3T51B

Crystal structures of the pre-extrusion and extrusion states of the cusba adaptor-transporter complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
322
structure length
322
Chain Sequence
ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Charged Amino Acids (R83, E567, D617, E625, R669, and K678) of CusA Are Required for Metal Ion Transport in the Cus Efflux System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Cation efflux system protein CusB
total genus 48
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3t51B02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3t51B03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3t51B01
3DXJC 1Q12A 3PUVA 1DXMA 2PCFB 3QIAA 1GUNA 1Z7TA 1GUGA 2BDOA 2O5IC 2D2CC 2O5JC 3LWUA 1Z6HA 1G291 2BA1A 3D4RA 1E2VA 4GZYC 1HPCA 1CI3M 3U9SA 2JXMB 1GHKA 1ONLA 5JEAG 1E2ZA 3FPPA 3PUXA 4IQZA 2EJFC 4LK1C 3VR2A 1O7LA 5C0XG 5A35A 1H9SA 2AUKA 3CRKC 2JEBI 3OPOA 3MFYA 4KMUC 2PNRC 1HQMC 1HCZA 2K7VA 4OO1H 2AWOA 3OW7A 3A8JE 1LABA 3I4LA 2DNEA 1Y69U 1IYVA 3A7LA 2DNCA 3M7NA 4DK0A 2EJGC 2NN6H 4KI0A 2QF7A 5BN5A 1H9JA 2E74C 1DD2A 1Q1EA 1SMYC 1YNJC 2A6EC 1GUTA 3MXUA 4HR7B 1Y8PB 2V4DA 2A6HD 1TU2B 1DCZA 1PMRA 4I7ZC 2F1MA 5JEAH 1H9RA 3M85A 3A8KE 5BN4A 1B9NA 1GUSA 1CFMA 1A6XA 1IW7C 1ZYRC 2KA7A 3IFTA 3TZUA 5BN3A 1VCIA 1H9MA 4OGQC 4KN7C 4IFDG 2A68D 3A7AB 2B8FA 4H13C 4KN4C 3P20A 2KCCA 3RLFA 4KKTA 3M4YA 2ZT9C 4RCNA 1H9SB 3CRLC 3PUZA 2K32A 3SDZA 4OO1G 1Q1BA 2BE5D 4L8JA 3I73A 3A8IE 3WDNA 4G7ZC 2NN6G 1GJXA 2E75C 2K33A 5KNCA 1V43A 1T5EA 1I6VC 3NE5B 4KKSA 2JE6I 3PUYA 1K8OA 1OXUA 2D5DA 1VDZA 1ZKOA 3VR3A 4DNRB 1BDOA 2LMCB 3IKJA 5KNDA 1IYUA 1EWHA 2L5TA 2EJMA 3BG3A 4PV1C 2E76C 3VR5A 3VR4A 3N6RA 2A69D 1Q90A 3VR6A 4KKUA 3GD7A 4BA2I 3QG1A 1FYCA 1OXXK 3GQBA 4IFDH 3L7ZC 4DK1A 2R6GA 3T56B 4LJZC 2EDGA 3ND9A 5C0XH 3EQLC 1GUOA 1E2WA 4G7OC 3FMCA 1K8MA 5K36H 3T53B 1OXSC 3BDOA 4KHZA 5KNBA 1VF7A 2A6ED 2A68C 1Y8OB 3KLRA 2PPBC 3HGBA 2CW0C 4XIGS 1H9KA 3W3AA 4XTCS 2JEAI 3PUWA 3D31A 4H44C 4TQUS 1B9MA 1OXTA 2IT1A 4G7HC 5K36G 1FR3A 4BA1I 2D62A 3I72A 1O78A 1LACA 2Q8IB 2A6HC 1OXVA 4H0LC 1Y8NB 2YYZA 1HTPA 2DN8A 3ND8A 4TKOB 1IW7D 3SE0A 2A69C 1QJOA 3LNNA 1YNNC 4JBWA 1V8QA 2BA0A 3QJYA 2AUJD 2EVBA 1VF5C 2BE5C 4JK1C 3OOCA 3H94A 3T51B 1CTMA 2B8GA 3AB9A 2NN6I 4DNTB 1GHJA 1TKWB 3PV0A 3VA7A
chains in the Genus database with same CATH superfamily
1HA3A 1V1QA 1EFTA 3DM1A 4A93G 5HXBA 1BCPB 4QJFA 4HIMA 3W1BA 2O5IC 2XZPA 1L1OC 1QUEA 1JB7A 1K3BC 3FJOA 3OKXA 3MAQA 2ZXPA 1W34A 3A55A 5H5JA 4K0KQ 2RCNA 3BH4A 1YJNB 1TVXA 3PUXA 4LK1C 2ENBA 2DY8A 1H9SA 4IUQA 4V0BA 4A3LG 3CMMA 3T1HL 3D6WA 1GO3E 4PC7A 1HCZA 3GVLA 4X65Q 4GOPB 1BF4A 3EN2A 2VUMG 3QO2A 4XORA 3I4LA 4A3MG 2VYQA 4N8FA 1Q81D 2DYIA 1EY0A 4DR5Q 5DS0A 4G57A 5BN5A 3G4SA 4JMQA 4WWVA 2CQAA 1YNJC 3PIP3 1FD7D 3HOYH 2Q6LA 1U4MA 3ZUGA 1X6OA 5CC4A 3CC2A 3AFQA 4QIWE 2PW7A 2QW7A 1XNQQ 2UUAQ 4OL7A 2YWFA 1F2ZA 1PRTC 4RDKA 2CC2A 4EX5A 1Q7YD 3JQQA 2XNJA 5GAGC 1JWSD 3M7GA 5IK2A 1Q8KA 4X3UA 3LQEA 3UDXA 2KVMA 2BVNA 4A3KG 2Q2HA 4NXMQ 3CRLC 3KLWA 4A3MH 1K0RA 2HMAA 3CW2C 4GNXB 1A0IA 1VQLA 4L8JA 1QWYA 4KJOA 4RGOS 1VQHA 2E75C 1V43A 2NVXB 1I94L 4X62Q 4B48A 4N9TA 1IBLL 3IKJA 1JMCA 4LBYA 4RD4A 3KDFA 4PV1C 4GLVB 5J3BA 2PZWA 2Z6BD 2ZTDA 3BVGA 4JBJA 4DR2L 5IGDA 2C77A 3Q6RA 1COWA 1ZYRD 2L12A 3Q6SA 4IFDH 1CKMA 3E1YE 1GVPA 3HKZG 3D8GA 1WTOA 4YCVA 1SYFA 4Z4TA 4HSVA 3C46A 4BS9A 1MIUA 2MGSA 4WZTA 3K7UC 1XNRL 2F0LA 2CK3A 1TT2A 2F4NA 1DYQA 2AWNA 3I1FA 1P4MA 4HJAA 4LF8Q 1HUNA 3ASTA 3TP8A 1OB5A 1RTNA 5A89A 3MMPA 1Y1VH 5A2QL 3CC4A 1PYWD 5DSZA 2DN8A 4X3TA 3SE0A 1RHPA 2K75A 5FO1A 2F0EA 1LM0A 1Q82C 1EIFA 1W6JA 5KSWB 2LY7A 2VS1A 4LF8L 2WZNA 3QR8A 3CPFA 2E2HH 4O42A 4HE5A 5M5YH 2JA8G 1W6KA 1GUNA 1PRTB 4CKEA 1EL0A 2Z0SA 3S14B 1Z6HA 2G9DA 5FLMH 3L2PA 2Q2UA 2L1BA 2GJKA 2VBTA 1JB3A 3WBKA 3UDFA 4M8AA 3PA1A 1CA6A 4ROXA 4BY1B 3GTLH 2JA6B 2OTJA 1YHAA 2YU9B 2CF4A 2PO4A 3SEBA 1VQ8A 1BOSA 2K5WA 2VJIA 1VQBA 4KMUC 5H1SE 1PFBA 1JNYA 4HEDA 3H09A 2L9HA 3QFRA 2MFIA 4IPCA 3GDEA 1LABA 1Y69U 4ZK9B 2B63H 1YNND 2K52A 3M7NA 2WINB 1CNFA 1T6YA 3CCQA 5FNZA 4B9XA 2EY2A 1QGAA 1MRZA 4X66L 4P1VA 1SNQA 4JV5Q 3U58A 1PMRA 2NZHA 2F1MA 2H4OA 5M5YB 4WJ4A 1KK1A 5GV7A 2EQSA 2BH2A 3A8KE 3AU7A 1NMGA 3H9NA 1EUJA 2R93H 1ZYRC 3PO2H 1E7ZA 4UHVA 2BMWA 5IYRA 1NTGA 4CDFC 1HH2P 5BN3A 5LL6X 5IT9c 4IALA 1SROA 3S1MH 4X7DA 3P20A 1WI5A 4DR2Q 1EXMA 3W2HA 3KYHC 2F3VA 1SYGA 1CZGA 3GV6A 3KUPA 3W2IA 1NSNS 2B2TC 4GKKL 4H02A 1E3ZA 4ALPA 4X62L 2K50A 4DXGA 1SE3A 4PC3A 4A3KB 2B2UC 1CHPD 3CC4B 1PRTF 1BX0A 1HNZQ 4DR3Q 4XQJA 3OWEB 1STEA 5J22A 2LMCB 5FIUA 1F20A 4RDJA 2O2LD 1YHQA 1PH7A 2Y0SE 5IGCA 1F2MA 1E1QA 1Q9SA 4NXML 2LXJA 5E1FA 5JBQA 1A8PA 1DJRD 3PUMA 4NCNA 1VQGA 2R6GA 4DV7L 4DAMA 3OJWA 3AVUA 2IPKD 3TP6A 5C0XH 1K83B 3TRZA 1EIYB 4G7OC 1WCMG 4JBMA 3U9OA 1JB9A 1VF7A 4BWGB 3R2TA 3HOYG 1LYLA 2KECA 1D5MC 5FO8B 1QG7A 5H59A 4A3DB 4XTCS 1PA6A 4LMQD 1B9MA 1CKOA 3IL8A 3Q3AA 5EMNA 2JA8H 2R7ZG 2C5HA 2AQ3B 4WJWA 1E63A 2C5BA 1N0UA 3RMHA 3PIOA 3HOZH 4HMJA 5FLXL 1UNSA 5ELOA 3ICEA 4CDEC 1SR3A 2LS01 3D4DA 5ELBA 1WTRA 3LNNA 1JJGA 3T1HQ 1YEZA 4N3GA 3VO1A 1A3TA 1E24A 5JJLA 3AB9A 4JV5L 3EIVA 1X3QA 1WOCA 3CCJA 1ZM9A 2D9UA 1Q3LA 1Y0RA 4R4TA 4JI6Q 2XOKA 1EYAA 3MEHA 1NBWA 5CDFA 2E2DC 4P6VF 2ZBVA 2LFNA 5J39A 1V9PA 1GUGA 2RDHA 1EQTA 1QG0A 2VL6A 5CV6A 1MHWC 4LF4Q 3OIPA 2Y0SB 2R7ZH 1X9NA 1GUWA 4F87A 4X06A 2XWBB 2XZLA 2OTLB 1M1KC 1H8HA 3I4MG 4O2DA 1WOPA 4WZKA 4JYAL 4CKCA 1EP1B 3FDTA 5T1IA 1IZ6A 3JAMi 3PO2G 4MHEA 2YWGA 2WZPP 1JQYD 1ET9A 3FP9A 3Q23A 1A62A 4X66Q 3F8TA 4O0AA 5FLXc 2CVRA 5JJIA 1S72B 1SMYC 5FA6A 3LWEA 4XKWA 4IURA 4A3JG 2NTSA 1Y1WB 1B8AA 3DWPA 4DN4M 3T1YQ 1PYSB 1CZWA 3BCDA 3F2DA 3DDYA 1B9NA 3PSIA 4E6IA 5AN9A 1R4QB 3IFTA 2N55A 4FXKC 1VCIA 4R9WA 2N78A 4OELB 4POFA 2B2UA 3H0GH 3A7AB 4H13C 3SK6A 2OTJB 1LT5D 2ZJPA 4KN4C 1PFSA 3DM3A 3HS0C 3M4YA 1RQRA 3E0EA 2ICIA 1NJID 1YZ6A 2IW3A 3ULPA 3K58A 5DLQE 3PA2A 3SDZA 1Z47A 2KBNA 2ES2A 3BZDB 5B6IA 4G7ZC 3GVKA 4IFDJ 4BBRB 5KNCA 3A8IA 4A3MB 2JJ2A 3W2GA 4DQLA 2QCPX 1KIXA 4B4DA 1S4ZA 3BYTB 1KHIA 2HUGA 4NW2A 4DUZQ 1B2RA 2ZL6A 3M3YB 3DWAA 1EWHA 4P71A 5EBDA 2PE3A 4RHSA 4UPAA 3GSIA 3L7ZC 5IYPA 1GXDC 3BDCA 1TWAB 1IB0A 1D8LA 4TVAB 3EQLC 4X05A 1IBLQ 5K36H 3ERSX 1KRHA 2F0HA 3HOVH 1I94Q 2CWAA 4P2CB 3W5UA 2WP8J 3ZYYX 3P27A 2NZ1D 4ZV4A 1ZUNB 4QUFA 1PH9A 4BY7H 1FNMA 1EOTA 3BY1A 2K28A 5IIFA 3I56A 1VQ7A 2R93G 4X0CA 5JPMC 1E43A 2F4IA 1ML0D 2EYLA 1JJCB 3KFUA 3ZZTA 4A3DG 1PFNA 3I91A 1YHBA 4DV4Q 4FF2A 4P3IA 2R7ZB 1Q7YC 1L1OA 3RZDB 3BQJA 5KW9A 1PLFA 5ELNA 1IXRA 1VF5C 1XXGA 1B70B 3OOCA 1CTMA 1GVHA 3T51B 3BZKA 3G6JB 1UD5A 1TKWB 4G1VA 4Q5VA 1K73C 3DXJC 3C2PA 1RL2A 1K28A 1WORA 3AVXA 3AVWA 3W5OA 3MXPA 5M5WH 2O5JC 2QEXA 3HOUG 1W35A 5LMNQ 4MYTA 4QVJA 1XX8A 2SEBD 3F1ZA 2VQFQ 1NCVA 1X3EA 4UZFA 4XQQA 3WWVA 4YAWA 5C0XG 4ASUA 1KD1C 1M90C 1KRTA 1HQMC 2K7VA 1O7ZA 1RQPA 4HIOA 5DN6A 1X3PA 1H42A 1C0AA 2EIFA 2ZXHA 2MHVA 3CPXA 5DM73 2DNCA 3NENA 1KAWA 4R1JA 2NN6H 3MVVA 2QF7A 3NBHA 4A93H 2E74C 2JYOA 1Q1EA 3ULLA 5I2XA 3CKIB 1U2RA 2WPDA 3EVQA 2PQAA 4XNFA 3DHQA 3J7AV 1LT6D 2K14A 4QIWB 1XJVA 1X54A 2CNDA 1AE3A 4A3IG 2HDMA 1VMCA 1CT1D 4X65L 1PH6A 3GVJA 3CCRB 4DV0L 1C7YA 2C5CA 1AEXA 5M9OA 4KHPL 3OEEA 1K28D 5I9PA 2ZJQA 2B63G 2Q6KA 4XT1B 1GKHA 5C4XG 2J7ZA 2ZTEA 4R8NA 3SLDA 1I4XA 2JDIA 4FXGC 2BE5D 1UD4A 4N3NA 1AP0A 3ISXA 4RD2A 1OB2A 3RY8A 4K5XA 2G9HD 1VQ5A 1KXLA 1WTWA 4X7FA 4YHHQ 2Q2IA 5C0XJ 1U4PA 1II3A 1JWMD 1E62A 3M9BA 4PG3A 1K8OA 2Q6OA 5KNDA 4AVZA 2KCNA 2EPBA 3URYA 3I8ZA 3S15B 1E1OA 3FKIG 1Q90A 1BMFA 4KKUA 2HD3A 4RKLA 5I4DA 2Z6KC 5DEHA 2UXCQ 3GTPB 4MIUA 4LFAQ 2ICEC 5K5PA 4A3CG 5C4XH 2DY7A 4Y7NH 4QMGA 4BY7B 3QOJA 4ZRZA 4LF5L 2PNHA 3SK5A 4A3JH 3WNBA 2PI2A 4HN7A 3HOUH 1L0YB 2Z1CA 4U673 2N88A 2BDNA 4XOPA 4JI4L 1QVFA 5TRDA 1C4QA 1E3PA 5ELFA 2PMDA 1PJ5A 2VXWA 3R93A 5EKKA 5C4HA 4KTAA 1JJ2A 5D65A 3I72A 2OYNA 1RJTA 1SNPA 2NYZD 4K2LA 3CCEA 4DR1Q 1PV4A 1SNCA 4LUOA 1GAQA 1YJ9B 1YJNA 3M4OB 4V190 2VB2X 4FO2A 5I6WA 1QJOA 4AH6A 2VNHA 1VQEA 3BJUA 4JK1C 3NTHA 2R92B 4ZGQB 3E0JA 4J0QA 2X53S 2JA7B 1YBYA 3S15H 4B43A 2KCMA 1AIPA 3KL9A 1G7TA 4C3JB 2V7WA 2F0FA 2YTVA 5F2DA 1D8TA 5T1GA 4HJ7A 1PH4A 1N36Q 3GTKH 1VMPA 4C1NK 4XD7A 1DM0B 5IT9E 4QUZA 1EY5A 4AYBB 3JAML 1WDTA 3JQRA 4MN3A 2OQKA 2F0NA 3CRKC 3OZVA 2V31A 3KEWA 3GTOH 3RN5A 1N33Q 2AWOA 5IGEA 1VQ4A 3AVVA 1VQ9A 3ZIAA 1FNBA 4RJLA 3WOEA 5LMUQ 2RA4A 5CBAE 1ZM2A 3GIRA 2A6EC 4A3EB 1ZM4A 3CTAA 3SEJA 1K8GA 3LQ6A 4DR1L 4RMFA 4CJ2C 2ZXOA 2Z6KA 1I3QH 3T1YL 3CCLB 4Y9RA 2EYHA 3D4WA 3BVMA 2MUYA 1WTHA 2E5LL 2IX0A 3Q22A 1TY0A 1VQ4B 3E3XA 3T13A 1TY2A 4ME3A 5IGFA 4IFDI 2OBTA 4X6AH 2GK7A 1IBMQ 4J6HA 3VDYA 4YELA 4Z4RA 1J9OA 3FVQA 1U0LA 1N32Q 5IGBA 1C48A 2FMMA 1A15A 1EWCA 2CQOA 3J81E 2QGQA 3SKBA 4JI5L 4RPBA 4HJ9A 5CV8A 1AMOA 1XMQL 1MGSA 2XWJB 2KUMA 3U6KA 4A3EH 1A3VA 3ND9A 1GR1A 2AKWB 4B3RL 3NXWA 4DV1Q 2N3SA 4L63B 5D14A 4XN0A 2QKIC 5F4MA 1M8AA 1XQBA 3JC66 3HGBA 4QFMA 4P74A 1H85A 3I3CA 4G5GA 3CCSA 4DV2L 4PZ8A 4UAIA 4G7HC 3HOZG 1E79A 1VQMB 3OMCA 3W5VA 3KDFB 2NVYB 4RPDA 1WTHD 5CV5A 5HURA 1ENFA 2GN5A 1BX1A 4DFAA 1WD1A 4DAYB 4N9PA 3STBD 3QB3A 2UUCQ 1SYDA 2AUJD 4YCWA 2BE5C 2B2VC 3K0XA 3TDQA 4APVA 1MJEA 1A63A 1SFOH 1VJSA 2QA4A 3QE2A 3B82A 5A8AA 5D3DA 1NY4A 2PCFB 4HTHA 1Z7TA 1M1KD 3G6EB 1QE6A 3HOVG 3V76A 4HCSA 3FKIH 3AQQA 3TBIB 3AYHB 5LMNL 3C1EA 5AJ3Q 3MHBA 4EQNA 1HNZL 1KL9A 3HRZC 1N06A 2P5ZX 2NTTA 3H3VH 1NR2A 1PZID 4LFCL 3S2HB 1JE5A 1MSHA 1UUPA 1UWVA 1A2TA 1EZ8A 2B3GA 2F0WA 2RHSB 4JOIC 2NWGA 2BV3A 4KJNA 5GAHC 2PLFA 2CBXA 1I3QB 2BM1A 2JJ1A 5HZBA 4Y7NB 1DD2A 3CB4A 1S3OA 1EWYA 3ZC3A 4DV4L 1B50A 1STGA 2ZM6Q 4LFBQ 3P7JA 2QE7A 1LTBD 4A3FG 1TU2B 2RC5A 2EYMA 3GP7A 3AGQA 2GK6A 1SSOA 4P26A 1PTOH 3M85A 3NBIA 3A35A 3WOFA 1MKHA 1CFMA 3KJPA 5D3IB 3ITPA 5C4JH 3TZUA 1NBMA 3KK7A 1GAWA 2EOTA 1KNAA 1TWHH 2JQOA 2IHEA 3EBEA 1XMOQ 3RLFA 2OTLA 1QH0A 4P22A 5M5XB 4B3TL 2D9RA 1Y1VB 5JJKA 3W2EA 1PH8A 1XPOA 5A88A 3J7A5 1NUCA 4XLFA 2XVSA 1GJXA 3E9HA 4Z1MA 5M3FG 4OPVA 1SKYB 1XTCD 4HIKA 3S1RH 4LBZA 1CK1A 2JE6I 5IODA 2ZJRA 2D5DA 3RD4A 3DLLA 4JI8L 1L1OB 2VUMB 4MTKA 1VLYA 3FHWA 4WZLA 2F0GA 2A69D 3S1NH 2K03A 1C8CA 3CCEB 2CW0D 3SHLA 2UXBL 1JOQA 2X0KA 1BCPF 4LJZC 4ME5A 5C44H 2K5VA 2NVTB 3ZJYC 3FMCA 2FJ2A 3T53B 2HCCA 4XLHA 1Y8OB 1VQOA 1X56A 1VQIA 1A2UA 4CJ0B 3BVZA 2HHHL 5ELEA 4YALA 4LNQA 2RF4A 2UXDL 2ZL7A 1J5EQ 2L11A 2CH4W 1LTAD 1YITB 2Q8IB 1L2FA 1OXVA 1NB9A 1K8AD 3CCMB 1VS0A 3ND8A 5JPNC 1NDHA 2BGIA 3NTIA 4X64Q 3J81L 1HQRD 1YNNC 4NPSA 4RGNA 5GQOA 1XNRQ 2B8GA 3H94A 4K6LA 4IN3A 5LL6S 4DF7A 2ID0A 4JW0A 1NJIC 1Y14B 4UAJA 2A1AA 3KF6A 4PGOA 4HJ5A 4DKAC 4BY7G 2D0OA 2NVTH 3HOWG 3BCFA 2HIVA 4LBVA 2W6IA 2R6HA 3Q0AA 2D0PA 1KC8D 2NUCA 3VYUA 4KK7A 3K5OA 4LF4L 5M3MG 3UI2A 5A35A 2LKVA 1WTQA 2IX1A 3OYYA 1HR0Q 4JI1Q 1N8RC 4OO1H 4OOXA 4HMIA 3A8JA 3PF4A 1ASYA 2MNAA 3BNWA 2EJGC 2NB0A 1FGBD 1H9JA 1K73D 4ZAIA 3OJXA 2JK8A 1SJHD 4JVZA 3S16B 1ESRA 2A6HD 2RBMA 4BXXH 1CUKA 5IYNA 4F88A 1XTDA 3K80C 5M3MH 4C3HG 1B53A 4HSPA 3U4ZA 5KYLA 2BM0A 2KEDA 1I7PA 1W87A 1DG1G 4BBSG 1JE4A 1F2LA 4XONA 1KABA 3KLSA 4RCOA 4JI7Q 1WCMH 1WFQA 2K32A 2WKDA 2D3NA 4WORA 2ZZFA 1EYGA 4DV7Q 4A3JB 3WNCA 1CQVA 3I73A 5KYIA 4NXNQ 2NN6G 4RAUC 4JI3L 2RCFA 4JBKA 1I50H 2OCEA 2BCOA 4UZUA 3V7AA 2N8NA 3SVMA 4B3FX 4OOSA 4K0KL 3J81k 3CCUA 4XMYA 4PABA 3NK9A 3GTGB 1LO5D 2E76C 4LUZA 1IL2A 1TWFB 2Z4HA 3A5UA 4IJHA 4B47A 3IAYA 1JOOA 1G8ZD 2E2IB 3LVBA 5C44B 1BLIA 3VO2A 2F0PA 4RWSC 3OWFA 3LX0A 4YY3L 1N08A 3BC9A 4P12A 2Z4IA 1UE5A 2K01A 2E1RA 1PJ6A 2SOBA 5BSXA 4R4OA 1N8RD 3S2DB 1UAPA 4A3FH 4L6TB 2RDFA 4YWLA 3I4NB 4Q0FA 4LF9L 3W3AA 2N49A 2K4KA 3GTKB 2F4VL 1UD2A 1OXTA 1AN8A 1W2BA 3CC7A 1KC8C 2P3MA 3R6KA 1YI2B 1PTOC 3GV3A 2XNDA 1KNEA 4C3IG 5FL7A 4UZEA 5BR8L 1QVGA 3S1QB 2FX3A 1OTCA 1K9MC 2JA5B 3BDLA 1FX0A 3NPPA 5GROA 2WIIB 4DV6L 4A3EG 2YWHA 3J7AF 2HCJB 1QB5D 1YHQB 3SXHA 1Q81C 2ASBA 1I6HH 1HTLD 2K5NA 5EAYA 3K5MA 1HFNA 1BPLA 2E2IH 1EP2B 4ZCLA 3ZZUA 1SAPA 3G71B 2DJGC 4PQXA 2F0MA 4JI1L 2ALYB 1G7CA 1TWGB 3QIAA 1K8AC 2PIAA 1WSRA 1TXYA 1HXYD 1KDBA 3NQIA 2OWOA 1MJCA 4LF7L 2I07B 4XM3A 1VQPA 1HPCA 1LT4D 2VBSA 1HNWQ 5FO0A 4DK3C 3NWTA 4XT3B 1CKNB 2WAQG 3K7AH 1N34Q 3C3LA 2WB1G 2FXQA 3A1PA 2PNRC 3D3RA 1BBUA 3H0GG 4A3IB 3OW7A 3A0JA 1F60A 3TMEA 5GADC 3O13A 3G71A 1NAPA 5M3MB 1IYVA 3A7LA 2QDBA 2I5LX 3DUZA 3CP2A 3HP3A 3QOLA 4KY7A 3FRPB 4DK0A 1HZCA 3ONAB 4RD3A 1K0SA 1S4MA 1SM4A 3SK8A 4E0FA 1KQSB 4FXUA 2VB3X 4DAVA 1WOOA 3PVDA 1BXTA 3BS1A 3S24A 3W1GA 2I5MX 5BN4A 4LF6Q 1D7QA 2UUBQ 4XR6A 3NSWA 2OBSA 4KN7C 1EWIA 3OHXC 1KD1D 3HOYB 2OXPA 4UDUC 4Y52H 4KKTA 2C4UA 4HE6A 1H9SB 5C3XA 1CQFA 2IJ0A 4IOCA 4XLCA 3WQZA 1R4PB 2EY5A 1OGIA 1EFCA 4EVOA 4DR4L 1EY6A 1SKQA 1DOKA 1UE1A 2B2WA 1STAA 3A8IE 5CORA 4A3GG 2OEOA 2C35B 1K9MD 2VW9A 1BCPD 1J6QA 1DONA 5C5MA 4C2MB 3VR3A 1PTOD 3RZDH 4MTNA 1BDOA 1S5CD 4JI8Q 2EJMA 2XNAC 3N6RA 3HOXH 2OT2A 4K14A 1N05A 3CD6A 2CCZA 1OXXK 1VQ6B 3CC2B 4DR7Q 5IP7H 3K6OA 1ZXTA 4P6YA 3NQTA 2NPFA 4BBRH 3AMUA 2QEXB 2A68C 2DCUA 3CCJB 2PPBC 1KTKA 4GLXA 2R92G 1EFRA 3D31A 1VQAA 3NHHA 1IBKQ 2QN6A 4A4IA 4A76A 1HNXQ 5ELCA 2PZTA 2AHOB 1U4LA 3ASSA 2A6HC 1V1PA 1KTVA 1D1IA 3HKSA 1PYBA 2CFMA 2XNCA 5CGKA 4DR5L 3U2QA 1LT3D 1L0WA 3I7FA 4GOPA 2R7FA 3K7AB 2QILA 5GV8A 4B08A 4LFCQ 4B9WA 4YCUA 1MBYA 5CR3A 3FEWX 4II3A 3NELA 5JOBA 1EYDA 1PRTD 1VQKB 4A3KH 5AJ3L 1YNXA 1QZHA 1CI3M 3K5NA 2JXMB 4L5SA 2HIXA 2E2HB 4IQZA 2L4NA 4G4KA 2X6GA 4TMZA 1PDQA 4J15A 3OPOA 3MFYA 1Q8IA 1AE2A 1QOHA 5E4WC 3MC0B 5IY0A 3W2FA 1R9TH 4XQFA 2WAQB 1P8LA 4J1MA 2KJXA 4ABNA 5G3LF 1G7RA 4UY8C 4AF6A 1I4PA 2VQEQ 4JI2L 2CH4A 4PZ7A 3AFPA 4AYBG 1DCZA 4XOTA 2OBRA 1HJPA 5JEAH 4QY7A 2EYJA 5FO9B 4DV2Q 1QGYA 5IT9L 2JN9A 4QGUA 2GVAA 4QQBX 4TMWA 5IYCH 1UD8A 4TT3A 1VQ8B 2W6JA 3OP1A 1VQ9B 3M4OH 4DGZA 3W5HA 3ONUA 1EY7A 1XWEA 2WYRA 1QVFB 1V0EA 4OO1G 3T4AC 2V7XA 5IP7G 4II2A 4P72A 1SMXA 4LW1A 3M3YH 4A3LH 1T5EA 1YITA 3F2UA 2DJFC 3NE5B 1FL0A 1OXUA 1TWCH 3CP8A 4C3IH 4IO9A 4AQYL 3VR5A 4RDLA 3MXNA 1WCMB 1XPUA 1E3XA 3SJZA 3OSOA 3RLNA 2GREA 1PH5A 2AQ2B 1UE7A 4ODGA 1UD3A 4KY5A 1S40A 5C4ZA 3G7LA 3KF8A 4DV3L 5L37A 5CV7A 4GKJL 1GUOA 5IP9G 1I4HA 1BVSA 2D3LA 5GAEC 3CCRA 1SN8A 4KHZA 4TSSA 1NRKA 3WYAA 2MO0A 1ICWA 4WJ3M 2F0TA 2QA4B 2CW0C 4XIGS 4QF4A 3PUWA 1K83H 4RD0A 3CCUB 1EY8A 2NV4A 1I8DA 1BR9A 3OIQA 1J5EL 1PTOF 4JI0L 4PZ6A 1RKNA 1EU4A 4H0LC 4U68A 2L0CA 1CNEA 4OXPA 3K0YA 2NVYH 1H8EA 4QVAA 1JA0A 5FK9C 2GQFA 3QJYA 2EVBA 4CDDC 2FFKB 2WFWA 2WJVA 3ERQA 2XRSD 4P3YA 4XXEA 1S72A 5FO7B 3TS2A 1N33L 4K2KA 3HOZB 4CKBA 3CMEA 4PC1A 5I2YA 1FDRA 1EFID 2UXBQ 2KHJA 4KHVA 1N9WA 3DWQA 3HEJA 4AC9A 3I56B 1VQ7B 1YVCA 2BDOA 2I0QA 2GA4B 3ASPA 3HOXG 1ILPA 1TWAH 1VQOB 4ZUIA 1WTXA 1KQSA 4DV3Q 1B2TA 1GHKA 2HDLA 2VNUD 3PO2B 1Z9FA 4OWWB 1VQNB 4OX9Q 4M53A 1I4GA 2F52A 4XLAA 4RH6A 4XN3A 1LTSD 1VQCA 3VMFA 4DV5Q 2VNIA 4IUPA 1FNCA 3OEHA 1Y1WG 2VZLA 1ESFA 1HA6A 3NEMA 4IPDA 1G6PA 1JR0D 3MEFA 2F3IA 4CQJA 1DOMA 4A3IH 1SNOA 3S9WA 2ZTNA 4DR6L 3B78A 5KNLA 4I7AA 1VQNA 1G91A 2ZM6L 4LFBL 3L0OA 2K1BA 1YJWA 2YU9H 1YIJB 3A8KA 1SDFA 1QILA 2F0DA 2R9VA 1BKBA 3VYTA 1E1RA 4CJ1B 3OTOL 4FF1A 3PO3B 1VQJA 4M1KA 3X3MA 3HFZB 3FKSA 1LTLA 1TWHB 1EFUA 2KCCA 5CV9A 3S1RB 3R8BA 4F7XA 1FRNA 1D5ZC 1MD2D 3ZZ0A 1Q86D 5ELDA 5E7NA 1NE3A 1Q1BA 1W2BB 4A3FB 4ZCIA 3ASQA 3G48A 3I4NH 2UXCL 5JVG3 3SLNA 2PQAB 1IKMA 4L5TA 2ZZEA 4BXXG 5JEAJ 1XE1A 1TVCA 4F8MA 2IL8A 2JA5H 3V05A 3GD7A 2WSSA 1QNKA 1HUMA 4WQMA 1EEFD 3W2DA 1YX2A 1HR0W 4NMZA 3EJIA 4C43A 1X32A 4MYUA 1K8MA 2R93B 1RDPD 3BDOA 2MQHA 3KLRA 4LWCA 2JP1A 3I4MH 1HZ9A 4AF7A 4H44C 2WACA 2X69A 5FLXE 1EEID 2B2VA 1IKLA 1W9XA 2LSSA 2HDNB 5CBEE 3MXGA 2VY3A 2RQXA 3CPWB 4ILWA 4RHRA 4CGYB 3M4PA 4Q7JB 1FRQA 3NP8A 1Y1WH 3CCVA 5I9OA 4DV1L 4DNTB 1TLLA 3ZPNA 3PV0A 3X3NA 1HHVA 2Q2TA 1EY4A 2B7BA 3M4QA 3PUVA 4NKLA 3NUCA 2QGGA 4EQ5A 4F7DA 5EJWA 2UU9L 1PZJD 4ACBA 4B3GA 4PMWA 1G291 3TEHB 4XQNA 4JI5Q 4GZYC 4DV5L 3MTSA 1WJJA 4RM0A 1RODA 4A3GB 4DR7L 3OAAA 1N32L 1EY9A 2Z9HA 1J9ZA 1QFJA 3AVTA 5DAUA 1CM9A 2SNSA 3J80c 2XN9C 1E22A 1ZEQX 2CKZB 1VQ5B 2WB1E 3T16A 4PC6A 4K5VA 4GS3A 2E5LQ 1QFZA 2KEEA 3CESA 2TSSA 1IBKL 3CAMA 4BBSB 4C3HH 2XSCA 1KLGD 1OGJA 1XFOA 2K5HA 5C3WA 3MXUA 3CMEB 3RN2A 4PAAA 4A3BH 2R3ZA 3A5ZB 2CW5A 4A93B 1SYCA 2B2TA 1GUSA 1A6XA 1IW7C 3ZBTA 1ENAA 1SYEA 3MXNB 2UUBL 3B8HA 4JI0Q 4ZKCB 4B3SL 4OX9L 2OK7A 4ZCMA 4Z4WA 3TREA 3HOWH 2DGYA 2VNKA 3CMAB 1BCPC 2CWPA 5J35A 1X3GA 4DQKA 5M3FH 3GTMB 4ULLA 2EYFA 2F0JA 4TN1A 1E0BA 3DMUA 3OFNA 2SNMA 2XIWA 1STBA 2GJRA 4GKJQ 3OMGA 4C3HB 5E6TA 2IX3A 1VQMA 4B44A 4GN5A 3Q38A 1YLOA 1JCKB 1SMYD 1XPRA 4GOPC 3TZDA 3I55A 2I46A 3VNVA 1LTGD 2A73B 2HCIA 3H6MA 4A3BB 3T56B 4Z4ZA 3I2ZA 4RA8A 3SGIA 1EIGA 1PXUA 3GTOB 4OEMB 3ONYA 1HNWL 1GJRA 2EDGA 5M5WB 5J1ZA 3MCAA 1VQLB 1FNWA 1O7IA 2HQEA 1JA1A 1EYCA 2B2YC 5M5XH 4IZ8A 5EKIA 2YWEA 1M4VA 4TQUS 2M2LA 2QTLA 3J7YW 1FR3A 1GOZA 3G6EA 4EQPA 1Y0YA 2J4XA 2CRVA 2X85A 1MSGA 1SJED 2ZTCA 2XGTA 3IFDA 3UDIA 5HZAA 1I4QA 4FF3A 2DIEA 1LACA 3I55B 3S1NB 1LTRD 4QV2A 3R2IA 4TSFA 5KEEA 5AFWA 3S1QH 2F0OA 1WYDA 3PIO3 2DERA 5I6YA 3U6BA 4JG2A 1PHJA 3S1MB 3G4SB 3NWSA 1IJFA 1NB0A 5TR9A 5EPJA 4AQYQ 2WJYA 5NUCA 3UE1A 2WR8A 5ISRA 2F4VQ 2F43A 5IYDG 2XTIA 2BGJA 3ASRA 2FVGA 4LF9Q 1JWUD 4UP9A 1X55A 2R92H 4X3KA 1AFPA 2JA5G 1YI2A 2A19A 2Q8RE 4KD3A 4YY3Q 1PZKD 2RHQB 4K5WA 3FPPA 3QFCA 2EJFC 1QNUA 1HRJA 1UEAB 4DXFA 4YWMA 3K5LA 4BY1H 4I65A 3H91A 4GNXA 4ZLTF 3CPWA 1DDIA 4JI6L 3S14H 3I4MB 4NBSA 3P1HA 3E5SA 1I18A 3HKZB 4JPBW 4KI0A 2JA6H 1M90D 1PH1A 4IUVA 2PYKA 4JI2Q 2VQEL 1ENCA 1GUTA 3CP0A 5HGQA 5JVH3 1WOSA 1HVXA 1PVOA 1X65A 5TY0A 3PGZA 5IOCA 2F0SA 5F4OA 4RGTA 3UDGA 2B5OA 1SFOB 1EQRA 3KBGA 2L55A 2YTXA 4AYBE 3A3BA 4MZ9A 2Z8LA 3PO3H 4Y9UA 3OW2A 3MHPA 3I90A 4R4IA 2SDFA 1D5XC 4DPGA 2DOGA 4G7WA 5CMDA 5LMZA 1FNVA 4X3SA 2K33A 1S5BD 3ES9A 4JI3Q 1UMKA 4KKSA 5COYA 2VQFL 1JT8A 1ZKOA 2J0TD 1ICFB 4DNRB 4H9GA 1IHMA 4GQNA 4DR3L 1PH2A 3QWNA 4JI7L 3S17B 4RCZA 5F4JA 1KDCA 1UD6A 1S5ED 5BSYA 2JA9A 1FYCA 3GQBA 1S0UA 2NBFA 2VJJA 1SE2A 4GKKQ 1QUQA 2QDXA 2FINB 1TS2A 4POGA 1G51A 1NNXA 3HG9A 3S2HH 5IGGA 4PMCA 4QUCA 1FJGL 2EYPA 2H1EA 2KENA 5FOBB 1BQQT 3KJOA 2QTZA 4BPRA 3QFSA 1D6EC 4M0LA 4M1UB 4UP7A 1SYBA 1B44D 2GJPA 4YHBA 2EY1A 4BA1I 3GTQH 1VQKA 4XKVA 2RDGA 3A3GA 4G6IA 4QL5A 3RUZA 1O78A 4N8X1 2BF4A 4FDBA 4JC0A 1Y8NB 1ILQA 1HTPA 1WP6A 1QUQB 1R5BA 3N52A 1QZGA 3C2QA 3J80L 5FJ8G 2KVOA 5A2QE 2UXDQ 2WV6D 1N0VC 4A3DH 3CXCB 5M3FB 1Q82D 2HHHQ 3GTMH 1X3FA 2FHTA 1DOLA 4XL9A 1EP3B 1C9OA 4ZKBB 3F2CA 1DXMA 4YWKA 3BU2A 3ER0A 2ZBUA 1T6ZA 2CHBD 3HKZE 3JAME 2HT1A 4EH1A 3D4RA 1NMFA 1DARA 5HY6A 4YIJA 4Z4VA 1F9PA 3U9SA 1DDGA 2V7VA 1ONLA 1V1PB 3CCSB 3VYSA 4ACAA 1EOVA 1VHEA 1GM5A 4X7EA 1MABA 2AUKA 1N34L 2F03A 1BBWA 4JCVE 1LTTD 1RF2D 1U5KA 4YEJA 4HAEA 1E1TA 1WU8A 3BY2A 2RSOA 1G7SA 3K81C 1G2TA 4B3SQ 1EQVA 2DEUA 4A3GH 4U9UA 4M2LA 1WSVA 4R8IA 3CD6B 1KMHA 4DU9A 4C56C 3RNUA 1WD0A 4PC2A 1CHQD 2B2WC 2K6AA 2ZZQA 1PTOB 4AIMA 1KDAA 5KGUA 2JA7H 2F1LA 1W0KA 1HZBA 4P73A 1SXTA 3AVYA 3D6CA 5C6AA 2B8FA 3I4NG 1KK0A 4RFBA 2BH8A 4ZYSA 3H3VI 2A74C 1W3SA 4RCNA 3BYYB 3RZOH 1VLOA 3B6YA 2E1BA 3G05A 5IYQA 3PUZA 1FJGQ 3PCOB 4H7BA 5L46A 4GN4B 4JYAQ 1JJ2B 4C3IB 3JAMc 2F0VA 4RGMA 1IHZA 5C4XB 5EPLA 2EE1A 1B4OA 2PMZE 4KLKA 1QUFA 2WB1B 1YJ9A 3H0GB 2IWHA 2RSNA 2JN4A 4B3TQ 3CCVB 1QVCA 4RG1A 1YNJD 4QB4A 3VR6A 1VHOA 1SBBB 2GPJA 2V7TA 2UU9Q 2V1CC 2A8VA 2V7UA 1CSPA 4DV6Q 3S16H 2AQ1B 2X6YA 3U50C 1ELOA 3DEPA 3GO5A 1R5NA 5C3EB 1TUIA 5LMNW 1DGSA 4X07A 5IYDH 1SLJA 1H9KA 2HQLA 2JEAI 1WPCA 1SNMA 4IPGA 4EQOA 3PF5A 2B7CA 1XNQL 3A56A 3SR1A 4A3CH 4P25A 4RLZA 2OF1A 2M9VA 1B1ZA 2E8GA 4B3XA 2MP1A 3I70A 1D1KA 3PIPA 4ID6A 2F0UA 4TKOB 2X8KA 4BY1G 4R4QA 4OPOA 2DETA 1V8QA 3PENA 3D0FA 2ZXRA 3OZWA 4P75A 1SRUA 4OPSA 2IY5B 1T9HA 5CV4A 4IUNA 1GHJA 1O80A 3V2TA 2LXKA 1J8IA 4YAOA 1BJKA 3WBJA 4P2NA 1U4RA 2BOSA 3TP7A 4OO1I 4ZGNB 3NTKA 2OQ0A 4PNYA 1NR4A 2D2CC 3LWUA 1E2VA 1I50B 1TIID 2M00A 4NXNL 2RC6A 2JA7G 4B3RQ 3A54A 3V96A 1STYA 1FNDA 4QCLA 3E9IA 5JEAG 1ZM3A 4BBRG 2B29A 1UEBA 4L5QA 3VR2A 5TV2A 2B39A 3TSSA 1YIJA 3CMAA 1FNUA 5G3LD 3F2BA 2AHOA 3GTPH 5C5LA 1BBXC 1TQOA 5DNFA 2F0KA 2NVXH 1R5OA 3J80E 3PO3G 1I5FA 4Z9CB 3D26A 2L15A 5E4XA 2VNJA 4A3BG 1QX4A 1PKVA 1IBML 2ZL5A 2H5XA 2ZZGA 3ULJA 3MZ5A 4IUTA 2V4DA 3KF6B 4M4SA 3SK4A 2BN4A 4DR6Q 1H9RA 2KHIA 5FJ8H 1F9RA 1IYJB 3KF8B 4C1NI 5TSSA 1A3UA 2VZAA 4IFDG 2EYOA 3MA2B 1HR0L 1JC7A 3Q39A 4IJLA 2C2WA 4OIKA 5J3OA 3PQIA 4PMBA 3U4VA 2EXZA 4IW3B 2GVBA 1WVLA 2XGJA 3NBHB 5CYUA 1HZEA 4ZQ3A 1QVGB 2KHSA 3E6ZX 1I6VC 1BUVT 2OK8A 2EIXA 4Z4YA 4GN3B 3LO8A 4DAYA 3TN2A 3TQYA 1IYUA 2JIZA 4FYDA 1F2YA 3R6JA 3SJPA 4HIZA 1A8VA 4ZUJA 3OZUA 4CHTB 1XYIA 4BA2I 1D2EA 1F9QA 3KLSX 5KIXA 4X64L 1RIPA 4C3JH 2K05A 2MJ8A 4XYQA 5IYWA 1WTPA 1FGUA 1AW7A 1OXSC 1SNDA 5KRUA 5KNBA 2ATWA 1TR5A 4DNIA 2NVQB 2A6ED 2B63B 3GTLB 4XYOA 3GTJH 4TRDA 2MO1A 2E2JH 1PJ7A 4IOAA 2IT1A 1LTID 2D74A 1BO0A 2KCTA 4LUVA 2Q6IA 5LMUL 1V5VA 2JSOA 2EY6A 2EXDA 2FMCA 1XMOL 2AMCB 3ZBUA 3EROA 2PMZB 1QGZA 5IWAQ 4NB3A 5EBCA 3OE7A 3EA6A 2A69C 4OWXB 3AGPA 1KRSA 2K5DA 2LZJA 3MFGA 3E20A 5IYBH 2DY1A 1P16A 4FWTA 2XEXA 5JAVA 2F0QA 2PW5A 2VUMH 1Q12A 1KAAA 1R9TB 2NVQH 3RZOB 4OONA 2Z6BA 1H95A 3CQZB 3P26A 4LF5Q 4RKBA 4FP5D 1L0XB 4K8JA 3CF5A 5IP9H 4K1XA 4OP7A 4LFAL 1E2ZA 1KK3A 4B3ML 2X6WA 1EQQA 3CCMA 4FF4A 2F0IA 3HOVB 3FPUB 1RTOA 4CBVA 4K6DA 3CC7B 2JEBI 1B3QA 4J8QA 3A8JE 3WNDA 4A75A 5C4JB 1XB2A 2C78A 4DUYQ 1CA5A 4R71A 3GTGH 4TMXA 4XDXA 3CU7A 2X3UA 1QFYA 2ZTGA 3RLOA 4HR7B 2UUAL 1Y8PB 4YXWA 3J81j 3PMFA 3IRBA 4ZCKA 1IL8A 4I7ZC 2QMUA 2UUCL 4FXDA 4UP8A 1STHA 5C3EH 1TS4A 5IYCG 4C3JG 4G7XA 1HA5A 3JU4A 3WY9A 1GO2A 1N07A 1D1NA 1VQPB 1H9MA 2Q8TA 2JA8B 2F3WA 4WZEA 2KOLA 1F77A 4DAPA 1IJEA 3HZXA 4OOVA 3WDNA 1F9SA 4KD4A 4OHJA 2JA6G 4YHHL 2TMPA 3L9AX 3J81i 3K57A 1CQXA 3QSYA 3R3OA 4NNJA 4WFN3 3RR5A 3VYRA 2X6XA 2WAQE 1Y1VG 5HKKA 3LGJA 1HZAA 4G1BA 2L5TA 1EU3A 1AZPA 3JQPA 2YTYA 1EIHA 3STBC 4RD1A 3PUNA 3MWYW 1WTVA 4GLAC 1T5XD 5IE8A 3CXCA 2I1LA 1I4RA 3GTQB 3Q6QA 4C2MH 5EKLA 2EZVA 3H3VC 3WXMA 4NDXA 2KQ3A 3A74A 1EFWA 5FKAC 5C0XI 5IYBG 3HOXB 1GD7A 1PFMA 1STNA 2K5QA 3DEOA 4MNOA 2HLDA 4S3SA 1VQFA 2PI2E 2XZOA 3OTOQ 2DUDA 1OO9B 3Q24A 2R7DA 4BBSH 2D62A 2VBUA 4O1NA 4HIDA 3TS0A 3H15A 1HNXL 1FVIA 1T6XA 2MPMA 2VBVA 1BNZA 1V0FA 1IW7D 4TMVA 4DA2A 1XMQQ 4JBWA 4L5RC 4DUYL 2BA0A 2QDLA 1QCBD 1ET6A 2JJQA 1K3RA 5THXA 3BZCA 4QHYA 1W0JA 4NP5A 5DM63 2NN6I 1CSQA 4KV6A 3HAGA 1B23P 3K8AA 4Z4UA 2ZITA 2XRQD 3TP5A 4LBWA 1TWCB 1B7YB 3CCQB 1RCVD 4B3MQ 2BA1A 5C3EG 2C9OA 3VNUA 1SE8A 4FK8A 1UE6A 4K8IA 2BSAA 4TMTA 4X8IA 1DZ1A 1O7LA 4EGVA 3HOWB 4R4CA 1AZQA 1YJWB 5LHY1 1VQDA 4XLEA 2R61A 4RCYA 2A5HA 4OWTB 4DR4Q 3C1FA 4Y7CA 3FPKA 2PQEA 4DUZL 2DNEA 3UE0A 1TS3A 1ASZA 3HOUB 1TS5A 5IWAL 1OB0A 3CHBD 3J80i 3L3OC 3K59A 4CDCC 4LF6L 1I6HB 4P9SA 2IHFA 1AH9A 1LLRD 1RD9D 1TWGH 1V1OA 1CKNA 1OHHA 4C0SA 1KK2A 2KA7A 4LAAA 4OGQC 3QFTA 2C4TA 1O7YA 2O4XA 2A68D 1VQ6A 1G2SA 2B2YA 1PH3A 2ZT9C 3EFXD 1E64A 3AEVA 4LC0A 2Y0SG 3CRZA 1N36L 1G6ZA 3S17H 3Q8DA 4IPHA 4Z4SA 4YAUA 1SE4A 5EGTA 4X7CA 1B3AA 2EFGA 4DK6C 3CQZH 3PUYA 1LUZA 2V7QA 1VDZA 1TTTA 2RVLA 1HFGA 3BG3A 4FVMA 3VR4A 4HJ8A 1TWFH 5EQ0A 4LF7Q 3CW2A 5FLMG 3S2DH 1EZ6A 3J81c 3QG1A 1Q46A 3CCLA 4DK1A 3KOJA 2ZXIA 3OW2B 2BPOA 2WKCA 1E2WA 2X6LA 4FN5A 1BQEA 3J7ZC 1LV9A 2PZUA 2YV5A 5C44G 4RD6A 1U9RA 2M5SA 4JI4Q 5JJZA 5EPKA 5HGTA 2G5DA 5K36G 3FKIB 4IUUA 1Q86C 1JOKA 3KBXA 1D2BA 4YAFA 1KLUD 2J7KA 3P75A 4GNXC 4HCEA 5BR8Q 4KHPQ 2NZOA 4KY6A 1MI2A 4DV0Q 4OIJA 2YYZA 4JOIA 1SEBD 1JICA 1S5DD 1JORA 3VA5A 2RKSA 2QEJC 4FNFA 1KZLA 4WRDA 2E2JB 3I4OA 5E3FA 3GTJB 2K04A 1S5FD 3VA7A 2I5HA 1KJZA
chains in the Genus database with same CATH topology
3DM1A 1BCPB 2O5IC 2XZPA 3MAQA 2ZXPA 3A55A 3PUXA 3BH4A 1TVXA 4LK1C 2ENBA 2DY8A 1H9SA 4IUQA 4V0BA 3CMMA 3D6WA 1HCZA 3GVLA 1BF4A 3QO2A 4XORA 3I4LA 1EY0A 4G57A 5BN5A 4JMQA 2CQAA 1YNJC 3PIP3 1FD7D 1U4MA 5CC4A 2PW7A 4OL7A 1F2ZA 1PRTC 1JWSD 3M7GA 5IK2A 4X3UA 2KVMA 3CRLC 4L8JA 1QWYA 4KJOA 4RGOS 2E75C 1V43A 2NVXB 4N9TA 3IKJA 4PV1C 2PZWA 2Z6BD 3BVGA 5IGDA 1COWA 1ZYRD 2L12A 3Q6SA 4IFDH 3D8GA 1WTOA 1SYFA 4HSVA 3C46A 4BS9A 2MGSA 2F0LA 2CK3A 1TT2A 1DYQA 2AWNA 1HUNA 3TP8A 1RTNA 5A2QL 1PYWD 3SE0A 2DN8A 4X3TA 1RHPA 2F0EA 1W6JA 2LY7A 4O42A 4CKEA 1W6KA 1GUNA 1PRTB 1EL0A 3S14B 1Z6HA 2G9DA 2L1BA 2GJKA 1JB3A 4M8AA 1CA6A 4BY1B 2JA6B 2YU9B 2PO4A 3SEBA 1BOSA 2K5WA 2VJIA 4KMUC 1PFBA 4HEDA 3H09A 2L9HA 1LABA 1Y69U 4ZK9B 1YNND 3M7NA 2WINB 4B9XA 2EY2A 1SNQA 1PMRA 2F1MA 2H4OA 5M5YB 3A8KE 3AU7A 1ZYRC 5BN3A 5LL6X 4IALA 3P20A 2F3VA 1SYGA 1CZGA 3GV6A 3KUPA 1NSNS 2B2TC 1E3ZA 4DXGA 1SE3A 4A3KB 2B2UC 1CHPD 1PRTF 4XQJA 3OWEB 1STEA 5J22A 2LMCB 2O2LD 5IGCA 1F2MA 1E1QA 5E1FA 1DJRD 2R6GA 2IPKD 3TP6A 5C0XH 1K83B 4G7OC 3U9OA 1VF7A 4BWGB 3R2TA 2KECA 1D5MC 5FO8B 1QG7A 4A3DB 4XTCS 4LMQD 1B9MA 3IL8A 2AQ3B 4WJWA 3RMHA 4HMJA 5FLXL 1UNSA 2LS01 3D4DA 5ELBA 1WTRA 3LNNA 1A3TA 3AB9A 1X3QA 2D9UA 1Q3LA 2XOKA 1EYAA 3MEHA 5CDFA 2E2DC 5J39A 2LFNA 2RDHA 1GUGA 1EQTA 5CV6A 3OIPA 2Y0SB 1GUWA 4F87A 2XWBB 2XZLA 1H8HA 4CKCA 3FDTA 5T1IA 4MHEA 1JQYD 2WZPP 1ET9A 3Q23A 2CVRA 1SMYC 3LWEA 4XKWA 4IURA 2NTSA 1Y1WB 3DWPA 4DN4M 1CZWA 3BCDA 3DDYA 1B9NA 4E6IA 1R4QB 3IFTA 2N55A 4FXKC 1VCIA 4R9WA 2B2UA 3A7AB 4H13C 3SK6A 1LT5D 4KN4C 3HS0C 3M4YA 2ICIA 2IW3A 3K58A 3SDZA 1Z47A 3BZDB 4G7ZC 3GVKA 4IFDJ 4BBRB 5KNCA 4A3MB 2JJ2A 2QCPX 1S4ZA 3BYTB 2HUGA 4NW2A 3M3YB 3DWAA 1EWHA 5EBDA 4RHSA 3L7ZC 1GXDC 3BDCA 1TWAB 3EQLC 5K36H 2F0HA 4P2CB 2WP8J 3ZYYX 2NZ1D 4QUFA 1EOTA 5IIFA 2K28A 5JPMC 1E43A 2F4IA 1ML0D 2EYLA 1PFNA 3I91A 4FF2A 2R7ZB 3RZDB 1PLFA 1VF5C 3OOCA 3T51B 1XXGA 1CTMA 3G6JB 1UD5A 1TKWB 4Q5VA 3DXJC 3C2PA 3MXPA 2O5JC 2SEBD 1XX8A 1NCVA 4XQQA 5C0XG 4ASUA 1HQMC 2K7VA 1O7ZA 5DN6A 1X3PA 2MHVA 2ZXHA 5DM73 2DNCA 2NN6H 3MVVA 2QF7A 3NBHA 2E74C 2JYOA 1Q1EA 5I2XA 3CKIB 2WPDA 3EVQA 4XNFA 3DHQA 3J7AV 1LT6D 4QIWB 2HDMA 1VMCA 1CT1D 3GVJA 2C5CA 1AEXA 5M9OA 3OEEA 1K28D 5I9PA 4XT1B 2J7ZA 4R8NA 1I4XA 2JDIA 4FXGC 2BE5D 1UD4A 1AP0A 4K5XA 2G9HD 1WTWA 5C0XJ 1U4PA 1II3A 1JWMD 1K8OA 5KNDA 4AVZA 2KCNA 2EPBA 3URYA 3I8ZA 3S15B 1Q90A 1BMFA 4KKUA 4RKLA 5I4DA 5DEHA 3GTPB 4MIUA 2ICEC 5K5PA 2DY7A 4QMGA 4BY7B 3QOJA 4ZRZA 3SK5A 4HN7A 1L0YB 2Z1CA 4U673 2N88A 2BDNA 4XOPA 1C4QA 5ELFA 2VXWA 3R93A 5EKKA 5C4HA 4KTAA 5D65A 3I72A 1RJTA 1SNPA 2NYZD 4K2LA 1SNCA 3M4OB 4V190 2VB2X 4FO2A 5I6WA 1QJOA 4JK1C 3NTHA 2R92B 3E0JA 2X53S 2JA7B 4C3JB 2F0FA 5F2DA 5T1GA 1VMPA 4C1NK 4XD7A 1DM0B 5IT9E 1EY5A 4AYBB 3JAML 4MN3A 2F0NA 3CRKC 2V31A 3KEWA 2AWOA 5IGEA 3ZIAA 3WOEA 2RA4A 5CBAE 2A6EC 4A3EB 4CJ2C 2ZXOA 2EYHA 3D4WA 3BVMA 2MUYA 2IX0A 3Q22A 1TY0A 3T13A 1TY2A 5IGFA 4IFDI 2GK7A 4J6HA 4YELA 1J9OA 3FVQA 5IGBA 1C48A 2FMMA 1A15A 1EWCA 3J81E 5CV8A 1MGSA 2XWJB 2KUMA 1A3VA 3ND9A 3NXWA 4L63B 5D14A 4XN0A 2QKIC 1M8AA 3HGBA 3I3CA 4G7HC 4UAIA 1E79A 3OMCA 2NVYB 1WTHD 5CV5A 5HURA 1ENFA 4DFAA 1WD1A 4N9PA 3QB3A 1SYDA 2AUJD 2BE5C 2B2VC 3TDQA 1VJSA 5D3DA 4HTHA 2PCFB 1Z7TA 1QE6A 4HCSA 3TBIB 3C1EA 3MHBA 4EQNA 3HRZC 2NTTA 1NR2A 1PZID 3S2HB 1MSHA 1UUPA 1A2TA 1EZ8A 2F0WA 2NWGA 4KJNA 1I3QB 2JJ1A 1DD2A 4Y7NB 1B50A 1STGA 3P7JA 2QE7A 1LTBD 1TU2B 2EYMA 3GP7A 2GK6A 1SSOA 1PTOH 3M85A 3NBIA 3A35A 3WOFA 1CFMA 5D3IB 3ITPA 3TZUA 1NBMA 3KK7A 2EOTA 1KNAA 3RLFA 4P22A 5M5XB 1Y1VB 1NUCA 4XLFA 2XVSA 1GJXA 4Z1MA 1SKYB 1XTCD 1CK1A 2JE6I 5IODA 2D5DA 3RD4A 2VUMB 1VLYA 2F0GA 2A69D 2K03A 1C8CA 2CW0D 3SHLA 1JOQA 1BCPF 4LJZC 4ME5A 2NVTB 3FMCA 2FJ2A 3T53B 2HCCA 4XLHA 1Y8OB 1A2UA 4CJ0B 3BVZA 5ELEA 2L11A 1LTAD 2Q8IB 1OXVA 3ND8A 5JPNC 3NTIA 3J81L 1HQRD 1YNNC 4RGNA 2B8GA 3H94A 4K6LA 4IN3A 5LL6S 4DF7A 2ID0A 3BCFA 2W6IA 3Q0AA 2NUCA 3VYUA 4KK7A 3K5OA 3UI2A 5A35A 2LKVA 1WTQA 2IX1A 4OO1H 4HMIA 2EJGC 2NB0A 1FGBD 1H9JA 4ZAIA 1SJHD 3S16B 1ESRA 2A6HD 2RBMA 4F88A 4C3HG 1B53A 4HSPA 5KYLA 2KEDA 1JE4A 1F2LA 4XONA 1KABA 3KLSA 4RCOA 2K32A 2WKDA 2D3NA 4WORA 2ZZFA 4A3JB 1CQVA 3I73A 5KYIA 2NN6G 4RAUC 2BCOA 4UZUA 3SVMA 4B3FX 4XMYA 3NK9A 3GTGB 1LO5D 2E76C 1TWFB 2Z4HA 3IAYA 1JOOA 1G8ZD 2E2IB 5C44B 1BLIA 2F0PA 4RWSC 3OWFA 3LX0A 3BC9A 2Z4IA 2K01A 2SOBA 3S2DB 1UAPA 3I4NB 4L6TB 2RDFA 4Q0FA 3W3AA 3GTKB 1UD2A 1OXTA 1AN8A 3GV3A 4C3IG 1PTOC 3S1QB 2XNDA 1KNEA 5FL7A 2JA5B 3BDLA 1FX0A 3NPPA 2WIIB 3J7AF 3SXHA 1QB5D 1HTLD 3K5MA 1HFNA 1BPLA 1SAPA 4PQXA 2F0MA 1TWGB 3QIAA 1HXYD 1KDBA 3NQIA 2I07B 4XM3A 1HPCA 1LT4D 3NWTA 4XT3B 3C3LA 2PNRC 3D3RA 4A3IB 3OW7A 3TMEA 3O13A 1NAPA 5M3MB 1IYVA 3A7LA 2QDBA 3DUZA 3QOLA 3CP2A 3HP3A 4KY7A 3FRPB 4DK0A 3ONAB 3SK8A 4E0FA 4FXUA 2VB3X 4DAVA 1BXTA 3BS1A 5BN4A 4XR6A 3NSWA 4KN7C 3OHXC 3HOYB 2OXPA 4UDUC 4KKTA 1H9SB 5C3XA 1CQFA 2IJ0A 4XLCA 3WQZA 1R4PB 2EY5A 4EVOA 1EY6A 1DOKA 2B2WA 3A8IE 1STAA 5CORA 2OEOA 1BCPD 1DONA 5C5MA 4C2MB 3VR3A 1PTOD 1BDOA 1S5CD 2EJMA 2XNAC 3N6RA 2OT2A 4K14A 1OXXK 3K6OA 1ZXTA 3NQTA 3AMUA 2A68C 2PPBC 1KTKA 1EFRA 3D31A 3NHHA 5ELCA 2PZTA 1U4LA 2A6HC 1V1PA 1D1IA 5CGKA 1LT3D 3K7AB 2QILA 4B08A 4B9WA 1MBYA 5CR3A 3FEWX 4II3A 5JOBA 1EYDA 1PRTD 1CI3M 3K5NA 2JXMB 2E2HB 4IQZA 2L4NA 4G4KA 2X6GA 1PDQA 3OPOA 3MFYA 1Q8IA 1QOHA 5E4WC 3MC0B 4XQFA 2WAQB 4J1MA 2KJXA 4ABNA 5G3LF 1I4PA 1DCZA 4XOTA 5JEAH 5FO9B 2EYJA 5IT9L 1UD8A 4TT3A 2W6JA 4DGZA 1EY7A 1XWEA 1V0EA 4OO1G 3T4AC 4II2A 1T5EA 3F2UA 3NE5B 1OXUA 3CP8A 3VR5A 3MXNA 1WCMB 1E3XA 3OSOA 2AQ2B 4ODGA 1UD3A 4KY5A 5C4ZA 3G7LA 3KF8A 5CV7A 1GUOA 1I4HA 2D3LA 4KHZA 4TSSA 1NRKA 1ICWA 2F0TA 2CW0C 4XIGS 4QF4A 3PUWA 1EY8A 1BR9A 1I8DA 3OIQA 1PTOF 1RKNA 1EU4A 4H0LC 4U68A 2L0CA 3K0YA 1H8EA 5FK9C 3QJYA 2EVBA 2FFKB 2WJVA 3ERQA 2XRSD 4XXEA 5FO7B 4K2KA 3HOZB 4CKBA 5I2YA 1EFID 4KHVA 3DWQA 3HEJA 2BDOA 2GA4B 1ILPA 4ZUIA 1WTXA 1B2TA 1GHKA 2HDLA 2VNUD 3PO2B 1I4GA 4XLAA 4RH6A 4XN3A 1LTSD 4IUPA 3OEHA 1ESFA 1HA6A 1JR0D 1DOMA 1SNOA 3S9WA 2ZTNA 5KNLA 1G91A 2K1BA 4CJ1B 1QILA 1SDFA 2F0DA 3VYTA 2R9VA 1E1RA 4FF1A 3PO3B 3X3MA 3FKSA 1TWHB 2KCCA 5CV9A 3S1RB 3R8BA 4F7XA 1D5ZC 1MD2D 5ELDA 1Q1BA 4A3FB 5JVG3 1IKMA 2ZZEA 5JEAJ 4F8MA 2IL8A 3V05A 3GD7A 2WSSA 1QNKA 1HUMA 1EEFD 3W2DA 4NMZA 3EJIA 1X32A 1K8MA 2R93B 1RDPD 3BDOA 3KLRA 2JP1A 4H44C 2WACA 2X69A 5FLXE 1EEID 2B2VA 1IKLA 1W9XA 5CBEE 3MXGA 2RQXA 4ILWA 4RHRA 4CGYB 3NP8A 5I9OA 4DNTB 3PV0A 3ZPNA 3X3NA 1HHVA 1EY4A 3PUVA 4NKLA 3NUCA 5EJWA 1PZJD 4B3GA 4XQNA 4PMWA 1G291 4GZYC 3MTSA 1RODA 4A3GB 3OAAA 1EY9A 5DAUA 1CM9A 2SNSA 2XN9C 1ZEQX 3T16A 4K5VA 2KEEA 3CESA 2TSSA 4BBSB 2XSCA 1KLGD 5C3WA 3MXUA 2R3ZA 4A93B 1SYCA 2B2TA 1GUSA 1A6XA 1ENAA 1IW7C 1SYEA 4ZKCB 1BCPC 3GTMB 4ULLA 2EYFA 2F0JA 1E0BA 3DMUA 3OFNA 2SNMA 2XIWA 1STBA 2GJRA 3OMGA 4C3HB 2IX3A 1JCKB 1SMYD 3TZDA 2I46A 2A73B 1LTGD 2HCIA 3H6MA 4A3BB 4RA8A 3T56B 3GTOB 1EIGA 1PXUA 2EDGA 5M5WB 5J1ZA 1FNWA 2HQEA 1EYCA 2B2YC 4IZ8A 5EKIA 1M4VA 4TQUS 2M2LA 3J7YW 1FR3A 1GOZA 4EQPA 2J4XA 3IFDA 2X85A 1MSGA 1SJED 4FF3A 1I4QA 2DIEA 1LACA 3S1NB 1LTRD 3R2IA 4TSFA 5KEEA 5AFWA 2F0OA 3PIO3 5I6YA 3S1MB 3NWSA 5EPJA 2WJYA 5NUCA 5ISRA 2F43A 1JWUD 4X3KA 1AFPA 2Q8RE 4KD3A 1PZKD 4K5WA 3FPPA 2EJFC 1QNUA 1HRJA 1UEAB 4DXFA 3K5LA 4I65A 3H91A 4ZLTF 3I4MB 3P1HA 3E5SA 1I18A 3HKZB 4KI0A 4IUVA 2PYKA 1ENCA 1GUTA 5JVH3 1HVXA 5IOCA 2F0SA 4RGTA 1SFOB 3KBGA 2L55A 3A3BA 2Z8LA 3I90A 2SDFA 1D5XC 4G7WA 5CMDA 1FNVA 4X3SA 2K33A 1S5BD 4KKSA 5COYA 1ZKOA 2J0TD 4DNRB 4GQNA 3S17B 3QWNA 1KDCA 1UD6A 1S5ED 1FYCA 3GQBA 2NBFA 2VJJA 1SE2A 2FINB 1TS2A 3HG9A 5IGGA 4PMCA 4QUCA 2EYPA 2H1EA 5FOBB 1BQQT 1D6EC 4M1UB 1SYBA 1B44D 2GJPA 2EY1A 4BA1I 4XKVA 2RDGA 3A3GA 4G6IA 3RUZA 1O78A 1Y8NB 1ILQA 1HTPA 1WP6A 3N52A 3J80L 2KVOA 5A2QE 2WV6D 5M3FB 2FHTA 4XL9A 1DOLA 4ZKBB 1DXMA 2CHBD 3JAME 3D4RA 4YIJA 1F9PA 3U9SA 1ONLA 1V1PB 3VYSA 1MABA 2AUKA 2F03A 1LTTD 1RF2D 4YEJA 4HAEA 2RSOA 1G2TA 1EQVA 4R8IA 1KMHA 4DU9A 4C56C 1WD0A 1CHQD 2B2WC 2K6AA 2ZZQA 1PTOB 1KDAA 5KGUA 1W0KA 1SXTA 3D6CA 5C6AA 2B8FA 4RFBA 4ZYSA 2A74C 4RCNA 3BYYB 2E1BA 3G05A 3PUZA 4H7BA 4C3IB 2F0VA 4RGMA 1IHZA 5C4XB 5EPLA 2EE1A 1B4OA 2WB1B 3H0GB 2IWHA 2RSNA 1YNJD 4QB4A 3VR6A 1SBBB 2AQ1B 2X6YA 3DEPA 3GO5A 5C3EB 1H9KA 2JEAI 1WPCA 1SNMA 4EQOA 3A56A 3SR1A 2OF1A 2M9VA 1B1ZA 2MP1A 3I70A 1D1KA 4ID6A 2F0UA 4TKOB 2X8KA 1V8QA 2ZXRA 5CV4A 4IUNA 1GHJA 1O80A 3V2TA 1J8IA 2BOSA 4OO1I 1U4RA 3TP7A 3NTKA 4PNYA 1NR4A 2D2CC 3LWUA 1E2VA 1I50B 1TIID 2M00A 3A54A 3V96A 1STYA 4QCLA 5JEAG 3VR2A 2B39A 3TSSA 1FNUA 5G3LD 5C5LA 1BBXC 1TQOA 5DNFA 2F0KA 3J80E 4Z9CB 5E4XA 1PKVA 2ZZGA 3MZ5A 4IUTA 2V4DA 3SK4A 1H9RA 1F9RA 4C1NI 5TSSA 1A3UA 4IFDG 2EYOA 3MA2B 1JC7A 4OIKA 4PMBA 2EXZA 1WVLA 2XGJA 5CYUA 1HZEA 4ZQ3A 2KHSA 3E6ZX 1I6VC 1BUVT 4DAYA 3TN2A 1IYUA 2JIZA 4FYDA 1F2YA 4HIZA 4ZUJA 1XYIA 4CHTB 4BA2I 1F9QA 3KLSX 5KIXA 2K05A 2MJ8A 4XYQA 1WTPA 1SNDA 1AW7A 1OXSC 5KRUA 5KNBA 2NVQB 1TR5A 2A6ED 2B63B 3GTLB 4XYOA 4TRDA 2IT1A 1LTID 1BO0A 2JSOA 2EY6A 2FMCA 3EROA 2PMZB 5EBCA 3OE7A 3EA6A 2A69C 2K5DA 2LZJA 3MFGA 5JAVA 2F0QA 2PW5A 1Q12A 1KAAA 1R9TB 3RZOB 3CQZB 4RKBA 4FP5D 1L0XB 4K8JA 1E2ZA 2X6WA 4FF4A 2F0IA 3HOVB 3FPUB 1RTOA 4CBVA 4K6DA 2JEBI 4J8QA 3A8JE 5C4JB 1CA5A 4XDXA 3CU7A 2ZTGA 4HR7B 1Y8PB 4YXWA 3PMFA 1IL8A 4I7ZC 4FXDA 1STHA 1TS4A 4C3JG 4G7XA 1HA5A 3JU4A 1H9MA 2Q8TA 2JA8B 2F3WA 2KOLA 1F77A 4DAPA 3HZXA 3WDNA 1F9SA 4KD4A 4OHJA 2TMPA 3L9AX 3K57A 3R3OA 4NNJA 4WFN3 3VYRA 2X6XA 5HKKA 2L5TA 1EU3A 1AZPA 1EIHA 3MWYW 1WTVA 1T5XD 1I4RA 3GTQB 5EKLA 2EZVA 3H3VC 4NDXA 2KQ3A 3HOXB 5FKAC 5C0XI 1PFMA 1STNA 2K5QA 3DEOA 4S3SA 2HLDA 2XZOA 1OO9B 3Q24A 2D62A 4O1NA 2MPMA 1BNZA 1V0FA 1IW7D 4DA2A 4JBWA 2BA0A 1QCBD 1ET6A 1W0JA 4NP5A 5DM63 2NN6I 4KV6A 3HAGA 3TP5A 2XRQD 1TWCB 1RCVD 2BA1A 2C9OA 4K8IA 1DZ1A 1O7LA 4EGVA 3HOWB 1AZQA 5LHY1 4XLEA 2R61A 2A5HA 3C1FA 2PQEA 2DNEA 1TS3A 3HOUB 1TS5A 1OB0A 3CHBD 3L3OC 3K59A 1I6HB 1LLRD 1RD9D 1V1OA 1OHHA 4LAAA 2KA7A 4OGQC 2O4XA 1O7YA 2A68D 1G2SA 2B2YA 2ZT9C 3EFXD 1G6ZA 5EGTA 1SE4A 1B3AA 3PUYA 2V7QA 1VDZA 2RVLA 1HFGA 3BG3A 4FVMA 3VR4A 5EQ0A 1EZ6A 3QG1A 4DK1A 2ZXIA 2WKCA 1E2WA 2X6LA 1LV9A 2PZUA 1U9RA 2M5SA 5JJZA 5EPKA 5HGTA 5K36G 3FKIB 4IUUA 1JOKA 3KBXA 1D2BA 1KLUD 3P75A 4HCEA 4KY6A 1MI2A 4OIJA 2YYZA 1SEBD 1JICA 1S5DD 1JORA 3VA5A 2RKSA 2QEJC 4FNFA 1KZLA 4WRDA 2E2JB 5E3FA 3GTJB 2K04A 1S5FD 3VA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXJ C;  1Q12 A;  3PUV A;  1DXM A;  2PCF B;  3QIA A;  1GUN A;  1Z7T A;  1GUG A;  2BDO A;  2O5I C;  2D2C C;  2O5J C;  3LWU A;  1Z6H A;  1G29 1;  2BA1 A;  3D4R A;  1E2V A;  4GZY C;  1HPC A;  1CI3 M;  3U9S A;  2JXM B;  1GHK A;  1ONL A;  5JEA G;  1E2Z A;  3FPP A;  3PUX A;  4IQZ A;  2EJF C;  4LK1 C;  3VR2 A;  1O7L A;  5C0X G;  5A35 A;  1H9S A;  2AUK A;  3CRK C;  2JEB I;  3OPO A;  3MFY A;  4KMU C;  2PNR C;  1HQM C;  1HCZ A;  2K7V A;  4OO1 H;  2AWO A;  3OW7 A;  3A8J E;  1LAB A;  3I4L A;  2DNE A;  1Y69 U;  1IYV A;  3A7L A;  2DNC A;  3M7N A;  4DK0 A;  2EJG C;  2NN6 H;  4KI0 A;  2QF7 A;  5BN5 A;  1H9J A;  2E74 C;  1DD2 A;  1Q1E A;  1SMY C;  1YNJ C;  2A6E C;  1GUT A;  3MXU A;  4HR7 B;  1Y8P B;  2V4D A;  2A6H D;  1TU2 B;  1DCZ A;  1PMR A;  4I7Z C;  2F1M A;  5JEA H;  1H9R A;  3M85 A;  3A8K E;  5BN4 A;  1B9N A;  1GUS A;  1CFM A;  1A6X A;  1IW7 C;  1ZYR C;  2KA7 A;  3IFT A;  3TZU A;  5BN3 A;  1VCI A;  1H9M A;  4OGQ C;  4KN7 C;  4IFD G;  2A68 D;  3A7A B;  2B8F A;  4H13 C;  4KN4 C;  3P20 A;  2KCC A;  3RLF A;  4KKT A;  3M4Y A;  2ZT9 C;  4RCN A;  1H9S B;  3CRL C;  3PUZ A;  2K32 A;  3SDZ A;  4OO1 G;  1Q1B A;  2BE5 D;  4L8J A;  3I73 A;  3A8I E;  3WDN A;  4G7Z C;  2NN6 G;  1GJX A;  2E75 C;  2K33 A;  5KNC A;  1V43 A;  1T5E A;  1I6V C;  3NE5 B;  4KKS A;  2JE6 I;  3PUY A;  1K8O A;  1OXU A;  2D5D A;  1VDZ A;  1ZKO A;  3VR3 A;  4DNR B;  1BDO A;  2LMC B;  3IKJ A;  5KND A;  1IYU A;  1EWH A;  2L5T A;  2EJM A;  3BG3 A;  4PV1 C;  2E76 C;  3VR5 A;  3VR4 A;  3N6R A;  2A69 D;  1Q90 A;  3VR6 A;  4KKU A;  3GD7 A;  4BA2 I;  3QG1 A;  1FYC A;  1OXX K;  3GQB A;  4IFD H;  3L7Z C;  4DK1 A;  2R6G A;  3T56 B;  4LJZ C;  2EDG A;  3ND9 A;  5C0X H;  3EQL C;  1GUO A;  1E2W A;  4G7O C;  3FMC A;  1K8M A;  5K36 H;  3T53 B;  1OXS C;  3BDO A;  4KHZ A;  5KNB A;  1VF7 A;  2A6E D;  2A68 C;  1Y8O B;  3KLR A;  2PPB C;  3HGB A;  2CW0 C;  4XIG S;  1H9K A;  3W3A A;  4XTC S;  2JEA I;  3PUW A;  3D31 A;  4H44 C;  4TQU S;  1B9M A;  1OXT A;  2IT1 A;  4G7H C;  5K36 G;  1FR3 A;  4BA1 I;  2D62 A;  3I72 A;  1O78 A;  1LAC A;  2Q8I B;  2A6H C;  1OXV A;  4H0L C;  1Y8N B;  2YYZ A;  1HTP A;  2DN8 A;  3ND8 A;  4TKO B;  1IW7 D;  3SE0 A;  2A69 C;  1QJO A;  3LNN A;  1YNN C;  4JBW A;  1V8Q A;  2BA0 A;  3QJY A;  2AUJ D;  2EVB A;  1VF5 C;  2BE5 C;  4JK1 C;  3OOC A;  3H94 A;  3T51 B;  1CTM A;  2B8G A;  3AB9 A;  2NN6 I;  4DNT B;  1GHJ A;  1TKW B;  3PV0 A;  3VA7 A; 
#chains in the Genus database with same CATH topology
 1HA3 A;  1V1Q A;  1EFT A;  3DM1 A;  4A93 G;  5HXB A;  1BCP B;  4QJF A;  4HIM A;  3W1B A;  2O5I C;  2XZP A;  1L1O C;  1QUE A;  1JB7 A;  1K3B C;  3FJO A;  3OKX A;  3MAQ A;  2ZXP A;  1W34 A;  3A55 A;  5H5J A;  4K0K Q;  2RCN A;  3BH4 A;  1YJN B;  1TVX A;  3PUX A;  4LK1 C;  2ENB A;  2DY8 A;  1H9S A;  4IUQ A;  4V0B A;  4A3L G;  3CMM A;  3T1H L;  3D6W A;  1GO3 E;  4PC7 A;  1HCZ A;  3GVL A;  4X65 Q;  4GOP B;  1BF4 A;  3EN2 A;  2VUM G;  3QO2 A;  4XOR A;  3I4L A;  4A3M G;  2VYQ A;  4N8F A;  1Q81 D;  2DYI A;  1EY0 A;  4DR5 Q;  5DS0 A;  4G57 A;  5BN5 A;  3G4S A;  4JMQ A;  4WWV A;  2CQA A;  1YNJ C;  3PIP 3;  1FD7 D;  3HOY H;  2Q6L A;  1U4M A;  3ZUG A;  1X6O A;  5CC4 A;  3CC2 A;  3AFQ A;  4QIW E;  2PW7 A;  2QW7 A;  1XNQ Q;  2UUA Q;  4OL7 A;  2YWF A;  1F2Z A;  1PRT C;  4RDK A;  2CC2 A;  4EX5 A;  1Q7Y D;  3JQQ A;  2XNJ A;  5GAG C;  1JWS D;  3M7G A;  5IK2 A;  1Q8K A;  4X3U A;  3LQE A;  3UDX A;  2KVM A;  2BVN A;  4A3K G;  2Q2H A;  4NXM Q;  3CRL C;  3KLW A;  4A3M H;  1K0R A;  2HMA A;  3CW2 C;  4GNX B;  1A0I A;  1VQL A;  4L8J A;  1QWY A;  4KJO A;  4RGO S;  1VQH A;  2E75 C;  1V43 A;  2NVX B;  1I94 L;  4X62 Q;  4B48 A;  4N9T A;  1IBL L;  3IKJ A;  1JMC A;  4LBY A;  4RD4 A;  3KDF A;  4PV1 C;  4GLV B;  5J3B A;  2PZW A;  2Z6B D;  2ZTD A;  3BVG A;  4JBJ A;  4DR2 L;  5IGD A;  2C77 A;  3Q6R A;  1COW A;  1ZYR D;  2L12 A;  3Q6S A;  4IFD H;  1CKM A;  3E1Y E;  1GVP A;  3HKZ G;  3D8G A;  1WTO A;  4YCV A;  1SYF A;  4Z4T A;  4HSV A;  3C46 A;  4BS9 A;  1MIU A;  2MGS A;  4WZT A;  3K7U C;  1XNR L;  2F0L A;  2CK3 A;  1TT2 A;  2F4N A;  1DYQ A;  2AWN A;  3I1F A;  1P4M A;  4HJA A;  4LF8 Q;  1HUN A;  3AST A;  3TP8 A;  1OB5 A;  1RTN A;  5A89 A;  3MMP A;  1Y1V H;  5A2Q L;  3CC4 A;  1PYW D;  5DSZ A;  2DN8 A;  4X3T A;  3SE0 A;  1RHP A;  2K75 A;  5FO1 A;  2F0E A;  1LM0 A;  1Q82 C;  1EIF A;  1W6J A;  5KSW B;  2LY7 A;  2VS1 A;  4LF8 L;  2WZN A;  3QR8 A;  3CPF A;  2E2H H;  4O42 A;  4HE5 A;  5M5Y H;  2JA8 G;  1W6K A;  1GUN A;  1PRT B;  4CKE A;  1EL0 A;  2Z0S A;  3S14 B;  1Z6H A;  2G9D A;  5FLM H;  3L2P A;  2Q2U A;  2L1B A;  2GJK A;  2VBT A;  1JB3 A;  3WBK A;  3UDF A;  4M8A A;  3PA1 A;  1CA6 A;  4ROX A;  4BY1 B;  3GTL H;  2JA6 B;  2OTJ A;  1YHA A;  2YU9 B;  2CF4 A;  2PO4 A;  3SEB A;  1VQ8 A;  1BOS A;  2K5W A;  2VJI A;  1VQB A;  4KMU C;  5H1S E;  1PFB A;  1JNY A;  4HED A;  3H09 A;  2L9H A;  3QFR A;  2MFI A;  4IPC A;  3GDE A;  1LAB A;  1Y69 U;  4ZK9 B;  2B63 H;  1YNN D;  2K52 A;  3M7N A;  2WIN B;  1CNF A;  1T6Y A;  3CCQ A;  5FNZ A;  4B9X A;  2EY2 A;  1QGA A;  1MRZ A;  4X66 L;  4P1V A;  1SNQ A;  4JV5 Q;  3U58 A;  1PMR A;  2NZH A;  2F1M A;  2H4O A;  5M5Y B;  4WJ4 A;  1KK1 A;  5GV7 A;  2EQS A;  2BH2 A;  3A8K E;  3AU7 A;  1NMG A;  3H9N A;  1EUJ A;  2R93 H;  1ZYR C;  3PO2 H;  1E7Z A;  4UHV A;  2BMW A;  5IYR A;  1NTG A;  4CDF C;  1HH2 P;  5BN3 A;  5LL6 X;  5IT9 c;  4IAL A;  1SRO A;  3S1M H;  4X7D A;  3P20 A;  1WI5 A;  4DR2 Q;  1EXM A;  3W2H A;  3KYH C;  2F3V A;  1SYG A;  1CZG A;  3GV6 A;  3KUP A;  3W2I A;  1NSN S;  2B2T C;  4GKK L;  4H02 A;  1E3Z A;  4ALP A;  4X62 L;  2K50 A;  4DXG A;  1SE3 A;  4PC3 A;  4A3K B;  2B2U C;  1CHP D;  3CC4 B;  1PRT F;  1BX0 A;  1HNZ Q;  4DR3 Q;  4XQJ A;  3OWE B;  1STE A;  5J22 A;  2LMC B;  5FIU A;  1F20 A;  4RDJ A;  2O2L D;  1YHQ A;  1PH7 A;  2Y0S E;  5IGC A;  1F2M A;  1E1Q A;  1Q9S A;  4NXM L;  2LXJ A;  5E1F A;  5JBQ A;  1A8P A;  1DJR D;  3PUM A;  4NCN A;  1VQG A;  2R6G A;  4DV7 L;  4DAM A;  3OJW A;  3AVU A;  2IPK D;  3TP6 A;  5C0X H;  1K83 B;  3TRZ A;  1EIY B;  4G7O C;  1WCM G;  4JBM A;  3U9O A;  1JB9 A;  1VF7 A;  4BWG B;  3R2T A;  3HOY G;  1LYL A;  2KEC A;  1D5M C;  5FO8 B;  1QG7 A;  5H59 A;  4A3D B;  4XTC S;  1PA6 A;  4LMQ D;  1B9M A;  1CKO A;  3IL8 A;  3Q3A A;  5EMN A;  2JA8 H;  2R7Z G;  2C5H A;  2AQ3 B;  4WJW A;  1E63 A;  2C5B A;  1N0U A;  3RMH A;  3PIO A;  3HOZ H;  4HMJ A;  5FLX L;  1UNS A;  5ELO A;  3ICE A;  4CDE C;  1SR3 A;  2LS0 1;  3D4D A;  5ELB A;  1WTR A;  3LNN A;  1JJG A;  3T1H Q;  1YEZ A;  4N3G A;  3VO1 A;  1A3T A;  1E24 A;  5JJL A;  3AB9 A;  4JV5 L;  3EIV A;  1X3Q A;  1WOC A;  3CCJ A;  1ZM9 A;  2D9U A;  1Q3L A;  1Y0R A;  4R4T A;  4JI6 Q;  2XOK A;  1EYA A;  3MEH A;  1NBW A;  5CDF A;  2E2D C;  4P6V F;  2ZBV A;  2LFN A;  5J39 A;  1V9P A;  1GUG A;  2RDH A;  1EQT A;  1QG0 A;  2VL6 A;  5CV6 A;  1MHW C;  4LF4 Q;  3OIP A;  2Y0S B;  2R7Z H;  1X9N A;  1GUW A;  4F87 A;  4X06 A;  2XWB B;  2XZL A;  2OTL B;  1M1K C;  1H8H A;  3I4M G;  4O2D A;  1WOP A;  4WZK A;  4JYA L;  4CKC A;  1EP1 B;  3FDT A;  5T1I A;  1IZ6 A;  3JAM i;  3PO2 G;  4MHE A;  2YWG A;  2WZP P;  1JQY D;  1ET9 A;  3FP9 A;  3Q23 A;  1A62 A;  4X66 Q;  3F8T A;  4O0A A;  5FLX c;  2CVR A;  5JJI A;  1S72 B;  1SMY C;  5FA6 A;  3LWE A;  4XKW A;  4IUR A;  4A3J G;  2NTS A;  1Y1W B;  1B8A A;  3DWP A;  4DN4 M;  3T1Y Q;  1PYS B;  1CZW A;  3BCD A;  3F2D A;  3DDY A;  1B9N A;  3PSI A;  4E6I A;  5AN9 A;  1R4Q B;  3IFT A;  2N55 A;  4FXK C;  1VCI A;  4R9W A;  2N78 A;  4OEL B;  4POF A;  2B2U A;  3H0G H;  3A7A B;  4H13 C;  3SK6 A;  2OTJ B;  1LT5 D;  2ZJP A;  4KN4 C;  1PFS A;  3DM3 A;  3HS0 C;  3M4Y A;  1RQR A;  3E0E A;  2ICI A;  1NJI D;  1YZ6 A;  2IW3 A;  3ULP A;  3K58 A;  5DLQ E;  3PA2 A;  3SDZ A;  1Z47 A;  2KBN A;  2ES2 A;  3BZD B;  5B6I A;  4G7Z C;  3GVK A;  4IFD J;  4BBR B;  5KNC A;  3A8I A;  4A3M B;  2JJ2 A;  3W2G A;  4DQL A;  2QCP X;  1KIX A;  4B4D A;  1S4Z A;  3BYT B;  1KHI A;  2HUG A;  4NW2 A;  4DUZ Q;  1B2R A;  2ZL6 A;  3M3Y B;  3DWA A;  1EWH A;  4P71 A;  5EBD A;  2PE3 A;  4RHS A;  4UPA A;  3GSI A;  3L7Z C;  5IYP A;  1GXD C;  3BDC A;  1TWA B;  1IB0 A;  1D8L A;  4TVA B;  3EQL C;  4X05 A;  1IBL Q;  5K36 H;  3ERS X;  1KRH A;  2F0H A;  3HOV H;  1I94 Q;  2CWA A;  4P2C B;  3W5U A;  2WP8 J;  3ZYY X;  3P27 A;  2NZ1 D;  4ZV4 A;  1ZUN B;  4QUF A;  1PH9 A;  4BY7 H;  1FNM A;  1EOT A;  3BY1 A;  2K28 A;  5IIF A;  3I56 A;  1VQ7 A;  2R93 G;  4X0C A;  5JPM C;  1E43 A;  2F4I A;  1ML0 D;  2EYL A;  1JJC B;  3KFU A;  3ZZT A;  4A3D G;  1PFN A;  3I91 A;  1YHB A;  4DV4 Q;  4FF2 A;  4P3I A;  2R7Z B;  1Q7Y C;  1L1O A;  3RZD B;  3BQJ A;  5KW9 A;  1PLF A;  5ELN A;  1IXR A;  1VF5 C;  1XXG A;  1B70 B;  3OOC A;  1CTM A;  1GVH A;  3T51 B;  3BZK A;  3G6J B;  1UD5 A;  1TKW B;  4G1V A;  4Q5V A;  1K73 C;  3DXJ C;  3C2P A;  1RL2 A;  1K28 A;  1WOR A;  3AVX A;  3AVW A;  3W5O A;  3MXP A;  5M5W H;  2O5J C;  2QEX A;  3HOU G;  1W35 A;  5LMN Q;  4MYT A;  4QVJ A;  1XX8 A;  2SEB D;  3F1Z A;  2VQF Q;  1NCV A;  1X3E A;  4UZF A;  4XQQ A;  3WWV A;  4YAW A;  5C0X G;  4ASU A;  1KD1 C;  1M90 C;  1KRT A;  1HQM C;  2K7V A;  1O7Z A;  1RQP A;  4HIO A;  5DN6 A;  1X3P A;  1H42 A;  1C0A A;  2EIF A;  2ZXH A;  2MHV A;  3CPX A;  5DM7 3;  2DNC A;  3NEN A;  1KAW A;  4R1J A;  2NN6 H;  3MVV A;  2QF7 A;  3NBH A;  4A93 H;  2E74 C;  2JYO A;  1Q1E A;  3ULL A;  5I2X A;  3CKI B;  1U2R A;  2WPD A;  3EVQ A;  2PQA A;  4XNF A;  3DHQ A;  3J7A V;  1LT6 D;  2K14 A;  4QIW B;  1XJV A;  1X54 A;  2CND A;  1AE3 A;  4A3I G;  2HDM A;  1VMC A;  1CT1 D;  4X65 L;  1PH6 A;  3GVJ A;  3CCR B;  4DV0 L;  1C7Y A;  2C5C A;  1AEX A;  5M9O A;  4KHP L;  3OEE A;  1K28 D;  5I9P A;  2ZJQ A;  2B63 G;  2Q6K A;  4XT1 B;  1GKH A;  5C4X G;  2J7Z A;  2ZTE A;  4R8N A;  3SLD A;  1I4X A;  2JDI A;  4FXG C;  2BE5 D;  1UD4 A;  4N3N A;  1AP0 A;  3ISX A;  4RD2 A;  1OB2 A;  3RY8 A;  4K5X A;  2G9H D;  1VQ5 A;  1KXL A;  1WTW A;  4X7F A;  4YHH Q;  2Q2I A;  5C0X J;  1U4P A;  1II3 A;  1JWM D;  1E62 A;  3M9B A;  4PG3 A;  1K8O A;  2Q6O A;  5KND A;  4AVZ A;  2KCN A;  2EPB A;  3URY A;  3I8Z A;  3S15 B;  1E1O A;  3FKI G;  1Q90 A;  1BMF A;  4KKU A;  2HD3 A;  4RKL A;  5I4D A;  2Z6K C;  5DEH A;  2UXC Q;  3GTP B;  4MIU A;  4LFA Q;  2ICE C;  5K5P A;  4A3C G;  5C4X H;  2DY7 A;  4Y7N H;  4QMG A;  4BY7 B;  3QOJ A;  4ZRZ A;  4LF5 L;  2PNH A;  3SK5 A;  4A3J H;  3WNB A;  2PI2 A;  4HN7 A;  3HOU H;  1L0Y B;  2Z1C A;  4U67 3;  2N88 A;  2BDN A;  4XOP A;  4JI4 L;  1QVF A;  5TRD A;  1C4Q A;  1E3P A;  5ELF A;  2PMD A;  1PJ5 A;  2VXW A;  3R93 A;  5EKK A;  5C4H A;  4KTA A;  1JJ2 A;  5D65 A;  3I72 A;  2OYN A;  1RJT A;  1SNP A;  2NYZ D;  4K2L A;  3CCE A;  4DR1 Q;  1PV4 A;  1SNC A;  4LUO A;  1GAQ A;  1YJ9 B;  1YJN A;  3M4O B;  4V19 0;  2VB2 X;  4FO2 A;  5I6W A;  1QJO A;  4AH6 A;  2VNH A;  1VQE A;  3BJU A;  4JK1 C;  3NTH A;  2R92 B;  4ZGQ B;  3E0J A;  4J0Q A;  2X53 S;  2JA7 B;  1YBY A;  3S15 H;  4B43 A;  2KCM A;  1AIP A;  3KL9 A;  1G7T A;  4C3J B;  2V7W A;  2F0F A;  2YTV A;  5F2D A;  1D8T A;  5T1G A;  4HJ7 A;  1PH4 A;  1N36 Q;  3GTK H;  1VMP A;  4C1N K;  4XD7 A;  1DM0 B;  5IT9 E;  4QUZ A;  1EY5 A;  4AYB B;  3JAM L;  1WDT A;  3JQR A;  4MN3 A;  2OQK A;  2F0N A;  3CRK C;  3OZV A;  2V31 A;  3KEW A;  3GTO H;  3RN5 A;  1N33 Q;  2AWO A;  5IGE A;  1VQ4 A;  3AVV A;  1VQ9 A;  3ZIA A;  1FNB A;  4RJL A;  3WOE A;  5LMU Q;  2RA4 A;  5CBA E;  1ZM2 A;  3GIR A;  2A6E C;  4A3E B;  1ZM4 A;  3CTA A;  3SEJ A;  1K8G A;  3LQ6 A;  4DR1 L;  4RMF A;  4CJ2 C;  2ZXO A;  2Z6K A;  1I3Q H;  3T1Y L;  3CCL B;  4Y9R A;  2EYH A;  3D4W A;  3BVM A;  2MUY A;  1WTH A;  2E5L L;  2IX0 A;  3Q22 A;  1TY0 A;  1VQ4 B;  3E3X A;  3T13 A;  1TY2 A;  4ME3 A;  5IGF A;  4IFD I;  2OBT A;  4X6A H;  2GK7 A;  1IBM Q;  4J6H A;  3VDY A;  4YEL A;  4Z4R A;  1J9O A;  3FVQ A;  1U0L A;  1N32 Q;  5IGB A;  1C48 A;  2FMM A;  1A15 A;  1EWC A;  2CQO A;  3J81 E;  2QGQ A;  3SKB A;  4JI5 L;  4RPB A;  4HJ9 A;  5CV8 A;  1AMO A;  1XMQ L;  1MGS A;  2XWJ B;  2KUM A;  3U6K A;  4A3E H;  1A3V A;  3ND9 A;  1GR1 A;  2AKW B;  4B3R L;  3NXW A;  4DV1 Q;  2N3S A;  4L63 B;  5D14 A;  4XN0 A;  2QKI C;  5F4M A;  1M8A A;  1XQB A;  3JC6 6;  3HGB A;  4QFM A;  4P74 A;  1H85 A;  3I3C A;  4G5G A;  3CCS A;  4DV2 L;  4PZ8 A;  4UAI A;  4G7H C;  3HOZ G;  1E79 A;  1VQM B;  3OMC A;  3W5V A;  3KDF B;  2NVY B;  4RPD A;  1WTH D;  5CV5 A;  5HUR A;  1ENF A;  2GN5 A;  1BX1 A;  4DFA A;  1WD1 A;  4DAY B;  4N9P A;  3STB D;  3QB3 A;  2UUC Q;  1SYD A;  2AUJ D;  4YCW A;  2BE5 C;  2B2V C;  3K0X A;  3TDQ A;  4APV A;  1MJE A;  1A63 A;  1SFO H;  1VJS A;  2QA4 A;  3QE2 A;  3B82 A;  5A8A A;  5D3D A;  1NY4 A;  2PCF B;  4HTH A;  1Z7T A;  1M1K D;  3G6E B;  1QE6 A;  3HOV G;  3V76 A;  4HCS A;  3FKI H;  3AQQ A;  3TBI B;  3AYH B;  5LMN L;  3C1E A;  5AJ3 Q;  3MHB A;  4EQN A;  1HNZ L;  1KL9 A;  3HRZ C;  1N06 A;  2P5Z X;  2NTT A;  3H3V H;  1NR2 A;  1PZI D;  4LFC L;  3S2H B;  1JE5 A;  1MSH A;  1UUP A;  1UWV A;  1A2T A;  1EZ8 A;  2B3G A;  2F0W A;  2RHS B;  4JOI C;  2NWG A;  2BV3 A;  4KJN A;  5GAH C;  2PLF A;  2CBX A;  1I3Q B;  2BM1 A;  2JJ1 A;  5HZB A;  4Y7N B;  1DD2 A;  3CB4 A;  1S3O A;  1EWY A;  3ZC3 A;  4DV4 L;  1B50 A;  1STG A;  2ZM6 Q;  4LFB Q;  3P7J A;  2QE7 A;  1LTB D;  4A3F G;  1TU2 B;  2RC5 A;  2EYM A;  3GP7 A;  3AGQ A;  2GK6 A;  1SSO A;  4P26 A;  1PTO H;  3M85 A;  3NBI A;  3A35 A;  3WOF A;  1MKH A;  1CFM A;  3KJP A;  5D3I B;  3ITP A;  5C4J H;  3TZU A;  1NBM A;  3KK7 A;  1GAW A;  2EOT A;  1KNA A;  1TWH H;  2JQO A;  2IHE A;  3EBE A;  1XMO Q;  3RLF A;  2OTL A;  1QH0 A;  4P22 A;  5M5X B;  4B3T L;  2D9R A;  1Y1V B;  5JJK A;  3W2E A;  1PH8 A;  1XPO A;  5A88 A;  3J7A 5;  1NUC A;  4XLF A;  2XVS A;  1GJX A;  3E9H A;  4Z1M A;  5M3F G;  4OPV A;  1SKY B;  1XTC D;  4HIK A;  3S1R H;  4LBZ A;  1CK1 A;  2JE6 I;  5IOD A;  2ZJR A;  2D5D A;  3RD4 A;  3DLL A;  4JI8 L;  1L1O B;  2VUM B;  4MTK A;  1VLY A;  3FHW A;  4WZL A;  2F0G A;  2A69 D;  3S1N H;  2K03 A;  1C8C A;  3CCE B;  2CW0 D;  3SHL A;  2UXB L;  1JOQ A;  2X0K A;  1BCP F;  4LJZ C;  4ME5 A;  5C44 H;  2K5V A;  2NVT B;  3ZJY C;  3FMC A;  2FJ2 A;  3T53 B;  2HCC A;  4XLH A;  1Y8O B;  1VQO A;  1X56 A;  1VQI A;  1A2U A;  4CJ0 B;  3BVZ A;  2HHH L;  5ELE A;  4YAL A;  4LNQ A;  2RF4 A;  2UXD L;  2ZL7 A;  1J5E Q;  2L11 A;  2CH4 W;  1LTA D;  1YIT B;  2Q8I B;  1L2F A;  1OXV A;  1NB9 A;  1K8A D;  3CCM B;  1VS0 A;  3ND8 A;  5JPN C;  1NDH A;  2BGI A;  3NTI A;  4X64 Q;  3J81 L;  1HQR D;  1YNN C;  4NPS A;  4RGN A;  5GQO A;  1XNR Q;  2B8G A;  3H94 A;  4K6L A;  4IN3 A;  5LL6 S;  4DF7 A;  2ID0 A;  4JW0 A;  1NJI C;  1Y14 B;  4UAJ A;  2A1A A;  3KF6 A;  4PGO A;  4HJ5 A;  4DKA C;  4BY7 G;  2D0O A;  2NVT H;  3HOW G;  3BCF A;  2HIV A;  4LBV A;  2W6I A;  2R6H A;  3Q0A A;  2D0P A;  1KC8 D;  2NUC A;  3VYU A;  4KK7 A;  3K5O A;  4LF4 L;  5M3M G;  3UI2 A;  5A35 A;  2LKV A;  1WTQ A;  2IX1 A;  3OYY A;  1HR0 Q;  4JI1 Q;  1N8R C;  4OO1 H;  4OOX A;  4HMI A;  3A8J A;  3PF4 A;  1ASY A;  2MNA A;  3BNW A;  2EJG C;  2NB0 A;  1FGB D;  1H9J A;  1K73 D;  4ZAI A;  3OJX A;  2JK8 A;  1SJH D;  4JVZ A;  3S16 B;  1ESR A;  2A6H D;  2RBM A;  4BXX H;  1CUK A;  5IYN A;  4F88 A;  1XTD A;  3K80 C;  5M3M H;  4C3H G;  1B53 A;  4HSP A;  3U4Z A;  5KYL A;  2BM0 A;  2KED A;  1I7P A;  1W87 A;  1DG1 G;  4BBS G;  1JE4 A;  1F2L A;  4XON A;  1KAB A;  3KLS A;  4RCO A;  4JI7 Q;  1WCM H;  1WFQ A;  2K32 A;  2WKD A;  2D3N A;  4WOR A;  2ZZF A;  1EYG A;  4DV7 Q;  4A3J B;  3WNC A;  1CQV A;  3I73 A;  5KYI A;  4NXN Q;  2NN6 G;  4RAU C;  4JI3 L;  2RCF A;  4JBK A;  1I50 H;  2OCE A;  2BCO A;  4UZU A;  3V7A A;  2N8N A;  3SVM A;  4B3F X;  4OOS A;  4K0K L;  3J81 k;  3CCU A;  4XMY A;  4PAB A;  3NK9 A;  3GTG B;  1LO5 D;  2E76 C;  4LUZ A;  1IL2 A;  1TWF B;  2Z4H A;  3A5U A;  4IJH A;  4B47 A;  3IAY A;  1JOO A;  1G8Z D;  2E2I B;  3LVB A;  5C44 B;  1BLI A;  3VO2 A;  2F0P A;  4RWS C;  3OWF A;  3LX0 A;  4YY3 L;  1N08 A;  3BC9 A;  4P12 A;  2Z4I A;  1UE5 A;  2K01 A;  2E1R A;  1PJ6 A;  2SOB A;  5BSX A;  4R4O A;  1N8R D;  3S2D B;  1UAP A;  4A3F H;  4L6T B;  2RDF A;  4YWL A;  3I4N B;  4Q0F A;  4LF9 L;  3W3A A;  2N49 A;  2K4K A;  3GTK B;  2F4V L;  1UD2 A;  1OXT A;  1AN8 A;  1W2B A;  3CC7 A;  1KC8 C;  2P3M A;  3R6K A;  1YI2 B;  1PTO C;  3GV3 A;  2XND A;  1KNE A;  4C3I G;  5FL7 A;  4UZE A;  5BR8 L;  1QVG A;  3S1Q B;  2FX3 A;  1OTC A;  1K9M C;  2JA5 B;  3BDL A;  1FX0 A;  3NPP A;  5GRO A;  2WII B;  4DV6 L;  4A3E G;  2YWH A;  3J7A F;  2HCJ B;  1QB5 D;  1YHQ B;  3SXH A;  1Q81 C;  2ASB A;  1I6H H;  1HTL D;  2K5N A;  5EAY A;  3K5M A;  1HFN A;  1BPL A;  2E2I H;  1EP2 B;  4ZCL A;  3ZZU A;  1SAP A;  3G71 B;  2DJG C;  4PQX A;  2F0M A;  4JI1 L;  2ALY B;  1G7C A;  1TWG B;  3QIA A;  1K8A C;  2PIA A;  1WSR A;  1TXY A;  1HXY D;  1KDB A;  3NQI A;  2OWO A;  1MJC A;  4LF7 L;  2I07 B;  4XM3 A;  1VQP A;  1HPC A;  1LT4 D;  2VBS A;  1HNW Q;  5FO0 A;  4DK3 C;  3NWT A;  4XT3 B;  1CKN B;  2WAQ G;  3K7A H;  1N34 Q;  3C3L A;  2WB1 G;  2FXQ A;  3A1P A;  2PNR C;  3D3R A;  1BBU A;  3H0G G;  4A3I B;  3OW7 A;  3A0J A;  1F60 A;  3TME A;  5GAD C;  3O13 A;  3G71 A;  1NAP A;  5M3M B;  1IYV A;  3A7L A;  2QDB A;  2I5L X;  3DUZ A;  3CP2 A;  3HP3 A;  3QOL A;  4KY7 A;  3FRP B;  4DK0 A;  1HZC A;  3ONA B;  4RD3 A;  1K0S A;  1S4M A;  1SM4 A;  3SK8 A;  4E0F A;  1KQS B;  4FXU A;  2VB3 X;  4DAV A;  1WOO A;  3PVD A;  1BXT A;  3BS1 A;  3S24 A;  3W1G A;  2I5M X;  5BN4 A;  4LF6 Q;  1D7Q A;  2UUB Q;  4XR6 A;  3NSW A;  2OBS A;  4KN7 C;  1EWI A;  3OHX C;  1KD1 D;  3HOY B;  2OXP A;  4UDU C;  4Y52 H;  4KKT A;  2C4U A;  4HE6 A;  1H9S B;  5C3X A;  1CQF A;  2IJ0 A;  4IOC A;  4XLC A;  3WQZ A;  1R4P B;  2EY5 A;  1OGI A;  1EFC A;  4EVO A;  4DR4 L;  1EY6 A;  1SKQ A;  1DOK A;  1UE1 A;  2B2W A;  1STA A;  3A8I E;  5COR A;  4A3G G;  2OEO A;  2C35 B;  1K9M D;  2VW9 A;  1BCP D;  1J6Q A;  1DON A;  5C5M A;  4C2M B;  3VR3 A;  1PTO D;  3RZD H;  4MTN A;  1BDO A;  1S5C D;  4JI8 Q;  2EJM A;  2XNA C;  3N6R A;  3HOX H;  2OT2 A;  4K14 A;  1N05 A;  3CD6 A;  2CCZ A;  1OXX K;  1VQ6 B;  3CC2 B;  4DR7 Q;  5IP7 H;  3K6O A;  1ZXT A;  4P6Y A;  3NQT A;  2NPF A;  4BBR H;  3AMU A;  2QEX B;  2A68 C;  2DCU A;  3CCJ B;  2PPB C;  1KTK A;  4GLX A;  2R92 G;  1EFR A;  3D31 A;  1VQA A;  3NHH A;  1IBK Q;  2QN6 A;  4A4I A;  4A76 A;  1HNX Q;  5ELC A;  2PZT A;  2AHO B;  1U4L A;  3ASS A;  2A6H C;  1V1P A;  1KTV A;  1D1I A;  3HKS A;  1PYB A;  2CFM A;  2XNC A;  5CGK A;  4DR5 L;  3U2Q A;  1LT3 D;  1L0W A;  3I7F A;  4GOP A;  2R7F A;  3K7A B;  2QIL A;  5GV8 A;  4B08 A;  4LFC Q;  4B9W A;  4YCU A;  1MBY A;  5CR3 A;  3FEW X;  4II3 A;  3NEL A;  5JOB A;  1EYD A;  1PRT D;  1VQK B;  4A3K H;  5AJ3 L;  1YNX A;  1QZH A;  1CI3 M;  3K5N A;  2JXM B;  4L5S A;  2HIX A;  2E2H B;  4IQZ A;  2L4N A;  4G4K A;  2X6G A;  4TMZ A;  1PDQ A;  4J15 A;  3OPO A;  3MFY A;  1Q8I A;  1AE2 A;  1QOH A;  5E4W C;  3MC0 B;  5IY0 A;  3W2F A;  1R9T H;  4XQF A;  2WAQ B;  1P8L A;  4J1M A;  2KJX A;  4ABN A;  5G3L F;  1G7R A;  4UY8 C;  4AF6 A;  1I4P A;  2VQE Q;  4JI2 L;  2CH4 A;  4PZ7 A;  3AFP A;  4AYB G;  1DCZ A;  4XOT A;  2OBR A;  1HJP A;  5JEA H;  4QY7 A;  2EYJ A;  5FO9 B;  4DV2 Q;  1QGY A;  5IT9 L;  2JN9 A;  4QGU A;  2GVA A;  4QQB X;  4TMW A;  5IYC H;  1UD8 A;  4TT3 A;  1VQ8 B;  2W6J A;  3OP1 A;  1VQ9 B;  3M4O H;  4DGZ A;  3W5H A;  3ONU A;  1EY7 A;  1XWE A;  2WYR A;  1QVF B;  1V0E A;  4OO1 G;  3T4A C;  2V7X A;  5IP7 G;  4II2 A;  4P72 A;  1SMX A;  4LW1 A;  3M3Y H;  4A3L H;  1T5E A;  1YIT A;  3F2U A;  2DJF C;  3NE5 B;  1FL0 A;  1OXU A;  1TWC H;  3CP8 A;  4C3I H;  4IO9 A;  4AQY L;  3VR5 A;  4RDL A;  3MXN A;  1WCM B;  1XPU A;  1E3X A;  3SJZ A;  3OSO A;  3RLN A;  2GRE A;  1PH5 A;  2AQ2 B;  1UE7 A;  4ODG A;  1UD3 A;  4KY5 A;  1S40 A;  5C4Z A;  3G7L A;  3KF8 A;  4DV3 L;  5L37 A;  5CV7 A;  4GKJ L;  1GUO A;  5IP9 G;  1I4H A;  1BVS A;  2D3L A;  5GAE C;  3CCR A;  1SN8 A;  4KHZ A;  4TSS A;  1NRK A;  3WYA A;  2MO0 A;  1ICW A;  4WJ3 M;  2F0T A;  2QA4 B;  2CW0 C;  4XIG S;  4QF4 A;  3PUW A;  1K83 H;  4RD0 A;  3CCU B;  1EY8 A;  2NV4 A;  1I8D A;  1BR9 A;  3OIQ A;  1J5E L;  1PTO F;  4JI0 L;  4PZ6 A;  1RKN A;  1EU4 A;  4H0L C;  4U68 A;  2L0C A;  1CNE A;  4OXP A;  3K0Y A;  2NVY H;  1H8E A;  4QVA A;  1JA0 A;  5FK9 C;  2GQF A;  3QJY A;  2EVB A;  4CDD C;  2FFK B;  2WFW A;  2WJV A;  3ERQ A;  2XRS D;  4P3Y A;  4XXE A;  1S72 A;  5FO7 B;  3TS2 A;  1N33 L;  4K2K A;  3HOZ B;  4CKB A;  3CME A;  4PC1 A;  5I2Y A;  1FDR A;  1EFI D;  2UXB Q;  2KHJ A;  4KHV A;  1N9W A;  3DWQ A;  3HEJ A;  4AC9 A;  3I56 B;  1VQ7 B;  1YVC A;  2BDO A;  2I0Q A;  2GA4 B;  3ASP A;  3HOX G;  1ILP A;  1TWA H;  1VQO B;  4ZUI A;  1WTX A;  1KQS A;  4DV3 Q;  1B2T A;  1GHK A;  2HDL A;  2VNU D;  3PO2 B;  1Z9F A;  4OWW B;  1VQN B;  4OX9 Q;  4M53 A;  1I4G A;  2F52 A;  4XLA A;  4RH6 A;  4XN3 A;  1LTS D;  1VQC A;  3VMF A;  4DV5 Q;  2VNI A;  4IUP A;  1FNC A;  3OEH A;  1Y1W G;  2VZL A;  1ESF A;  1HA6 A;  3NEM A;  4IPD A;  1G6P A;  1JR0 D;  3MEF A;  2F3I A;  4CQJ A;  1DOM A;  4A3I H;  1SNO A;  3S9W A;  2ZTN A;  4DR6 L;  3B78 A;  5KNL A;  4I7A A;  1VQN A;  1G91 A;  2ZM6 L;  4LFB L;  3L0O A;  2K1B A;  1YJW A;  2YU9 H;  1YIJ B;  3A8K A;  1SDF A;  1QIL A;  2F0D A;  2R9V A;  1BKB A;  3VYT A;  1E1R A;  4CJ1 B;  3OTO L;  4FF1 A;  3PO3 B;  1VQJ A;  4M1K A;  3X3M A;  3HFZ B;  3FKS A;  1LTL A;  1TWH B;  1EFU A;  2KCC A;  5CV9 A;  3S1R B;  3R8B A;  4F7X A;  1FRN A;  1D5Z C;  1MD2 D;  3ZZ0 A;  1Q86 D;  5ELD A;  5E7N A;  1NE3 A;  1Q1B A;  1W2B B;  4A3F B;  4ZCI A;  3ASQ A;  3G48 A;  3I4N H;  2UXC L;  5JVG 3;  3SLN A;  2PQA B;  1IKM A;  4L5T A;  2ZZE A;  4BXX G;  5JEA J;  1XE1 A;  1TVC A;  4F8M A;  2IL8 A;  2JA5 H;  3V05 A;  3GD7 A;  2WSS A;  1QNK A;  1HUM A;  4WQM A;  1EEF D;  3W2D A;  1YX2 A;  1HR0 W;  4NMZ A;  3EJI A;  4C43 A;  1X32 A;  4MYU A;  1K8M A;  2R93 B;  1RDP D;  3BDO A;  2MQH A;  3KLR A;  4LWC A;  2JP1 A;  3I4M H;  1HZ9 A;  4AF7 A;  4H44 C;  2WAC A;  2X69 A;  5FLX E;  1EEI D;  2B2V A;  1IKL A;  1W9X A;  2LSS A;  2HDN B;  5CBE E;  3MXG A;  2VY3 A;  2RQX A;  3CPW B;  4ILW A;  4RHR A;  4CGY B;  3M4P A;  4Q7J B;  1FRQ A;  3NP8 A;  1Y1W H;  3CCV A;  5I9O A;  4DV1 L;  4DNT B;  1TLL A;  3ZPN A;  3PV0 A;  3X3N A;  1HHV A;  2Q2T A;  1EY4 A;  2B7B A;  3M4Q A;  3PUV A;  4NKL A;  3NUC A;  2QGG A;  4EQ5 A;  4F7D A;  5EJW A;  2UU9 L;  1PZJ D;  4ACB A;  4B3G A;  4PMW A;  1G29 1;  3TEH B;  4XQN A;  4JI5 Q;  4GZY C;  4DV5 L;  3MTS A;  1WJJ A;  4RM0 A;  1ROD A;  4A3G B;  4DR7 L;  3OAA A;  1N32 L;  1EY9 A;  2Z9H A;  1J9Z A;  1QFJ A;  3AVT A;  5DAU A;  1CM9 A;  2SNS A;  3J80 c;  2XN9 C;  1E22 A;  1ZEQ X;  2CKZ B;  1VQ5 B;  2WB1 E;  3T16 A;  4PC6 A;  4K5V A;  4GS3 A;  2E5L Q;  1QFZ A;  2KEE A;  3CES A;  2TSS A;  1IBK L;  3CAM A;  4BBS B;  4C3H H;  2XSC A;  1KLG D;  1OGJ A;  1XFO A;  2K5H A;  5C3W A;  3MXU A;  3CME B;  3RN2 A;  4PAA A;  4A3B H;  2R3Z A;  3A5Z B;  2CW5 A;  4A93 B;  1SYC A;  2B2T A;  1GUS A;  1A6X A;  1IW7 C;  3ZBT A;  1ENA A;  1SYE A;  3MXN B;  2UUB L;  3B8H A;  4JI0 Q;  4ZKC B;  4B3S L;  4OX9 L;  2OK7 A;  4ZCM A;  4Z4W A;  3TRE A;  3HOW H;  2DGY A;  2VNK A;  3CMA B;  1BCP C;  2CWP A;  5J35 A;  1X3G A;  4DQK A;  5M3F H;  3GTM B;  4ULL A;  2EYF A;  2F0J A;  4TN1 A;  1E0B A;  3DMU A;  3OFN A;  2SNM A;  2XIW A;  1STB A;  2GJR A;  4GKJ Q;  3OMG A;  4C3H B;  5E6T A;  2IX3 A;  1VQM A;  4B44 A;  4GN5 A;  3Q38 A;  1YLO A;  1JCK B;  1SMY D;  1XPR A;  4GOP C;  3TZD A;  3I55 A;  2I46 A;  3VNV A;  1LTG D;  2A73 B;  2HCI A;  3H6M A;  4A3B B;  3T56 B;  4Z4Z A;  3I2Z A;  4RA8 A;  3SGI A;  1EIG A;  1PXU A;  3GTO B;  4OEM B;  3ONY A;  1HNW L;  1GJR A;  2EDG A;  5M5W B;  5J1Z A;  3MCA A;  1VQL B;  1FNW A;  1O7I A;  2HQE A;  1JA1 A;  1EYC A;  2B2Y C;  5M5X H;  4IZ8 A;  5EKI A;  2YWE A;  1M4V A;  4TQU S;  2M2L A;  2QTL A;  3J7Y W;  1FR3 A;  1GOZ A;  3G6E A;  4EQP A;  1Y0Y A;  2J4X A;  2CRV A;  2X85 A;  1MSG A;  1SJE D;  2ZTC A;  2XGT A;  3IFD A;  3UDI A;  5HZA A;  1I4Q A;  4FF3 A;  2DIE A;  1LAC A;  3I55 B;  3S1N B;  1LTR D;  4QV2 A;  3R2I A;  4TSF A;  5KEE A;  5AFW A;  3S1Q H;  2F0O A;  1WYD A;  3PIO 3;  2DER A;  5I6Y A;  3U6B A;  4JG2 A;  1PHJ A;  3S1M B;  3G4S B;  3NWS A;  1IJF A;  1NB0 A;  5TR9 A;  5EPJ A;  4AQY Q;  2WJY A;  5NUC A;  3UE1 A;  2WR8 A;  5ISR A;  2F4V Q;  2F43 A;  5IYD G;  2XTI A;  2BGJ A;  3ASR A;  2FVG A;  4LF9 Q;  1JWU D;  4UP9 A;  1X55 A;  2R92 H;  4X3K A;  1AFP A;  2JA5 G;  1YI2 A;  2A19 A;  2Q8R E;  4KD3 A;  4YY3 Q;  1PZK D;  2RHQ B;  4K5W A;  3FPP A;  3QFC A;  2EJF C;  1QNU A;  1HRJ A;  1UEA B;  4DXF A;  4YWM A;  3K5L A;  4BY1 H;  4I65 A;  3H91 A;  4GNX A;  4ZLT F;  3CPW A;  1DDI A;  4JI6 L;  3S14 H;  3I4M B;  4NBS A;  3P1H A;  3E5S A;  1I18 A;  3HKZ B;  4JPB W;  4KI0 A;  2JA6 H;  1M90 D;  1PH1 A;  4IUV A;  2PYK A;  4JI2 Q;  2VQE L;  1ENC A;  1GUT A;  3CP0 A;  5HGQ A;  5JVH 3;  1WOS A;  1HVX A;  1PVO A;  1X65 A;  5TY0 A;  3PGZ A;  5IOC A;  2F0S A;  5F4O A;  4RGT A;  3UDG A;  2B5O A;  1SFO B;  1EQR A;  3KBG A;  2L55 A;  2YTX A;  4AYB E;  3A3B A;  4MZ9 A;  2Z8L A;  3PO3 H;  4Y9U A;  3OW2 A;  3MHP A;  3I90 A;  4R4I A;  2SDF A;  1D5X C;  4DPG A;  2DOG A;  4G7W A;  5CMD A;  5LMZ A;  1FNV A;  4X3S A;  2K33 A;  1S5B D;  3ES9 A;  4JI3 Q;  1UMK A;  4KKS A;  5COY A;  2VQF L;  1JT8 A;  1ZKO A;  2J0T D;  1ICF B;  4DNR B;  4H9G A;  1IHM A;  4GQN A;  4DR3 L;  1PH2 A;  3QWN A;  4JI7 L;  3S17 B;  4RCZ A;  5F4J A;  1KDC A;  1UD6 A;  1S5E D;  5BSY A;  2JA9 A;  1FYC A;  3GQB A;  1S0U A;  2NBF A;  2VJJ A;  1SE2 A;  4GKK Q;  1QUQ A;  2QDX A;  2FIN B;  1TS2 A;  4POG A;  1G51 A;  1NNX A;  3HG9 A;  3S2H H;  5IGG A;  4PMC A;  4QUC A;  1FJG L;  2EYP A;  2H1E A;  2KEN A;  5FOB B;  1BQQ T;  3KJO A;  2QTZ A;  4BPR A;  3QFS A;  1D6E C;  4M0L A;  4M1U B;  4UP7 A;  1SYB A;  1B44 D;  2GJP A;  4YHB A;  2EY1 A;  4BA1 I;  3GTQ H;  1VQK A;  4XKV A;  2RDG A;  3A3G A;  4G6I A;  4QL5 A;  3RUZ A;  1O78 A;  4N8X 1;  2BF4 A;  4FDB A;  4JC0 A;  1Y8N B;  1ILQ A;  1HTP A;  1WP6 A;  1QUQ B;  1R5B A;  3N52 A;  1QZG A;  3C2Q A;  3J80 L;  5FJ8 G;  2KVO A;  5A2Q E;  2UXD Q;  2WV6 D;  1N0V C;  4A3D H;  3CXC B;  5M3F B;  1Q82 D;  2HHH Q;  3GTM H;  1X3F A;  2FHT A;  1DOL A;  4XL9 A;  1EP3 B;  1C9O A;  4ZKB B;  3F2C A;  1DXM A;  4YWK A;  3BU2 A;  3ER0 A;  2ZBU A;  1T6Z A;  2CHB D;  3HKZ E;  3JAM E;  2HT1 A;  4EH1 A;  3D4R A;  1NMF A;  1DAR A;  5HY6 A;  4YIJ A;  4Z4V A;  1F9P A;  3U9S A;  1DDG A;  2V7V A;  1ONL A;  1V1P B;  3CCS B;  3VYS A;  4ACA A;  1EOV A;  1VHE A;  1GM5 A;  4X7E A;  1MAB A;  2AUK A;  1N34 L;  2F03 A;  1BBW A;  4JCV E;  1LTT D;  1RF2 D;  1U5K A;  4YEJ A;  4HAE A;  1E1T A;  1WU8 A;  3BY2 A;  2RSO A;  1G7S A;  3K81 C;  1G2T A;  4B3S Q;  1EQV A;  2DEU A;  4A3G H;  4U9U A;  4M2L A;  1WSV A;  4R8I A;  3CD6 B;  1KMH A;  4DU9 A;  4C56 C;  3RNU A;  1WD0 A;  4PC2 A;  1CHQ D;  2B2W C;  2K6A A;  2ZZQ A;  1PTO B;  4AIM A;  1KDA A;  5KGU A;  2JA7 H;  2F1L A;  1W0K A;  1HZB A;  4P73 A;  1SXT A;  3AVY A;  3D6C A;  5C6A A;  2B8F A;  3I4N G;  1KK0 A;  4RFB A;  2BH8 A;  4ZYS A;  3H3V I;  2A74 C;  1W3S A;  4RCN A;  3BYY B;  3RZO H;  1VLO A;  3B6Y A;  2E1B A;  3G05 A;  5IYQ A;  3PUZ A;  1FJG Q;  3PCO B;  4H7B A;  5L46 A;  4GN4 B;  4JYA Q;  1JJ2 B;  4C3I B;  3JAM c;  2F0V A;  4RGM A;  1IHZ A;  5C4X B;  5EPL A;  2EE1 A;  1B4O A;  2PMZ E;  4KLK A;  1QUF A;  2WB1 B;  1YJ9 A;  3H0G B;  2IWH A;  2RSN A;  2JN4 A;  4B3T Q;  3CCV B;  1QVC A;  4RG1 A;  1YNJ D;  4QB4 A;  3VR6 A;  1VHO A;  1SBB B;  2GPJ A;  2V7T A;  2UU9 Q;  2V1C C;  2A8V A;  2V7U A;  1CSP A;  4DV6 Q;  3S16 H;  2AQ1 B;  2X6Y A;  3U50 C;  1ELO A;  3DEP A;  3GO5 A;  1R5N A;  5C3E B;  1TUI A;  5LMN W;  1DGS A;  4X07 A;  5IYD H;  1SLJ A;  1H9K A;  2HQL A;  2JEA I;  1WPC A;  1SNM A;  4IPG A;  4EQO A;  3PF5 A;  2B7C A;  1XNQ L;  3A56 A;  3SR1 A;  4A3C H;  4P25 A;  4RLZ A;  2OF1 A;  2M9V A;  1B1Z A;  2E8G A;  4B3X A;  2MP1 A;  3I70 A;  1D1K A;  3PIP A;  4ID6 A;  2F0U A;  4TKO B;  2X8K A;  4BY1 G;  4R4Q A;  4OPO A;  2DET A;  1V8Q A;  3PEN A;  3D0F A;  2ZXR A;  3OZW A;  4P75 A;  1SRU A;  4OPS A;  2IY5 B;  1T9H A;  5CV4 A;  4IUN A;  1GHJ A;  1O80 A;  3V2T A;  2LXK A;  1J8I A;  4YAO A;  1BJK A;  3WBJ A;  4P2N A;  1U4R A;  2BOS A;  3TP7 A;  4OO1 I;  4ZGN B;  3NTK A;  2OQ0 A;  4PNY A;  1NR4 A;  2D2C C;  3LWU A;  1E2V A;  1I50 B;  1TII D;  2M00 A;  4NXN L;  2RC6 A;  2JA7 G;  4B3R Q;  3A54 A;  3V96 A;  1STY A;  1FND A;  4QCL A;  3E9I A;  5JEA G;  1ZM3 A;  4BBR G;  2B29 A;  1UEB A;  4L5Q A;  3VR2 A;  5TV2 A;  2B39 A;  3TSS A;  1YIJ A;  3CMA A;  1FNU A;  5G3L D;  3F2B A;  2AHO A;  3GTP H;  5C5L A;  1BBX C;  1TQO A;  5DNF A;  2F0K A;  2NVX H;  1R5O A;  3J80 E;  3PO3 G;  1I5F A;  4Z9C B;  3D26 A;  2L15 A;  5E4X A;  2VNJ A;  4A3B G;  1QX4 A;  1PKV A;  1IBM L;  2ZL5 A;  2H5X A;  2ZZG A;  3ULJ A;  3MZ5 A;  4IUT A;  2V4D A;  3KF6 B;  4M4S A;  3SK4 A;  2BN4 A;  4DR6 Q;  1H9R A;  2KHI A;  5FJ8 H;  1F9R A;  1IYJ B;  3KF8 B;  4C1N I;  5TSS A;  1A3U A;  2VZA A;  4IFD G;  2EYO A;  3MA2 B;  1HR0 L;  1JC7 A;  3Q39 A;  4IJL A;  2C2W A;  4OIK A;  5J3O A;  3PQI A;  4PMB A;  3U4V A;  2EXZ A;  4IW3 B;  2GVB A;  1WVL A;  2XGJ A;  3NBH B;  5CYU A;  1HZE A;  4ZQ3 A;  1QVG B;  2KHS A;  3E6Z X;  1I6V C;  1BUV T;  2OK8 A;  2EIX A;  4Z4Y A;  4GN3 B;  3LO8 A;  4DAY A;  3TN2 A;  3TQY A;  1IYU A;  2JIZ A;  4FYD A;  1F2Y A;  3R6J A;  3SJP A;  4HIZ A;  1A8V A;  4ZUJ A;  3OZU A;  4CHT B;  1XYI A;  4BA2 I;  1D2E A;  1F9Q A;  3KLS X;  5KIX A;  4X64 L;  1RIP A;  4C3J H;  2K05 A;  2MJ8 A;  4XYQ A;  5IYW A;  1WTP A;  1FGU A;  1AW7 A;  1OXS C;  1SND A;  5KRU A;  5KNB A;  2ATW A;  1TR5 A;  4DNI A;  2NVQ B;  2A6E D;  2B63 B;  3GTL B;  4XYO A;  3GTJ H;  4TRD A;  2MO1 A;  2E2J H;  1PJ7 A;  4IOA A;  2IT1 A;  1LTI D;  2D74 A;  1BO0 A;  2KCT A;  4LUV A;  2Q6I A;  5LMU L;  1V5V A;  2JSO A;  2EY6 A;  2EXD A;  2FMC A;  1XMO L;  2AMC B;  3ZBU A;  3ERO A;  2PMZ B;  1QGZ A;  5IWA Q;  4NB3 A;  5EBC A;  3OE7 A;  3EA6 A;  2A69 C;  4OWX B;  3AGP A;  1KRS A;  2K5D A;  2LZJ A;  3MFG A;  3E20 A;  5IYB H;  2DY1 A;  1P16 A;  4FWT A;  2XEX A;  5JAV A;  2F0Q A;  2PW5 A;  2VUM H;  1Q12 A;  1KAA A;  1R9T B;  2NVQ H;  3RZO B;  4OON A;  2Z6B A;  1H95 A;  3CQZ B;  3P26 A;  4LF5 Q;  4RKB A;  4FP5 D;  1L0X B;  4K8J A;  3CF5 A;  5IP9 H;  4K1X A;  4OP7 A;  4LFA L;  1E2Z A;  1KK3 A;  4B3M L;  2X6W A;  1EQQ A;  3CCM A;  4FF4 A;  2F0I A;  3HOV B;  3FPU B;  1RTO A;  4CBV A;  4K6D A;  3CC7 B;  2JEB I;  1B3Q A;  4J8Q A;  3A8J E;  3WND A;  4A75 A;  5C4J B;  1XB2 A;  2C78 A;  4DUY Q;  1CA5 A;  4R71 A;  3GTG H;  4TMX A;  4XDX A;  3CU7 A;  2X3U A;  1QFY A;  2ZTG A;  3RLO A;  4HR7 B;  2UUA L;  1Y8P B;  4YXW A;  3J81 j;  3PMF A;  3IRB A;  4ZCK A;  1IL8 A;  4I7Z C;  2QMU A;  2UUC L;  4FXD A;  4UP8 A;  1STH A;  5C3E H;  1TS4 A;  5IYC G;  4C3J G;  4G7X A;  1HA5 A;  3JU4 A;  3WY9 A;  1GO2 A;  1N07 A;  1D1N A;  1VQP B;  1H9M A;  2Q8T A;  2JA8 B;  2F3W A;  4WZE A;  2KOL A;  1F77 A;  4DAP A;  1IJE A;  3HZX A;  4OOV A;  3WDN A;  1F9S A;  4KD4 A;  4OHJ A;  2JA6 G;  4YHH L;  2TMP A;  3L9A X;  3J81 i;  3K57 A;  1CQX A;  3QSY A;  3R3O A;  4NNJ A;  4WFN 3;  3RR5 A;  3VYR A;  2X6X A;  2WAQ E;  1Y1V G;  5HKK A;  3LGJ A;  1HZA A;  4G1B A;  2L5T A;  1EU3 A;  1AZP A;  3JQP A;  2YTY A;  1EIH A;  3STB C;  4RD1 A;  3PUN A;  3MWY W;  1WTV A;  4GLA C;  1T5X D;  5IE8 A;  3CXC A;  2I1L A;  1I4R A;  3GTQ B;  3Q6Q A;  4C2M H;  5EKL A;  2EZV A;  3H3V C;  3WXM A;  4NDX A;  2KQ3 A;  3A74 A;  1EFW A;  5FKA C;  5C0X I;  5IYB G;  3HOX B;  1GD7 A;  1PFM A;  1STN A;  2K5Q A;  3DEO A;  4MNO A;  2HLD A;  4S3S A;  1VQF A;  2PI2 E;  2XZO A;  3OTO Q;  2DUD A;  1OO9 B;  3Q24 A;  2R7D A;  4BBS H;  2D62 A;  2VBU A;  4O1N A;  4HID A;  3TS0 A;  3H15 A;  1HNX L;  1FVI A;  1T6X A;  2MPM A;  2VBV A;  1BNZ A;  1V0F A;  1IW7 D;  4TMV A;  4DA2 A;  1XMQ Q;  4JBW A;  4L5R C;  4DUY L;  2BA0 A;  2QDL A;  1QCB D;  1ET6 A;  2JJQ A;  1K3R A;  5THX A;  3BZC A;  4QHY A;  1W0J A;  4NP5 A;  5DM6 3;  2NN6 I;  1CSQ A;  4KV6 A;  3HAG A;  1B23 P;  3K8A A;  4Z4U A;  2ZIT A;  2XRQ D;  3TP5 A;  4LBW A;  1TWC B;  1B7Y B;  3CCQ B;  1RCV D;  4B3M Q;  2BA1 A;  5C3E G;  2C9O A;  3VNU A;  1SE8 A;  4FK8 A;  1UE6 A;  4K8I A;  2BSA A;  4TMT A;  4X8I A;  1DZ1 A;  1O7L A;  4EGV A;  3HOW B;  4R4C A;  1AZQ A;  1YJW B;  5LHY 1;  1VQD A;  4XLE A;  2R61 A;  4RCY A;  2A5H A;  4OWT B;  4DR4 Q;  3C1F A;  4Y7C A;  3FPK A;  2PQE A;  4DUZ L;  2DNE A;  3UE0 A;  1TS3 A;  1ASZ A;  3HOU B;  1TS5 A;  5IWA L;  1OB0 A;  3CHB D;  3J80 i;  3L3O C;  3K59 A;  4CDC C;  4LF6 L;  1I6H B;  4P9S A;  2IHF A;  1AH9 A;  1LLR D;  1RD9 D;  1TWG H;  1V1O A;  1CKN A;  1OHH A;  4C0S A;  1KK2 A;  2KA7 A;  4LAA A;  4OGQ C;  3QFT A;  2C4T A;  1O7Y A;  2O4X A;  2A68 D;  1VQ6 A;  1G2S A;  2B2Y A;  1PH3 A;  2ZT9 C;  3EFX D;  1E64 A;  3AEV A;  4LC0 A;  2Y0S G;  3CRZ A;  1N36 L;  1G6Z A;  3S17 H;  3Q8D A;  4IPH A;  4Z4S A;  4YAU A;  1SE4 A;  5EGT A;  4X7C A;  1B3A A;  2EFG A;  4DK6 C;  3CQZ H;  3PUY A;  1LUZ A;  2V7Q A;  1VDZ A;  1TTT A;  2RVL A;  1HFG A;  3BG3 A;  4FVM A;  3VR4 A;  4HJ8 A;  1TWF H;  5EQ0 A;  4LF7 Q;  3CW2 A;  5FLM G;  3S2D H;  1EZ6 A;  3J81 c;  3QG1 A;  1Q46 A;  3CCL A;  4DK1 A;  3KOJ A;  2ZXI A;  3OW2 B;  2BPO A;  2WKC A;  1E2W A;  2X6L A;  4FN5 A;  1BQE A;  3J7Z C;  1LV9 A;  2PZU A;  2YV5 A;  5C44 G;  4RD6 A;  1U9R A;  2M5S A;  4JI4 Q;  5JJZ A;  5EPK A;  5HGT A;  2G5D A;  5K36 G;  3FKI B;  4IUU A;  1Q86 C;  1JOK A;  3KBX A;  1D2B A;  4YAF A;  1KLU D;  2J7K A;  3P75 A;  4GNX C;  4HCE A;  5BR8 Q;  4KHP Q;  2NZO A;  4KY6 A;  1MI2 A;  4DV0 Q;  4OIJ A;  2YYZ A;  4JOI A;  1SEB D;  1JIC A;  1S5D D;  1JOR A;  3VA5 A;  2RKS A;  2QEJ C;  4FNF A;  1KZL A;  4WRD A;  2E2J B;  3I4O A;  5E3F A;  3GTJ B;  2K04 A;  1S5F D;  3VA7 A;  2I5H A;  1KJZ A; 
#chains in the Genus database with same CATH homology
 3DM1 A;  1BCP B;  2O5I C;  2XZP A;  3MAQ A;  2ZXP A;  3A55 A;  3PUX A;  3BH4 A;  1TVX A;  4LK1 C;  2ENB A;  2DY8 A;  1H9S A;  4IUQ A;  4V0B A;  3CMM A;  3D6W A;  1HCZ A;  3GVL A;  1BF4 A;  3QO2 A;  4XOR A;  3I4L A;  1EY0 A;  4G57 A;  5BN5 A;  4JMQ A;  2CQA A;  1YNJ C;  3PIP 3;  1FD7 D;  1U4M A;  5CC4 A;  2PW7 A;  4OL7 A;  1F2Z A;  1PRT C;  1JWS D;  3M7G A;  5IK2 A;  4X3U A;  2KVM A;  3CRL C;  4L8J A;  1QWY A;  4KJO A;  4RGO S;  2E75 C;  1V43 A;  2NVX B;  4N9T A;  3IKJ A;  4PV1 C;  2PZW A;  2Z6B D;  3BVG A;  5IGD A;  1COW A;  1ZYR D;  2L12 A;  3Q6S A;  4IFD H;  3D8G A;  1WTO A;  1SYF A;  4HSV A;  3C46 A;  4BS9 A;  2MGS A;  2F0L A;  2CK3 A;  1TT2 A;  1DYQ A;  2AWN A;  1HUN A;  3TP8 A;  1RTN A;  5A2Q L;  1PYW D;  3SE0 A;  2DN8 A;  4X3T A;  1RHP A;  2F0E A;  1W6J A;  2LY7 A;  4O42 A;  4CKE A;  1W6K A;  1GUN A;  1PRT B;  1EL0 A;  3S14 B;  1Z6H A;  2G9D A;  2L1B A;  2GJK A;  1JB3 A;  4M8A A;  1CA6 A;  4BY1 B;  2JA6 B;  2YU9 B;  2PO4 A;  3SEB A;  1BOS A;  2K5W A;  2VJI A;  4KMU C;  1PFB A;  4HED A;  3H09 A;  2L9H A;  1LAB A;  1Y69 U;  4ZK9 B;  1YNN D;  3M7N A;  2WIN B;  4B9X A;  2EY2 A;  1SNQ A;  1PMR A;  2F1M A;  2H4O A;  5M5Y B;  3A8K E;  3AU7 A;  1ZYR C;  5BN3 A;  5LL6 X;  4IAL A;  3P20 A;  2F3V A;  1SYG A;  1CZG A;  3GV6 A;  3KUP A;  1NSN S;  2B2T C;  1E3Z A;  4DXG A;  1SE3 A;  4A3K B;  2B2U C;  1CHP D;  1PRT F;  4XQJ A;  3OWE B;  1STE A;  5J22 A;  2LMC B;  2O2L D;  5IGC A;  1F2M A;  1E1Q A;  5E1F A;  1DJR D;  2R6G A;  2IPK D;  3TP6 A;  5C0X H;  1K83 B;  4G7O C;  3U9O A;  1VF7 A;  4BWG B;  3R2T A;  2KEC A;  1D5M C;  5FO8 B;  1QG7 A;  4A3D B;  4XTC S;  4LMQ D;  1B9M A;  3IL8 A;  2AQ3 B;  4WJW A;  3RMH A;  4HMJ A;  5FLX L;  1UNS A;  2LS0 1;  3D4D A;  5ELB A;  1WTR A;  3LNN A;  1A3T A;  3AB9 A;  1X3Q A;  2D9U A;  1Q3L A;  2XOK A;  1EYA A;  3MEH A;  5CDF A;  2E2D C;  5J39 A;  2LFN A;  2RDH A;  1GUG A;  1EQT A;  5CV6 A;  3OIP A;  2Y0S B;  1GUW A;  4F87 A;  2XWB B;  2XZL A;  1H8H A;  4CKC A;  3FDT A;  5T1I A;  4MHE A;  1JQY D;  2WZP P;  1ET9 A;  3Q23 A;  2CVR A;  1SMY C;  3LWE A;  4XKW A;  4IUR A;  2NTS A;  1Y1W B;  3DWP A;  4DN4 M;  1CZW A;  3BCD A;  3DDY A;  1B9N A;  4E6I A;  1R4Q B;  3IFT A;  2N55 A;  4FXK C;  1VCI A;  4R9W A;  2B2U A;  3A7A B;  4H13 C;  3SK6 A;  1LT5 D;  4KN4 C;  3HS0 C;  3M4Y A;  2ICI A;  2IW3 A;  3K58 A;  3SDZ A;  1Z47 A;  3BZD B;  4G7Z C;  3GVK A;  4IFD J;  4BBR B;  5KNC A;  4A3M B;  2JJ2 A;  2QCP X;  1S4Z A;  3BYT B;  2HUG A;  4NW2 A;  3M3Y B;  3DWA A;  1EWH A;  5EBD A;  4RHS A;  3L7Z C;  1GXD C;  3BDC A;  1TWA B;  3EQL C;  5K36 H;  2F0H A;  4P2C B;  2WP8 J;  3ZYY X;  2NZ1 D;  4QUF A;  1EOT A;  5IIF A;  2K28 A;  5JPM C;  1E43 A;  2F4I A;  1ML0 D;  2EYL A;  1PFN A;  3I91 A;  4FF2 A;  2R7Z B;  3RZD B;  1PLF A;  1VF5 C;  3OOC A;  3T51 B;  1XXG A;  1CTM A;  3G6J B;  1UD5 A;  1TKW B;  4Q5V A;  3DXJ C;  3C2P A;  3MXP A;  2O5J C;  2SEB D;  1XX8 A;  1NCV A;  4XQQ A;  5C0X G;  4ASU A;  1HQM C;  2K7V A;  1O7Z A;  5DN6 A;  1X3P A;  2MHV A;  2ZXH A;  5DM7 3;  2DNC A;  2NN6 H;  3MVV A;  2QF7 A;  3NBH A;  2E74 C;  2JYO A;  1Q1E A;  5I2X A;  3CKI B;  2WPD A;  3EVQ A;  4XNF A;  3DHQ A;  3J7A V;  1LT6 D;  4QIW B;  2HDM A;  1VMC A;  1CT1 D;  3GVJ A;  2C5C A;  1AEX A;  5M9O A;  3OEE A;  1K28 D;  5I9P A;  4XT1 B;  2J7Z A;  4R8N A;  1I4X A;  2JDI A;  4FXG C;  2BE5 D;  1UD4 A;  1AP0 A;  4K5X A;  2G9H D;  1WTW A;  5C0X J;  1U4P A;  1II3 A;  1JWM D;  1K8O A;  5KND A;  4AVZ A;  2KCN A;  2EPB A;  3URY A;  3I8Z A;  3S15 B;  1Q90 A;  1BMF A;  4KKU A;  4RKL A;  5I4D A;  5DEH A;  3GTP B;  4MIU A;  2ICE C;  5K5P A;  2DY7 A;  4QMG A;  4BY7 B;  3QOJ A;  4ZRZ A;  3SK5 A;  4HN7 A;  1L0Y B;  2Z1C A;  4U67 3;  2N88 A;  2BDN A;  4XOP A;  1C4Q A;  5ELF A;  2VXW A;  3R93 A;  5EKK A;  5C4H A;  4KTA A;  5D65 A;  3I72 A;  1RJT A;  1SNP A;  2NYZ D;  4K2L A;  1SNC A;  3M4O B;  4V19 0;  2VB2 X;  4FO2 A;  5I6W A;  1QJO A;  4JK1 C;  3NTH A;  2R92 B;  3E0J A;  2X53 S;  2JA7 B;  4C3J B;  2F0F A;  5F2D A;  5T1G A;  1VMP A;  4C1N K;  4XD7 A;  1DM0 B;  5IT9 E;  1EY5 A;  4AYB B;  3JAM L;  4MN3 A;  2F0N A;  3CRK C;  2V31 A;  3KEW A;  2AWO A;  5IGE A;  3ZIA A;  3WOE A;  2RA4 A;  5CBA E;  2A6E C;  4A3E B;  4CJ2 C;  2ZXO A;  2EYH A;  3D4W A;  3BVM A;  2MUY A;  2IX0 A;  3Q22 A;  1TY0 A;  3T13 A;  1TY2 A;  5IGF A;  4IFD I;  2GK7 A;  4J6H A;  4YEL A;  1J9O A;  3FVQ A;  5IGB A;  1C48 A;  2FMM A;  1A15 A;  1EWC A;  3J81 E;  5CV8 A;  1MGS A;  2XWJ B;  2KUM A;  1A3V A;  3ND9 A;  3NXW A;  4L63 B;  5D14 A;  4XN0 A;  2QKI C;  1M8A A;  3HGB A;  3I3C A;  4G7H C;  4UAI A;  1E79 A;  3OMC A;  2NVY B;  1WTH D;  5CV5 A;  5HUR A;  1ENF A;  4DFA A;  1WD1 A;  4N9P A;  3QB3 A;  1SYD A;  2AUJ D;  2BE5 C;  2B2V C;  3TDQ A;  1VJS A;  5D3D A;  4HTH A;  2PCF B;  1Z7T A;  1QE6 A;  4HCS A;  3TBI B;  3C1E A;  3MHB A;  4EQN A;  3HRZ C;  2NTT A;  1NR2 A;  1PZI D;  3S2H B;  1MSH A;  1UUP A;  1A2T A;  1EZ8 A;  2F0W A;  2NWG A;  4KJN A;  1I3Q B;  2JJ1 A;  1DD2 A;  4Y7N B;  1B50 A;  1STG A;  3P7J A;  2QE7 A;  1LTB D;  1TU2 B;  2EYM A;  3GP7 A;  2GK6 A;  1SSO A;  1PTO H;  3M85 A;  3NBI A;  3A35 A;  3WOF A;  1CFM A;  5D3I B;  3ITP A;  3TZU A;  1NBM A;  3KK7 A;  2EOT A;  1KNA A;  3RLF A;  4P22 A;  5M5X B;  1Y1V B;  1NUC A;  4XLF A;  2XVS A;  1GJX A;  4Z1M A;  1SKY B;  1XTC D;  1CK1 A;  2JE6 I;  5IOD A;  2D5D A;  3RD4 A;  2VUM B;  1VLY A;  2F0G A;  2A69 D;  2K03 A;  1C8C A;  2CW0 D;  3SHL A;  1JOQ A;  1BCP F;  4LJZ C;  4ME5 A;  2NVT B;  3FMC A;  2FJ2 A;  3T53 B;  2HCC A;  4XLH A;  1Y8O B;  1A2U A;  4CJ0 B;  3BVZ A;  5ELE A;  2L11 A;  1LTA D;  2Q8I B;  1OXV A;  3ND8 A;  5JPN C;  3NTI A;  3J81 L;  1HQR D;  1YNN C;  4RGN A;  2B8G A;  3H94 A;  4K6L A;  4IN3 A;  5LL6 S;  4DF7 A;  2ID0 A;  3BCF A;  2W6I A;  3Q0A A;  2NUC A;  3VYU A;  4KK7 A;  3K5O A;  3UI2 A;  5A35 A;  2LKV A;  1WTQ A;  2IX1 A;  4OO1 H;  4HMI A;  2EJG C;  2NB0 A;  1FGB D;  1H9J A;  4ZAI A;  1SJH D;  3S16 B;  1ESR A;  2A6H D;  2RBM A;  4F88 A;  4C3H G;  1B53 A;  4HSP A;  5KYL A;  2KED A;  1JE4 A;  1F2L A;  4XON A;  1KAB A;  3KLS A;  4RCO A;  2K32 A;  2WKD A;  2D3N A;  4WOR A;  2ZZF A;  4A3J B;  1CQV A;  3I73 A;  5KYI A;  2NN6 G;  4RAU C;  2BCO A;  4UZU A;  3SVM A;  4B3F X;  4XMY A;  3NK9 A;  3GTG B;  1LO5 D;  2E76 C;  1TWF B;  2Z4H A;  3IAY A;  1JOO A;  1G8Z D;  2E2I B;  5C44 B;  1BLI A;  2F0P A;  4RWS C;  3OWF A;  3LX0 A;  3BC9 A;  2Z4I A;  2K01 A;  2SOB A;  3S2D B;  1UAP A;  3I4N B;  4L6T B;  2RDF A;  4Q0F A;  3W3A A;  3GTK B;  1UD2 A;  1OXT A;  1AN8 A;  3GV3 A;  4C3I G;  1PTO C;  3S1Q B;  2XND A;  1KNE A;  5FL7 A;  2JA5 B;  3BDL A;  1FX0 A;  3NPP A;  2WII B;  3J7A F;  3SXH A;  1QB5 D;  1HTL D;  3K5M A;  1HFN A;  1BPL A;  1SAP A;  4PQX A;  2F0M A;  1TWG B;  3QIA A;  1HXY D;  1KDB A;  3NQI A;  2I07 B;  4XM3 A;  1HPC A;  1LT4 D;  3NWT A;  4XT3 B;  3C3L A;  2PNR C;  3D3R A;  4A3I B;  3OW7 A;  3TME A;  3O13 A;  1NAP A;  5M3M B;  1IYV A;  3A7L A;  2QDB A;  3DUZ A;  3QOL A;  3CP2 A;  3HP3 A;  4KY7 A;  3FRP B;  4DK0 A;  3ONA B;  3SK8 A;  4E0F A;  4FXU A;  2VB3 X;  4DAV A;  1BXT A;  3BS1 A;  5BN4 A;  4XR6 A;  3NSW A;  4KN7 C;  3OHX C;  3HOY B;  2OXP A;  4UDU C;  4KKT A;  1H9S B;  5C3X A;  1CQF A;  2IJ0 A;  4XLC A;  3WQZ A;  1R4P B;  2EY5 A;  4EVO A;  1EY6 A;  1DOK A;  2B2W A;  3A8I E;  1STA A;  5COR A;  2OEO A;  1BCP D;  1DON A;  5C5M A;  4C2M B;  3VR3 A;  1PTO D;  1BDO A;  1S5C D;  2EJM A;  2XNA C;  3N6R A;  2OT2 A;  4K14 A;  1OXX K;  3K6O A;  1ZXT A;  3NQT A;  3AMU A;  2A68 C;  2PPB C;  1KTK A;  1EFR A;  3D31 A;  3NHH A;  5ELC A;  2PZT A;  1U4L A;  2A6H C;  1V1P A;  1D1I A;  5CGK A;  1LT3 D;  3K7A B;  2QIL A;  4B08 A;  4B9W A;  1MBY A;  5CR3 A;  3FEW X;  4II3 A;  5JOB A;  1EYD A;  1PRT D;  1CI3 M;  3K5N A;  2JXM B;  2E2H B;  4IQZ A;  2L4N A;  4G4K A;  2X6G A;  1PDQ A;  3OPO A;  3MFY A;  1Q8I A;  1QOH A;  5E4W C;  3MC0 B;  4XQF A;  2WAQ B;  4J1M A;  2KJX A;  4ABN A;  5G3L F;  1I4P A;  1DCZ A;  4XOT A;  5JEA H;  5FO9 B;  2EYJ A;  5IT9 L;  1UD8 A;  4TT3 A;  2W6J A;  4DGZ A;  1EY7 A;  1XWE A;  1V0E A;  4OO1 G;  3T4A C;  4II2 A;  1T5E A;  3F2U A;  3NE5 B;  1OXU A;  3CP8 A;  3VR5 A;  3MXN A;  1WCM B;  1E3X A;  3OSO A;  2AQ2 B;  4ODG A;  1UD3 A;  4KY5 A;  5C4Z A;  3G7L A;  3KF8 A;  5CV7 A;  1GUO A;  1I4H A;  2D3L A;  4KHZ A;  4TSS A;  1NRK A;  1ICW A;  2F0T A;  2CW0 C;  4XIG S;  4QF4 A;  3PUW A;  1EY8 A;  1BR9 A;  1I8D A;  3OIQ A;  1PTO F;  1RKN A;  1EU4 A;  4H0L C;  4U68 A;  2L0C A;  3K0Y A;  1H8E A;  5FK9 C;  3QJY A;  2EVB A;  2FFK B;  2WJV A;  3ERQ A;  2XRS D;  4XXE A;  5FO7 B;  4K2K A;  3HOZ B;  4CKB A;  5I2Y A;  1EFI D;  4KHV A;  3DWQ A;  3HEJ A;  2BDO A;  2GA4 B;  1ILP A;  4ZUI A;  1WTX A;  1B2T A;  1GHK A;  2HDL A;  2VNU D;  3PO2 B;  1I4G A;  4XLA A;  4RH6 A;  4XN3 A;  1LTS D;  4IUP A;  3OEH A;  1ESF A;  1HA6 A;  1JR0 D;  1DOM A;  1SNO A;  3S9W A;  2ZTN A;  5KNL A;  1G91 A;  2K1B A;  4CJ1 B;  1QIL A;  1SDF A;  2F0D A;  3VYT A;  2R9V A;  1E1R A;  4FF1 A;  3PO3 B;  3X3M A;  3FKS A;  1TWH B;  2KCC A;  5CV9 A;  3S1R B;  3R8B A;  4F7X A;  1D5Z C;  1MD2 D;  5ELD A;  1Q1B A;  4A3F B;  5JVG 3;  1IKM A;  2ZZE A;  5JEA J;  4F8M A;  2IL8 A;  3V05 A;  3GD7 A;  2WSS A;  1QNK A;  1HUM A;  1EEF D;  3W2D A;  4NMZ A;  3EJI A;  1X32 A;  1K8M A;  2R93 B;  1RDP D;  3BDO A;  3KLR A;  2JP1 A;  4H44 C;  2WAC A;  2X69 A;  5FLX E;  1EEI D;  2B2V A;  1IKL A;  1W9X A;  5CBE E;  3MXG A;  2RQX A;  4ILW A;  4RHR A;  4CGY B;  3NP8 A;  5I9O A;  4DNT B;  3PV0 A;  3ZPN A;  3X3N A;  1HHV A;  1EY4 A;  3PUV A;  4NKL A;  3NUC A;  5EJW A;  1PZJ D;  4B3G A;  4XQN A;  4PMW A;  1G29 1;  4GZY C;  3MTS A;  1ROD A;  4A3G B;  3OAA A;  1EY9 A;  5DAU A;  1CM9 A;  2SNS A;  2XN9 C;  1ZEQ X;  3T16 A;  4K5V A;  2KEE A;  3CES A;  2TSS A;  4BBS B;  2XSC A;  1KLG D;  5C3W A;  3MXU A;  2R3Z A;  4A93 B;  1SYC A;  2B2T A;  1GUS A;  1A6X A;  1ENA A;  1IW7 C;  1SYE A;  4ZKC B;  1BCP C;  3GTM B;  4ULL A;  2EYF A;  2F0J A;  1E0B A;  3DMU A;  3OFN A;  2SNM A;  2XIW A;  1STB A;  2GJR A;  3OMG A;  4C3H B;  2IX3 A;  1JCK B;  1SMY D;  3TZD A;  2I46 A;  2A73 B;  1LTG D;  2HCI A;  3H6M A;  4A3B B;  4RA8 A;  3T56 B;  3GTO B;  1EIG A;  1PXU A;  2EDG A;  5M5W B;  5J1Z A;  1FNW A;  2HQE A;  1EYC A;  2B2Y C;  4IZ8 A;  5EKI A;  1M4V A;  4TQU S;  2M2L A;  3J7Y W;  1FR3 A;  1GOZ A;  4EQP A;  2J4X A;  3IFD A;  2X85 A;  1MSG A;  1SJE D;  4FF3 A;  1I4Q A;  2DIE A;  1LAC A;  3S1N B;  1LTR D;  3R2I A;  4TSF A;  5KEE A;  5AFW A;  2F0O A;  3PIO 3;  5I6Y A;  3S1M B;  3NWS A;  5EPJ A;  2WJY A;  5NUC A;  5ISR A;  2F43 A;  1JWU D;  4X3K A;  1AFP A;  2Q8R E;  4KD3 A;  1PZK D;  4K5W A;  3FPP A;  2EJF C;  1QNU A;  1HRJ A;  1UEA B;  4DXF A;  3K5L A;  4I65 A;  3H91 A;  4ZLT F;  3I4M B;  3P1H A;  3E5S A;  1I18 A;  3HKZ B;  4KI0 A;  4IUV A;  2PYK A;  1ENC A;  1GUT A;  5JVH 3;  1HVX A;  5IOC A;  2F0S A;  4RGT A;  1SFO B;  3KBG A;  2L55 A;  3A3B A;  2Z8L A;  3I90 A;  2SDF A;  1D5X C;  4G7W A;  5CMD A;  1FNV A;  4X3S A;  2K33 A;  1S5B D;  4KKS A;  5COY A;  1ZKO A;  2J0T D;  4DNR B;  4GQN A;  3S17 B;  3QWN A;  1KDC A;  1UD6 A;  1S5E D;  1FYC A;  3GQB A;  2NBF A;  2VJJ A;  1SE2 A;  2FIN B;  1TS2 A;  3HG9 A;  5IGG A;  4PMC A;  4QUC A;  2EYP A;  2H1E A;  5FOB B;  1BQQ T;  1D6E C;  4M1U B;  1SYB A;  1B44 D;  2GJP A;  2EY1 A;  4BA1 I;  4XKV A;  2RDG A;  3A3G A;  4G6I A;  3RUZ A;  1O78 A;  1Y8N B;  1ILQ A;  1HTP A;  1WP6 A;  3N52 A;  3J80 L;  2KVO A;  5A2Q E;  2WV6 D;  5M3F B;  2FHT A;  4XL9 A;  1DOL A;  4ZKB B;  1DXM A;  2CHB D;  3JAM E;  3D4R A;  4YIJ A;  1F9P A;  3U9S A;  1ONL A;  1V1P B;  3VYS A;  1MAB A;  2AUK A;  2F03 A;  1LTT D;  1RF2 D;  4YEJ A;  4HAE A;  2RSO A;  1G2T A;  1EQV A;  4R8I A;  1KMH A;  4DU9 A;  4C56 C;  1WD0 A;  1CHQ D;  2B2W C;  2K6A A;  2ZZQ A;  1PTO B;  1KDA A;  5KGU A;  1W0K A;  1SXT A;  3D6C A;  5C6A A;  2B8F A;  4RFB A;  4ZYS A;  2A74 C;  4RCN A;  3BYY B;  2E1B A;  3G05 A;  3PUZ A;  4H7B A;  4C3I B;  2F0V A;  4RGM A;  1IHZ A;  5C4X B;  5EPL A;  2EE1 A;  1B4O A;  2WB1 B;  3H0G B;  2IWH A;  2RSN A;  1YNJ D;  4QB4 A;  3VR6 A;  1SBB B;  2AQ1 B;  2X6Y A;  3DEP A;  3GO5 A;  5C3E B;  1H9K A;  2JEA I;  1WPC A;  1SNM A;  4EQO A;  3A56 A;  3SR1 A;  2OF1 A;  2M9V A;  1B1Z A;  2MP1 A;  3I70 A;  1D1K A;  4ID6 A;  2F0U A;  4TKO B;  2X8K A;  1V8Q A;  2ZXR A;  5CV4 A;  4IUN A;  1GHJ A;  1O80 A;  3V2T A;  1J8I A;  2BOS A;  4OO1 I;  1U4R A;  3TP7 A;  3NTK A;  4PNY A;  1NR4 A;  2D2C C;  3LWU A;  1E2V A;  1I50 B;  1TII D;  2M00 A;  3A54 A;  3V96 A;  1STY A;  4QCL A;  5JEA G;  3VR2 A;  2B39 A;  3TSS A;  1FNU A;  5G3L D;  5C5L A;  1BBX C;  1TQO A;  5DNF A;  2F0K A;  3J80 E;  4Z9C B;  5E4X A;  1PKV A;  2ZZG A;  3MZ5 A;  4IUT A;  2V4D A;  3SK4 A;  1H9R A;  1F9R A;  4C1N I;  5TSS A;  1A3U A;  4IFD G;  2EYO A;  3MA2 B;  1JC7 A;  4OIK A;  4PMB A;  2EXZ A;  1WVL A;  2XGJ A;  5CYU A;  1HZE A;  4ZQ3 A;  2KHS A;  3E6Z X;  1I6V C;  1BUV T;  4DAY A;  3TN2 A;  1IYU A;  2JIZ A;  4FYD A;  1F2Y A;  4HIZ A;  4ZUJ A;  1XYI A;  4CHT B;  4BA2 I;  1F9Q A;  3KLS X;  5KIX A;  2K05 A;  2MJ8 A;  4XYQ A;  1WTP A;  1SND A;  1AW7 A;  1OXS C;  5KRU A;  5KNB A;  2NVQ B;  1TR5 A;  2A6E D;  2B63 B;  3GTL B;  4XYO A;  4TRD A;  2IT1 A;  1LTI D;  1BO0 A;  2JSO A;  2EY6 A;  2FMC A;  3ERO A;  2PMZ B;  5EBC A;  3OE7 A;  3EA6 A;  2A69 C;  2K5D A;  2LZJ A;  3MFG A;  5JAV A;  2F0Q A;  2PW5 A;  1Q12 A;  1KAA A;  1R9T B;  3RZO B;  3CQZ B;  4RKB A;  4FP5 D;  1L0X B;  4K8J A;  1E2Z A;  2X6W A;  4FF4 A;  2F0I A;  3HOV B;  3FPU B;  1RTO A;  4CBV A;  4K6D A;  2JEB I;  4J8Q A;  3A8J E;  5C4J B;  1CA5 A;  4XDX A;  3CU7 A;  2ZTG A;  4HR7 B;  1Y8P B;  4YXW A;  3PMF A;  1IL8 A;  4I7Z C;  4FXD A;  1STH A;  1TS4 A;  4C3J G;  4G7X A;  1HA5 A;  3JU4 A;  1H9M A;  2Q8T A;  2JA8 B;  2F3W A;  2KOL A;  1F77 A;  4DAP A;  3HZX A;  3WDN A;  1F9S A;  4KD4 A;  4OHJ A;  2TMP A;  3L9A X;  3K57 A;  3R3O A;  4NNJ A;  4WFN 3;  3VYR A;  2X6X A;  5HKK A;  2L5T A;  1EU3 A;  1AZP A;  1EIH A;  3MWY W;  1WTV A;  1T5X D;  1I4R A;  3GTQ B;  5EKL A;  2EZV A;  3H3V C;  4NDX A;  2KQ3 A;  3HOX B;  5FKA C;  5C0X I;  1PFM A;  1STN A;  2K5Q A;  3DEO A;  4S3S A;  2HLD A;  2XZO A;  1OO9 B;  3Q24 A;  2D62 A;  4O1N A;  2MPM A;  1BNZ A;  1V0F A;  1IW7 D;  4DA2 A;  4JBW A;  2BA0 A;  1QCB D;  1ET6 A;  1W0J A;  4NP5 A;  5DM6 3;  2NN6 I;  4KV6 A;  3HAG A;  3TP5 A;  2XRQ D;  1TWC B;  1RCV D;  2BA1 A;  2C9O A;  4K8I A;  1DZ1 A;  1O7L A;  4EGV A;  3HOW B;  1AZQ A;  5LHY 1;  4XLE A;  2R61 A;  2A5H A;  3C1F A;  2PQE A;  2DNE A;  1TS3 A;  3HOU B;  1TS5 A;  1OB0 A;  3CHB D;  3L3O C;  3K59 A;  1I6H B;  1LLR D;  1RD9 D;  1V1O A;  1OHH A;  4LAA A;  2KA7 A;  4OGQ C;  2O4X A;  1O7Y A;  2A68 D;  1G2S A;  2B2Y A;  2ZT9 C;  3EFX D;  1G6Z A;  5EGT A;  1SE4 A;  1B3A A;  3PUY A;  2V7Q A;  1VDZ A;  2RVL A;  1HFG A;  3BG3 A;  4FVM A;  3VR4 A;  5EQ0 A;  1EZ6 A;  3QG1 A;  4DK1 A;  2ZXI A;  2WKC A;  1E2W A;  2X6L A;  1LV9 A;  2PZU A;  1U9R A;  2M5S A;  5JJZ A;  5EPK A;  5HGT A;  5K36 G;  3FKI B;  4IUU A;  1JOK A;  3KBX A;  1D2B A;  1KLU D;  3P75 A;  4HCE A;  4KY6 A;  1MI2 A;  4OIJ A;  2YYZ A;  1SEB D;  1JIC A;  1S5D D;  1JOR A;  3VA5 A;  2RKS A;  2QEJ C;  4FNF A;  1KZL A;  4WRD A;  2E2J B;  5E3F A;  3GTJ B;  2K04 A;  1S5F D;  3VA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...