2J H;  1H9R A;  2E1B A;  4P73 A;  3ITP A;  1W0J A;  4Z9C B;  4FXG C;  3CCQ A;  2CK3 A;  1SEB D;  1Q7Y D;  2OXP A;  5EPJ A;  1J8I A;  4NP5 A;  3U2Q A;  4KMU C;  3VDY A;  1H9M A;  4WZT A;  1SLJ A;  2EQS A;  4LFA Q;  3H9N A;  1E2Z A;  1IJE A;  3CP2 A;  4P9S A;  4CQJ A;  3Q0A A;  4XLF A;  4KHP Q;  1BDO A;  2QIL A;  4QUF A;  3K80 C;  2AQ1 B;  3AVY A;  1VQ6 A;  2BDO A;  4RCO A;  3A5Z B;  3HRZ C;  3E20 A;  1EYG A;  3S9W A;  3G48 A;  3TEH B;  4PGO A;  1BQQ T;  2K05 A;  2FFK B;  4ZRZ A;  3ONY A;  3F2B A;  1PFS A;  2FVG A;  1HFN A;  1R5B A;  3CCS B;  1JQY D;  1V43 A;  2E2H B;  2BF4 A;  4A3E B;  4G4K A;  4DAY B;  4FK8 A;  4K8I A;  2K03 A;  3CC2 B;  2LXK A;  1YIT A;  3CC4 B;  4R4I A;  3S24 A;  3Q23 A;  4JI3 Q;  3S2H H;  2UXD Q;  1STH A;  4LF9 Q;  1WVL A;  5I6Y A;  5KYI A;  3JQP A;  3VYT A;  1I5F A;  3ULP A;  4C3J B;  4OPO A;  1RD9 D;  3VYU A;  1B3A A;  2IL8 A;  4XQJ A;  4JI2 Q;  3AST A;  4XD7 A;  1LAB A;  2L1B A;  1E43 A;  1K3B C;  2KCC A;  1JWU D;  4HAE A;  2RDH A;  3OEE A;  3NEM A;  2GN5 A;  4ZUJ A;  5IP7 H;  3HKZ E;  4X8I A;  4OL7 A;  4L5S A;  3LVB A;  5A88 A;  2JN4 A;  5IYC G;  1YJ9 A;  3S1Q B;  2R7F A;  5HZB A;  4AYB B;  5I2Y A;  3M3Y B;  1Q90 A;  2PZU A;  4NMZ A;  1SKY B;  2LZJ A;  4FVM A;  1R9T H;  1NE3 A;  1ICF B;  4ABN A;  1I50 B;  5CR3 A;  4XMY A;  3CCL B;  2KEC A;  4X7E A;  3GTL B;  2FX3 A;  2H1E A;  1YLO A;  5M3M G;  3K0X A;  3G6J B;  4XOT A;  3CRZ A;  2EZV A;  1STB A;  2R9V A;  2UU9 L;  1E7Z A;  3J81 c;  3HAG A;  4IUP A;  3A8I E;  1TWF B;  2LSS A;  4LFB Q;  4P3Y A;  1FNM A;  3BJU A;  2C4T A;  4X64 L;  2AQ3 B;  2KA7 A;  2BH2 A;  4JI0 Q;  1PYB A;  4TMW A;  3C1E A;  1HJP A;  1GKH A;  4ME5 A;  1WU8 A;  4A3G H;  3GIR A;  4LFC Q;  4JI5 L;  3MC0 B;  2JA5 G;  2B29 A;  1R9T B;  4A3I B;  2VBU A;  5KEE A;  3GTQ H;  2JA6 H;  3J81 k;  2ZIT A;  5HKK A;  4FYD A;  1F2Z A;  2Q8R E;  2VUM H;  3F1Z A;  3MEF A;  3A7A B;  3QIA A;  4HN7 A;  1PH9 A;  1F20 A;  3K81 C;  1N9W A;  2FXQ A;  3TP7 A;  1HA6 A;  1I8D A;  3WYA A;  2OYN A;  2WJV A;  3A8K E;  1K73 D;  2Q2T A;  4K6L A;  2ZJR A;  1HZB A;  1EP2 B;  4BBS B;  5LL6 S;  1FRN A;  3K58 A;  2IX1 A;  1EIH A;  1ZM2 A;  4RCN A;  3JQQ A;  2F4N A;  5EJW A;  2WPD A;  2ZT9 C;  5E4X A;  5DLQ E;  1HVX A;  1HZC A;  1KQS A;  4K0K Q;  4YCV A;  2A6H C;  2CKZ B;  2GVA A;  4HJ5 A;  4CDD C;  3K6O A;  3OYY A;  2N55 A;  4X65 Q;  1VQL B;  3S1Q H;  1IBK L;  2TMP A;  3X3N A;  2CC2 A;  1KL9 A;  3R2I A;  5M5W B;  1CZG A;  5T1G A;  2CBX A;  1E62 A;  3MAQ A;  4U68 A;  3AGQ A;  1RIP A;  2Z6K A;  4GZY C;  3BDO A;  3OP1 A;  5GAH C;  3J81 j;  4ACB A;  3EA6 A;  1O7Y A;  4LUZ A;  4DR1 Q;  2A69 C;  4YWM A;  5A8A A;  1MBY A;  1KDA A;  1Q82 D;  1VQ9 A;  1VQB A;  3ND8 A;  4IJH A;  4B9X A;  1SMY D;  2F0U A;  5IWA Q;  3RN2 A;  4B3T Q;  4LF7 L;  5IYP A;  3PUW A;  3JC6 6;  2Q2H A;  4QIW B;  1WPC A;  4QQB X;  1PH3 A;  1B23 P;  3K8A A;  1LT5 D;  1LLR D;  2NWG A;  1WJJ A;  2E1R A;  3PUV A;  1OTC A;  3K5O A;  3RNU A;  1YX2 A;  4RPB A;  3G6E B;  3CC7 B;  3G4S B;  2CWP A;  1CI3 M;  4ZUI A;  4QVA A;  4EGV A;  2Z6B A;  4OX9 L;  2QKI C;  2EY2 A;  4BBR H;  1WSR A;  3VR6 A;  2EVB A;  4IQZ A;  1TS3 A;  2A68 D;  1V9P A;  2A69 D;  1S5F D;  3DEP A;  2JA6 G;  1G7S A;  3R6K A;  4RHR A;  4OWT B;  4GQN A;  4N3N A;  1N05 A;  2NTT A;  4A3B G;  3Q8D A;  1QNK A;  2QDL A;  3Q38 A;  4RWS C;  5IT9 L;  4WZK A;  4KY7 A;  1I3Q B;  1UMK A;  4XLA A;  2IPK D;  1K0R A;  1KRT A;  2A6H D;  2RC6 A;  2OQK A;  1W0K A;  1E22 A;  2EIF A;  2MNA A;  2UUB Q;  2M00 A;  1ET6 A;  1ASY A;  3AGP A;  2G9D A;  3QO2 A;  1TUI A;  3W2E A;  2QTL A;  5E1F A;  5BN3 A;  3NXW A;  1K73 C;  2F0K A;  4G1V A;  1J5E L;  2JA6 B;  2F1M A;  4R9W A;  1P16 A;  3JAM i;  1EYA A;  3S17 B;  1KNA A;  4C3I H;  4DUZ L;  1CT1 D;  1OGJ A;  1HZ9 A;  1DM0 B;  1S72 A;  2IHF A;  2R92 H;  3UDF A;  1SFO H;  4Y9R A;  1U9R A;  3EN2 A;  3PIP A;  4ROX A;  1K9M D;  1UD3 A;  2FMM A;  4ACA A;  2DJF C;  1DOL A;  5J35 A;  3IRB A;  4JI4 L;  4B3R Q;  3W5O A;  1GUN A;  2A8V A;  1TWH B;  3OW2 A;  1CSQ A;  1ICW A;  4A3D H;  5IYB G;  4DR2 L;  1Y14 B;  4DPG A;  1HUM A;  4II3 A;  2DY1 A;  4XNF A;  1H8E A;  1CQF A;  3DWQ A;  3LGJ A;  2Q8T A;  2ZXR A;  1XNR L;  1XPU A;  2FJ2 A;  2I5M X;  4PMC A;  1SRO A;  2F4I A;  4DV5 L;  4X66 L;  1L1O A;  4RD2 A;  4L63 B;  3C1F A;  4R4O A;  3D0F A;  1ZM9 A;  2QDB A;  2EY5 A;  1O78 A;  2K5V A;  5FLX L;  3UE1 A;  3AVW A;  4PC6 A;  2RBM A;  4BXX H;  4DV4 Q;  3CF5 A;  1EIF A;  4H02 A;  3U9S A;  5FLX c;  1J9Z A;  1SYG A;  2IJ0 A;  3NSW A;  4TMX A;  1CNE A;  3PUN A;  1H85 A;  3PA2 A;  3P7J A;  5IY0 A;  4YXW A;  2HQL A;  1PH1 A;  3CC7 A;  3PIO 3;  3DDY A;  1NAP A;  5C3W A;  1IYJ B;  1QVC A;  3U6K A;  2UXC L;  2QN6 A;  2RHQ B;  4GS3 A;  3HOZ H;  4P1V A;  1Q81 D;  4L6T B;  4FN5 A;  3H3V H;  3AYH B;  1RTO A;  3GD7 A;  1GR1 A;  2AMC B;  1S5E D;  1TWA B;  3BZD B;  4DV2 L;  2EXD A;  3L9A X;  4LC0 A;  1TXY A;  1TVC A;  1N0V C;  3MMP A;  4DK1 A;  3H0G H;  1BCP B;  3FKI B;  4P71 A;  4CDF C;  4EVO A;  5BN4 A;  3HOZ G;  3BDC A;  4KHZ A;  2ZTE A;  2PZT A;  4ID6 A;  1KK2 A;  3OTO Q;  1WTO A;  1KLU D;  3D6C A;  4TVA B;  1KTV A;  1BBX C;  3NEL A;  1GM5 A;  1QVF A;  2DET A;  3TN2 A;  1WTW A;  3SVM A;  2RC5 A;  2VZL A;  1VQG A;  3NBI A;  3VYS A;  1BNZ A;  5C0X G;  1PLF A;  2F0H A;  4ZCL A;  2DGY A;  2B8F A;  2JP1 A;  3GP7 A;  2OBS A;  5C44 H;  2UXB L;  3VNU A;  5A2Q L;  3I55 B;  3CRL C;  2VNU D;  2PQA B;  2VNJ A;  2ZTC A;  3MHP A;  4AYB E;  3W5U A;  2IT1 A;  3OIQ A;  2GJR A;  3SDZ A;  1I4X A;  1CKN B;  1LTS D;  1ZYR D;  4XQF A;  1SE2 A;  2JYO A;  1WD1 A;  4QVJ A;  1HXY D;  3CXC B;  1QVG B;  5TR9 A;  1C48 A;  1HH2 P;  2PNH A;  3OE7 A;  1EY6 A;  3CD6 B;  3GO5 A;  3TP5 A;  2B2V A;  4QHY A;  3CCE A;  4NXM L;  1YI2 A;  3QFC A;  1E0B A;  2L12 A;  1PRT B;  4G5G A;  3UE0 A;  1GHJ A;  2PNR C;  3HKS A;  4DV4 L;  2E74 C;  4AQY L;  1HHV A;  1PH6 A;  1TWH H;  4A3K B;  1L0W A;  2R92 G;  1F9P A;  4X7F A;  1QFZ A;  1KC8 C;  3RZO B;  4TMT A;  2WKC A;  1YNN D;  4YY3 L;  4KN4 C;  4N9T A;  4LFA L;  5I9O A;  4C1N I;  1D1N A;  1QGA A;  3I55 A;  3C3L A;  3OW2 B;  3B6Y A;  3OZW A;  1KRS A;  1X6O A;  1FNB A;  2CQA A;  3TBI B;  3HOU H;  1WTX A;  2XNJ A;  4B47 A;  1HTP A;  2CQO A;  2DNC A;  5C4J B;  1HNZ L;  3GTG B;  1QVF B;  2K50 A;  3NPP A;  3KF6 A;  4IPC A;  3CCJ B;  3R93 A;  3KF8 B;  2OF1 A;  2BDN A;  3OPO A;  4NBS A;  4GNX A;  4DR5 L;  5IWA L;  3SK4 A;  1LUZ A;  3W5V A;  1VQE A;  1N8R C;  3Q22 A;  3QR8 A;  3CCM A;  4QCL A;  2EY6 A;  1HUN A;  4WWV A;  3CAM A;  5F2D A;  2JN9 A;  1Y69 U;  3FKI H;  1FGU A;  1D2B A;  2UUC L;  1XNQ Q;  2LS0 1;  4A3M H;  1MJC A;  2NZO A;  1PZI D;  4Z4Y A;  2A68 C;  4P6Y A;  3S16 B;  1HQM C;  5C6A A;  2R93 H;  3FJO A;  1Y8P B;  5I2X A;  1G91 A;  3I4M B;  5C4J H;  4CBV A;  5ELF A;  2KHI A;  4HJ7 A;  2PCF B;  4HIK A;  4XQQ A;  1C4Q A;  1SAP A;  4TKO B;  5FLM H;  2QEX A;  3PVD A;  2EYF A;  4DAP A;  4B44 A;  2C5C A;  4RDJ A;  1OB5 A;  1K8G A;  3TP6 A;  4Y7N B;  4DNT B;  1UD4 A;  3SLD A;  1FX0 A;  1UE6 A;  5FK9 C;  5IOD A;  1Q1E A;  4NXM Q;  3SLN A;  1LTG D;  4U9U A;  2Z4I A;  1DOM A;  3E9I A;  4LAA A;  4RFB A;  3QOL A;  3QB3 A;  1SMY C;  4QV2 A;  1E1Q A;  4JBW A;  4C2M B;  1Q82 C;  5GV8 A;  2YWE A;  1ENF A;  3A56 A;  1XPR A;  1WCM H;  3RLN A;  3A7L A;  1GHK A;  4QIW E;  3H91 A;  1G8Z D;  2X6X A;  4NCN A;  4DK0 A;  3U58 A;  2PMD A;  2K6A A;  1GUS A;  5LL6 X;  4DR4 Q;  3P20 A;  2UU9 Q;  4AYB G;  2X6W A;  1QUF A;  5BSX A;  1EQR A;  1ML0 D;  1T9H A;  1QFJ A;  2JSO A;  3K7U C;  1RJT A;  2XSC A;  4O0A A;  3GTM B;  1VQ5 B;  4GN4 B;  2VY3 A;  1O7L A;  5C4X H;  4LFC L;  1VQ9 B;  3AB9 A;  3RR5 A;  1ELO A;  3W2F A;  2DEU A;  5EQ0 A;  4M8A A;  3UDI A;  1PYS B;  3RZD H;  4HE5 A;  1LM0 A;  1NDH A;  4NNJ A;  5IYR A;  5A89 A;  3KK7 A;  4HCE A;  3HOV B;  4WFN 3;  1DON A;  4GOP A;  4V19 0;  3CCJ A;  2D2C C;  1E63 A;  3CPX A;  2Y0S E;  1XNR Q;  4B48 A;  2HIX A;  2Z6B D;  3DEO A;  1JOQ A;  1EU3 A;  1SDF A;  3CB4 A;  4XN3 A;  1D5M C;  1LT3 D;  4X3U A;  1JB9 A;  2QF7 A;  2RQX A;  4LK1 C;  3BQJ A;  1X3Q A;  1YIJ A;  2ZXP A;  2WV6 D;  5GQO A;  3P1H A;  1IBL L;  2R92 B;  1VQ8 B;  4X05 A;  3WY9 A;  3ZZT A;  3OOC A;  2RSN A;  1F60 A;  3FKS A;  3Q6R A;  4N9P A;  2RF4 A;  5GAD C;  1FVI A;  1NJI C;  3IFD A;  3B78 A;  4GKK L;  5KW9 A;  4YCU A;  3NEN A;  1EWH A;  4F7X A;  1XMQ L;  3PO3 G;  1OHH A;  1DDI A;  2KED A;  1JB7 A;  1AZQ A;  1A3U A;  1KD1 C;  2E2I H;  1BX0 A;  4A3C H;  1NMG A;  3J80 E;  1AZP A;  4R8I A;  5FIU A;  3D31 A;  5COR A;  3E3X A;  1V0F A;  2ZM6 Q;  3EQL C;  4GKJ Q;  2QE7 A;  1V5V A;  4GLV B;  2BA1 A;  1JA0 A;  5JBQ A;  4JOI C;  4HR7 B;  2JQO A;  2PIA A;  1VQI A;  2R3Z A;  2PQA A;  1A8P A;  1HCZ A;  2HCI A;  4POG A;  3FPK A;  5E6T A;  4DV6 Q;  2VJJ A;  1A0I A;  5IYW A;  4BY7 G;  4ZAI A;  1IZ6 A;  4A3D B;  4DR4 L;  2XZP A;  5KSW B;  3J7Z C;  3P75 A;  3E0J A;  2ZZG A;  3QSY A;  3HOW H;  5DNF A;  2NVQ B;  5IGE A;  1JJ2 A;  2B63 H;  4N3G A;  5TV2 A;  1SFO B;  5M5Y B;  3M7N A;  4RKL A;  3HKZ G;  4QL5 A;  1Y1W H;  3KUP A;  4LF8 Q;  2JA7 H;  3S15 B;  2VNK A;  1OXS C;  3ND9 A;  1EYC A;  1STG A;  5M5W H;  5IP7 G;  3S1R H;  3TQY A;  2W6I A;  1HZE A;  4OGQ C;  1E1O A;  1N34 Q;  1Y1W G;  1WD0 A;  3MXG A;  2GRE A;  2E75 C;  5EKL A;  4C3H G;  1VQN A;  2YU9 B;  1N0U A;  4WZL A;  3WNC A;  4NPS A;  1II3 A;  1UEA B;  4WJ3 M;  1N08 A;  1SNO A;  3CCU B;  3GV3 A;  1W34 A;  2A5H A;  1VQF A;  4ZKB B;  4LF4 Q;  1RHP A;  3DM1 A;  3OWF A;  5CC4 A;  4JC0 A;  1CM9 A;  2QW7 A;  1ZYR C;  3KLR A;  5CV5 A;  4X7C A;  1SYE A;  1YZ6 A;  1PFB A;  2JJ2 A;  4MYU A;  1PH5 A;  4ME3 A;  1PXU A;  1HNX L;  5FNZ A;  4Z4T A;  4RKB A;  4UDU C;  4JI8 L;  2OT2 A;  4BBS H;  1NBM A;  4L5Q A;  3K5L A;  2C78 A;  4R4Q A;  2NPF A;  4A3L H;  1Q1B A;  2VBT A;  2DY7 A;  3GTL H;  4KHV A;  4Y9U A;  4M2L A;  1G6P A;  5IE8 A;  4C56 C;  5IYD H;  4FXK C;  4AVZ A;  2QDX A;  4K6D A;  4LBY A;  4B3G A;  1EYD A;  2FMC A;  4OO1 I;  1VQP B;  4RM0 A;  1SNC A;  5IGG A;  4A3I H;  4PMW A;  3S1M H;  1TWF H;  1N06 A;  4B08 A;  1Y1W B;  1PZJ D;  1OGI A;  1U4P A;  1M90 C;  5EAY A;  1QFY A;  3WQZ A;  4B43 A;  2CW5 A;  4B9W A;  5IYD G;  1WOP A;  3D4R A;  1SKQ A;  2WB1 G;  4MTK A;  1YHB A;  2EJG C;  5M3F H;  3MVV A;  2IHE A;  1I6H B;  3BDL A;  2YU9 H;  1A2U A;  2DYI A;  5JOB A;  2VB3 X;  1CHQ D;  3DWA A;  4K5X A;  4LW1 A;  4G7X A;  4B3S L;  3L0O A;  2B63 G;  1GO2 A;  1D6E C;  1H42 A;  5EBC A;  3WOE A;  1EQQ A;  3NE5 B;  4B3F X;  5THX A;  1QWY A;  3GTO H;  4N8F A;  4BA2 I;  1IL2 A;  2B2T A;  4APV A;  2KCT A;  2F0I A;  4BY7 H;  1A6X A;  4JMQ A;  3V7A A;  4ZV4 A;  1B9M A;  4A3J G;  1RL2 A;  2OTL B;  1MHW C;  2HHH Q;  2WII B;  1E1R A;  2WB1 B;  4RD1 A;  4DUY Q;  1EFC A;  2WAQ G;  1D1K A;  3I91 A;  3OHX C;  5IIF A;  3BYT B;  4IFD J;  1CFM A;  5C0X J;  1K9M C;  3AEV A;  4Z4U A;  1V1Q A;  4YHH Q;  4C2M H;  5DM6 3;  5E3F A;  2RDG A;  2DN8 A;  4IN3 A;  3WND A;  3A8K A;  2JK8 A;  2AWN A;  2SNS A;  1YEZ A;  2E2H H;  3A3G A;  2WYR A;  1BMF A;  1QOH A;  1QNU A;  4J6H A;  3OTO L;  3DXJ C;  1OB2 A;  4Y7N H;  2MO1 A;  5FO7 B;  2JA5 B;  1B7Y B;  1IW7 D;  1Y8N B;  1DOK A;  4H7B A;  5D14 A;  3KJO A;  2ATW A;  1RQP A;  3SE0 A;  3TS0 A;  4ZQ3 A;  3MWY W;  1J5E Q;  1WOS A;  5M3F B;  4A3C G;  3W1G A;  5IGB A;  2AKW B;  1CKO A;  4O42 A;  4DUZ Q;  4FWT A;  4AF6 A;  3C2P A;  3HZX A;  1TKW B;  1EOT A;  3PO2 G;  3G6E A;  2F4V Q;  1KDC A;  3HOV H;  3A55 A;  5C4X G;  4DV7 L;  1XMO L;  4UP8 A;  3D6W A;  2PW5 A;  4K2K A;  3CP8 A;  1XQB A;  4J0Q A;  4OPS A;  1LTB D;  2F1L A;  1ONL A;  2GQF A;  1W35 A;  1XXG A;  2RDF A;  4DU9 A;  2YV5 A;  1QGY A;  4FF4 A;  2E2I B;  1DAR A;  5C4X B;  4XOP A;  1XFO A;  1QVG A;  1C7Y A;  2XND A;  3NWS A;  3RLO A;  1EIY B;  1G6Z A;  2KEE A;  1JA1 A;  1W2B B;  1E3P A;  5LMU Q;  2MO0 A;  3J80 L;  3FPU B;  1EY8 A;  1KDB A;  2I1L A;  1QUQ A;  2F0G A;  4U67 3;  1JMC A;  1HFG A;  3VR2 A;  4K5V A;  2B8G A;  4KN7 C;  4JI7 L;  1I4Q A;  4PC1 A;  5A2Q E;  3OZU A;  5FO0 A;  3GVJ A;  4FXU A;  1MSH A;  1M8A A;  1H95 A;  2WIN B;  3ER0 A;  3H09 A;  1PFM A;  1VQ5 A;  1C0A A;  4YAO A;  5J3B A;  1QX4 A;  5BR8 Q;  1FJG L;  4GLA C;  2Q2U A;  1S3O A;  4A3B B;  4XIG S;  4ZK9 B;  4BY1 H;  4M53 A;  3AVV A;  2V7T A;  3LQE A;  2K32 A;  2YYZ A;  1SYD A;  1NB9 A;  4X3K A;  3GTP H;  4A3E H;  3S2D B;  1D5Z C;  1IYV A;  4DNR B;  1S4Z A;  2ICI A;  1HA3 A;  1FL0 A;  3CTA A;  3MXP A;  4UPA A;  1UD2 A;  4JVZ A;  1W2B A;  1KLG D;  5KNB A;  5HY6 A;  3CMA A;  2UUC Q;  3I56 B;  1E3Z A;  4LF8 L;  4OP7 A;  4JCV E;  5C44 G;  2I5H A;  4II2 A;  2O2L D;  5ELD A;  1UAP A;  1EY4 A;  3TDQ A;  2YWG A;  4DV2 Q;  1IKM A;  3S1R B;  2K5H A;  3E5S A;  1S72 B;  2WAQ E;  4BS9 A;  4X62 Q;  1D2E A;  1SE3 A;  1VCI A;  2RKS A;  2A74 C;  4B3T L;  1Q8K A;  3EIV A;  1KK0 A;  2I46 A;  4LF7 Q;  1N33 Q;  2RVL A;  3CPW B;  2K1B A;  2L5T A;  1ENC A;  1U4M A;  2NVQ H;  3OSO A;  2HCJ B;  2KVO A;  1NR4 A;  2JA9 A;  4ZKC B;  4L5R C;  1K8O A;  4X06 A;  5GAE C;  1WCM B;  5EPK A;  4ZCI A;  5IGF A;  1KNE A;  3PIO A;  1H9S A;  1IHZ A;  1CQV A;  1B44 D;  1LT6 D;  2Z1C A;  1PZK D;  2Z0S A;  3J7Y W;  2MFI A;  3HS0 C;  1R5N A;  2CH4 W;  3S1N B;  4BY1 B;  1JE4 A;  4OWW B;  4NDX A;  1SRU A;  2R93 G;  4HIZ A;  4F7D A;  1CSP A;  2F0P A;  5CV7 A;  4KY6 A;  4F8M A;  5HXB A;  1V1O A;  1QJO A;  2EYO A;  1VF5 C;  2YTV A;  3L3O C;  1X65 A;  5CV8 A;  3SK5 A;  1UD6 A;  3PGZ A;  4LBW A;  4HJ8 A;  1PKV A;  3CCQ B;  4BXX G;  2JEB I;  1FD7 D;  2ZJP A;  1EFU A;  3ULL A;  1U2R A;  3ONU A;  3AVX A;  2E2D C;  2XOK A;  4GKJ L;  1DYQ A;  3CW2 C;  2JJ1 A;  3GTK B;  1A2T A;  1K83 B;  1U4R A;  5J1Z A;  1VQ4 A;  1NUC A;  5L37 A;  2XNA C;  4RGN A;  3I1F A;  2UUB L;  3CES A;  1DZ1 A;  4RPD A;  1K83 H;  2M2L A;  3KFU A;  4A3D G;  1PVO A;  2NUC A;  3GTP B;  3H0G B;  4H0L C;  3EVQ A;  5J22 A;  3CCU A;  2CF4 A;  1SYB A;  2BA0 A;  1IW7 C;  2ZXO A;  3U4Z A;  3L2P A;  1H9S B;  2XRS D;  1EWC A;  2ICE C;  1KK3 A;  2ZZQ A;  1EEI D;  1PTO F;  3S14 H;  3WBJ A;  1Y1V H;  5IYN A;  1RTN A;  2BGI A;  3T1Y Q;  1EQV A;  2H4O A;  3D4W A;  1I94 L;  1HZA A;  5BN5 A;  1KMH A;  2PMZ E;  3C46 A;  1STA A;  1Q81 C;  2D62 A;  1F2L A;  3ISX A;  2PLF A;  1KAA A;  1SMX A;  4C3I B;  1O80 A;  1QB5 D;  2X85 A;  3BZC A;  1JB3 A;  5KRU A;  3E6Z X;  2YTX A;  2WZP P;  2MP1 A;  2A6E D;  2HUG A;  5K5P A;  1H8H A;  1UD5 A;  3H3V I;  3I56 A;  1S5C D;  3PCO B;  1YVC A;  1MRZ A;  4GNX C;  1ZEQ X;  4RG1 A;  4H44 C;  4OON A;  4ZCM A;  1BOS A;  5FO1 A;  1E2W A;  4A76 A;  3CPW A;  1PJ5 A;  2AHO A;  3A3B A;  1LT4 D;  4DV0 L;  1YHQ A;  3PUM A;  1GVH A;  4Y7C A;  3JAM c;  1VQ7 A;  4XLH A;  1HNW Q;  4DV6 L;  1V8Q A;  1VF7 A;  2VXW A;  1GUT A;  1X55 A;  1BPL A;  4IUU A;  2KBN A;  4BY7 B;  4HE6 A;  5C3E H;  2NV4 A;  3BNW A;  1AEX A;  1VJS A;  3U9O A;  3R6J A;  1VQO B;  3SK6 A;  4RDK A;  3T13 A;  3CCR A;  2F0L A;  2OTL A;  2L9H A;  3MZ5 A;  2J0T D;  4XLE A;  2XGJ A;  1VQM A;  1VQD A;  4YAF A;  2UUA Q;  3PUY A;  4KHP L;  1PJ6 A;  1YBY A;  5FOB B;  5JJZ A;  2M9V A;  1CK1 A;  2K7V A;  2J4X A;  2KEN A;  5KYL A;  1M1K D;  4K8J A;  4RAU C;  3MA2 B;  4J8Q A;  1WOR A;  4Q7J B;  1VLY A;  4DV7 Q;  1XMO Q;  3BVM A;  1UE1 A;  1BLI A;  2D3L A;  2EPB A;  4C3I G;  4KKT A;  3PO3 B;  3DM3 A;  4TN1 A;  4X7D A;  1UUP A;  1QUQ B;  1VHO A;  3KJP A;  4A3E G;  2CH4 A;  3T16 A;  1PFN A;  2NTS A;  2EIX A;  1V1P B;  5EBD A;  2ES2 A;  4JI8 Q;  4DXF A;  2VUM B;  3DMU A;  2XNC A;  1Z47 A;  2A73 B;  2JXM B;  2HQE A;  1LYL A;  2WKD A;  1U0L A;  5IYB H;  3V76 A;  2BH8 A;  1EFW A;  1DG1 G;  1T6Y A;  5LHY 1;  4AH6 A;  1PH7 A;  5E7N A;  2B7B A;  4DR7 Q;  5FJ8 H;  4HJA A;  2X3U A;  1SJH D;  1BCP D;  3STB D;  3M4O H;  4Q0F A;  1IXR A;  1ET9 A;  1TWG H;  4HTH A;  4IUN A;  1BXT A;  1VQK A;  5CBE E;  3LX0 A;  1WOC A;  2C5H A;  4A3B H;  4ASU A;  3PIP 3;  1TWC B;  4RGO S;  1EY9 A;  1O7I A;  4A4I A;  2G9H D;  3KOJ A;  2EXZ A;  2Y0S G;  2X6G A;  4KD3 A;  1MI2 A;  2KHJ A;  5JJI A;  4RGM A;  3OAA A;  4CJ1 B;  4YY3 Q;  5NUC A;  3Q3A A;  1TS5 A;  2IX0 A;  4OPV A;  4X3T A;  5IGD A;  2OK8 A;  3A54 A;  4YHH L;  3CHB D;  3CU7 A;  4JV5 L;  4Z4Z A;  1O7Z A;  3HGB A;  3KLW A;  4LFB L;  2NZH A;  1HRJ A;  3HOX H;  1CUK A;  2F3I A;  4R8N A;  2KCN A;  3G71 B;  1GUG A;  1VDZ A;  3PO2 H;  1IB0 A;  4G57 A;  1HA5 A;  1YJW A;  1NNX A;  3CCL A;  1XJV A;  1MJE A;  3FDT A;  4IUT A;  2EYM A;  2JA5 H;  1PRT D;  2O4X A;  1TR5 A;  3NP8 A;  1TY0 A;  2VQE Q;  5D3I B;  4YHB A;  1SE8 A;  4JI5 Q;  3SEJ A;  2VNH A;  2QA4 B;  3MXN A;  3QWN A;  1MGS A;  4DR2 Q;  4HJ9 A;  1EP3 B;  1C9O A;  2VZA A;  1FYC A;  2NYZ D;  1VQK B;  1VQ4 B;  4G7O C;  1T5X D;  1W87 A;  1IHM A;  3NK9 A;  1IL8 A;  2FIN B;  1NSN S;  1XYI A;  4BY1 G;  4OEM B;  3DUZ A;  4KY5 A;  2K5Q A;  4Q5V A;  4IO9 A;  1F9R A;  4DQL A;  1YI2 B;  1GOZ A;  2L0C A;  1EU4 A;  3GV6 A;  5FLX E;  4NXN L;  5IYC H;  1WSV A;  1YHA A;  4DR7 L;  4AC9 A;  1S4M A;  2OBR A;  1FNU A;  2E5L L;  2MHV A;  1X3P A;  5M3F G;  4A75 A;  3EJI A;  5HGT A;  1HNZ Q;  4ZGQ B;  1HNX Q;  2DUD A;  3RMH A;  4XTC S;  1XB2 A;  5TY0 A;  4A3J H;  4G7W A;  4UP7 A;  2MJ8 A;  2QA4 A;  2CRV A;  3ONA B;  2C77 A;  1V0E A;  1P8L A;  2HDM A;  5M9O A;  4JI6 L;  4B4D A;  1RF2 D;  4A3I G;  2PW7 A;  4FO2 A;  3QFT A;  4E6I A;  4XKV A;  1SNQ A;  1KZL A;  3E9H A;  3CXC A;  5HGQ A;  1R5O A;  3CMA B;  1I6H H;  4JV5 Q;  1VQM B;  2XGT A;  2VNI A;  3GQB A;  3CCM B;  2Z9H A;  1GAW A;  3B8H A;  2CWA A;  2F0E A;  1VQP A;  1Y0Y A;  2F4V L;  2HCC A;  3NBH B;  1EY5 A;  3FMC A;  3OIP A;  3V2T A;  3KF6 B;  1NCV A;  1JR0 D;  3S1M B;  2EYL A;  4LF4 L;  4IJL A;  4L8J A;  2E76 C;  1KIX A;  5G3L D;  4LF9 L;  4P3I A;  4WJW A;  2DIE A;  5IT9 c;  2UXB Q;  2M5S A;  2ZL5 A;  3VR5 A;  5AN9 A;  3A5U A;  3CKI B;  3M4Y A;  4XT3 B;  1SE4 A;  4FDB A;  4UAI A;  3AMU A;  1SJE D;  4PC2 A;  1TY2 A;  2HMA A;  2CW0 D;  4RCZ A;  4JW0 A;  3TZU A;  3J7A 5;  5I4D A;  2KUM A;  4Y52 H;  2R6G A;  4O1N A;  1DGS A;  1VQA A;  5GAG C;  4RLZ A;  1QH0 A;  1LTA D;  4JI7 Q;  2XWB B;  3ULJ A;  1BF4 A;  2ZTG A;  1XTD A;  3NTI A;  4A3L G;  3T51 B;  4GN5 A;  2F0S A;  1YJN A;  1JJC B;  4JYA L;  1QG7 A;  3NTK A;  1EQT A;  2JJQ A;  2E5L Q;  2VYQ A;  3VMF A;  5CMD A;  3ZZ0 A;  4CGY B;  3G4S A;  1QG0 A;  1X54 A;  1NB0 A;  1JE5 A;  4UY8 C;  4C43 A;  1NR2 A;  4FNF A;  2FHT A;  2ZM6 L;  2B2T C;  1LTL A;  1A63 A;  3LQ6 A;  3M3Y H;  1X3G A;  1PV4 A;  3W2H A;  1F2M A;  2B7C A;  4DGZ A;  2B5O A;  4M0L A;  4WQM A;  5EMN A;  3AVT A;  3BZK A;  5EKK A;  4TSF A;  2X6Y A;  1UE5 A;  4IW3 B;  1CTM A;  5LMN L;  1N36 L;  1YNX A;  2BGJ A;  4C3H H;  4XDX A;  1BCP F;  3HKZ B;  3R3O A;  3SEB A;  2EYJ A;  3HOY G;  4UHV A;  3V05 A;  4F87 A;  4TT3 A;  1W6J A;  2F3W A;  1E24 A;  1WTH A;  4CJ2 C;  4RD6 A;  3Q6Q A;  2OQ0 A;  4XL9 A;  4PQX A;  2QGQ A;  1F9S A;  1QCB D;  3CPF A;  1A3T A;  5AFW A;  3PQI A;  3CQZ H;  2WR8 A;  2EDG A;  3QOJ A;  5CBA E;  2ZZE A;  5FO9 B;  1R4Q B;  4B3R L;  3SGI A;  2F0Q A;  3UI2 A;  4CKC A;  1AFP A;  3BVZ A;  3NWT A;  5FA6 A;  4X66 Q;  1AW7 A;  2E2J B;  4LMQ D;  1AN8 A;  1XPO A;  1X32 A;  4P25 A;  4CDE C;  1STN A;  4QF4 A;  2JIZ A;  2R7Z H;  1B53 A;  1ZM3 A;  4QMG A;  2ZZF A;  2D0O A;  4DQK A;  3A0J A;  5H5J A;  1WI5 A;  3W3A A;  2PE3 A;  1Y8O B;  4JI1 Q;  4CDC C;  2B2W C;  1MIU A;  3RZO H;  1CA6 A;  2SNM A;  4XN0 A;  4ILW A;  3H6M A;  3GVK A;  4ZYS A;  1SYF A;  1K28 A;  1JOR A;  5LMU L;  1Q86 D;  3HP3 A;  1S0U A;  2D0P A;  2HT1 A;  1P4M A;  3PO3 H;  3SJZ A;  1QUE A;  4HIO A;  3FPP A;  4F88 A;  2D74 A;  1MSG A;  4PC3 A;  3T53 B;  4JBJ A;  1SN8 A;  1K3R A;  3W2D A;  1J9O A;  2QEX B;  4QY7 A;  1K8A C;  1SNM A;  2RHS B;  4X6A H;  5FO8 B;  1ROD A;  4K2L A;  4DAV A;  2N3S A;  1G29 1;  2BV3 A;  1G7T A;  3F8T A;  4B3M Q;  1BX1 A;  3WXM A;  1DJR D;  1Q46 A;  1XNQ L;  3BVG A;  2BOS A;  4QUC A;  4LF5 L;  1AH9 A;  4TMZ A;  4Z4R A;  4J1M A;  1UEB A;  1G2S A;  2ZBV A;  5EPL A;  2WZN A;  2PYK A;  4M1U B;  1VS0 A;  2GPJ A;  2K75 A;  3TSS A;  4H13 C;  4RGT A;  5IT9 E;  3B82 A;  1WCM G;  4R1J A;  4P2C B;  3WDN A;  4FF2 A;  1IYU A;  3DLL A;  1CQX A;  4QUZ A;  4GNX B;  1N32 Q;  1PH4 A;  3PEN A;  2K4K A;  3W2I A;  3JQR A;  2D9U A;  3U4V A;  1TS4 A;  2VW9 A;  2UXD L;  1Q3L A;  2OTJ A;  2AUJ D;  4KJN A;  3Q24 A;  3HOW G;  3S16 H;  4R4T A;  2NVT H;  4RMF A;  1JT8 A;  1K0S A;  4P2N A;  4RCY A;  4HCS A;  1Z7T A;  3EBE A;  3M4Q A;  2F03 A;  5KIX A;  1GJX A;  1EXM A;  1FNV A;  3ZPN A;  2I5L X;  3D3R A;  1H9K A;  2G5D A;  2I07 B;  3FRP B;  5FLM G;  3I4L A;  1LTI D;  2DER A;  2IX3 A;  1GJR A;  5DS0 A;  4TSS A;  1S40 A;  1FNC A;  5H1S E;  1DCZ A;  3LWE A;  2JDI A;  1Z6H A;  1ZUN B;  3BH4 A;  1XMQ Q;  3IL8 A;  2D3N A;  3GTJ H;  2NN6 G;  4PMB A;  4DUY L;  1OXV A;  2A6E C;  4WOR A;  5CYU A;  4DN4 M;  2AQ2 B;  3OKX A;  3PUZ A;  2VQF L;  1GD7 A;  1SND A;  4AF7 A;  4HED A;  2RCF A;  4A3M B;  1BQE A;  4LF6 L;  3ASS A;  4JI6 Q;  1FDR A;  3HOW B;  1WP6 A;  5F4M A;  3G7L A;  4KKS A;  4GN3 B;  4LUO A;  4MTN A;  5AJ3 Q;  1ASZ A;  2X6L A;  2DCU A;  3ASR A;  2F0O A;  4MZ9 A;  4XOR A;  4R71 A;  1B4O A;  1CA5 A;  1L2F A;  4B3M L;  2N88 A;  1X56 A;  3N52 A;  2VB2 X;  1F2Y A;  1JWM D;  2MUY A;  5CGK A;  1BR9 A;  1HPC A;  2NVY H;  5B6I A;  4A3F G;  4X3S A;  1UD8 A;  4P26 A;  2EE1 A;  2KVM A;  3R8B A;  4G1B A;  2PMZ B;  2QTZ A;  1SM4 A;  5J39 A;  1SNP A;  4DV1 Q;  3VO2 A;  1EZ6 A;  3CME B;  1NY4 A;  4LJZ C;  1E2V A;  3I73 A;  4A3M G;  3F2U A;  3T4A C;  1M4V A;  1HR0 W;  1VHE A;  1N07 A;  3PO2 B;  2XZL A;  4DR3 Q;  4OOS A;  3K59 A;  2PO4 A;  1PTO B;  2BMW A;  2BVN A;  2EYH A;  1K8A D;  3GTJ B;  5DM7 3;  4BWG B;  4WRD A;  3T1H Q;  4CKE A;  2V31 A;  3CMM A;  5JJK A;  1YJ9 B;  5HUR A;  3UDX A;  2WSS A;  1VQ7 B;  1WOO A;  1UE7 A;  4B3X A;  3FVQ A;  3H15 A;  2JEA I;  3PF4 A;  1QZH A;  1PHJ A;  3GTK H;  2L4N A;  4P22 A;  2R61 A;  5ELC A;  3SR1 A;  3HG9 A;  2W6J A;  4YAW A;  5JAV A;  4CHT B;  1KTK A;  4OWX B;  4A93 B;  2NBF A;  1PMR A;  1Q7Y C;  1QGZ A;  1PTO H;  1JOO A;  3H94 A;  2WP8 J;  2BN4 A;  2VL6 A;  1Q9S A;  3SXH A;  1MKH A;  2EOT A;  1ILP A;  1HQR D;  2DY8 A;  2Q8I B;  5AJ3 L;  2YWF A;  1CKM A;  4MYT A;  4DV3 Q;  4IPG A;  5F4O A;  2IY5 B;  1WTV A;  4LF6 Q;  3GTM H;  2QMU A;  3H0G G;  2Y0S B;  3S14 B;  3Q6S A;  3WNB A;  4TQU S;  1STY A;  1Y0R A;  3U6B A;  1OB0 A;  3A8J A;  3EFX D;  5CDF A;  5LMZ A;  5C3E G;  3J81 L;  3J81 i;  2JA8 H;  3I4M H;  1VQ8 A;  3M85 A;  3LNN A;  3VNV A;  3BY1 A;  1HTL D;  1Q86 C;  1RQR A;  4Z4S A;  3CCV B;  4RHS A;  1N34 L;  1KXL A;  2DOG A;  4C1N K;  3HOY B;  1VQ6 B;  5DAU A;  3QE2 A;  1GVP A;  3ZYY X;  4RD4 A;  4DXG A;  1F77 A;  1B50 A;  1YNJ C;  4XKW A;  1S5D D;  2F0N A;  5CV9 A;  3ZZU A;  3QG1 A;  3OW7 A;  5C4H A;  4KI0 A;  1I4H A;  4ZGN B;  3GVL A;  2ZTD A;  1GAQ A;  2Z8L A;  3MFG A;  3MXN B;  4FF3 A;  2R7Z G;  2AUK A;  3NHH A;  4V0B A;  2ZJQ A;  4DK3 C;  3BCF A;  2ENB A;  1ESF A;  2X0K A;  1NBW A;  3AU7 A;  4HSV A;  3HOU G;  2Q6O A;  1C8C A;  1MAB A;  3MTS A;  4CJ0 B;  1COW A;  4PNY A;  4UZU A;  1OXX K;  4DK6 C;  1NMF A;  4YAU A;  3LWU A;  1JNY A;  3QFS A;  1BVS A;  1GUW A;  2BCO A;  5ELB A;  3J80 c;  4X0C A;  2K14 A;  3PA1 A;  3I8Z A;  1LV9 A;  2R6H A;  2CW0 C;  1WDT A;  4YIJ A;  3HOY H;  4K14 A;  5HZA A;  1TVX A;  1EFT A;  1STE A;  5C5M A;  5BSY A;  1L0Y B;  5ELE A;  2YWH A;  2PZW A;  2RA4 A;  4RDL A;  4XXE A;  2BE5 C;  3JU4 A;  3WOF A;  1T5E A;  3SJP A;  4C3H B;  3WWV A;  4LF5 Q;  1FND A;  3HOU B;  2QEJ C;  1NTG A;  2DJG C;  4KV6 A;  1L1O C;  3OMG A;  4IFD H;  5ISR A;  2I0Q A;  2XN9 C;  3I7F A;  4DR5 Q;  2R7Z B;  1KD1 D;  4DA2 A;  2WFW A;  4HSP A;  4A3K H;  1Z9F A;  2P3M A;  1VQJ A;  2EYP A;  4I7Z C;  1KAB A;  2ZTN A;  4MNO A;  3ASQ A;  3J81 E;  1D5X C;  4P12 A;  1WTR A;  4NKL A;  4G7Z C;  1TWA H;  5J3O A;  4JK1 C;  2EFG A;  4JBM A;  2SDF A;  5JVG 3;  3CRK C;  3CQZ B;  4QGU A;  3I72 A;  3MFY A;  2F0V A;  4TRD A;  3A8I A;  2F0D A;  2MPM A;  3I3C A;  1W9X A;  2SOB A;  3VYR A;  4BBR G;  5ELO A;  5IYQ A;  2EJM A;  2K33 A;  1VQL A;  1SSO A;  3ICE A;  4KLK A;  3I70 A;  2HDN B;  4CKB A;  1PYW D;  4LUV A;  3E0E A;  4X65 L;  4IUQ A;  1OO9 B;  3DWP A;  1XX8 A;  1A62 A;  2C5B A;  1D1I A;  1YIJ B;  3I4O A;  1VQH A;  4OO1 H;  3PV0 A;  2CND A;  2OBT A;  4JG2 A;  4G6I A;  2ZXI A;  4KJO A;  1B9N A;  1I4R A;  4UZE A;  4P74 A;  2J7K A;  5IK2 A;  2B39 A;  1A8V A;  2F0M A;  2HDL A;  2VS1 A;  5G3L F;  1TT2 A;  5K36 G;  1N8R D;  5KNC A;  4XQN A;  2LFN A;  1KQS B;  2PI2 A;  1N36 Q;  4M4S A;  2F0F A;  3L7Z C;  4OHJ A;  5FKA C;  3KYH C;  1PH2 A;  3HOZ B;  3CCR B;  2V7V A;  4RA8 A;  2VQE L;  1T6X A;  2XEX A;  3GDE A;  1PH8 A;  1G2T A;  1PRT C;  2C35 B;  3I2Z A;  2RCN A;  1I94 Q;  3ZIA A;  3BYY B;  1EWY A;  3Q39 A;  4RH6 A;  2RSO A;  1KRH A;  3X3M A;  3H3V C;  1Q12 A;  2WB1 E;  1RKN A;  3I4N H;  2UUA L;  1KC8 D; 
#chains in the Genus database with same CATH homology
 3GTO B;  2K28 A;  4FP5 D;  5A35 A;  5M3M B;  1PDQ A;  1FR3 A;  2C9O A;  1I18 A;  3BS1 A;  2NVT B;  1PRT F;  5K36 H;  4E0F A;  1U4L A;  1JIC A;  2Z4H A;  2GJP A;  1QE6 A;  3MHB A;  1OXU A;  3JAM L;  5JPN C;  1YNJ D;  3IFT A;  3KBG A;  1DXM A;  2B2U C;  2X69 A;  4XYO A;  5C5L A;  3GTQ B;  3K5N A;  3IKJ A;  2VJI A;  4C3J G;  3FEW X;  1LTT D;  2XIW A;  3D4D A;  1GUO A;  5JVH 3;  5JEA J;  4BBR B;  2F0T A;  4IUR A;  2V7Q A;  1NRK A;  2EJF C;  1A15 A;  2JA7 B;  4XT1 B;  3O13 A;  5T1I A;  1EY7 A;  1BCP C;  1Q8I A;  2F3V A;  2L11 A;  3NTH A;  3K5M A;  2K04 A;  4FF1 A;  3K7A B;  4I65 A;  2B2Y C;  2O5I C;  1F9Q A;  4K5W A;  3S2H B;  3KEW A;  4XYQ A;  1RCV D;  3I4N B;  4DAY A;  3NQT A;  2O5J C;  1EFR A;  5D3D A;  1BUV T;  4ZLT F;  2PPB C;  4A3J B;  4KK7 A;  1WTH D;  1E3X A;  3URY A;  2B63 B;  3KF8 A;  2ZXH A;  2DNE A;  3HOX B;  2HLD A;  4OO1 G;  2K5D A;  3RLF A;  2SEB D;  3BC9 A;  3JAM E;  3DHQ A;  4ULL A;  5C4Z A;  3RD4 A;  3TZD A;  2X8K A;  1ILQ A;  3TP8 A;  1E79 A;  2GA4 B;  5KGU A;  3NQI A;  1IKL A;  5TSS A;  4OIK A;  1PTO C;  5FL7 A;  2GJK A;  4XLC A;  4A3G B;  2LMC B;  5IGC A;  1MD2 D;  2D5D A;  5C3E B;  3VR3 A;  2XZO A;  2WAQ B;  3I90 A;  1W6K A;  2QCP X;  3A35 A;  1EFI D;  3ERO A;  1TII D;  2B2W A;  5C0X I;  1ZXT A;  2NVX B;  2OEO A;  3VR4 A;  3NBH A;  1BO0 A;  1SYC A;  4IFD I;  1B2T A;  2KQ3 A;  5KNL A;  4MIU A;  1UNS A;  1TWG B;  4KD4 A;  3RZD B;  5C44 B;  2IWH A;  1WTQ A;  1JWS D;  1S5B D;  1A3V A;  1V1P A;  1JC7 A;  1CZW A;  3SK8 A;  3VA7 A;  4IFD G;  1QIL A;  2F43 A;  1LAC A;  5JPM C;  1SXT A;  3HEJ A;  1XWE A;  4S3S A;  1XTC D;  2WAC A;  3OWE B;  1R4P B;  2V4D A;  1CHP D;  4IUV A;  5M5X B;  5CV4 A;  3QJY A;  4XON A;  3PUX A;  5D65 A;  2B2U A;  3K0Y A;  4EQP A;  1TS2 A;  3K57 A;  1EL0 A;  3OMC A;  1K8M A;  2KOL A;  1DD2 A;  1VMC A;  1YNN C;  5CV6 A;  4YEJ A;  3KBX A;  4NW2 A;  4EQN A;  3M4O B;  1WTP A;  3OEH A;  4KKU A;  1TU2 B;  3A8J E;  4HMJ A;  3VA5 A;  3N6R A;  2B2Y A;  4QB4 A;  2K5W A;  2TSS A;  3G05 A;  2JA8 B;  5EKI A;  1GXD C;  4PV1 C;  3SHL A;  4ODG A;  2JE6 I;  1EY0 A;  4HMI A;  3BG3 A;  5EGT A;  3V96 A;  4Z1M A;  5JEA G;  2X53 S;  2WJY A;  5I6W A;  1FNW A;  2EY1 A;  3KLS X;  1LO5 D;  2XWJ B;  2BE5 D;  2J7Z A;  2B2V C;  1VMP A;  1I4P A;  2KHS A;  3PMF A;  1EEF D;  2PQE A;  2KJX A;  2CVR A;  3KLS A;  3J7A F;  1L0X B;  1TQO A;  3D8G A;  5JEA H;  2XVS A;  1Y1V B;  5COY A;  4XM3 A;  2R93 B;  1EZ8 A;  1I4G A;  2XRQ D;  4DFA A;  2NN6 I;  4A3F B;  1FGB D;  3MEH A;  5DN6 A;  2GK7 A;  1EIG A;  5C3X A;  4YEL A;  3MXU A;  4DF7 A;  1AP0 A;  1PTO D;  1ZKO A;  1RDP D;  3TME A;  1K28 D;  3R2T A;  2F0W A;  4G7H C;  1ENA A;  2K01 A;  2LKV A;  3RUZ A;  4OIJ A;  5KND A;  1SBB B;  3IAY A;  2NB0 A;  3OFN A;  3M7G A;  4KTA A;  2LY7 A;  2IW3 A;  3T56 B;  2F0J A;  2GK6 A;  2NVY B;  2AWO A;  1H9J A;  2NN6 H;  2NZ1 D;  4MN3 A;  4EQO A;  5IOC A;  2L55 A;  4XR6 A;  3BCD A;  1OXT A;  1JCK B;  5E4W C;  3J7A V;  2CHB D;  3ERQ A;  2ID0 A;  4MHE A;  1ESR A;  4IZ8 A;  5DEH A;  1LTR D;  4BA1 I;  5C0X H;  5I9P A;  1I6V C;  4IAL A;  1B1Z A;  4FXD A;  1JOK A;  3NUC A;  2MGS A;  1H9R A;  2E1B A;  3ITP A;  1W0J A;  4Z9C B;  4FXG C;  2CK3 A;  1SEB D;  5EPJ A;  2OXP A;  1J8I A;  4NP5 A;  4KMU C;  1H9M A;  1E2Z A;  3CP2 A;  3Q0A A;  4XLF A;  1BDO A;  2QIL A;  4QUF A;  2AQ1 B;  2BDO A;  4RCO A;  3HRZ C;  3S9W A;  1BQQ T;  2K05 A;  2FFK B;  4ZRZ A;  1HFN A;  1V43 A;  1JQY D;  2E2H B;  4A3E B;  4G4K A;  4K8I A;  2K03 A;  3Q23 A;  1STH A;  1WVL A;  5I6Y A;  5KYI A;  3VYT A;  4C3J B;  1RD9 D;  3VYU A;  1B3A A;  2IL8 A;  4XQJ A;  4XD7 A;  1LAB A;  2L1B A;  1E43 A;  2KCC A;  1JWU D;  4HAE A;  2RDH A;  3OEE A;  4ZUJ A;  4OL7 A;  3S1Q B;  4AYB B;  5I2Y A;  3M3Y B;  1Q90 A;  2PZU A;  4NMZ A;  1SKY B;  2LZJ A;  4FVM A;  4ABN A;  1I50 B;  5CR3 A;  4XMY A;  2KEC A;  3GTL B;  2H1E A;  3G6J B;  4XOT A;  2EZV A;  1STB A;  2R9V A;  3HAG A;  4IUP A;  3A8I E;  1TWF B;  2AQ3 B;  2KA7 A;  3C1E A;  4ME5 A;  3MC0 B;  1R9T B;  4A3I B;  5KEE A;  5HKK A;  4FYD A;  1F2Z A;  2Q8R E;  3QIA A;  3A7A B;  4HN7 A;  3TP7 A;  1HA6 A;  1I8D A;  2WJV A;  3A8K E;  4K6L A;  4BBS B;  5LL6 S;  1EIH A;  3K58 A;  2IX1 A;  4RCN A;  5EJW A;  2WPD A;  2ZT9 C;  5E4X A;  1HVX A;  2A6H C;  3K6O A;  2N55 A;  2TMP A;  3X3N A;  3R2I A;  5M5W B;  1CZG A;  5T1G A;  3MAQ A;  4U68 A;  4GZY C;  3BDO A;  3EA6 A;  1O7Y A;  2A69 C;  1MBY A;  1KDA A;  3ND8 A;  4B9X A;  1SMY D;  2F0U A;  3PUW A;  4QIW B;  1WPC A;  1LT5 D;  1LLR D;  2NWG A;  3PUV A;  3K5O A;  1CI3 M;  4ZUI A;  4EGV A;  2QKI C;  2EY2 A;  3VR6 A;  2EVB A;  4IQZ A;  1TS3 A;  2A68 D;  2A69 D;  3DEP A;  1S5F D;  4RHR A;  4GQN A;  2NTT A;  1QNK A;  4RWS C;  5IT9 L;  4KY7 A;  1I3Q B;  4XLA A;  2IPK D;  2A6H D;  1W0K A;  2M00 A;  1ET6 A;  2G9D A;  3QO2 A;  5E1F A;  5BN3 A;  3NXW A;  2F0K A;  2JA6 B;  2F1M A;  4R9W A;  1EYA A;  3S17 B;  1KNA A;  1CT1 D;  1DM0 B;  1U9R A;  1UD3 A;  2FMM A;  1DOL A;  1GUN A;  1TWH B;  1ICW A;  4II3 A;  1HUM A;  2Q8T A;  4XNF A;  1H8E A;  1CQF A;  3DWQ A;  2ZXR A;  2FJ2 A;  4PMC A;  2F4I A;  4L63 B;  3C1F A;  2QDB A;  2EY5 A;  1O78 A;  5FLX L;  2RBM A;  3U9S A;  1SYG A;  2IJ0 A;  3NSW A;  3P7J A;  4YXW A;  3PIO 3;  3DDY A;  1NAP A;  5C3W A;  4L6T B;  1RTO A;  3GD7 A;  1S5E D;  1TWA B;  3BZD B;  3L9A X;  4DK1 A;  1BCP B;  3FKI B;  4EVO A;  5BN4 A;  3BDC A;  4KHZ A;  2PZT A;  4ID6 A;  1WTO A;  1KLU D;  3D6C A;  1BBX C;  3TN2 A;  1WTW A;  3SVM A;  3VYS A;  3NBI A;  1BNZ A;  5C0X G;  1PLF A;  2F0H A;  2B8F A;  2JP1 A;  3GP7 A;  5A2Q L;  3CRL C;  2VNU D;  2IT1 A;  3OIQ A;  2GJR A;  3SDZ A;  1I4X A;  1LTS D;  1ZYR D;  4XQF A;  1SE2 A;  2JYO A;  1WD1 A;  1HXY D;  1C48 A;  3OE7 A;  1EY6 A;  3TP5 A;  3GO5 A;  2B2V A;  1E0B A;  2L12 A;  1PRT B;  1GHJ A;  2PNR C;  2E74 C;  1HHV A;  4A3K B;  1F9P A;  3RZO B;  2WKC A;  1YNN D;  4KN4 C;  4N9T A;  5I9O A;  4C1N I;  3C3L A;  2CQA A;  3TBI B;  1WTX A;  1HTP A;  2DNC A;  5C4J B;  3GTG B;  3NPP A;  3R93 A;  2OF1 A;  2BDN A;  3OPO A;  3SK4 A;  3Q22 A;  4QCL A;  2EY6 A;  1HUN A;  5F2D A;  1Y69 U;  1D2B A;  2LS0 1;  1PZI D;  2A68 C;  3S16 B;  1HQM C;  5C6A A;  1G91 A;  5I2X A;  1Y8P B;  3I4M B;  4CBV A;  5ELF A;  2PCF B;  4XQQ A;  1C4Q A;  1SAP A;  4TKO B;  2EYF A;  4DAP A;  2C5C A;  3TP6 A;  4Y7N B;  4DNT B;  1UD4 A;  1FX0 A;  5FK9 C;  5IOD A;  1Q1E A;  1LTG D;  2Z4I A;  1DOM A;  4LAA A;  4RFB A;  3QOL A;  3QB3 A;  1SMY C;  1E1Q A;  4JBW A;  4C2M B;  1ENF A;  3A56 A;  3A7L A;  1GHK A;  3H91 A;  1G8Z D;  2X6X A;  4DK0 A;  2K6A A;  1GUS A;  5LL6 X;  3P20 A;  2X6W A;  1ML0 D;  2JSO A;  1RJT A;  2XSC A;  3GTM B;  1O7L A;  3AB9 A;  5EQ0 A;  4M8A A;  4NNJ A;  3HOV B;  4HCE A;  3KK7 A;  1DON A;  4WFN 3;  4V19 0;  2D2C C;  3DEO A;  2Z6B D;  1JOQ A;  1EU3 A;  1SDF A;  4XN3 A;  1D5M C;  1LT3 D;  4X3U A;  2QF7 A;  2RQX A;  4LK1 C;  1X3Q A;  2ZXP A;  2WV6 D;  3P1H A;  2R92 B;  2RSN A;  3OOC A;  3FKS A;  4N9P A;  3IFD A;  1EWH A;  4F7X A;  1OHH A;  2KED A;  1AZQ A;  1A3U A;  3J80 E;  1AZP A;  4R8I A;  3D31 A;  5COR A;  1V0F A;  3EQL C;  2QE7 A;  2BA1 A;  4HR7 B;  2R3Z A;  1HCZ A;  2HCI A;  2VJJ A;  4ZAI A;  4A3D B;  2XZP A;  3P75 A;  3E0J A;  2ZZG A;  5DNF A;  2NVQ B;  5IGE A;  1SFO B;  5M5Y B;  3M7N A;  4RKL A;  3KUP A;  3S15 B;  1OXS C;  3ND9 A;  1EYC A;  1STG A;  4OGQ C;  2W6I A;  1HZE A;  1WD0 A;  3MXG A;  2E75 C;  5EKL A;  4C3H G;  2YU9 B;  1II3 A;  1UEA B;  1SNO A;  3GV3 A;  2A5H A;  4ZKB B;  1RHP A;  3DM1 A;  3OWF A;  5CC4 A;  1CM9 A;  5CV5 A;  1ZYR C;  3KLR A;  1SYE A;  1PFB A;  2JJ2 A;  1PXU A;  4RKB A;  4UDU C;  2OT2 A;  1NBM A;  3K5L A;  1Q1B A;  2DY7 A;  4KHV A;  4C56 C;  4FXK C;  4AVZ A;  4K6D A;  4B3G A;  1EYD A;  2FMC A;  4OO1 I;  1SNC A;  5IGG A;  4PMW A;  1Y1W B;  4B08 A;  1PZJ D;  1U4P A;  3WQZ A;  4B9W A;  3D4R A;  2EJG C;  3MVV A;  1I6H B;  3BDL A;  1A2U A;  5JOB A;  2VB3 X;  1CHQ D;  3DWA A;  4K5X A;  4G7X A;  1D6E C;  3WOE A;  5EBC A;  3NE5 B;  4B3F X;  1QWY A;  4BA2 I;  2B2T A;  2F0I A;  1A6X A;  4JMQ A;  1B9M A;  2WII B;  1E1R A;  2WB1 B;  1D1K A;  3I91 A;  3OHX C;  5IIF A;  3BYT B;  4IFD J;  1CFM A;  5C0X J;  5DM6 3;  5E3F A;  2RDG A;  2DN8 A;  4IN3 A;  2SNS A;  2AWN A;  3A3G A;  1BMF A;  1QOH A;  1QNU A;  4J6H A;  3DXJ C;  5FO7 B;  2JA5 B;  1IW7 D;  1Y8N B;  1DOK A;  4H7B A;  5D14 A;  3SE0 A;  4ZQ3 A;  3MWY W;  5M3F B;  5IGB A;  4O42 A;  3C2P A;  3HZX A;  1TKW B;  1EOT A;  1KDC A;  3A55 A;  3D6W A;  2PW5 A;  4K2K A;  3CP8 A;  1LTB D;  1XXG A;  2RDF A;  1ONL A;  4DU9 A;  5C4X B;  4FF4 A;  2E2I B;  4XOP A;  2XND A;  3NWS A;  1G6Z A;  2KEE A;  3J80 L;  3FPU B;  1EY8 A;  1KDB A;  2F0G A;  4U67 3;  1HFG A;  3VR2 A;  4K5V A;  2B8G A;  4KN7 C;  1I4Q A;  5A2Q E;  3GVJ A;  4FXU A;  1MSH A;  1M8A A;  2WIN B;  3H09 A;  1PFM A;  4A3B B;  4XIG S;  4ZK9 B;  2K32 A;  2YYZ A;  1SYD A;  4X3K A;  3S2D B;  1D5Z C;  1IYV A;  4DNR B;  1S4Z A;  2ICI A;  3MXP A;  1UD2 A;  1KLG D;  5KNB A;  1E3Z A;  4II2 A;  2O2L D;  5ELD A;  1UAP A;  1EY4 A;  3TDQ A;  1IKM A;  3S1R B;  3E5S A;  4BS9 A;  1SE3 A;  1VCI A;  2RKS A;  2A74 C;  2I46 A;  2RVL A;  2K1B A;  2L5T A;  1ENC A;  1U4M A;  3OSO A;  2KVO A;  1NR4 A;  4ZKC B;  1K8O A;  1WCM B;  5EPK A;  5IGF A;  1KNE A;  2Z1C A;  1H9S A;  1CQV A;  1B44 D;  1IHZ A;  1LT6 D;  1PZK D;  3J7Y W;  3HS0 C;  3S1N B;  4BY1 B;  1JE4 A;  4NDX A;  4HIZ A;  2F0P A;  5CV7 A;  4KY6 A;  4F8M A;  1V1O A;  1QJO A;  2EYO A;  1VF5 C;  3L3O C;  5CV8 A;  3SK5 A;  1UD6 A;  1PKV A;  2JEB I;  1FD7 D;  2E2D C;  2XOK A;  1DYQ A;  2JJ1 A;  3GTK B;  1A2T A;  1K83 B;  1U4R A;  5J1Z A;  1NUC A;  2XNA C;  4RGN A;  3CES A;  1DZ1 A;  2M2L A;  2NUC A;  3GTP B;  3H0G B;  4H0L C;  3EVQ A;  5J22 A;  1SYB A;  2BA0 A;  1IW7 C;  2ZXO A;  1H9S B;  2XRS D;  1EWC A;  2ICE C;  1EEI D;  2ZZQ A;  1PTO F;  1RTN A;  1EQV A;  2H4O A;  3D4W A;  5BN5 A;  1KMH A;  3C46 A;  1STA A;  2D62 A;  1F2L A;  1KAA A;  4C3I B;  1O80 A;  1QB5 D;  2X85 A;  5KRU A;  1JB3 A;  3E6Z X;  2WZP P;  2MP1 A;  2A6E D;  2HUG A;  5K5P A;  1H8H A;  1UD5 A;  1S5C D;  1ZEQ X;  4H44 C;  1BOS A;  1E2W A;  3A3B A;  1LT4 D;  4XLH A;  1V8Q A;  1VF7 A;  2VXW A;  1GUT A;  1BPL A;  4IUU A;  4BY7 B;  1AEX A;  1VJS A;  3U9O A;  3T13 A;  3SK6 A;  2F0L A;  2L9H A;  3MZ5 A;  2J0T D;  4XLE A;  2XGJ A;  3PUY A;  5JJZ A;  5FOB B;  2M9V A;  1CK1 A;  2K7V A;  2J4X A;  5KYL A;  4K8J A;  4RAU C;  3MA2 B;  4J8Q A;  1VLY A;  3BVM A;  1BLI A;  2D3L A;  2EPB A;  4C3I G;  4KKT A;  3PO3 B;  1UUP A;  3T16 A;  1PFN A;  2NTS A;  1V1P B;  5EBD A;  4DXF A;  2VUM B;  3DMU A;  2A73 B;  1Z47 A;  2JXM B;  2WKD A;  2HQE A;  5LHY 1;  1SJH D;  1BCP D;  4Q0F A;  1ET9 A;  4HTH A;  4IUN A;  1BXT A;  5CBE E;  3LX0 A;  4ASU A;  3PIP 3;  1TWC B;  4RGO S;  1EY9 A;  2G9H D;  2EXZ A;  4KD3 A;  2X6G A;  1MI2 A;  4RGM A;  3OAA A;  4CJ1 B;  5NUC A;  1TS5 A;  2IX0 A;  4X3T A;  5IGD A;  3A54 A;  3CHB D;  3CU7 A;  1O7Z A;  3HGB A;  1HRJ A;  4R8N A;  2KCN A;  1GUG A;  1VDZ A;  4G57 A;  1HA5 A;  3FDT A;  4IUT A;  2EYM A;  1PRT D;  2O4X A;  1TR5 A;  3NP8 A;  1TY0 A;  5D3I B;  3MXN A;  3QWN A;  1MGS A;  1FYC A;  2NYZ D;  4G7O C;  1T5X D;  3NK9 A;  1IL8 A;  2FIN B;  1NSN S;  1XYI A;  3DUZ A;  4KY5 A;  2K5Q A;  4Q5V A;  1F9R A;  1GOZ A;  2L0C A;  1EU4 A;  3GV6 A;  5FLX E;  1FNU A;  2MHV A;  1X3P A;  3EJI A;  5HGT A;  3RMH A;  4XTC S;  4G7W A;  2MJ8 A;  3ONA B;  1V0E A;  5M9O A;  2HDM A;  1RF2 D;  2PW7 A;  4FO2 A;  4E6I A;  4XKV A;  1SNQ A;  1KZL A;  3GQB A;  2F0E A;  2HCC A;  1EY5 A;  3FMC A;  3OIP A;  3V2T A;  1NCV A;  1JR0 D;  3S1M B;  2EYL A;  4L8J A;  2E76 C;  5G3L D;  4WJW A;  2DIE A;  2M5S A;  3VR5 A;  3CKI B;  3M4Y A;  4XT3 B;  1SE4 A;  4UAI A;  3AMU A;  1SJE D;  1TY2 A;  2CW0 D;  3TZU A;  5I4D A;  2KUM A;  2R6G A;  4O1N A;  1LTA D;  2XWB B;  1BF4 A;  2ZTG A;  3NTI A;  3T51 B;  2F0S A;  1QG7 A;  3NTK A;  1EQT A;  5CMD A;  4CGY B;  1NR2 A;  4FNF A;  2FHT A;  2B2T C;  1F2M A;  4DGZ A;  5EKK A;  4TSF A;  2X6Y A;  1CTM A;  4XDX A;  1BCP F;  3HKZ B;  3R3O A;  3SEB A;  2EYJ A;  3V05 A;  4F87 A;  4TT3 A;  1W6J A;  2F3W A;  4CJ2 C;  4XL9 A;  4PQX A;  1F9S A;  1QCB D;  1A3T A;  5AFW A;  2EDG A;  3QOJ A;  5CBA E;  2ZZE A;  5FO9 B;  1R4Q B;  2F0Q A;  3UI2 A;  4CKC A;  1AFP A;  3BVZ A;  3NWT A;  1AW7 A;  2E2J B;  4LMQ D;  1AN8 A;  1X32 A;  1STN A;  4QF4 A;  2JIZ A;  1B53 A;  4QMG A;  2ZZF A;  3W3A A;  1Y8O B;  2B2W C;  1CA6 A;  2SNM A;  4XN0 A;  4ILW A;  3H6M A;  3GVK A;  4ZYS A;  1SYF A;  1JOR A;  3HP3 A;  3FPP A;  4F88 A;  1MSG A;  3T53 B;  3W2D A;  1J9O A;  1SNM A;  5FO8 B;  1ROD A;  4K2L A;  4DAV A;  1G29 1;  1DJR D;  3BVG A;  2BOS A;  4QUC A;  4J1M A;  1G2S A;  5EPL A;  2PYK A;  4M1U B;  3TSS A;  4H13 C;  4RGT A;  5IT9 E;  4P2C B;  3WDN A;  4FF2 A;  1IYU A;  2D9U A;  1TS4 A;  1Q3L A;  2AUJ D;  4KJN A;  3Q24 A;  4HCS A;  1Z7T A;  2F03 A;  5KIX A;  1GJX A;  1FNV A;  3ZPN A;  3D3R A;  1H9K A;  2I07 B;  3FRP B;  3I4L A;  1LTI D;  2IX3 A;  4TSS A;  1DCZ A;  3LWE A;  2JDI A;  1Z6H A;  3BH4 A;  3IL8 A;  2D3N A;  2NN6 G;  4PMB A;  1OXV A;  2A6E C;  4WOR A;  5CYU A;  4DN4 M;  2AQ2 B;  3PUZ A;  1SND A;  4HED A;  4A3M B;  3HOW B;  1WP6 A;  3G7L A;  4KKS A;  2X6L A;  2F0O A;  1CA5 A;  4XOR A;  1B4O A;  2N88 A;  3N52 A;  2VB2 X;  1F2Y A;  2MUY A;  1JWM D;  5CGK A;  1BR9 A;  1HPC A;  4X3S A;  1UD8 A;  2EE1 A;  2KVM A;  3R8B A;  2PMZ B;  5J39 A;  1SNP A;  1EZ6 A;  4LJZ C;  1E2V A;  3I73 A;  3F2U A;  3T4A C;  1M4V A;  3PO2 B;  2XZL A;  3K59 A;  2PO4 A;  1PTO B;  3GTJ B;  2EYH A;  5DM7 3;  4BWG B;  4WRD A;  4CKE A;  2V31 A;  3CMM A;  5HUR A;  2WSS A;  3FVQ A;  2JEA I;  2L4N A;  4P22 A;  2R61 A;  5ELC A;  3SR1 A;  3HG9 A;  2W6J A;  5JAV A;  4CHT B;  1KTK A;  4A93 B;  2NBF A;  1PMR A;  1PTO H;  1JOO A;  3H94 A;  2WP8 J;  3SXH A;  2EOT A;  1ILP A;  1HQR D;  2DY8 A;  2Q8I B;  1WTV A;  3S14 B;  2Y0S B;  3Q6S A;  4TQU S;  1STY A;  3J81 L;  1OB0 A;  3EFX D;  5CDF A;  3M85 A;  3LNN A;  1HTL D;  4RHS A;  4C1N K;  3HOY B;  5DAU A;  3ZYY X;  4DXG A;  1F77 A;  1B50 A;  1YNJ C;  4XKW A;  1S5D D;  2F0N A;  5CV9 A;  3QG1 A;  3OW7 A;  5C4H A;  4KI0 A;  1I4H A;  3GVL A;  2Z8L A;  3MFG A;  4FF3 A;  2AUK A;  3NHH A;  4V0B A;  3BCF A;  2ENB A;  1ESF A;  3AU7 A;  4HSV A;  1C8C A;  1MAB A;  3MTS A;  4CJ0 B;  1COW A;  4PNY A;  4UZU A;  1OXX K;  3LWU A;  1GUW A;  2BCO A;  5ELB A;  3I8Z A;  1LV9 A;  2CW0 C;  4YIJ A;  4K14 A;  1TVX A;  1STE A;  5C5M A;  1L0Y B;  5ELE A;  2PZW A;  2RA4 A;  4XXE A;  2BE5 C;  3JU4 A;  3WOF A;  1T5E A;  4C3H B;  3HOU B;  2QEJ C;  4KV6 A;  3OMG A;  4IFD H;  5ISR A;  2XN9 C;  2R7Z B;  4DA2 A;  4HSP A;  2EYP A;  4I7Z C;  1KAB A;  2ZTN A;  3J81 E;  1D5X C;  1WTR A;  4NKL A;  4G7Z C;  4JK1 C;  2SDF A;  5JVG 3;  3CRK C;  3CQZ B;  3I72 A;  3MFY A;  2F0V A;  4TRD A;  2F0D A;  2MPM A;  3I3C A;  1W9X A;  2SOB A;  3VYR A;  2EJM A;  2K33 A;  1SSO A;  3I70 A;  4CKB A;  1PYW D;  4IUQ A;  1OO9 B;  3DWP A;  1XX8 A;  1D1I A;  4OO1 H;  3PV0 A;  4G6I A;  2ZXI A;  4KJO A;  1B9N A;  1I4R A;  5IK2 A;  2B39 A;  2F0M A;  2HDL A;  5G3L F;  1TT2 A;  5K36 G;  5KNC A;  4XQN A;  2LFN A;  5FKA C;  2F0F A;  3L7Z C;  4OHJ A;  3HOZ B;  4RA8 A;  1G2T A;  1PRT C;  3ZIA A;  3BYY B;  4RH6 A;  2RSO A;  3X3M A;  3H3V C;  1Q12 A;  1RKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...