3T51B

Crystal structures of the pre-extrusion and extrusion states of the cusba adaptor-transporter complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
322
structure length
322
Chain Sequence
ASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Charged Amino Acids (R83, E567, D617, E625, R669, and K678) of CusA Are Required for Metal Ion Transport in the Cus Efflux System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Cation efflux system protein CusB
total genus 48
structure length 322
sequence length 322
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16572 HlyD_D4 Long alpha hairpin domain of cation efflux system protein, CusB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.170 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3t51B02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3t51B03
2.40.420.20 Mainly Beta Beta Barrel conserved putative lor/sdh protein from methanococcus maripaludis s2 fold conserved putative lor/sdh protein from methanococcus maripaludis s2 fold 3t51B01
3D31A 3MFYA 4IQZA 3D4RA 1GJXA 3FMCA 3A7LA 4KN7C 3ND9A 1Z7TA 1GUGA 2F1MA 2ZT9C 1Y8PB 1E2VA 1Q90A 4JBWA 4IFDH 3TZUA 2E75C 3M4YA 2A69D 1H9KA 4XTCS 3SE0A 5KNDA 3PUWA 2BDOA 2IT1A 4H44C 4TQUS 3HGBA 5BN4A 1GUSA 3WDNA 4G7HC 1DD2A 4H0LC 1DCZA 2KCCA 3T53B 2AUKA 5A35A 4OGQC 1B9MA 2JEBI 2BA0A 2NN6I 1E2WA 3VR5A 1H9RA 1OXSC 1OXUA 2EJMA 4KKSA 3LNNA 5C0XG 1GUNA 1VCIA 4PV1C 3A8IE 1Q12A 3PUYA 1DXMA 3VR3A 3M7NA 2Q8IB 4KMUC 2KA7A 2D62A 1LABA 1B9NA 3QJYA 1YNJC 1Q1BA 2A6ED 2K7VA 1CFMA 1TU2B 3CRKC 2DN8A 2NN6H 1Q1EA 4IFDG 4KKUA 1K8MA 3BG3A 3KLRA 3T51B 2JXMB 4GZYC 2BA1A 2AUJD 2A6HC 2B8FA 2NN6G 4BA1I 4I7ZC 1GUTA 1Y69U 2R6GA 3I4LA 5KNBA 2A69C 1PMRA 3OOCA 1A6XA 2V4DA 2EJFC 3U9SA 1GHKA 4L8JA 1LACA 2K33A 3P20A 3PUVA 1HQMC 1V8QA 3PUXA 5K36G 4LJZC 3A7AB 3ND8A 2EJGC 5JEAH 1IYVA 4KKTA 4HR7B 1G291 3RLFA 1O78A 2A68D 2YYZA 3CRLC 3OW7A 3IFTA 3LWUA 3OPOA 1HCZA 3VR2A 3I72A 1QJOA 3T56B 1T5EA 2EVBA 1HPCA 3I73A 4LK1C 3SDZA 4KHZA 3GQBA 3BDOA 4KI0A 1BDOA 5C0XH 1IW7D 3QG1A 5BN5A 1IYUA 3FPPA 1ZYRC 1OXXK 3MXUA 1EWHA 2A6HD 2PPBC 2BE5D 1O7LA 2EDGA 2E76C 1Y8NB 3H94A 4OO1G 1SMYC 5KNCA 1VF7A 1IW7C 5JEAG 1FR3A 1E2ZA 1GHJA 2O5JC 1H9SB 1Y8OB 2CW0C 2D2CC 2PNRC 1I6VC 2QF7A 2B8GA 2A6EC 1V43A 2BE5C 3IKJA 2JEAI 3A8KE 2D5DA 2L5TA 4KN4C 1ONLA 4G7ZC 2DNEA 3PV0A 3GD7A 3VA7A 1K8OA 2A68C 1OXTA 1CTMA 5BN3A 1Z6HA 4TKOB 1ZKOA 2DNCA 1CI3M 2E74C 4XIGS 3L7ZC 1VDZA 3PUZA 4DK1A 2O5IC 4DNRB 4DNTB 1H9MA 4RCNA 4G7OC 1VF5C 1YNNC 2LMCB 4DK0A 3EQLC 4JK1C 1H9JA 3VR6A 5K36H 4BA2I 3VR4A 1HTPA 3NE5B 1GUOA 4H13C 1OXVA 1TKWB 2K32A 3DXJC 3QIAA 2PCFB 3N6RA 3AB9A 2JE6I 3M85A 3W3AA 4OO1H 1FYCA 3A8JE 1H9SA 2AWOA
chains in the Genus database with same CATH superfamily
2PQAA 3A7LA 1JB9A 1LTID 1V9PA 3DHQA 2F4NA 4GOPC 4UZUA 3AVTA 2PI2A 3AFQA 3MA2B 2B2WC 3S16B 4JV5L 1JE4A 1TT2A 1GXDC 3RD4A 1C48A 4O1NA 3CB4A 3OZUA 1U4PA 3WDNA 1PHJA 2R3ZA 1DCZA 4IALA 3LVBA 3VDYA 3MHBA 1KC8D 1G6PA 2R61A 2VB3X 3VR5A 1H9RA 2WIIB 4N9TA 3GTKB 4KD4A 2P3MA 3FPUB 1XNRL 3MCAA 2F3IA 2I0QA 2B5OA 3PA1A 5TSSA 1CK1A 1YNJC 3VMFA 1E22A 3GTJH 3CC7A 4J15A 4JMQA 2A6ED 2WV6D 4POFA 1JMCA 4GN5A 4FF1A 5H1SE 3L3OC 4CDEC 1XE1A 2I1LA 1CM9A 4IUUA 4DPGA 1K8MA 1U4MA 2PZWA 4QGUA 4B3TL 2K75A 3GV6A 4AF7A 3H9NA 5FO0A 4Z9CB 1E7ZA 1SMYD 1BKBA 2JA7G 1PZID 2OBSA 4IPDA 3GVKA 2EYLA 1Q7YD 1XMQQ 3BZKA 2MP1A 2WYRA 4LBVA 3U9SA 5GADC 1QNUA 1WTVA 3HOWH 1Z9FA 3RZDB 4OO1I 2JJ2A 3A7AB 1PJ6A 4NXML 1F20A 3ZBUA 2A68D 5M3FB 3GTLB 1XJVA 3GSIA 1EY9A 4H9GA 1E1RA 3I72A 4A3EB 3G6EB 4A93H 1K73D 3CW2A 1RJTA 3S14H 3M9BA 5C0XJ 1GVPA 4LFCQ 4JG2A 2Q6OA 1EFCA 3BU2A 1P4MA 2B2YC 4OPVA 2EDGA 1QG7A 1JJGA 1I4GA 5A2QL 1G7RA 2PMDA 4XYOA 4ZCMA 3G71A 4WQMA 4R4IA 2ZM6Q 2D2CC 2PNRC 1HTLD 2IWHA 4LF8L 3CC2B 4TT3A 2B8GA 4K14A 3AQQA 1M4VA 3TN2A 1RODA 1L1OB 3VO1A 4QHYA 3A8IA 4GKKQ 1KJZA 1XMOQ 3I55B 3Q3AA 4ACAA 2DNEA 3F1ZA 1QUEA 4F7XA 2F0KA 3GV3A 4P1VA 1BCPD 1LUZA 4IZ8A 4F8MA 4HJ5A 5C4ZA 5IYDG 1TS3A 4IPCA 1F2YA 4XIGS 3WWVA 3L7ZC 5M5YB 5IP9G 3IFDA 4XR6A 3S24A 1OB0A 4E6IA 5NUCA 5M3MG 2UUAL 3K5NA 1KNAA 3U9OA 4AQYL 2YWHA 5CV5A 2BGJA 2NVXB 2GJKA 2F0EA 3CAMA 4X64Q 1KABA 1KTVA 2C4UA 4ZCIA 1OGJA 1H9SA 1QCBD 1EOVA 2B29A 3D31A 3FKIH 5EQ0A 4P9SA 4RGOS 4ILWA 3PENA 4F87A 3I2ZA 4JBWA 1N32L 3CMEA 2VS1A 3TZUA 1GVHA 1IKLA 2KHIA 2XZPA 4B47A 1CHPD 3PUWA 4NBSA 2DIEA 1MABA 3ISXA 1AE2A 2ZJPA 5A2QE 1BCPC 3ES9A 1OXUA 4DXGA 3CQZH 3ZJYC 1YNXA 2CK3A 3RY8A 1B44D 2IX3A 5IYBG 3VR3A 3T4AC 5C4JH 4DV3Q 1LABA 1B9NA 1EWYA 1UE5A 3E5SA 4JW0A 3GDEA 5C44H 2X0KA 3E20A 2DN8A 2NTTA 3OWEB 4XLEA 1T6XA 1W2BB 2IPKD 1KIXA 3GTGB 2VBUA 5EKKA 1PTOC 1XMOL 2BCOA 2GK6A 2EYFA 2XNAC 1O7YA 2R92G 1FRNA 2NVTH 2Q8TA 5G3LF 1HNZQ 2ENBA 2E2HB 1AW7A 2V4DA 2PW5A 1CUKA 1MKHA 1Q8KA 1QH0A 1EP1B 4QV2A 2XIWA 1WTHD 3G48A 1RF2D 3WNBA 3BC9A 5DAUA 5GAEC 1BX0A 1N8RD 1JA0A 3CCVA 1TWHH 1X6OA 1AE3A 2MNAA 5A89A 4UZEA 2LXKA 4DV2L 4RMFA 5IOCA 3CCMB 3AMUA 3HOVB 4A3IB 1X65A 3HS0C 2K5WA 4DV1Q 3BVZA 1SE2A 2BM0A 1KAAA 2EY5A 3J7AV 3M4QA 2A6HD 2F0DA 4LF5L 1N32Q 1A2UA 5J35A 1PTOD 4FXDA 2YWEA 5C5MA 2O5JC 5I6WA 3S1MH 4NDXA 2V1CC 1RKNA 4A93G 1HR0W 4RDLA 1ZM9A 2D5DA 4X3SA 1H95A 4XQFA 1FNVA 4BBRH 5LMUQ 4KV6A 3M4OB 3VA7A 1HNXQ 3S1QB 2V7WA 1EYDA 1FGUA 2F0FA 2JYOA 3A3BA 5JJZA 2ZZQA 4K2LA 3J80L 4JCVE 1MD2D 2B2WA 2K05A 2XWBB 2JA6H 5FO1A 4M4SA 2LMCB 2WACA 1IB0A 1LT6D 2EY1A 1EY8A 1T6YA 1PRTC 4X65Q 3Q23A 3HOYB 2DERA 3HG9A 2AMCB 5DLQE 2PZTA 4OEMB 5BSXA 4PMBA 2KJXA 3CCSA 4PMWA 3OIPA 2RC5A 3HAGA 4Z4VA 1I3QH 4OWXB 3C46A 1DOMA 1ASZA 2HUGA 2EIXA 1HUMA 1TWFH 1HNXL 4JI3Q 1D5ZC 1GUGA 1N0UA 1X56A 3QR8A 1E2VA 1PTOB 3HOVG 2WSSA 1RHPA 1BUVT 2K5HA 2Q2HA 1VQ8A 4C3JB 2HIVA 2RBMA 3J81E 1VJSA 1VQPB 3OW2B 1YX2A 2AUKA 2I46A 3DEOA 4K8IA 1XPRA 1QFYA 3CMAB 4PQXA 3NXWA 4K5WA 1D1NA 4QIWB 2OYNA 4CDFC 4X6AH 1NR4A 1GUNA 4B9XA 3K7UC 4KHPL 1QVFB 3VA5A 1H42A 1D6EC 1VQGA 3PUYA 4U9UA 2ICIA 1N33Q 4UP9A 2X6YA 2L11A 4G4KA 5HZAA 4DR4Q 1WTHA 3I4MH 3PO2G 2Q6IA 3BH4A 2VJIA 2G9DA 3TS2A 1MSGA 4NP5A 2K7VA 4XKVA 1BMFA 4ZCLA 3CRKC 2PLFA 5IT9c 4X05A 2WFWA 4A3IH 2AQ3B 1TWAB 2LZJA 1VQNA 1D2EA 2A6HC 5TV2A 1CNFA 1V5VA 1JA1A 3RR5A 3I91A 1UD3A 1Y69U 2KENA 3K58A 2YWFA 2RKSA 4LFBL 5FLXE 1X3PA 4JI0Q 3K6OA 3PUVA 4JI6Q 4XLAA 3E0JA 1LTGD 2VJJA 1HQMC 2D9UA 3ND8A 1FJGL 2HCJB 4TMTA 3W5HA 1HFGA 2PQEA 2I5HA 4OXPA 5C4XB 3ZBTA 3HZXA 3V7AA 1LYLA 4NXNQ 1QJOA 3PIP3 5ELDA 1M8AA 3I73A 3SDZA 2R92H 3H0GB 1BDOA 2JDIA 5DEHA 4LF4Q 2MHVA 4TRDA 5FJ8H 4QB4A 2OCEA 1VQ4B 4ZUJA 3MXUA 5C44B 3VO2A 1EP2B 5A88A 4GN4B 2HT1A 3FVQA 4PNYA 1S72A 4FN5A 1SMYC 2GVAA 3ZC3A 3NPPA 5IGBA 1H9SB 3M4OH 2KVOA 1I6VC 1XPOA 3UI2A 1JWSD 5HGTA 2RCNA 1VQPA 4FVMA 3H15A 5M5XB 2R7DA 5KEEA 4MYTA 4Y52H 4TMWA 1W0KA 3F2DA 4BWGB 4OX9L 4B3ML 5KYLA 2A68C 4C2MB 3PCOB 4K6LA 3D4DA 5KRUA 4DR1L 3PUZA 4RG1A 5FK9C 3H0GG 2NWGA 4YWKA 1XTDA 4FDBA 4G7OC 5FLXL 3HOWG 4OELB 2QCPX 3ULPA 1PTOF 1ZUNB 3VNVA 1HJPA 4MIUA 5FO7B 4EGVA 1GAWA 2K52A 2EIFA 4IFDH 5M5WH 1WD0A 1I6HH 3KLWA 3FMCA 4KN7C 1QVGB 5KYIA 1YVCA 4LBZA 1AMOA 4S3SA 2EQSA 3FDTA 2HLDA 4Z4UA 1YHQB 3GTPH 1CSQA 4P2NA 3DDYA 3JAMi 2NZHA 3KBGA 3H3VI 4XDXA 1XWEA 2N78A 2UXBL 4CJ1B 4BY7B 1HZEA 2FHTA 2G9HD 3M7GA 3CCLA 1YZ6A 2PNHA 2KCCA 2F4VL 3X3NA 4XQQA 4BY7G 2X6XA 3HP3A 5C0XG 1OGIA 3AU7A 4X66L 4TMZA 4ROXA 4CGYB 1I4PA 2C5HA 4ID6A 1UE1A 2HDNB 1HZCA 4DR1Q 3W1BA 1E24A 3HOVH 4HEDA 2PI2E 4Z4RA 1TU2B 4XOPA 3AVVA 1VHEA 3AVWA 1OHHA 3CCMA 4HCEA 3OE7A 3R2IA 4C3JH 3T51B 1EQTA 1Y1VG 3W2GA 1I18A 2YU9B 1NB0A 4NCNA 1A0IA 2YTYA 4K0KQ 1V0FA 2B63G 2ZXIA 2R6GA 2V7QA 1LTBD 1TWFB 2F0JA 2RC6A 1Y1VB 3NBHA 1BO0A 3KF8B 1PFMA 4PZ8A 5J39A 4QUCA 4I7AA 3I1FA 3FKIG 2B63B 3CC7B 1EQVA 3KL9A 2NBFA 5HURA 3D6CA 5C3WA 2R93H 3RLNA 1O7ZA 4X0CA 5EBDA 2OQ0A 1M90C 3E0EA 4AQYQ 4CBVA 1EU4A 1WFQA 1QUFA 3FKIB 5ELFA 1UD2A 4A3GB 3J81i 4BBSG 4GN3B 3FKSA 1YNJD 1U5KA 4DAMA 1KK3A 2JSOA 1VQHA 2B2VC 2ZITA 4KHZA 2D3NA 3BDOA 4A3KH 4A3GG 5M3MB 1N9WA 4A3DH 3WY9A 5ELEA 1SYCA 1NB9A 4N3GA 2QDXA 4LBWA 2BE5D 2R7FA 2ZBUA 3DM3A 2Y0SB 1FR3A 3ASSA 5AJ3L 3K57A 4MYUA 3CCJB 5FKAC 4EQPA 1SLJA 2BH8A 3I4NG 1UD4A 3CXCA 3CRZA 1CKNA 3MZ5A 2VQEQ 4R9WA 4OIJA 3GD7A 2N88A 1M1KD 4V0BA 4B3XA 4LC0A 2A19A 4JI1L 4IUVA 2B7BA 1K73C 3S2DH 1A63A 1C8CA 3KF6A 2UUCQ 3R3OA 4CJ0B 2K5DA 1WDTA 4RGTA 1TXYA 3A74A 5JOBA 1NBWA 1N36Q 3MTSA 4A3JH 4Z4YA 2FINB 2A8VA 1J5EL 5THXA 4QUFA 3ZYYX 3GTLH 2WZPP 1FVIA 1QX4A 3MWYW 3STBC 1E3XA 3K7AH 1HZAA 1I94Q 3CPWB 1VS0A 2NB0A 3B6YA 2ZZFA 3RZDH 3QE2A 4FF2A 2QGGA 1D7QA 3W2FA 4H44C 4JYAL 4NXMQ 1GUSA 4L6TB 3FEWX 3RLOA 2AHOA 3S2HB 5JEAJ 5CYUA 3I70A 1AFPA 1R5NA 1SSOA 3BNWA 1ET9A 4HIOA 4RGMA 4RD1A 1TWCH 2P5ZX 1TIID 3Q6QA 3PF4A 1COWA 1YLOA 1UWVA 4V190 4PMCA 1G6ZA 1PVOA 2WJYA 4MZ9A 2VB2X 3I8ZA 5M3FH 1HVXA 1A3VA 2HHHL 4P71A 2F0SA 4PG3A 1A8PA 4ZUIA 4ZYSA 5HZBA 2GK7A 5KIXA 1KMHA 3CCQB 1X3EA 1HR0Q 1F2LA 1JWUD 1JC7A 5BSYA 1VQOB 1B2RA 2VNJA 1NE3A 3A5ZB 3CCRB 1NRKA 1I94L 1MSHA 2F0GA 3TBIB 5C4XG 1PXUA 3GVLA 3KYHC 3PUXA 5K36G 3JQPA 1GO3E 1KRSA 1KD1C 1E43A 5GV8A 2DCUA 1A8VA 4B9WA 2ZTGA 4LF6L 4TSFA 5KNLA 5CMDA 2J7ZA 1FNCA 1IJFA 1VQFA 1IW7D 2FJ2A 1JT8A 3FPPA 1XNQL 1N0VC 2I07B 2Q2IA 5JEAG 1HQRD 4FF3A 2QW7A 1DG1G 4DXFA 2FXQA 3WYAA 2QF7A 5IGGA 3B8HA 1QGAA 2A74C 1G7TA 5GQOA 3SEJA 4NNJA 1STNA 5CV6A 2V31A 2GPJA 2JA5G 1CQFA 4DV1L 3CCUB 4WJ4A 2JA8H 1KDCA 2TSSA 5LMNQ 1VMPA 3U2QA 1KD1D 2DNCA 1E1TA 4XXEA 3S14B 4AC9A 4K5VA 3EQLC 4LNQA 1I50B 1CKOA 1SAPA 1F9SA 3LO8A 3EIVA 1JB7A 1IBLQ 1K83H 1EY5A 2QKIC 3N6RA 4R8IA 5HXBA 1HA5A 3NK9A 1BBXC 2RDFA 5BN4A 2O2LD 1WTRA 4RD4A 2X3UA 1YITA 2UUBL 4DR4L 2WINB 3W2IA 2VY3A 1Z7TA 1WPCA 1CT1D 4R1JA 3JAME 2R93B 1LM0A 3TMEA 5BR8L 2QEXA 2F0UA 1QE6A 5IGEA 4X8IA 1IBMQ 2E75C 2YWGA 4GOPA 2HQEA 3V76A 2OTLA 4H0LC 1V1PB 1UUPA 4DU9A 1WSRA 5JJIA 3CU7A 1B9MA 5M5XH 1H8HA 4KKSA 2XEXA 1SE8A 4JI8L 1BVSA 2YU9H 1EIHA 3ONYA 1IXRA 4A3DB 4QVJA 2IL8A 2QTZA 1PH9A 3DM1A 1MJCA 1W6KA 1HNWQ 2RDHA 5I4DA 2IW3A 1DZ1A 3OTOQ 1B1ZA 2UXDQ 1ZEQX 5D3IB 4HE5A 1GAQA 1A3TA 1C7YA 2ASBA 4A3FG 1HHVA 1STGA 1UEAB 1Q1EA 3T1YQ 5C4HA 4X65L 1ZM2A 1IL2A 5IYCG 1SNQA 4A3MG 2JXMB 3STBD 4P12A 3CCSB 1S72B 3KK7A 5D65A 2QA4A 3HOUB 3NTIA 1X32A 1B3QA 4FP5D 3K5MA 4DV4L 2B3GA 4C3JG 3K7AB 2CF4A 3PO3H 3OOCA 1VQ5A 1S5ED 5AN9A 4RD3A 4TVAB 1SN8A 1TUIA 1UE6A 4DR7Q 2ATWA 2OQKA 4X62Q 2OTJA 1FD7D 1L0XB 1KDBA 1STHA 3P27A 1X3QA 4CQJA 3A8JA 1TY2A 3A35A 4WZTA 1PJ7A 3BDLA 1KZLA 4LK1C 3RNUA 1QWYA 1AH9A 1ZM4A 4XLFA 5C0XH 1B3AA 2RDGA 2PIAA 1LTAD 3TQYA 2BGIA 1EWHA 1WJJA 3OTOL 1O7LA 1F60A 1YJNB 2E76C 2K5VA 4WRDA 1XPUA 1SMXA 1VF7A 1SKQA 2NYZD 2ZTNA 3PF5A 1Y8OB 2CW0C 1EFID 4IUPA 4C1NI 2C4TA 3SR1A 5JVH3 2JA8G 3S9WA 4R4TA 1EZ8A 2Z6KA 3SEBA 1EFRA 3M3YH 2QEXB 1HH2P 3WNCA 4M1KA 1MHWC 2PMZE 2Z8LA 3OAAA 1UMKA 2C5CA 4KK7A 1D2BA 1X9NA 1E79A 1Q81D 4YALA 4A76A 4M0LA 1HZ9A 1BPLA 1VQ8B 3H0GH 3J7A5 1QFJA 4NXNL 4POGA 3CTAA 4P3IA 3HOXG 5E1FA 3PQIA 4ZCKA 3W3AA 3B82A 2NZOA 3J81k 1EYCA 3G05A 2R7ZB 2JIZA 4R71A 4UP8A 5C4XH 5LHY1 4LFBQ 1Y1VH 1ESRA 1SYEA 1VQDA 3J80E 1YIJA 1QVCA 4ZRZA 5JBQA 1P8LA 1W6JA 3E1YE 1NUCA 2IT1A 2K1BA 1VQOA 4LUZA 4FK8A 1KK2A 5IYRA 1VQ7B 1S5DD 4TQUS 1EU3A 2OTJB 3K8AA 5EPLA 4DUZL 3I4OA 2VBSA 1EZ6A 1WP6A 1L2FA 2AWNA 3HOYG 1BBWA 5K5PA 5HY6A 3T1HL 2ZTEA 3OYYA 4WJ3M 4KY5A 4GKJL 1TY0A 4B3MQ 4KMUC 3PUMA 5HKKA 4R4CA 1XYIA 3D3RA 2N3SA 2RHQB 5IODA 3KFUA 1B70B 4OWTB 4JV5Q 4UHVA 4LF8Q 5DM63 4DAYB 4LF7Q 2AUJD 2UU9Q 4PC3A 4J1MA 5DNFA 4TMVA 2NZ1D 4RM0A 1ILPA 5EPKA 5LMNW 1TVXA 3I4LA 1QZGA 1R5OA 4RDKA 2XGTA 4OOSA 4L5SA 4UDUC 1TTTA 2M00A 1GHKA 1WOCA 1D1KA 3I55A 1SFOB 1S4ZA 3UE0A 2CC2A 1JQYD 4IN3A 2EJGC 4XT3B 1LO5D 1B50A 1WCMH 5IYDH 4RPBA 1DYQA 2VZAA 1TVCA 1U2RA 1K0RA 2F0HA 1P16A 3T56B 4LF7L 2AQ2B 1W34A 1BR9A 3JC66 3T1HQ 2R6HA 4CJ2C 2ZL5A 4G5GA 5BN5A 2VXWA 1VQLB 1QUQA 3R6JA 1XMQL 4G1VA 2K14A 4XKWA 3V96A 3MEHA 1SM4A 1ZYRD 2KECA 2RA4A 1ET6A 1YHAA 1JNYA 2KQ3A 3ERSX 5FLMH 1SNPA 4HJAA 4JI4L 4XLHA 1XX8A 2JJQA 2JEAI 2WJVA 3K0YA 3G4SB 4QCLA 2M5SA 4K0KL 3Q6SA 3Q0AA 3U50C 1PH5A 1WORA 2BM1A 4TKOB 5IYWA 1XB2A 4JI7L 4DK1A 1H9MA 4B4DA 4DNTB 2RF4A 1DONA 3PIO3 2UXCL 2QMUA 2HHHQ 1VQ6A 4K8JA 5K36H 2XNJA 4B3TQ 4HN7A 3SJPA 4H13C 1GUOA 4FO2A 2C35B 2ZTCA 4KY6A 4CKBA 2QE7A 4DV6L 3TREA 5TRDA 4AF6A 2VBTA 1Q7YC 3H3VC 3AVYA 3MEFA 3NENA 3S1QH 3M3YB 3D4RA 1KQSB 3CC4B 1VMCA 3CMMA 2DGYA 3TP8A 2JP1A 1NMGA 2CW0D 4RH6A 5CV9A 1SJED 4JI1Q 5M5YH 4G7WA 2BVNA 5KNDA 2DY1A 1FNBA 2L9HA 3QFRA 5ELOA 2DY8A 2BN4A 3HGBA 2E2HH 2B39A 3PO3B 1MIUA 1KRHA 3EN2A 4DGZA 3CW2C 1B4OA 4PZ7A 3MFGA 2BA0A 4PC6A 1E2WA 1N08A 3OJXA 2VUMH 4N3NA 2L0CA 5FJ8G 5LL6S 5DS0A 4P6YA 4KTAA 5ISRA 1N34L 3J81c 4C1NK 1FNDA 1FL0A 3CCRA 1N05A 3QJYA 3G4SA 3QOLA 4O2DA 1VQEA 3GTQB 5IYPA 1EXMA 1EFTA 1PH3A 1FRQA 4YAOA 3OKXA 2UUCL 4DQLA 2PQAB 2XWJB 3S1NB 1BX1A 2K6AA 4UZFA 3AVUA 4GZYC 2E2IB 2B8FA 1PTOH 1S3OA 2WB1B 1STBA 1W9XA 1IBKL 1DM0B 1NMFA 1KDAA 5E4WC 1VQLA 2CH4A 4B3RL 2K03A 3ONUA 3W2DA 3H91A 2E2JB 1I3QB 5CC4A 4L8JA 1QVGA 2EOTA 1WD1A 1BNZA 1MI2A 4KKTA 2AHOB 4DR2Q 1JJCB 5IYBH 1O78A 4QL5A 2YYZA 1B7YB 1I4QA 1SE4A 2OEOA 2RVLA 4C0SA 5FOBB 1E1QA 3SXHA 4JC0A 3A5UA 4F88A 5LMUL 2OBRA 2UUBQ 2F4IA 2KCTA 3CPWA 2D9RA 4XOTA 3RMHA 3NHHA 1CA6A 1I50H 1Q86C 3GTMH 2CCZA 2PPBC 3H94A 1IYJB 5KNCA 2JA8B 5C3XA 2Q2UA 4II2A 4M8AA 4IOCA 2X53S 1N06A 3Q39A 1DARA 5COYA 5FO9B 1HR0L 4KHPQ 1VQKA 3JQQA 2GJRA 3L2PA 2SNMA 3PV0A 1X3GA 1CTMA 2TMPA 3S16H 3U6BA 3KOJA 4JI5Q 1VQBA 2F52A 2ZTDA 5EBCA 4BBRG 1V1OA 2H5XA 5C6AA 1QGZA 1TS5A 2L1BA 4YCUA 3VR6A 1SRUA 2E5LQ 4DUYQ 3QIAA 3I4NH 2JA6G 1WTQA 3T13A 1AZPA 1IBKQ 3SK5A 4K2KA 5T1IA 2NTSA 3L9AX 4K5XA 5JAVA 1PFNA 1MJEA 3CD6B 3LX0A 3M4YA 2A69D 1S5CD 3SE0A 1ENAA 1II3A 4RHSA 1G91A 3Q8DA 5FIUA 1DD2A 2X85A 5KSWB 1SDFA 5A35A 3DLLA 4BPRA 2L55A 1M1KC 1LTLA 4X7EA 2WZNA 1L0WA 4FYDA 2X6GA 2Z4IA 1CHQD 1NY4A 5ELNA 2EXDA 4LUOA 1CQXA 1YHBA 5GAHC 2HD3A 2EE1A 1XNQQ 4WJWA 2IX0A 2ES2A 1K28D 5J3BA 3ONAB 4A93B 4Z4SA 5IT9L 4ABNA 1WTPA 5IYNA 4K1XA 4P2CB 2NV4A 4KKUA 3O13A 3PA2A 2EYJA 3KLRA 1G7SA 3WBJA 1AEXA 1EEFD 5IP7G 2WAQB 1UEBA 2CQOA 1PZKD 2F0VA 4RCYA 4TMXA 2X6LA 3KUPA 4L63B 1EY4A 5E4XA 3W5OA 2D74A 2A69C 4O42A 1Y0YA 2CKZB 1PFSA 3EBEA 1SJHD 4DV3L 4DR5L 4PC2A 1SROA 4KLKA 2NPFA 1IBML 3D26A 3EVQA 2AQ1B 2VW9A 1K83B 3TEHB 5IYQA 1PLFA 4O0AA 4A3JG 4YWMA 2KEDA 3T1YL 4XLCA 2F0NA 5TY0A 1QILA 3NQIA 2WKCA 1TLLA 1E3ZA 4RGNA 2BMWA 4OWWB 1S5FD 4A3JB 1YHQA 5ELBA 1BJKA 1TWCB 3K59A 3OEHA 3CCEB 3C3LA 3BY1A 3OZWA 2B2VA 2EYMA 2XVSA 2XRSD 1AN8A 1Y8NB 1RD9D 5EMNA 5F4MA 1VQ5B 3GIRA 3GTOH 4AYBB 2F4VQ 1V43A 4P75A 4I65A 3OW2A 3ZPNA 1YJ9B 1BCPB 1GOZA 5LL6X 4DV5L 2Z1CA 3HKZE 2GJPA 1PZJD 2WR8A 4RD0A 2NVQB 1Z6HA 4GS3A 2WAQE 3D6WA 1IL8A 1MGSA 4DNRB 4XNFA 4JVZA 4LFAL 1VF5C 3W2HA 4HMIA 1YJ9A 5T1GA 2O4XA 4R4QA 4JI2L 3SLDA 3I4MG 2F0PA 3VYSA 1IKMA 4G6IA 2SEBD 1JCKB 3M85A 2PYKA 2PO4A 4KD3A 4OO1H 1KLGD 4A3BG 5FNZA 5DSZA 1S5BD 3K0XA 3CCEA 4DR5Q 1U9RA 2ZT9C 5D3DA 1JR0D 4BY1H 2B63H 1HUNA 2ZXOA 4C3IG 4B3GA 5CBEE 2BDOA 4EX5A 2JA7B 2K04A 1UD6A 2E2JH 2ZL7A 4RLZA 2BV3A 4JBMA 4L5QA 1WSVA 1O7IA 2ICEC 2F0OA 5LMZA 5IE8A 3OWFA 2EJMA 2PZUA 3NQTA 2IHEA 1GO2A 2OF1A 3JAMc 1VQMA 2D0OA 3CPFA 3EFXD 4AYBE 2MO0A 1D5MC 2Q8IB 4JI0L 4OOVA 3FP9A 3HKZG 4X06A 2B7CA 1RTNA 4G7XA 2Z6BD 4X07A 2GVBA 1GKHA 4B3FX 3OP1A 4LFAQ 3WBKA 2ALYB 2QEJC 3FPKA 1VQNB 3SK6A 1H85A 4P6VF 1IJEA 1K3RA 2FMCA 2XOKA 1R4PB 2ZZGA 3BYYB 2DETA 4HJ8A 1KXLA 4OPOA 4IUTA 1NJIC 3F8TA 1D1IA 1K8AD 4Q5VA 4A3MB 1EQQA 2OK8A 2EJFC 4JI7Q 4IPHA 2W6IA 2E2IH 4BBSB 4PC7A 5KW9A 5AJ3Q 4YY3Q 1FNMA 2N8NA 1FGBD 1VQ9A 3I4NB 2X69A 5F4JA 4P3YA 4JI4Q 3A1PA 1PH2A 3OPOA 1VHOA 4A3FB 2VNIA 3CXCB 4EQ5A 2VQEL 1TWAH 1X55A 1VQ6B 1SE3A 1YNND 1LT4D 4MNOA 2BDNA 1K3BC 3TP6A 3TZDA 3RZOH 4RAUC 3KJOA 3DUZA 1RQPA 1U0LA 1RQRA 2J7KA 2PE3A 1WVLA 2RSOA 2M9VA 4YHBA 4JI6L 2IY5B 2F0MA 5J3OA 3BS1A 3DWPA 1KC8C 1EYAA 2A6EC 4LW1A 4C3HB 2BE5C 4RCOA 3CCQA 1I8DA 2DYIA 1WOPA 4X64L 3CC2A 4YIJA 1XQBA 2F3VA 3R8BA 1VLOA 3P7JA 4QMGA 1EOTA 4RFBA 2OBTA 1JWMD 1OXTA 4DV7Q 4A3KB 1QUQB 2Z9HA 2KOLA 1VQKB 1UE7A 2NUCA 1Y0RA 5C5LA 4A3KG 3NBHB 2L4NA 3E9IA 2JN4A 1EY6A 4A4IA 4KY7A 4JOIC 2JA5H 1B23P 3U58A 1QOHA 3A8JE 3G6JB 4UP7A 3LGJA 1BF4A 1PH6A 2JK8A 3IAYA 1SEBD 3Q22A 1Q90A 1SFOH 3M7NA 4X3KA 2K50A 2X6WA 1CKMA 1BLIA 3T53B 1R5BA 5C0XI 5EPJA 3SLNA 1JICA 1N36L 3D8GA 4G1BA 4M2LA 5IP9H 4A3BH 4C3HH 2B2UA 2OK7A 5C3EH 1Q12A 3I7FA 4P22A 1VQ9B 1DXMA 4FNFA 3CCLB 1EUJA 2NVYH 3V2TA 3S17H 2DOGA 2D62A 2CQAA 1F2ZA 4LUVA 3NUCA 1KRTA 1X3FA 5A8AA 5F2DA 1LLRD 2EXZA 4DR3Q 2F03A 2NN6H 1LTTD 4QY7A 4IFDI 1DOKA 1WCMB 2LFNA 4HJ9A 1H8EA 1W87A 2GQFA 4DV2Q 5ELCA 4A75A 4GNXB 4DK3C 2BA1A 1CSPA 4Q0FA 1CZGA 1EL0A 1R9TB 4PGOA 3U6KA 1D8LA 4U673 1QGYA 5IP7H 2CFMA 4ZQ3A 4ASUA 4QIWE 3S15B 2C77A 3J7YW 4XT1B 1UD8A 2I5MX 4A3CG 4JOIA 3WNDA 2ZM6L 5L46A 2E5LL 1LT5D 2EYPA 1LT3D 5IYCH 4A3MH 4LBYA 3C2QA 3LWEA 4YELA 5H5JA 1T5EA 4DV0Q 4F7DA 1EP3B 2H1EA 2EY2A 2LS01 3Q6RA 3PO3G 2H4OA 1TWGB 4ME3A 3C2PA 5C3EB 3HEJA 2MPMA 3F2UA 3LQEA 2G5DA 3BYTB 2JA6B 3CPXA 4UY8C 1VQ4A 2QN6A 1E2ZA 2B2UC 5FL7A 1PH1A 4P26A 1UNSA 1VQIA 4BS9A 4U68A 3P1HA 5H59A 4DF7A 3TRZA 4LF6Q 4B43A 4DV0L 3S1MB 4OP7A 5GAGC 2FVGA 3HOZG 4C56C 3BZCA 4Z4ZA 1K8OA 1C0AA 3PIOA 5JPMC 4AIMA 2WAQG 4RD6A 5CV8A 3OMCA 4MHEA 1KNEA 3KBXA 2JQOA 4DAYA 2V7UA 4FWTA 3NE5B 5JJLA 1WYDA 1B8AA 2CVRA 1SXTA 2JE6I 1JORA 4HJ7A 3ASPA 2KEEA 1SYDA 5GV7A 2AWOA 2DY7A 4DQKA 1JOKA 1TWHB 1E62A 1SNCA 3ND9A 1OTCA 5CDFA 3HOZB 3NBIA 5JVG3 1AZQA 1XXGA 4JI5L 1YJWB 3ERQA 4XTCS 1H9KA 1WOSA 4DN4M 5CBAE 5CV7A 4H7BA 3BZDB 3I56A 4X66Q 4G7HC 3CF5A 2FMMA 1BBUA 4LF9Q 5C3EG 2KUMA 3SK8A 4GKKL 4XMYA 3CMAA 3RZOB 4WWVA 4IFDJ 5JJKA 4NB3A 3K81C 4Y9UA 1E0BA 2ZXPA 1BQQT 3KDFB 1STYA 4AYBG 4LF5Q 4UAJA 1EY7A 4IJHA 1T5XD 1T6ZA 3P75A 4DR7L 1QNKA 3HOUG 5FLMG 4YWLA 2R93G 1DDIA 3QO2A 2HDLA 3MXPA 5B6IA 2KHSA 1SKYB 2KVMA 4Y7CA 1IBLL 4JBKA 2Y0SE 1PDQA 3W5VA 2VQFQ 2CRVA 4GOPB 3BCFA 5KNBA 4LF4L 3SHLA 4FXUA 1IZ6A 5JPNC 4DK6C 3OZVA 5IWAL 2XN9C 1N34Q 1QFZA 1A6XA 3RN2A 3ASTA 4P73A 4A3DG 3OHXC 1ENFA 4CDCC 5HGQA 4M53A 1K28A 1VQAA 1YITB 3GTGH 2OWOA 1OO9B 2UXDL 3MVVA 3QFCA 2Q6LA 4ZV4A 1SBBB 1D5XC 3ZIAA 1G291 1MBYA 1PA6A 1PV4A 4ZAIA 1HCZA 1SNOA 2XRQD 3E3XA 4ODGA 2DJFC 3DEPA 1NTGA 1CZWA 2MQHA 3W5UA 2VQFL 4OX9Q 2ZJQA 2MGSA 5LMNL 3X3MA 4AH6A 2MFIA 2GA4B 3CD6A 1OXXK 4A3IG 1Y1WB 1E64A 1ELOA 1TR5A 4A3CH 1J9ZA 1YI2B 3R93A 4GLVB 3AYHB 3NWSA 4P25A 2RSNA 1HFNA 3F2CA 4ZLTF 4Y7NB 4RKLA 3PO2B 3SJZA 2L15A 4DR6L 2C5BA 2LSSA 2CH4W 2L5TA 1PFBA 4IO9A 4G7ZC 2WKDA 1N33L 3ASQA 1W35A 4WORA 5IWAQ 3EA6A 3GTOB 3NTHA 1ZKOA 4N9PA 2E74C 1K8GA 2WB1E 4HIDA 1STAA 2VL6A 4R8NA 2NVXH 3ULLA 3S1RB 3J80c 2RQXA 3HOXB 4JK1C 2V7TA 4X62L 1FDRA 1H9JA 4PC1A 3WXMA 1OB2A 5CORA 4OHJA 2ID0A 5EGTA 1K9MD 2KBNA 4QQBX 3DWAA 3KLSX 2NVQH 2J4XA 4DKAC 1WTWA 2EYOA 2Z6BA 3MFYA 1A15A 3WOFA 1B2TA 3E9HA 4QJFA 4XM3A 2K28A 4TSSA 1G8ZD 5EKLA 3QFSA 1Y8PB 2ZJRA 4G57A 4N8X1 3KJPA 1FJGQ 2K5QA 3MXNB 4Y9RA 4XN0A 4HSPA 4KHVA 4BY1G 4OGQC 2BSAA 2A5HA 3I56B 1V1QA 4JI2Q 1RTOA 2HDMA 2QDLA 2CWAA 4Y7NH 3PO2H 4XYQA 2D0PA 4QVAA 4RD2A 2F3WA 2SNSA 1STEA 3L0OA 5I2XA 3NP8A 4C3HG 3T16A 3SKBA 4A3EH 1ENCA 1K9MC 1F9QA 1W0JA 2QA4B 1EWIA 1BQEA 1R4QB 1NDHA 4YXWA 4IOAA 4R4OA 4J8QA 4BA1I 3MC0B 4IW3B 3HOWB 1G51A 1WOOA 3TP7A 1EIFA 3K80C 3AGPA 3E6ZX 4X7FA 4N8FA 1Q8IA 3A54A 1PYSB 2E2DC 2K33A 2K01A 4EH1A 2YV5A 2Z0SA 1JOQA 3GVJA 1ICFB 1EIYB 2KCMA 4Z4WA 2UXCQ 1IYVA 1V0EA 5JEAH 2VNUD 1VQJA 4M1UB 1FNWA 3TP5A 4CDDC 2ZL6A 3HKZB 1GR1A 1N07A 2XNDA 1I4XA 1YEZA 3IFTA 3VR2A 3ZZTA 2Q2TA 2W6JA 5KGUA 3BVGA 2VNHA 1HPCA 1L1OA 2DUDA 4KI0A 3QSYA 2ZBVA 1Q82D 1XFOA 1DGSA 3S1NH 5I9OA 4II3A 1ZYRC 5TR9A 4RCZA 3HOXH 4OPSA 1PKVA 4RJLA 1S4MA 1MRZA 4YHHQ 1C9OA 3MHPA 1W2BA 5E6TA 4ME5A 1X54A 3LQ6A 5GROA 5C44G 3CP0A 4WZEA 3W2EA 3ZZ0A 5D14A 3TSSA 4ACBA 2I5LX 3IKJA 2BPOA 2EFGA 5IK2A 3V05A 2C2WA 3Q24A 3BCDA 3KDFA 3SK4A 4HIKA 3A8KA 3UDFA 2JN9A 2JJ1A 1WCMG 4K6DA 3CCUA 1A3UA 1IHZA 4CHTB 4EVOA 4DAPA 5IIFA 3HOZH 1T9HA 5EJWA 1SYGA 3IL8A 1YNNC 5EKIA 1Q3LA 4IUQA 1ML0D 2YTVA 1ZM3A 4ZGNB 1DDGA 2K32A 3D0FA 4AVZA 4J0QA 3PGZA 1QZHA 1E1OA 1PYWD 3CMEB 3ULJA 2CW5A 4X3UA 4NPSA 4RPDA 3H3VH 1L0YB 4B3RQ 1GJXA 1NR2A 3OEEA 4APVA 2HQLA 2GN5A 2F1MA 1IHMA 1J9OA 1O80A 2L12A 4LAAA 2HIXA 1KQSA 3AGQA 3CC4A 2Z4HA 4C2MH 2LY7A 4BXXG 1HRJA 5CV4A 1G2SA 3OSOA 3HRZC 1KK1A 4RHRA 4HMJA 2WP8J 2JEBI 4CKCA 1W3SA 1Y1WH 2SOBA 1I7PA 4DV6Q 1GD7A 3GTJB 1VCIA 4PV1C 4CKEA 1J8IA 2HCIA 1M90D 3VNUA 4LFCL 3A8IE 4FF4A 3J80i 2XSCA 1FX0A 4RA8A 2B2YA 4HIMA 3P26A 1HA6A 3WOEA 3GTQH 1Q1BA 4GLXA 3G7LA 1CFMA 4A3GH 2IJ0A 2E8GA 4IFDG 3PIPA 1EFWA 3GP7A 3IRBA 1ESFA 2X8KA 3FJOA 3G71B 3BG3A 3CHBD 2R92B 2VUMB 3KF6B 3R6KA 3MMPA 2NN6G 1NBMA 2M2LA 1PH4A 4GQNA 4I7ZC 4A3LG 1UD5A 4DV7L 4WZKA 1DJRD 1CNEA 3QWNA 4MTNA 3A3GA 3HKSA 5I9PA 4BY7H 2F0TA 2XGJA 3SVMA 5CGKA 4LJZC 2CBXA 5E7NA 3RLFA 1JB3A 3CRLC 3BY2A 3S1RH 3S2DB 1R9TH 2CHBD 2PMZB 2EVBA 1U4LA 2VNKA 1WTXA 2Z6KC 3AFPA 3R2TA 4X7CA 3SGIA 2ZXRA 4WFN3 2Q8RE 2EYHA 3BJUA 4C3IH 3QB3A 4YCWA 1PYBA 2UUAQ 1IW7C 1I4RA 3S17B 4DR3L 1GHJA 4HIZA 1QB5D 1BXTA 3W1GA 3C1EA 2QDBA 1FNUA 3CKIB 4IJLA 4YAFA 5I2YA 1ASYA 4B3SL 4JBJA 2C9OA 4PZ6A 2XZOA 2CWPA 3GTMB 1A62A 3QFTA 1KHIA 1KL9A 1CQVA 2QILA 1HNZL 5M3MH 1TS2A 4A3EG 1CI3M 1EIGA 4ALPA 3TS0A 2MUYA 1CKNB 2O5IC 1VLYA 4RCNA 3Q38A 3N52A 2VUMG 4JYAQ 4XN3A 1G7CA 2WB1G 1NSNS 2B2TA 4ZK9B 2LXJA 2IHFA 2FX3A 1WI5A 3C1FA 3B78A 1TWGH 1I4HA 3WQZA 5M9OA 3CCJA 2F0WA 1TKWB 2Y0SG 3J81L 5G3LD 2ZZEA 4XORA 1E63A 4PABA 1U4RA 1VQ7A 3HOYH 4HE6A 1A2TA 4B08A 4IQZA 1LV9A 1EFUA 1YI2A 3EJIA 1VQMB 4Z4TA 1YIJB 1KAWA 1L1OC 3CESA 1KK0A 1DOLA 4JPBW 4LMQD 2D3LA 5L37A 2SDFA 4BBRB 1ILQA 1RCVD 2DEUA 3NWTA 4HTHA 3VYTA 4OOXA 4HSVA 4J6HA 1CA5A 1RDPD 3M4PA 2WPDA 4DV4Q 3LNNA 4B3SQ 2BOSA 4XL9A 3RUZA 4XD7A 1Q86D 1J5EQ 4YAWA 5FA6A 1TQOA 2K5NA 1JJ2B 3KF8A 2PW7A 2HCCA 3GO5A 1SNMA 4UAIA 1SNDA 1YBYA 2QGQA 3OIQA 4NKLA 4X3TA 4EQNA 3VYRA 2CNDA 2Q6KA 4DR2L 1EYGA 1WU8A 3URYA 1PJ5A 2B2TC 3DWQA 2R9VA 3K5OA 4LF9L 1Y1WG 5CR3A 2XZLA 3AVXA 3S15H 3MXNA 3GTPB 5FO8B 3PUNA 3ICEA 5E3FA 3JAML 3H09A 1F77A 5M5WB 4DNIA 1I6HB 1LACA 2OT2A 1RIPA 3P20A 3U4VA 2N55A 2QTLA 3UDGA 1SR3A 5IGFA 4QFMA 4HR7B 3BQJA 4RDJA 1S40A 3LWUA 2BH2A 4XONA 2JA5B 4EQOA 3JU4A 3NELA 4Z1MA 2XTIA 1V1PA 1SYBA 2FFKB 3RN5A 4A3LH 2OTLB 3GQBA 2NVYB 4B48A 1VQCA 5M3FG 1EQRA 2MO1A 4OL7A 3QG1A 2C78A 1IYUA 3TDQA 1HNWL 1KLUD 2F0QA 4L5RC 4PAAA 4OO1G 1Y14B 3ER0A 4DA2A 4L5TA 2KHJA 4MTKA 3ZUGA 4RWSC 1BOSA 3PMFA 3CQZB 3A8KE 2LKVA 2HMAA 4OONA 4B44A 4UPAA 4XQNA 2RHSB 3MXGA 4ZKCB 4X7DA 1NCVA 2R7ZH 3I3CA 2JA7H 3ASRA 4YCVA 1HXYD 1GJRA 1JE5A 4BY1B 1VDZA 2F0LA 3ZZUA 2JA9A 2MJ8A 1TS4A 1J6QA 1Q82C 3K5LA 2V7VA 5IT9E 2E1RA 1OXVA 2N49A 2XNCA 2J0TD 3DMUA 3DXJC 2BF4A 2PCFB 4JI8Q 4IPGA 3AB9A 4Q7JB 3CCVB 1KTKA 1EY0A 4A3FH 1FYCA 4P74A 3UDIA 1Z47A 4DV5Q 1NNXA 1I5FA 4XQJA 2DJGC 4H02A 3PVDA 1AIPA 3OFNA 1NAPA 5F4OA 1QVFA 5IGCA 2F1LA 4HCSA 2E1BA 4YY3L 2K4KA 1PH7A 1F2MA 1Q9SA 3H6MA 2V7XA 1B53A 2RCFA 1S0UA 5I6YA 3KEWA 4DUYL 2NN6I 4E0FA 1OXSC 4DR6Q 3NSWA 4BXXH 2ZXHA 3I4MB 4YAUA 1N8RC 1LTSD 1YJNA 3QOJA 1HZBA 1K0SA 2KA7A 2KCNA 4QF4A 1E3PA 4KJNA 3OMGA 4A3BB 1D8TA 5BR8Q 3NTKA 3J7ZC 1NJID 1OB5A 3NEMA 4QUZA 2AKWB 4ZKBB 4BBSH 4GNXA 4DUZQ 1GUTA 4YEJA 2VZLA 4P72A 3CP8A 1PMRA 2NVTB 2F0IA 3UDXA 2OXPA 4JI3L 2EPBA 2EY6A 3F2BA 1QG0A 1PRTF 3VYUA 4YHHL 3J81j 3HOUH 1V8QA 1EWCA 1JOOA 1EEID 1F9RA 3ITPA 4WZLA 3OW7A 5J1ZA 1UAPA 2GREA 4KJOA 1ICWA 4ZGQB 4IUNA 4RKBA 4GNXC 2F43A 1C4QA 4OIKA 3BVMA 5AFWA 5C4JB 1Q81C 3EROA 1PRTD 4GKJQ 5IY0A 3MAQA 2A1AA 3FRPB 3A55A 3FHWA 2UXBQ 3D4WA 3U4ZA 1XTCD 4MN3A 1ZXTA 4GLAC 3CP2A 4NW2A 1SYFA 1LTRD 1WTOA 5IGDA 3JQRA 1F9PA 3BDCA 1GM5A 3GTKH 5DN6A 2R7ZG 1AP0A 2IX1A 5EAYA 5J22A 3S2HH 4C43A 4KN4C 5FLXc 1ONLA 4C3IB 1XNRQ 1YJWA 1HA3A 5DM73 4HAEA 5BN3A 1G2TA 4LWCA 3AEVA 2YTXA 4ULLA 2A73B 1JJ2A 4IURA 4DAVA 4FXKC 4TN1A 3PSIA 4DK0A 1PH8A 3J7AF 4FXGC 4BA2I 3VR4A 3G6EA 1BCPF 1HTPA 3A0JA 3A56A 3HFZB 3I90A 1K8AC 2UU9L 1GUWA 3OJWA 4DFAA 1RL2A 3KLSA 2VYQA 4NMZA 2EZVA 1Q46A 3UE1A 2VBVA 1PRTB
chains in the Genus database with same CATH topology
3A7LA 1LTID 3DHQA 4UZUA 3MA2B 2B2WC 3S16B 1JE4A 1TT2A 1GXDC 3RD4A 1C48A 4O1NA 3WDNA 1U4PA 2R3ZA 1DCZA 4IALA 3MHBA 2R61A 2VB3X 3VR5A 1H9RA 2WIIB 4N9TA 3GTKB 4KD4A 3FPUB 5TSSA 1CK1A 1YNJC 4JMQA 2A6ED 2WV6D 4FF1A 3L3OC 4IUUA 1CM9A 1K8MA 1U4MA 2PZWA 3GV6A 4Z9CB 1SMYD 1PZID 3GVKA 2EYLA 2MP1A 3U9SA 1QNUA 1WTVA 4OO1I 3RZDB 2JJ2A 3A7AB 2A68D 5M3FB 3GTLB 1EY9A 3I72A 1E1RA 4A3EB 1RJTA 5C0XJ 2B2YC 2EDGA 1QG7A 1I4GA 5A2QL 4XYOA 2D2CC 2PNRC 1HTLD 2IWHA 2B8GA 4TT3A 4K14A 3TN2A 1M4VA 1RODA 2DNEA 4F7XA 2F0KA 3GV3A 1BCPD 4IZ8A 4F8MA 5C4ZA 1TS3A 1F2YA 4XIGS 3L7ZC 5M5YB 3IFDA 4XR6A 1OB0A 4E6IA 5NUCA 3K5NA 1KNAA 3U9OA 5CV5A 2NVXB 2GJKA 2F0EA 1KABA 1H9SA 1QCBD 3D31A 5EQ0A 4RGOS 4ILWA 4F87A 4JBWA 3TZUA 1IKLA 2XZPA 1CHPD 3PUWA 2DIEA 1MABA 5A2QE 1BCPC 1OXUA 4DXGA 2CK3A 1B44D 2IX3A 3VR3A 3T4AC 1LABA 1B9NA 3E5SA 2DN8A 2NTTA 3OWEB 4XLEA 2IPKD 3GTGB 5EKKA 1PTOC 2BCOA 2GK6A 2EYFA 2XNAC 1O7YA 2Q8TA 5G3LF 2E2HB 2ENBA 1AW7A 2V4DA 2PW5A 2XIWA 1WTHD 1RF2D 3BC9A 5DAUA 5IOCA 3AMUA 3HOVB 4A3IB 3HS0C 2K5WA 3BVZA 1SE2A 1KAAA 2EY5A 3J7AV 2A6HD 2F0DA 1A2UA 1PTOD 4FXDA 5C5MA 2O5JC 5I6WA 4NDXA 1RKNA 2D5DA 4X3SA 4XQFA 1FNVA 4KV6A 3M4OB 3VA7A 3S1QB 1EYDA 2F0FA 2JYOA 3A3BA 5JJZA 2ZZQA 4K2LA 3J80L 1MD2D 2B2WA 2K05A 2XWBB 2LMCB 2WACA 1LT6D 2EY1A 1EY8A 1PRTC 3Q23A 3HOYB 3HG9A 2PZTA 4PMBA 2KJXA 4PMWA 3OIPA 3HAGA 3C46A 1DOMA 2HUGA 1HUMA 1D5ZC 1GUGA 1E2VA 1PTOB 2WSSA 1RHPA 1BUVT 4C3JB 2RBMA 3J81E 1VJSA 2AUKA 2I46A 3DEOA 4K8IA 4PQXA 3NXWA 4K5WA 4QIWB 1NR4A 1GUNA 4B9XA 3VA5A 1D6EC 3PUYA 2ICIA 2X6YA 2L11A 4G4KA 3BH4A 2VJIA 2G9DA 1MSGA 4NP5A 2K7VA 4XKVA 1BMFA 3CRKC 2AQ3B 1TWAB 2LZJA 2A6HC 3I91A 1UD3A 1Y69U 3K58A 2RKSA 5FLXE 1X3PA 3K6OA 3PUVA 4XLAA 3E0JA 1LTGD 2VJJA 1HQMC 2D9UA 3ND8A 1HFGA 2PQEA 5C4XB 3HZXA 1QJOA 3PIP3 5ELDA 1M8AA 3I73A 3SDZA 3H0GB 1BDOA 2JDIA 5DEHA 2MHVA 4TRDA 4QB4A 4ZUJA 5C44B 3MXUA 3FVQA 4PNYA 1SMYC 3NPPA 5IGBA 1H9SB 2KVOA 1I6VC 3UI2A 1JWSD 5HGTA 4FVMA 5M5XB 5KEEA 1W0KA 4BWGB 5KYLA 2A68C 4C2MB 4K6LA 3D4DA 5KRUA 3PUZA 5FK9C 2NWGA 4G7OC 5FLXL 2QCPX 1PTOF 4MIUA 5FO7B 4EGVA 4IFDH 1WD0A 3FMCA 4KN7C 5KYIA 4S3SA 3FDTA 2HLDA 3DDYA 3KBGA 4XDXA 1XWEA 4BY7B 4CJ1B 1HZEA 2FHTA 2G9HD 3M7GA 2KCCA 3X3NA 4XQQA 2X6XA 3HP3A 5C0XG 3AU7A 4CGYB 1I4PA 4ID6A 4HEDA 1TU2B 4XOPA 1OHHA 4HCEA 3OE7A 3R2IA 3T51B 1EQTA 1I18A 2YU9B 1V0FA 2ZXIA 2R6GA 2V7QA 1LTBD 1TWFB 2F0JA 1Y1VB 3NBHA 5J39A 1BO0A 1PFMA 4QUCA 2B63B 1EQVA 2NBFA 5HURA 3D6CA 5C3WA 1O7ZA 5EBDA 4CBVA 1EU4A 3FKIB 5ELFA 1UD2A 4A3GB 3FKSA 1YNJD 2JSOA 2B2VC 4KHZA 2D3NA 3BDOA 5M3MB 5ELEA 1SYCA 2BE5D 2Y0SB 1FR3A 3K57A 5FKAC 4EQPA 1UD4A 3MZ5A 4R9WA 4OIJA 3GD7A 2N88A 4V0BA 4IUVA 1C8CA 3R3OA 4CJ0B 2K5DA 4RGTA 5JOBA 3MTSA 2FINB 4QUFA 3ZYYX 2WZPP 3MWYW 1E3XA 2NB0A 2ZZFA 4FF2A 4H44C 1GUSA 4L6TB 3FEWX 3S2HB 5JEAJ 5CYUA 3I70A 1AFPA 1SSOA 1ET9A 4RGMA 1TIID 1COWA 4V190 4PMCA 1G6ZA 2WJYA 2VB2X 3I8ZA 1HVXA 1A3VA 2F0SA 4ZYSA 4ZUIA 2GK7A 5KIXA 1KMHA 1F2LA 1JWUD 1JC7A 1NRKA 1MSHA 2F0GA 3TBIB 1PXUA 3GVLA 3PUXA 5K36G 1E43A 4B9WA 2ZTGA 4TSFA 5KNLA 5CMDA 2J7ZA 1IW7D 2FJ2A 3FPPA 2I07B 5JEAG 1HQRD 4FF3A 4DXFA 2QF7A 5IGGA 2A74C 4NNJA 1STNA 5CV6A 2V31A 1CQFA 1KDCA 2TSSA 1VMPA 2DNCA 4XXEA 3S14B 4K5VA 3EQLC 1I50B 1SAPA 1F9SA 1EY5A 2QKIC 3N6RA 4R8IA 1HA5A 3NK9A 1BBXC 2RDFA 5BN4A 2O2LD 1WTRA 2WINB 1Z7TA 1WPCA 1CT1D 3JAME 2R93B 3TMEA 2F0UA 1QE6A 5IGEA 2E75C 2HQEA 4H0LC 1V1PB 1UUPA 4DU9A 3CU7A 1B9MA 1H8HA 4KKSA 1EIHA 4A3DB 2IL8A 3DM1A 1W6KA 2RDHA 5I4DA 2IW3A 1DZ1A 1B1ZA 1ZEQX 5D3IB 1A3TA 1HHVA 1STGA 1UEAB 1Q1EA 5C4HA 1SNQA 2JXMB 3KK7A 3HOUB 5D65A 3NTIA 1X32A 4FP5D 3K5MA 4C3JG 3K7AB 3OOCA 1S5ED 1FD7D 1L0XB 1KDBA 1STHA 1X3QA 1TY2A 3A35A 3BDLA 4LK1C 1KZLA 1QWYA 4XLFA 5C0XH 1B3AA 2RDGA 1LTAD 1EWHA 1O7LA 2E76C 4WRDA 1VF7A 2NYZD 2ZTNA 1Y8OB 2CW0C 1EFID 4IUPA 4C1NI 3SR1A 5JVH3 3S9WA 1EZ8A 3SEBA 1EFRA 2Z8LA 3OAAA 4KK7A 2C5CA 1D2BA 1E79A 1BPLA 5E1FA 3W3AA 1EYCA 3G05A 2R7ZB 2JIZA 5LHY1 1ESRA 1SYEA 3J80E 4ZRZA 1W6JA 1NUCA 2IT1A 2K1BA 1S5DD 4TQUS 1EU3A 5EPLA 1EZ6A 1WP6A 2AWNA 5K5PA 4KY5A 1TY0A 4KMUC 5HKKA 1XYIA 3D3RA 5IODA 5DM63 2AUJD 4J1MA 5DNFA 2NZ1D 1ILPA 5EPKA 1TVXA 3I4LA 4UDUC 2M00A 1GHKA 1D1KA 1SFOB 1S4ZA 1JQYD 4IN3A 2EJGC 4XT3B 1LO5D 1B50A 1DYQA 2F0HA 3T56B 2AQ2B 1BR9A 4CJ2C 5BN5A 2VXWA 4XKWA 3V96A 3MEHA 1ZYRD 2KECA 2RA4A 1ET6A 2KQ3A 1SNPA 4XLHA 1XX8A 2JEAI 2WJVA 3K0YA 4QCLA 2M5SA 3Q6SA 3Q0AA 4TKOB 4DK1A 1H9MA 4DNTB 1DONA 3PIO3 4K8JA 5K36H 4HN7A 4H13C 1GUOA 4FO2A 4KY6A 4CKBA 2QE7A 3H3VC 3M3YB 3D4RA 3CMMA 1VMCA 3TP8A 2JP1A 2CW0D 4RH6A 5CV9A 1SJED 4G7WA 5KNDA 2L9HA 2DY8A 3HGBA 2B39A 3PO3B 4DGZA 1B4OA 3MFGA 2BA0A 1E2WA 2L0CA 5LL6S 4KTAA 5ISRA 4C1NK 3QJYA 3QOLA 3GTQB 2XWJB 3S1NB 2K6AA 4GZYC 2E2IB 2B8FA 1PTOH 2WB1B 1STBA 1W9XA 1DM0B 1KDAA 5E4WC 2K03A 3W2DA 3H91A 2E2JB 1I3QB 5CC4A 4L8JA 2EOTA 1WD1A 1BNZA 1MI2A 4KKTA 1O78A 2YYZA 1I4QA 1SE4A 2OEOA 2RVLA 5FOBB 1E1QA 3SXHA 4F88A 2F4IA 4XOTA 3RMHA 3NHHA 1CA6A 2PPBC 3H94A 5KNCA 2JA8B 5C3XA 4II2A 4M8AA 2X53S 5COYA 5FO9B 2GJRA 2SNMA 3PV0A 2TMPA 1CTMA 5EBCA 1V1OA 5C6AA 1TS5A 2L1BA 3VR6A 3QIAA 1WTQA 3T13A 1AZPA 3SK5A 4K2KA 5T1IA 2NTSA 3L9AX 4K5XA 5JAVA 1PFNA 3LX0A 3M4YA 2A69D 1S5CD 3SE0A 1ENAA 1II3A 4RHSA 1G91A 1DD2A 2X85A 5A35A 1SDFA 2L55A 4FYDA 2X6GA 2Z4IA 1CHQD 2EE1A 4WJWA 2IX0A 1K28D 3ONAB 4A93B 5IT9L 4ABNA 1WTPA 4P2CB 4KKUA 3O13A 2EYJA 3KLRA 1AEXA 1EEFD 2WAQB 1PZKD 2F0VA 2X6LA 3KUPA 4L63B 1EY4A 5E4XA 2A69C 4O42A 1SJHD 3EVQA 2AQ1B 1K83B 1PLFA 2KEDA 4XLCA 2F0NA 1QILA 3NQIA 2WKCA 4RGNA 1E3ZA 1S5FD 4A3JB 5ELBA 1TWCB 3K59A 3OEHA 3C3LA 2B2VA 2EYMA 2XVSA 2XRSD 1AN8A 1Y8NB 1RD9D 4AYBB 1V43A 4I65A 3ZPNA 1BCPB 1GOZA 5LL6X 2Z1CA 2GJPA 1PZJD 2NVQB 1Z6HA 3D6WA 1IL8A 1MGSA 4DNRB 4XNFA 1VF5C 4HMIA 5T1GA 2O4XA 2F0PA 3VYSA 1IKMA 4G6IA 2SEBD 1JCKB 3M85A 2PYKA 2PO4A 4KD3A 4OO1H 1KLGD 1S5BD 1U9RA 2ZT9C 5D3DA 1JR0D 1HUNA 2ZXOA 4C3IG 4B3GA 5CBEE 2BDOA 2JA7B 2K04A 1UD6A 2ICEC 2F0OA 3OWFA 2EJMA 2PZUA 3NQTA 2OF1A 3EFXD 1D5MC 2Q8IB 1RTNA 4G7XA 2Z6BD 4B3FX 2QEJC 3SK6A 2FMCA 2XOKA 1R4PB 2ZZGA 3BYYB 4IUTA 1D1IA 4Q5VA 4A3MB 2EJFC 2W6IA 4BBSB 1FGBD 3I4NB 2X69A 3OPOA 4A3FB 1SE3A 1YNND 1LT4D 2BDNA 3TP6A 3TZDA 4RAUC 3DUZA 1WVLA 2RSOA 2M9VA 2F0MA 3BS1A 3DWPA 1EYAA 2A6EC 4C3HB 2BE5C 4RCOA 1I8DA 4YIJA 2F3VA 3R8BA 3P7JA 4QMGA 1EOTA 4RFBA 1JWMD 1OXTA 4A3KB 2KOLA 2NUCA 5C5LA 2L4NA 1EY6A 4KY7A 1QOHA 3A8JE 3G6JB 1BF4A 3IAYA 1SEBD 3Q22A 1Q90A 3M7NA 4X3KA 2X6WA 1BLIA 3T53B 5C0XI 5EPJA 1JICA 3D8GA 2B2UA 1Q12A 4FNFA 4P22A 1DXMA 3V2TA 2D62A 2CQAA 1F2ZA 3NUCA 5F2DA 1LLRD 2EXZA 2F03A 4IFDI 2NN6H 1LTTD 1DOKA 1WCMB 2LFNA 1H8EA 5ELCA 2BA1A 4Q0FA 1EL0A 1CZGA 1R9TB 4U673 4ZQ3A 4ASUA 3S15B 3J7YW 4XT1B 1UD8A 1LT5D 2EYPA 1LT3D 3LWEA 4YELA 1T5EA 2H1EA 2EY2A 2LS01 2H4OA 1TWGB 3C2PA 5C3EB 3HEJA 2MPMA 3F2UA 3BYTB 2JA6B 1E2ZA 2B2UC 5FL7A 1UNSA 4BS9A 4U68A 3P1HA 4DF7A 3S1MB 4C56C 1K8OA 5JPMC 5CV8A 3OMCA 4MHEA 1KNEA 3KBXA 4DAYA 3NE5B 2CVRA 1SXTA 2JE6I 1JORA 2KEEA 1SYDA 2AWOA 2DY7A 1JOKA 1TWHB 1SNCA 3ND9A 5CDFA 3HOZB 3NBIA 5JVG3 1AZQA 1XXGA 3ERQA 4XTCS 1H9KA 4DN4M 5CBAE 5CV7A 4H7BA 3BZDB 4G7HC 2FMMA 2KUMA 3SK8A 4XMYA 3RZOB 4IFDJ 1E0BA 2ZXPA 1BQQT 1STYA 1EY7A 1T5XD 3P75A 1QNKA 3QO2A 2HDLA 3MXPA 2KHSA 1SKYB 2KVMA 1PDQA 3BCFA 5KNBA 3SHLA 4FXUA 5JPNC 1A6XA 2XN9C 3OHXC 1ENFA 1OO9B 3MVVA 1SBBB 1D5XC 3ZIAA 1G291 1MBYA 4ZAIA 1HCZA 1SNOA 2XRQD 4ODGA 3DEPA 1CZWA 2MGSA 3X3MA 2GA4B 1OXXK 1Y1WB 1TR5A 3R93A 3NWSA 2RSNA 1HFNA 4ZLTF 4Y7NB 4RKLA 3PO2B 2L5TA 1PFBA 4G7ZC 2WKDA 4WORA 3EA6A 3GTOB 3NTHA 1ZKOA 4N9PA 2E74C 1STAA 4R8NA 3S1RB 3HOXB 2RQXA 4JK1C 1H9JA 5CORA 4OHJA 2ID0A 5EGTA 3DWAA 3KLSX 2J4XA 1WTWA 2EYOA 3WOFA 3MFYA 1A15A 1B2TA 4XM3A 2K28A 4TSSA 1G8ZD 5EKLA 1Y8PB 4G57A 2K5QA 4XN0A 4HSPA 4KHVA 4OGQC 2A5HA 1RTOA 2HDMA 4XYQA 2F3WA 2SNSA 1STEA 5I2XA 3NP8A 4C3HG 3T16A 1ENCA 1F9QA 1W0JA 1R4QB 4YXWA 4J8QA 4BA1I 3MC0B 3HOWB 3TP7A 3E6ZX 1Q8IA 3A54A 2E2DC 2K33A 2K01A 1JOQA 3GVJA 1IYVA 1V0EA 5JEAH 2VNUD 4M1UB 1FNWA 3TP5A 3HKZB 1I4XA 2XNDA 3IFTA 3VR2A 2W6JA 5KGUA 3BVGA 1HPCA 4KI0A 5I9OA 4II3A 1ZYRC 1PKVA 4ME5A 5D14A 3TSSA 3IKJA 5IK2A 3V05A 3Q24A 3BCDA 3SK4A 2JJ1A 4K6DA 1A3UA 1IHZA 4CHTB 4EVOA 4DAPA 5IIFA 5EJWA 1SYGA 3IL8A 1YNNC 5EKIA 1Q3LA 4IUQA 1ML0D 2K32A 4AVZA 1PYWD 4X3UA 1L0YB 1GJXA 1NR2A 3OEEA 2F1MA 1J9OA 1O80A 2L12A 4LAAA 2Z4HA 2LY7A 1HRJA 5CV4A 1G2SA 3OSOA 3HRZC 4RHRA 4HMJA 2WP8J 2JEBI 4CKCA 2SOBA 1J8IA 3GTJB 1VCIA 4PV1C 4CKEA 2HCIA 3A8IE 4FF4A 2XSCA 1FX0A 4RA8A 2B2YA 1HA6A 3WOEA 1Q1BA 3G7LA 1CFMA 2IJ0A 4IFDG 3GP7A 1ESFA 2X8KA 3CHBD 3BG3A 2R92B 2VUMB 2NN6G 1NBMA 2M2LA 4GQNA 4I7ZC 1UD5A 1DJRD 3QWNA 3A3GA 5I9PA 2F0TA 2XGJA 3SVMA 5CGKA 4LJZC 3RLFA 1JB3A 3CRLC 3S2DB 2CHBD 2PMZB 2EVBA 1U4LA 1WTXA 3R2TA 2ZXRA 4WFN3 2Q8RE 2EYHA 3QB3A 1IW7C 1I4RA 3S17B 1GHJA 4HIZA 1QB5D 1BXTA 3C1EA 2QDBA 1FNUA 3CKIB 5I2YA 2C9OA 2XZOA 3GTMB 1CQVA 2QILA 1TS2A 1CI3M 1EIGA 2MUYA 2O5IC 1VLYA 4RCNA 3N52A 4XN3A 4ZK9B 1NSNS 2B2TA 3C1FA 1I4HA 3WQZA 5M9OA 2F0WA 1TKWB 3J81L 5G3LD 2ZZEA 4XORA 1U4RA 1A2TA 4B08A 4IQZA 1LV9A 3EJIA 3CESA 1DOLA 4LMQD 2D3LA 2SDFA 4BBRB 1ILQA 1RCVD 3NWTA 4HTHA 3VYTA 4HSVA 4J6HA 1CA5A 1RDPD 2WPDA 3LNNA 2BOSA 4XL9A 3RUZA 4XD7A 1TQOA 3KF8A 2PW7A 2HCCA 3GO5A 1SNMA 4UAIA 1SNDA 3OIQA 4NKLA 4X3TA 4EQNA 3VYRA 3URYA 2B2TC 3DWQA 2R9VA 3K5OA 5CR3A 2XZLA 3MXNA 3GTPB 5FO8B 5E3FA 3JAML 3H09A 1F77A 5M5WB 1I6HB 1LACA 2OT2A 3P20A 2N55A 5IGFA 4HR7B 3LWUA 4XONA 2JA5B 4EQOA 3JU4A 4Z1MA 1V1PA 1SYBA 2FFKB 3GQBA 2NVYB 4OL7A 3QG1A 1IYUA 3TDQA 1KLUD 2F0QA 4OO1G 4DA2A 4RWSC 1BOSA 3PMFA 3CQZB 3A8KE 2LKVA 4XQNA 3MXGA 4ZKCB 1NCVA 3I3CA 1HXYD 4BY1B 1VDZA 2F0LA 2MJ8A 1TS4A 3K5LA 5IT9E 1OXVA 3DXJC 2J0TD 3DMUA 2PCFB 3AB9A 1KTKA 1EY0A 1FYCA 1Z47A 4XQJA 3OFNA 1NAPA 5IGCA 4HCSA 2E1BA 1F2MA 3H6MA 1B53A 5I6YA 3KEWA 2NN6I 4E0FA 1OXSC 3NSWA 2ZXHA 3I4MB 1LTSD 3QOJA 2KA7A 2KCNA 4QF4A 4KJNA 3OMGA 4A3BB 3NTKA 4ZKBB 1GUTA 4YEJA 3CP8A 1PMRA 2NVTB 2F0IA 2OXPA 2EPBA 2EY6A 1PRTF 3VYUA 1V8QA 1EWCA 1JOOA 1EEID 1F9RA 3ITPA 3OW7A 5J1ZA 4KJOA 1UAPA 1ICWA 4IUNA 4RKBA 2F43A 1C4QA 4OIKA 3BVMA 5AFWA 5C4JB 3EROA 1PRTD 3MAQA 3FRPB 3A55A 3D4WA 1XTCD 4MN3A 1ZXTA 3CP2A 4NW2A 1SYFA 1LTRD 1WTOA 5IGDA 1F9PA 3BDCA 5DN6A 1AP0A 2IX1A 5J22A 4KN4C 1ONLA 4C3IB 5DM73 4HAEA 5BN3A 1G2TA 4ULLA 2A73B 4IURA 4DAVA 4FXKC 4DK0A 3J7AF 4FXGC 4BA2I 3VR4A 1BCPF 1HTPA 3A56A 3I90A 1GUWA 4DFAA 3KLSA 4NMZA 2EZVA 1PRTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D31 A;  3MFY A;  4IQZ A;  3D4R A;  1GJX A;  3FMC A;  3A7L A;  4KN7 C;  3ND9 A;  1Z7T A;  1GUG A;  2F1M A;  2ZT9 C;  1Y8P B;  1E2V A;  1Q90 A;  4JBW A;  4IFD H;  3TZU A;  2E75 C;  3M4Y A;  2A69 D;  1H9K A;  4XTC S;  3SE0 A;  5KND A;  3PUW A;  2BDO A;  2IT1 A;  4H44 C;  4TQU S;  3HGB A;  5BN4 A;  1GUS A;  3WDN A;  4G7H C;  1DD2 A;  4H0L C;  1DCZ A;  2KCC A;  3T53 B;  2AUK A;  5A35 A;  4OGQ C;  1B9M A;  2JEB I;  2BA0 A;  2NN6 I;  1E2W A;  3VR5 A;  1H9R A;  1OXS C;  1OXU A;  2EJM A;  4KKS A;  3LNN A;  5C0X G;  1GUN A;  1VCI A;  4PV1 C;  3A8I E;  1Q12 A;  3PUY A;  1DXM A;  3VR3 A;  3M7N A;  2Q8I B;  4KMU C;  2KA7 A;  2D62 A;  1LAB A;  1B9N A;  3QJY A;  1YNJ C;  1Q1B A;  2A6E D;  2K7V A;  1CFM A;  1TU2 B;  3CRK C;  2DN8 A;  2NN6 H;  1Q1E A;  4IFD G;  4KKU A;  1K8M A;  3BG3 A;  3KLR A;  3T51 B;  2JXM B;  4GZY C;  2BA1 A;  2AUJ D;  2A6H C;  2B8F A;  2NN6 G;  4BA1 I;  4I7Z C;  1GUT A;  1Y69 U;  2R6G A;  3I4L A;  5KNB A;  2A69 C;  1PMR A;  3OOC A;  1A6X A;  2V4D A;  2EJF C;  3U9S A;  1GHK A;  4L8J A;  1LAC A;  2K33 A;  3P20 A;  3PUV A;  1HQM C;  1V8Q A;  3PUX A;  5K36 G;  4LJZ C;  3A7A B;  3ND8 A;  2EJG C;  5JEA H;  1IYV A;  4KKT A;  4HR7 B;  1G29 1;  3RLF A;  1O78 A;  2A68 D;  2YYZ A;  3CRL C;  3OW7 A;  3IFT A;  3LWU A;  3OPO A;  1HCZ A;  3VR2 A;  3I72 A;  1QJO A;  3T56 B;  1T5E A;  2EVB A;  1HPC A;  3I73 A;  4LK1 C;  3SDZ A;  4KHZ A;  3GQB A;  3BDO A;  4KI0 A;  1BDO A;  5C0X H;  1IW7 D;  3QG1 A;  5BN5 A;  1IYU A;  3FPP A;  1ZYR C;  1OXX K;  3MXU A;  1EWH A;  2A6H D;  2PPB C;  2BE5 D;  1O7L A;  2EDG A;  2E76 C;  1Y8N B;  3H94 A;  4OO1 G;  1SMY C;  5KNC A;  1VF7 A;  1IW7 C;  5JEA G;  1FR3 A;  1E2Z A;  1GHJ A;  2O5J C;  1H9S B;  1Y8O B;  2CW0 C;  2D2C C;  2PNR C;  1I6V C;  2QF7 A;  2B8G A;  2A6E C;  1V43 A;  2BE5 C;  3IKJ A;  2JEA I;  3A8K E;  2D5D A;  2L5T A;  4KN4 C;  1ONL A;  4G7Z C;  2DNE A;  3PV0 A;  3GD7 A;  3VA7 A;  1K8O A;  2A68 C;  1OXT A;  1CTM A;  5BN3 A;  1Z6H A;  4TKO B;  1ZKO A;  2DNC A;  1CI3 M;  2E74 C;  4XIG S;  3L7Z C;  1VDZ A;  3PUZ A;  4DK1 A;  2O5I C;  4DNR B;  4DNT B;  1H9M A;  4RCN A;  4G7O C;  1VF5 C;  1YNN C;  2LMC B;  4DK0 A;  3EQL C;  4JK1 C;  1H9J A;  3VR6 A;  5K36 H;  4BA2 I;  3VR4 A;  1HTP A;  3NE5 B;  1GUO A;  4H13 C;  1OXV A;  1TKW B;  2K32 A;  3DXJ C;  3QIA A;  2PCF B;  3N6R A;  3AB9 A;  2JE6 I;  3M85 A;  3W3A A;  4OO1 H;  1FYC A;  3A8J E;  1H9S A;  2AWO A; 
#chains in the Genus database with same CATH topology
 2PQA A;  3A7L A;  1JB9 A;  1LTI D;  1V9P A;  3DHQ A;  2F4N A;  4GOP C;  4UZU A;  3AVT A;  2PI2 A;  3AFQ A;  3MA2 B;  2B2W C;  3S16 B;  4JV5 L;  1JE4 A;  1TT2 A;  1GXD C;  3RD4 A;  1C48 A;  4O1N A;  3CB4 A;  3OZU A;  1U4P A;  3WDN A;  1PHJ A;  2R3Z A;  1DCZ A;  4IAL A;  3LVB A;  3VDY A;  3MHB A;  1KC8 D;  1G6P A;  2R61 A;  2VB3 X;  3VR5 A;  1H9R A;  2WII B;  4N9T A;  3GTK B;  4KD4 A;  2P3M A;  3FPU B;  1XNR L;  3MCA A;  2F3I A;  2I0Q A;  2B5O A;  3PA1 A;  5TSS A;  1CK1 A;  1YNJ C;  3VMF A;  1E22 A;  3GTJ H;  3CC7 A;  4J15 A;  4JMQ A;  2A6E D;  2WV6 D;  4POF A;  1JMC A;  4GN5 A;  4FF1 A;  5H1S E;  3L3O C;  4CDE C;  1XE1 A;  2I1L A;  1CM9 A;  4IUU A;  4DPG A;  1K8M A;  1U4M A;  2PZW A;  4QGU A;  4B3T L;  2K75 A;  3GV6 A;  4AF7 A;  3H9N A;  5FO0 A;  4Z9C B;  1E7Z A;  1SMY D;  1BKB A;  2JA7 G;  1PZI D;  2OBS A;  4IPD A;  3GVK A;  2EYL A;  1Q7Y D;  1XMQ Q;  3BZK A;  2MP1 A;  2WYR A;  4LBV A;  3U9S A;  5GAD C;  1QNU A;  1WTV A;  3HOW H;  1Z9F A;  3RZD B;  4OO1 I;  2JJ2 A;  3A7A B;  1PJ6 A;  4NXM L;  1F20 A;  3ZBU A;  2A68 D;  5M3F B;  3GTL B;  1XJV A;  3GSI A;  1EY9 A;  4H9G A;  1E1R A;  3I72 A;  4A3E B;  3G6E B;  4A93 H;  1K73 D;  3CW2 A;  1RJT A;  3S14 H;  3M9B A;  5C0X J;  1GVP A;  4LFC Q;  4JG2 A;  2Q6O A;  1EFC A;  3BU2 A;  1P4M A;  2B2Y C;  4OPV A;  2EDG A;  1QG7 A;  1JJG A;  1I4G A;  5A2Q L;  1G7R A;  2PMD A;  4XYO A;  4ZCM A;  3G71 A;  4WQM A;  4R4I A;  2ZM6 Q;  2D2C C;  2PNR C;  1HTL D;  2IWH A;  4LF8 L;  3CC2 B;  4TT3 A;  2B8G A;  4K14 A;  3AQQ A;  1M4V A;  3TN2 A;  1ROD A;  1L1O B;  3VO1 A;  4QHY A;  3A8I A;  4GKK Q;  1KJZ A;  1XMO Q;  3I55 B;  3Q3A A;  4ACA A;  2DNE A;  3F1Z A;  1QUE A;  4F7X A;  2F0K A;  3GV3 A;  4P1V A;  1BCP D;  1LUZ A;  4IZ8 A;  4F8M A;  4HJ5 A;  5C4Z A;  5IYD G;  1TS3 A;  4IPC A;  1F2Y A;  4XIG S;  3WWV A;  3L7Z C;  5M5Y B;  5IP9 G;  3IFD A;  4XR6 A;  3S24 A;  1OB0 A;  4E6I A;  5NUC A;  5M3M G;  2UUA L;  3K5N A;  1KNA A;  3U9O A;  4AQY L;  2YWH A;  5CV5 A;  2BGJ A;  2NVX B;  2GJK A;  2F0E A;  3CAM A;  4X64 Q;  1KAB A;  1KTV A;  2C4U A;  4ZCI A;  1OGJ A;  1H9S A;  1QCB D;  1EOV A;  2B29 A;  3D31 A;  3FKI H;  5EQ0 A;  4P9S A;  4RGO S;  4ILW A;  3PEN A;  4F87 A;  3I2Z A;  4JBW A;  1N32 L;  3CME A;  2VS1 A;  3TZU A;  1GVH A;  1IKL A;  2KHI A;  2XZP A;  4B47 A;  1CHP D;  3PUW A;  4NBS A;  2DIE A;  1MAB A;  3ISX A;  1AE2 A;  2ZJP A;  5A2Q E;  1BCP C;  3ES9 A;  1OXU A;  4DXG A;  3CQZ H;  3ZJY C;  1YNX A;  2CK3 A;  3RY8 A;  1B44 D;  2IX3 A;  5IYB G;  3VR3 A;  3T4A C;  5C4J H;  4DV3 Q;  1LAB A;  1B9N A;  1EWY A;  1UE5 A;  3E5S A;  4JW0 A;  3GDE A;  5C44 H;  2X0K A;  3E20 A;  2DN8 A;  2NTT A;  3OWE B;  4XLE A;  1T6X A;  1W2B B;  2IPK D;  1KIX A;  3GTG B;  2VBU A;  5EKK A;  1PTO C;  1XMO L;  2BCO A;  2GK6 A;  2EYF A;  2XNA C;  1O7Y A;  2R92 G;  1FRN A;  2NVT H;  2Q8T A;  5G3L F;  1HNZ Q;  2ENB A;  2E2H B;  1AW7 A;  2V4D A;  2PW5 A;  1CUK A;  1MKH A;  1Q8K A;  1QH0 A;  1EP1 B;  4QV2 A;  2XIW A;  1WTH D;  3G48 A;  1RF2 D;  3WNB A;  3BC9 A;  5DAU A;  5GAE C;  1BX0 A;  1N8R D;  1JA0 A;  3CCV A;  1TWH H;  1X6O A;  1AE3 A;  2MNA A;  5A89 A;  4UZE A;  2LXK A;  4DV2 L;  4RMF A;  5IOC A;  3CCM B;  3AMU A;  3HOV B;  4A3I B;  1X65 A;  3HS0 C;  2K5W A;  4DV1 Q;  3BVZ A;  1SE2 A;  2BM0 A;  1KAA A;  2EY5 A;  3J7A V;  3M4Q A;  2A6H D;  2F0D A;  4LF5 L;  1N32 Q;  1A2U A;  5J35 A;  1PTO D;  4FXD A;  2YWE A;  5C5M A;  2O5J C;  5I6W A;  3S1M H;  4NDX A;  2V1C C;  1RKN A;  4A93 G;  1HR0 W;  4RDL A;  1ZM9 A;  2D5D A;  4X3S A;  1H95 A;  4XQF A;  1FNV A;  4BBR H;  5LMU Q;  4KV6 A;  3M4O B;  3VA7 A;  1HNX Q;  3S1Q B;  2V7W A;  1EYD A;  1FGU A;  2F0F A;  2JYO A;  3A3B A;  5JJZ A;  2ZZQ A;  4K2L A;  3J80 L;  4JCV E;  1MD2 D;  2B2W A;  2K05 A;  2XWB B;  2JA6 H;  5FO1 A;  4M4S A;  2LMC B;  2WAC A;  1IB0 A;  1LT6 D;  2EY1 A;  1EY8 A;  1T6Y A;  1PRT C;  4X65 Q;  3Q23 A;  3HOY B;  2DER A;  3HG9 A;  2AMC B;  5DLQ E;  2PZT A;  4OEM B;  5BSX A;  4PMB A;  2KJX A;  3CCS A;  4PMW A;  3OIP A;  2RC5 A;  3HAG A;  4Z4V A;  1I3Q H;  4OWX B;  3C46 A;  1DOM A;  1ASZ A;  2HUG A;  2EIX A;  1HUM A;  1TWF H;  1HNX L;  4JI3 Q;  1D5Z C;  1GUG A;  1N0U A;  1X56 A;  3QR8 A;  1E2V A;  1PTO B;  3HOV G;  2WSS A;  1RHP A;  1BUV T;  2K5H A;  2Q2H A;  1VQ8 A;  4C3J B;  2HIV A;  2RBM A;  3J81 E;  1VJS A;  1VQP B;  3OW2 B;  1YX2 A;  2AUK A;  2I46 A;  3DEO A;  4K8I A;  1XPR A;  1QFY A;  3CMA B;  4PQX A;  3NXW A;  4K5W A;  1D1N A;  4QIW B;  2OYN A;  4CDF C;  4X6A H;  1NR4 A;  1GUN A;  4B9X A;  3K7U C;  4KHP L;  1QVF B;  3VA5 A;  1H42 A;  1D6E C;  1VQG A;  3PUY A;  4U9U A;  2ICI A;  1N33 Q;  4UP9 A;  2X6Y A;  2L11 A;  4G4K A;  5HZA A;  4DR4 Q;  1WTH A;  3I4M H;  3PO2 G;  2Q6I A;  3BH4 A;  2VJI A;  2G9D A;  3TS2 A;  1MSG A;  4NP5 A;  2K7V A;  4XKV A;  1BMF A;  4ZCL A;  3CRK C;  2PLF A;  5IT9 c;  4X05 A;  2WFW A;  4A3I H;  2AQ3 B;  1TWA B;  2LZJ A;  1VQN A;  1D2E A;  2A6H C;  5TV2 A;  1CNF A;  1V5V A;  1JA1 A;  3RR5 A;  3I91 A;  1UD3 A;  1Y69 U;  2KEN A;  3K58 A;  2YWF A;  2RKS A;  4LFB L;  5FLX E;  1X3P A;  4JI0 Q;  3K6O A;  3PUV A;  4JI6 Q;  4XLA A;  3E0J A;  1LTG D;  2VJJ A;  1HQM C;  2D9U A;  3ND8 A;  1FJG L;  2HCJ B;  4TMT A;  3W5H A;  1HFG A;  2PQE A;  2I5H A;  4OXP A;  5C4X B;  3ZBT A;  3HZX A;  3V7A A;  1LYL A;  4NXN Q;  1QJO A;  3PIP 3;  5ELD A;  1M8A A;  3I73 A;  3SDZ A;  2R92 H;  3H0G B;  1BDO A;  2JDI A;  5DEH A;  4LF4 Q;  2MHV A;  4TRD A;  5FJ8 H;  4QB4 A;  2OCE A;  1VQ4 B;  4ZUJ A;  3MXU A;  5C44 B;  3VO2 A;  1EP2 B;  5A88 A;  4GN4 B;  2HT1 A;  3FVQ A;  4PNY A;  1S72 A;  4FN5 A;  1SMY C;  2GVA A;  3ZC3 A;  3NPP A;  5IGB A;  1H9S B;  3M4O H;  2KVO A;  1I6V C;  1XPO A;  3UI2 A;  1JWS D;  5HGT A;  2RCN A;  1VQP A;  4FVM A;  3H15 A;  5M5X B;  2R7D A;  5KEE A;  4MYT A;  4Y52 H;  4TMW A;  1W0K A;  3F2D A;  4BWG B;  4OX9 L;  4B3M L;  5KYL A;  2A68 C;  4C2M B;  3PCO B;  4K6L A;  3D4D A;  5KRU A;  4DR1 L;  3PUZ A;  4RG1 A;  5FK9 C;  3H0G G;  2NWG A;  4YWK A;  1XTD A;  4FDB A;  4G7O C;  5FLX L;  3HOW G;  4OEL B;  2QCP X;  3ULP A;  1PTO F;  1ZUN B;  3VNV A;  1HJP A;  4MIU A;  5FO7 B;  4EGV A;  1GAW A;  2K52 A;  2EIF A;  4IFD H;  5M5W H;  1WD0 A;  1I6H H;  3KLW A;  3FMC A;  4KN7 C;  1QVG B;  5KYI A;  1YVC A;  4LBZ A;  1AMO A;  4S3S A;  2EQS A;  3FDT A;  2HLD A;  4Z4U A;  1YHQ B;  3GTP H;  1CSQ A;  4P2N A;  3DDY A;  3JAM i;  2NZH A;  3KBG A;  3H3V I;  4XDX A;  1XWE A;  2N78 A;  2UXB L;  4CJ1 B;  4BY7 B;  1HZE A;  2FHT A;  2G9H D;  3M7G A;  3CCL A;  1YZ6 A;  2PNH A;  2KCC A;  2F4V L;  3X3N A;  4XQQ A;  4BY7 G;  2X6X A;  3HP3 A;  5C0X G;  1OGI A;  3AU7 A;  4X66 L;  4TMZ A;  4ROX A;  4CGY B;  1I4P A;  2C5H A;  4ID6 A;  1UE1 A;  2HDN B;  1HZC A;  4DR1 Q;  3W1B A;  1E24 A;  3HOV H;  4HED A;  2PI2 E;  4Z4R A;  1TU2 B;  4XOP A;  3AVV A;  1VHE A;  3AVW A;  1OHH A;  3CCM A;  4HCE A;  3OE7 A;  3R2I A;  4C3J H;  3T51 B;  1EQT A;  1Y1V G;  3W2G A;  1I18 A;  2YU9 B;  1NB0 A;  4NCN A;  1A0I A;  2YTY A;  4K0K Q;  1V0F A;  2B63 G;  2ZXI A;  2R6G A;  2V7Q A;  1LTB D;  1TWF B;  2F0J A;  2RC6 A;  1Y1V B;  3NBH A;  1BO0 A;  3KF8 B;  1PFM A;  4PZ8 A;  5J39 A;  4QUC A;  4I7A A;  3I1F A;  3FKI G;  2B63 B;  3CC7 B;  1EQV A;  3KL9 A;  2NBF A;  5HUR A;  3D6C A;  5C3W A;  2R93 H;  3RLN A;  1O7Z A;  4X0C A;  5EBD A;  2OQ0 A;  1M90 C;  3E0E A;  4AQY Q;  4CBV A;  1EU4 A;  1WFQ A;  1QUF A;  3FKI B;  5ELF A;  1UD2 A;  4A3G B;  3J81 i;  4BBS G;  4GN3 B;  3FKS A;  1YNJ D;  1U5K A;  4DAM A;  1KK3 A;  2JSO A;  1VQH A;  2B2V C;  2ZIT A;  4KHZ A;  2D3N A;  3BDO A;  4A3K H;  4A3G G;  5M3M B;  1N9W A;  4A3D H;  3WY9 A;  5ELE A;  1SYC A;  1NB9 A;  4N3G A;  2QDX A;  4LBW A;  2BE5 D;  2R7F A;  2ZBU A;  3DM3 A;  2Y0S B;  1FR3 A;  3ASS A;  5AJ3 L;  3K57 A;  4MYU A;  3CCJ B;  5FKA C;  4EQP A;  1SLJ A;  2BH8 A;  3I4N G;  1UD4 A;  3CXC A;  3CRZ A;  1CKN A;  3MZ5 A;  2VQE Q;  4R9W A;  4OIJ A;  3GD7 A;  2N88 A;  1M1K D;  4V0B A;  4B3X A;  4LC0 A;  2A19 A;  4JI1 L;  4IUV A;  2B7B A;  1K73 C;  3S2D H;  1A63 A;  1C8C A;  3KF6 A;  2UUC Q;  3R3O A;  4CJ0 B;  2K5D A;  1WDT A;  4RGT A;  1TXY A;  3A74 A;  5JOB A;  1NBW A;  1N36 Q;  3MTS A;  4A3J H;  4Z4Y A;  2FIN B;  2A8V A;  1J5E L;  5THX A;  4QUF A;  3ZYY X;  3GTL H;  2WZP P;  1FVI A;  1QX4 A;  3MWY W;  3STB C;  1E3X A;  3K7A H;  1HZA A;  1I94 Q;  3CPW B;  1VS0 A;  2NB0 A;  3B6Y A;  2ZZF A;  3RZD H;  3QE2 A;  4FF2 A;  2QGG A;  1D7Q A;  3W2F A;  4H44 C;  4JYA L;  4NXM Q;  1GUS A;  4L6T B;  3FEW X;  3RLO A;  2AHO A;  3S2H B;  5JEA J;  5CYU A;  3I70 A;  1AFP A;  1R5N A;  1SSO A;  3BNW A;  1ET9 A;  4HIO A;  4RGM A;  4RD1 A;  1TWC H;  2P5Z X;  1TII D;  3Q6Q A;  3PF4 A;  1COW A;  1YLO A;  1UWV A;  4V19 0;  4PMC A;  1G6Z A;  1PVO A;  2WJY A;  4MZ9 A;  2VB2 X;  3I8Z A;  5M3F H;  1HVX A;  1A3V A;  2HHH L;  4P71 A;  2F0S A;  4PG3 A;  1A8P A;  4ZUI A;  4ZYS A;  5HZB A;  2GK7 A;  5KIX A;  1KMH A;  3CCQ B;  1X3E A;  1HR0 Q;  1F2L A;  1JWU D;  1JC7 A;  5BSY A;  1VQO B;  1B2R A;  2VNJ A;  1NE3 A;  3A5Z B;  3CCR B;  1NRK A;  1I94 L;  1MSH A;  2F0G A;  3TBI B;  5C4X G;  1PXU A;  3GVL A;  3KYH C;  3PUX A;  5K36 G;  3JQP A;  1GO3 E;  1KRS A;  1KD1 C;  1E43 A;  5GV8 A;  2DCU A;  1A8V A;  4B9W A;  2ZTG A;  4LF6 L;  4TSF A;  5KNL A;  5CMD A;  2J7Z A;  1FNC A;  1IJF A;  1VQF A;  1IW7 D;  2FJ2 A;  1JT8 A;  3FPP A;  1XNQ L;  1N0V C;  2I07 B;  2Q2I A;  5JEA G;  1HQR D;  4FF3 A;  2QW7 A;  1DG1 G;  4DXF A;  2FXQ A;  3WYA A;  2QF7 A;  5IGG A;  3B8H A;  1QGA A;  2A74 C;  1G7T A;  5GQO A;  3SEJ A;  4NNJ A;  1STN A;  5CV6 A;  2V31 A;  2GPJ A;  2JA5 G;  1CQF A;  4DV1 L;  3CCU B;  4WJ4 A;  2JA8 H;  1KDC A;  2TSS A;  5LMN Q;  1VMP A;  3U2Q A;  1KD1 D;  2DNC A;  1E1T A;  4XXE A;  3S14 B;  4AC9 A;  4K5V A;  3EQL C;  4LNQ A;  1I50 B;  1CKO A;  1SAP A;  1F9S A;  3LO8 A;  3EIV A;  1JB7 A;  1IBL Q;  1K83 H;  1EY5 A;  2QKI C;  3N6R A;  4R8I A;  5HXB A;  1HA5 A;  3NK9 A;  1BBX C;  2RDF A;  5BN4 A;  2O2L D;  1WTR A;  4RD4 A;  2X3U A;  1YIT A;  2UUB L;  4DR4 L;  2WIN B;  3W2I A;  2VY3 A;  1Z7T A;  1WPC A;  1CT1 D;  4R1J A;  3JAM E;  2R93 B;  1LM0 A;  3TME A;  5BR8 L;  2QEX A;  2F0U A;  1QE6 A;  5IGE A;  4X8I A;  1IBM Q;  2E75 C;  2YWG A;  4GOP A;  2HQE A;  3V76 A;  2OTL A;  4H0L C;  1V1P B;  1UUP A;  4DU9 A;  1WSR A;  5JJI A;  3CU7 A;  1B9M A;  5M5X H;  1H8H A;  4KKS A;  2XEX A;  1SE8 A;  4JI8 L;  1BVS A;  2YU9 H;  1EIH A;  3ONY A;  1IXR A;  4A3D B;  4QVJ A;  2IL8 A;  2QTZ A;  1PH9 A;  3DM1 A;  1MJC A;  1W6K A;  1HNW Q;  2RDH A;  5I4D A;  2IW3 A;  1DZ1 A;  3OTO Q;  1B1Z A;  2UXD Q;  1ZEQ X;  5D3I B;  4HE5 A;  1GAQ A;  1A3T A;  1C7Y A;  2ASB A;  4A3F G;  1HHV A;  1STG A;  1UEA B;  1Q1E A;  3T1Y Q;  5C4H A;  4X65 L;  1ZM2 A;  1IL2 A;  5IYC G;  1SNQ A;  4A3M G;  2JXM B;  3STB D;  4P12 A;  3CCS B;  1S72 B;  3KK7 A;  5D65 A;  2QA4 A;  3HOU B;  3NTI A;  1X32 A;  1B3Q A;  4FP5 D;  3K5M A;  4DV4 L;  2B3G A;  4C3J G;  3K7A B;  2CF4 A;  3PO3 H;  3OOC A;  1VQ5 A;  1S5E D;  5AN9 A;  4RD3 A;  4TVA B;  1SN8 A;  1TUI A;  1UE6 A;  4DR7 Q;  2ATW A;  2OQK A;  4X62 Q;  2OTJ A;  1FD7 D;  1L0X B;  1KDB A;  1STH A;  3P27 A;  1X3Q A;  4CQJ A;  3A8J A;  1TY2 A;  3A35 A;  4WZT A;  1PJ7 A;  3BDL A;  1KZL A;  4LK1 C;  3RNU A;  1QWY A;  1AH9 A;  1ZM4 A;  4XLF A;  5C0X H;  1B3A A;  2RDG A;  2PIA A;  1LTA D;  3TQY A;  2BGI A;  1EWH A;  1WJJ A;  3OTO L;  1O7L A;  1F60 A;  1YJN B;  2E76 C;  2K5V A;  4WRD A;  1XPU A;  1SMX A;  1VF7 A;  1SKQ A;  2NYZ D;  2ZTN A;  3PF5 A;  1Y8O B;  2CW0 C;  1EFI D;  4IUP A;  4C1N I;  2C4T A;  3SR1 A;  5JVH 3;  2JA8 G;  3S9W A;  4R4T A;  1EZ8 A;  2Z6K A;  3SEB A;  1EFR A;  3M3Y H;  2QEX B;  1HH2 P;  3WNC A;  4M1K A;  1MHW C;  2PMZ E;  2Z8L A;  3OAA A;  1UMK A;  2C5C A;  4KK7 A;  1D2B A;  1X9N A;  1E79 A;  1Q81 D;  4YAL A;  4A76 A;  4M0L A;  1HZ9 A;  1BPL A;  1VQ8 B;  3H0G H;  3J7A 5;  1QFJ A;  4NXN L;  4POG A;  3CTA A;  4P3I A;  3HOX G;  5E1F A;  3PQI A;  4ZCK A;  3W3A A;  3B82 A;  2NZO A;  3J81 k;  1EYC A;  3G05 A;  2R7Z B;  2JIZ A;  4R71 A;  4UP8 A;  5C4X H;  5LHY 1;  4LFB Q;  1Y1V H;  1ESR A;  1SYE A;  1VQD A;  3J80 E;  1YIJ A;  1QVC A;  4ZRZ A;  5JBQ A;  1P8L A;  1W6J A;  3E1Y E;  1NUC A;  2IT1 A;  2K1B A;  1VQO A;  4LUZ A;  4FK8 A;  1KK2 A;  5IYR A;  1VQ7 B;  1S5D D;  4TQU S;  1EU3 A;  2OTJ B;  3K8A A;  5EPL A;  4DUZ L;  3I4O A;  2VBS A;  1EZ6 A;  1WP6 A;  1L2F A;  2AWN A;  3HOY G;  1BBW A;  5K5P A;  5HY6 A;  3T1H L;  2ZTE A;  3OYY A;  4WJ3 M;  4KY5 A;  4GKJ L;  1TY0 A;  4B3M Q;  4KMU C;  3PUM A;  5HKK A;  4R4C A;  1XYI A;  3D3R A;  2N3S A;  2RHQ B;  5IOD A;  3KFU A;  1B70 B;  4OWT B;  4JV5 Q;  4UHV A;  4LF8 Q;  5DM6 3;  4DAY B;  4LF7 Q;  2AUJ D;  2UU9 Q;  4PC3 A;  4J1M A;  5DNF A;  4TMV A;  2NZ1 D;  4RM0 A;  1ILP A;  5EPK A;  5LMN W;  1TVX A;  3I4L A;  1QZG A;  1R5O A;  4RDK A;  2XGT A;  4OOS A;  4L5S A;  4UDU C;  1TTT A;  2M00 A;  1GHK A;  1WOC A;  1D1K A;  3I55 A;  1SFO B;  1S4Z A;  3UE0 A;  2CC2 A;  1JQY D;  4IN3 A;  2EJG C;  4XT3 B;  1LO5 D;  1B50 A;  1WCM H;  5IYD H;  4RPB A;  1DYQ A;  2VZA A;  1TVC A;  1U2R A;  1K0R A;  2F0H A;  1P16 A;  3T56 B;  4LF7 L;  2AQ2 B;  1W34 A;  1BR9 A;  3JC6 6;  3T1H Q;  2R6H A;  4CJ2 C;  2ZL5 A;  4G5G A;  5BN5 A;  2VXW A;  1VQL B;  1QUQ A;  3R6J A;  1XMQ L;  4G1V A;  2K14 A;  4XKW A;  3V96 A;  3MEH A;  1SM4 A;  1ZYR D;  2KEC A;  2RA4 A;  1ET6 A;  1YHA A;  1JNY A;  2KQ3 A;  3ERS X;  5FLM H;  1SNP A;  4HJA A;  4JI4 L;  4XLH A;  1XX8 A;  2JJQ A;  2JEA I;  2WJV A;  3K0Y A;  3G4S B;  4QCL A;  2M5S A;  4K0K L;  3Q6S A;  3Q0A A;  3U50 C;  1PH5 A;  1WOR A;  2BM1 A;  4TKO B;  5IYW A;  1XB2 A;  4JI7 L;  4DK1 A;  1H9M A;  4B4D A;  4DNT B;  2RF4 A;  1DON A;  3PIO 3;  2UXC L;  2QMU A;  2HHH Q;  1VQ6 A;  4K8J A;  5K36 H;  2XNJ A;  4B3T Q;  4HN7 A;  3SJP A;  4H13 C;  1GUO A;  4FO2 A;  2C35 B;  2ZTC A;  4KY6 A;  4CKB A;  2QE7 A;  4DV6 L;  3TRE A;  5TRD A;  4AF6 A;  2VBT A;  1Q7Y C;  3H3V C;  3AVY A;  3MEF A;  3NEN A;  3S1Q H;  3M3Y B;  3D4R A;  1KQS B;  3CC4 B;  1VMC A;  3CMM A;  2DGY A;  3TP8 A;  2JP1 A;  1NMG A;  2CW0 D;  4RH6 A;  5CV9 A;  1SJE D;  4JI1 Q;  5M5Y H;  4G7W A;  2BVN A;  5KND A;  2DY1 A;  1FNB A;  2L9H A;  3QFR A;  5ELO A;  2DY8 A;  2BN4 A;  3HGB A;  2E2H H;  2B39 A;  3PO3 B;  1MIU A;  1KRH A;  3EN2 A;  4DGZ A;  3CW2 C;  1B4O A;  4PZ7 A;  3MFG A;  2BA0 A;  4PC6 A;  1E2W A;  1N08 A;  3OJX A;  2VUM H;  4N3N A;  2L0C A;  5FJ8 G;  5LL6 S;  5DS0 A;  4P6Y A;  4KTA A;  5ISR A;  1N34 L;  3J81 c;  4C1N K;  1FND A;  1FL0 A;  3CCR A;  1N05 A;  3QJY A;  3G4S A;  3QOL A;  4O2D A;  1VQE A;  3GTQ B;  5IYP A;  1EXM A;  1EFT A;  1PH3 A;  1FRQ A;  4YAO A;  3OKX A;  2UUC L;  4DQL A;  2PQA B;  2XWJ B;  3S1N B;  1BX1 A;  2K6A A;  4UZF A;  3AVU A;  4GZY C;  2E2I B;  2B8F A;  1PTO H;  1S3O A;  2WB1 B;  1STB A;  1W9X A;  1IBK L;  1DM0 B;  1NMF A;  1KDA A;  5E4W C;  1VQL A;  2CH4 A;  4B3R L;  2K03 A;  3ONU A;  3W2D A;  3H91 A;  2E2J B;  1I3Q B;  5CC4 A;  4L8J A;  1QVG A;  2EOT A;  1WD1 A;  1BNZ A;  1MI2 A;  4KKT A;  2AHO B;  4DR2 Q;  1JJC B;  5IYB H;  1O78 A;  4QL5 A;  2YYZ A;  1B7Y B;  1I4Q A;  1SE4 A;  2OEO A;  2RVL A;  4C0S A;  5FOB B;  1E1Q A;  3SXH A;  4JC0 A;  3A5U A;  4F88 A;  5LMU L;  2OBR A;  2UUB Q;  2F4I A;  2KCT A;  3CPW A;  2D9R A;  4XOT A;  3RMH A;  3NHH A;  1CA6 A;  1I50 H;  1Q86 C;  3GTM H;  2CCZ A;  2PPB C;  3H94 A;  1IYJ B;  5KNC A;  2JA8 B;  5C3X A;  2Q2U A;  4II2 A;  4M8A A;  4IOC A;  2X53 S;  1N06 A;  3Q39 A;  1DAR A;  5COY A;  5FO9 B;  1HR0 L;  4KHP Q;  1VQK A;  3JQQ A;  2GJR A;  3L2P A;  2SNM A;  3PV0 A;  1X3G A;  1CTM A;  2TMP A;  3S16 H;  3U6B A;  3KOJ A;  4JI5 Q;  1VQB A;  2F52 A;  2ZTD A;  5EBC A;  4BBR G;  1V1O A;  2H5X A;  5C6A A;  1QGZ A;  1TS5 A;  2L1B A;  4YCU A;  3VR6 A;  1SRU A;  2E5L Q;  4DUY Q;  3QIA A;  3I4N H;  2JA6 G;  1WTQ A;  3T13 A;  1AZP A;  1IBK Q;  3SK5 A;  4K2K A;  5T1I A;  2NTS A;  3L9A X;  4K5X A;  5JAV A;  1PFN A;  1MJE A;  3CD6 B;  3LX0 A;  3M4Y A;  2A69 D;  1S5C D;  3SE0 A;  1ENA A;  1II3 A;  4RHS A;  1G91 A;  3Q8D A;  5FIU A;  1DD2 A;  2X85 A;  5KSW B;  1SDF A;  5A35 A;  3DLL A;  4BPR A;  2L55 A;  1M1K C;  1LTL A;  4X7E A;  2WZN A;  1L0W A;  4FYD A;  2X6G A;  2Z4I A;  1CHQ D;  1NY4 A;  5ELN A;  2EXD A;  4LUO A;  1CQX A;  1YHB A;  5GAH C;  2HD3 A;  2EE1 A;  1XNQ Q;  4WJW A;  2IX0 A;  2ES2 A;  1K28 D;  5J3B A;  3ONA B;  4A93 B;  4Z4S A;  5IT9 L;  4ABN A;  1WTP A;  5IYN A;  4K1X A;  4P2C B;  2NV4 A;  4KKU A;  3O13 A;  3PA2 A;  2EYJ A;  3KLR A;  1G7S A;  3WBJ A;  1AEX A;  1EEF D;  5IP7 G;  2WAQ B;  1UEB A;  2CQO A;  1PZK D;  2F0V A;  4RCY A;  4TMX A;  2X6L A;  3KUP A;  4L63 B;  1EY4 A;  5E4X A;  3W5O A;  2D74 A;  2A69 C;  4O42 A;  1Y0Y A;  2CKZ B;  1PFS A;  3EBE A;  1SJH D;  4DV3 L;  4DR5 L;  4PC2 A;  1SRO A;  4KLK A;  2NPF A;  1IBM L;  3D26 A;  3EVQ A;  2AQ1 B;  2VW9 A;  1K83 B;  3TEH B;  5IYQ A;  1PLF A;  4O0A A;  4A3J G;  4YWM A;  2KED A;  3T1Y L;  4XLC A;  2F0N A;  5TY0 A;  1QIL A;  3NQI A;  2WKC A;  1TLL A;  1E3Z A;  4RGN A;  2BMW A;  4OWW B;  1S5F D;  4A3J B;  1YHQ A;  5ELB A;  1BJK A;  1TWC B;  3K59 A;  3OEH A;  3CCE B;  3C3L A;  3BY1 A;  3OZW A;  2B2V A;  2EYM A;  2XVS A;  2XRS D;  1AN8 A;  1Y8N B;  1RD9 D;  5EMN A;  5F4M A;  1VQ5 B;  3GIR A;  3GTO H;  4AYB B;  2F4V Q;  1V43 A;  4P75 A;  4I65 A;  3OW2 A;  3ZPN A;  1YJ9 B;  1BCP B;  1GOZ A;  5LL6 X;  4DV5 L;  2Z1C A;  3HKZ E;  2GJP A;  1PZJ D;  2WR8 A;  4RD0 A;  2NVQ B;  1Z6H A;  4GS3 A;  2WAQ E;  3D6W A;  1IL8 A;  1MGS A;  4DNR B;  4XNF A;  4JVZ A;  4LFA L;  1VF5 C;  3W2H A;  4HMI A;  1YJ9 A;  5T1G A;  2O4X A;  4R4Q A;  4JI2 L;  3SLD A;  3I4M G;  2F0P A;  3VYS A;  1IKM A;  4G6I A;  2SEB D;  1JCK B;  3M85 A;  2PYK A;  2PO4 A;  4KD3 A;  4OO1 H;  1KLG D;  4A3B G;  5FNZ A;  5DSZ A;  1S5B D;  3K0X A;  3CCE A;  4DR5 Q;  1U9R A;  2ZT9 C;  5D3D A;  1JR0 D;  4BY1 H;  2B63 H;  1HUN A;  2ZXO A;  4C3I G;  4B3G A;  5CBE E;  2BDO A;  4EX5 A;  2JA7 B;  2K04 A;  1UD6 A;  2E2J H;  2ZL7 A;  4RLZ A;  2BV3 A;  4JBM A;  4L5Q A;  1WSV A;  1O7I A;  2ICE C;  2F0O A;  5LMZ A;  5IE8 A;  3OWF A;  2EJM A;  2PZU A;  3NQT A;  2IHE A;  1GO2 A;  2OF1 A;  3JAM c;  1VQM A;  2D0O A;  3CPF A;  3EFX D;  4AYB E;  2MO0 A;  1D5M C;  2Q8I B;  4JI0 L;  4OOV A;  3FP9 A;  3HKZ G;  4X06 A;  2B7C A;  1RTN A;  4G7X A;  2Z6B D;  4X07 A;  2GVB A;  1GKH A;  4B3F X;  3OP1 A;  4LFA Q;  3WBK A;  2ALY B;  2QEJ C;  3FPK A;  1VQN B;  3SK6 A;  1H85 A;  4P6V F;  1IJE A;  1K3R A;  2FMC A;  2XOK A;  1R4P B;  2ZZG A;  3BYY B;  2DET A;  4HJ8 A;  1KXL A;  4OPO A;  4IUT A;  1NJI C;  3F8T A;  1D1I A;  1K8A D;  4Q5V A;  4A3M B;  1EQQ A;  2OK8 A;  2EJF C;  4JI7 Q;  4IPH A;  2W6I A;  2E2I H;  4BBS B;  4PC7 A;  5KW9 A;  5AJ3 Q;  4YY3 Q;  1FNM A;  2N8N A;  1FGB D;  1VQ9 A;  3I4N B;  2X69 A;  5F4J A;  4P3Y A;  4JI4 Q;  3A1P A;  1PH2 A;  3OPO A;  1VHO A;  4A3F B;  2VNI A;  3CXC B;  4EQ5 A;  2VQE L;  1TWA H;  1X55 A;  1VQ6 B;  1SE3 A;  1YNN D;  1LT4 D;  4MNO A;  2BDN A;  1K3B C;  3TP6 A;  3TZD A;  3RZO H;  4RAU C;  3KJO A;  3DUZ A;  1RQP A;  1U0L A;  1RQR A;  2J7K A;  2PE3 A;  1WVL A;  2RSO A;  2M9V A;  4YHB A;  4JI6 L;  2IY5 B;  2F0M A;  5J3O A;  3BS1 A;  3DWP A;  1KC8 C;  1EYA A;  2A6E C;  4LW1 A;  4C3H B;  2BE5 C;  4RCO A;  3CCQ A;  1I8D A;  2DYI A;  1WOP A;  4X64 L;  3CC2 A;  4YIJ A;  1XQB A;  2F3V A;  3R8B A;  1VLO A;  3P7J A;  4QMG A;  1EOT A;  4RFB A;  2OBT A;  1JWM D;  1OXT A;  4DV7 Q;  4A3K B;  1QUQ B;  2Z9H A;  2KOL A;  1VQK B;  1UE7 A;  2NUC A;  1Y0R A;  5C5L A;  4A3K G;  3NBH B;  2L4N A;  3E9I A;  2JN4 A;  1EY6 A;  4A4I A;  4KY7 A;  4JOI C;  2JA5 H;  1B23 P;  3U58 A;  1QOH A;  3A8J E;  3G6J B;  4UP7 A;  3LGJ A;  1BF4 A;  1PH6 A;  2JK8 A;  3IAY A;  1SEB D;  3Q22 A;  1Q90 A;  1SFO H;  3M7N A;  4X3K A;  2K50 A;  2X6W A;  1CKM A;  1BLI A;  3T53 B;  1R5B A;  5C0X I;  5EPJ A;  3SLN A;  1JIC A;  1N36 L;  3D8G A;  4G1B A;  4M2L A;  5IP9 H;  4A3B H;  4C3H H;  2B2U A;  2OK7 A;  5C3E H;  1Q12 A;  3I7F A;  4P22 A;  1VQ9 B;  1DXM A;  4FNF A;  3CCL B;  1EUJ A;  2NVY H;  3V2T A;  3S17 H;  2DOG A;  2D62 A;  2CQA A;  1F2Z A;  4LUV A;  3NUC A;  1KRT A;  1X3F A;  5A8A A;  5F2D A;  1LLR D;  2EXZ A;  4DR3 Q;  2F03 A;  2NN6 H;  1LTT D;  4QY7 A;  4IFD I;  1DOK A;  1WCM B;  2LFN A;  4HJ9 A;  1H8E A;  1W87 A;  2GQF A;  4DV2 Q;  5ELC A;  4A75 A;  4GNX B;  4DK3 C;  2BA1 A;  1CSP A;  4Q0F A;  1CZG A;  1EL0 A;  1R9T B;  4PGO A;  3U6K A;  1D8L A;  4U67 3;  1QGY A;  5IP7 H;  2CFM A;  4ZQ3 A;  4ASU A;  4QIW E;  3S15 B;  2C77 A;  3J7Y W;  4XT1 B;  1UD8 A;  2I5M X;  4A3C G;  4JOI A;  3WND A;  2ZM6 L;  5L46 A;  2E5L L;  1LT5 D;  2EYP A;  1LT3 D;  5IYC H;  4A3M H;  4LBY A;  3C2Q A;  3LWE A;  4YEL A;  5H5J A;  1T5E A;  4DV0 Q;  4F7D A;  1EP3 B;  2H1E A;  2EY2 A;  2LS0 1;  3Q6R A;  3PO3 G;  2H4O A;  1TWG B;  4ME3 A;  3C2P A;  5C3E B;  3HEJ A;  2MPM A;  3F2U A;  3LQE A;  2G5D A;  3BYT B;  2JA6 B;  3CPX A;  4UY8 C;  1VQ4 A;  2QN6 A;  1E2Z A;  2B2U C;  5FL7 A;  1PH1 A;  4P26 A;  1UNS A;  1VQI A;  4BS9 A;  4U68 A;  3P1H A;  5H59 A;  4DF7 A;  3TRZ A;  4LF6 Q;  4B43 A;  4DV0 L;  3S1M B;  4OP7 A;  5GAG C;  2FVG A;  3HOZ G;  4C56 C;  3BZC A;  4Z4Z A;  1K8O A;  1C0A A;  3PIO A;  5JPM C;  4AIM A;  2WAQ G;  4RD6 A;  5CV8 A;  3OMC A;  4MHE A;  1KNE A;  3KBX A;  2JQO A;  4DAY A;  2V7U A;  4FWT A;  3NE5 B;  5JJL A;  1WYD A;  1B8A A;  2CVR A;  1SXT A;  2JE6 I;  1JOR A;  4HJ7 A;  3ASP A;  2KEE A;  1SYD A;  5GV7 A;  2AWO A;  2DY7 A;  4DQK A;  1JOK A;  1TWH B;  1E62 A;  1SNC A;  3ND9 A;  1OTC A;  5CDF A;  3HOZ B;  3NBI A;  5JVG 3;  1AZQ A;  1XXG A;  4JI5 L;  1YJW B;  3ERQ A;  4XTC S;  1H9K A;  1WOS A;  4DN4 M;  5CBA E;  5CV7 A;  4H7B A;  3BZD B;  3I56 A;  4X66 Q;  4G7H C;  3CF5 A;  2FMM A;  1BBU A;  4LF9 Q;  5C3E G;  2KUM A;  3SK8 A;  4GKK L;  4XMY A;  3CMA A;  3RZO B;  4WWV A;  4IFD J;  5JJK A;  4NB3 A;  3K81 C;  4Y9U A;  1E0B A;  2ZXP A;  1BQQ T;  3KDF B;  1STY A;  4AYB G;  4LF5 Q;  4UAJ A;  1EY7 A;  4IJH A;  1T5X D;  1T6Z A;  3P75 A;  4DR7 L;  1QNK A;  3HOU G;  5FLM G;  4YWL A;  2R93 G;  1DDI A;  3QO2 A;  2HDL A;  3MXP A;  5B6I A;  2KHS A;  1SKY B;  2KVM A;  4Y7C A;  1IBL L;  4JBK A;  2Y0S E;  1PDQ A;  3W5V A;  2VQF Q;  2CRV A;  4GOP B;  3BCF A;  5KNB A;  4LF4 L;  3SHL A;  4FXU A;  1IZ6 A;  5JPN C;  4DK6 C;  3OZV A;  5IWA L;  2XN9 C;  1N34 Q;  1QFZ A;  1A6X A;  3RN2 A;  3AST A;  4P73 A;  4A3D G;  3OHX C;  1ENF A;  4CDC C;  5HGQ A;  4M53 A;  1K28 A;  1VQA A;  1YIT B;  3GTG H;  2OWO A;  1OO9 B;  2UXD L;  3MVV A;  3QFC A;  2Q6L A;  4ZV4 A;  1SBB B;  1D5X C;  3ZIA A;  1G29 1;  1MBY A;  1PA6 A;  1PV4 A;  4ZAI A;  1HCZ A;  1SNO A;  2XRQ D;  3E3X A;  4ODG A;  2DJF C;  3DEP A;  1NTG A;  1CZW A;  2MQH A;  3W5U A;  2VQF L;  4OX9 Q;  2ZJQ A;  2MGS A;  5LMN L;  3X3M A;  4AH6 A;  2MFI A;  2GA4 B;  3CD6 A;  1OXX K;  4A3I G;  1Y1W B;  1E64 A;  1ELO A;  1TR5 A;  4A3C H;  1J9Z A;  1YI2 B;  3R93 A;  4GLV B;  3AYH B;  3NWS A;  4P25 A;  2RSN A;  1HFN A;  3F2C A;  4ZLT F;  4Y7N B;  4RKL A;  3PO2 B;  3SJZ A;  2L15 A;  4DR6 L;  2C5B A;  2LSS A;  2CH4 W;  2L5T A;  1PFB A;  4IO9 A;  4G7Z C;  2WKD A;  1N33 L;  3ASQ A;  1W35 A;  4WOR A;  5IWA Q;  3EA6 A;  3GTO B;  3NTH A;  1ZKO A;  4N9P A;  2E74 C;  1K8G A;  2WB1 E;  4HID A;  1STA A;  2VL6 A;  4R8N A;  2NVX H;  3ULL A;  3S1R B;  3J80 c;  2RQX A;  3HOX B;  4JK1 C;  2V7T A;  4X62 L;  1FDR A;  1H9J A;  4PC1 A;  3WXM A;  1OB2 A;  5COR A;  4OHJ A;  2ID0 A;  5EGT A;  1K9M D;  2KBN A;  4QQB X;  3DWA A;  3KLS X;  2NVQ H;  2J4X A;  4DKA C;  1WTW A;  2EYO A;  2Z6B A;  3MFY A;  1A15 A;  3WOF A;  1B2T A;  3E9H A;  4QJF A;  4XM3 A;  2K28 A;  4TSS A;  1G8Z D;  5EKL A;  3QFS A;  1Y8P B;  2ZJR A;  4G57 A;  4N8X 1;  3KJP A;  1FJG Q;  2K5Q A;  3MXN B;  4Y9R A;  4XN0 A;  4HSP A;  4KHV A;  4BY1 G;  4OGQ C;  2BSA A;  2A5H A;  3I56 B;  1V1Q A;  4JI2 Q;  1RTO A;  2HDM A;  2QDL A;  2CWA A;  4Y7N H;  3PO2 H;  4XYQ A;  2D0P A;  4QVA A;  4RD2 A;  2F3W A;  2SNS A;  1STE A;  3L0O A;  5I2X A;  3NP8 A;  4C3H G;  3T16 A;  3SKB A;  4A3E H;  1ENC A;  1K9M C;  1F9Q A;  1W0J A;  2QA4 B;  1EWI A;  1BQE A;  1R4Q B;  1NDH A;  4YXW A;  4IOA A;  4R4O A;  4J8Q A;  4BA1 I;  3MC0 B;  4IW3 B;  3HOW B;  1G51 A;  1WOO A;  3TP7 A;  1EIF A;  3K80 C;  3AGP A;  3E6Z X;  4X7F A;  4N8F A;  1Q8I A;  3A54 A;  1PYS B;  2E2D C;  2K33 A;  2K01 A;  4EH1 A;  2YV5 A;  2Z0S A;  1JOQ A;  3GVJ A;  1ICF B;  1EIY B;  2KCM A;  4Z4W A;  2UXC Q;  1IYV A;  1V0E A;  5JEA H;  2VNU D;  1VQJ A;  4M1U B;  1FNW A;  3TP5 A;  4CDD C;  2ZL6 A;  3HKZ B;  1GR1 A;  1N07 A;  2XND A;  1I4X A;  1YEZ A;  3IFT A;  3VR2 A;  3ZZT A;  2Q2T A;  2W6J A;  5KGU A;  3BVG A;  2VNH A;  1HPC A;  1L1O A;  2DUD A;  4KI0 A;  3QSY A;  2ZBV A;  1Q82 D;  1XFO A;  1DGS A;  3S1N H;  5I9O A;  4II3 A;  1ZYR C;  5TR9 A;  4RCZ A;  3HOX H;  4OPS A;  1PKV A;  4RJL A;  1S4M A;  1MRZ A;  4YHH Q;  1C9O A;  3MHP A;  1W2B A;  5E6T A;  4ME5 A;  1X54 A;  3LQ6 A;  5GRO A;  5C44 G;  3CP0 A;  4WZE A;  3W2E A;  3ZZ0 A;  5D14 A;  3TSS A;  4ACB A;  2I5L X;  3IKJ A;  2BPO A;  2EFG A;  5IK2 A;  3V05 A;  2C2W A;  3Q24 A;  3BCD A;  3KDF A;  3SK4 A;  4HIK A;  3A8K A;  3UDF A;  2JN9 A;  2JJ1 A;  1WCM G;  4K6D A;  3CCU A;  1A3U A;  1IHZ A;  4CHT B;  4EVO A;  4DAP A;  5IIF A;  3HOZ H;  1T9H A;  5EJW A;  1SYG A;  3IL8 A;  1YNN C;  5EKI A;  1Q3L A;  4IUQ A;  1ML0 D;  2YTV A;  1ZM3 A;  4ZGN B;  1DDG A;  2K32 A;  3D0F A;  4AVZ A;  4J0Q A;  3PGZ A;  1QZH A;  1E1O A;  1PYW D;  3CME B;  3ULJ A;  2CW5 A;  4X3U A;  4NPS A;  4RPD A;  3H3V H;  1L0Y B;  4B3R Q;  1GJX A;  1NR2 A;  3OEE A;  4APV A;  2HQL A;  2GN5 A;  2F1M A;  1IHM A;  1J9O A;  1O80 A;  2L12 A;  4LAA A;  2HIX A;  1KQS A;  3AGQ A;  3CC4 A;  2Z4H A;  4C2M H;  2LY7 A;  4BXX G;  1HRJ A;  5CV4 A;  1G2S A;  3OSO A;  3HRZ C;  1KK1 A;  4RHR A;  4HMJ A;  2WP8 J;  2JEB I;  4CKC A;  1W3S A;  1Y1W H;  2SOB A;  1I7P A;  4DV6 Q;  1GD7 A;  3GTJ B;  1VCI A;  4PV1 C;  4CKE A;  1J8I A;  2HCI A;  1M90 D;  3VNU A;  4LFC L;  3A8I E;  4FF4 A;  3J80 i;  2XSC A;  1FX0 A;  4RA8 A;  2B2Y A;  4HIM A;  3P26 A;  1HA6 A;  3WOE A;  3GTQ H;  1Q1B A;  4GLX A;  3G7L A;  1CFM A;  4A3G H;  2IJ0 A;  2E8G A;  4IFD G;  3PIP A;  1EFW A;  3GP7 A;  3IRB A;  1ESF A;  2X8K A;  3FJO A;  3G71 B;  3BG3 A;  3CHB D;  2R92 B;  2VUM B;  3KF6 B;  3R6K A;  3MMP A;  2NN6 G;  1NBM A;  2M2L A;  1PH4 A;  4GQN A;  4I7Z C;  4A3L G;  1UD5 A;  4DV7 L;  4WZK A;  1DJR D;  1CNE A;  3QWN A;  4MTN A;  3A3G A;  3HKS A;  5I9P A;  4BY7 H;  2F0T A;  2XGJ A;  3SVM A;  5CGK A;  4LJZ C;  2CBX A;  5E7N A;  3RLF A;  1JB3 A;  3CRL C;  3BY2 A;  3S1R H;  3S2D B;  1R9T H;  2CHB D;  2PMZ B;  2EVB A;  1U4L A;  2VNK A;  1WTX A;  2Z6K C;  3AFP A;  3R2T A;  4X7C A;  3SGI A;  2ZXR A;  4WFN 3;  2Q8R E;  2EYH A;  3BJU A;  4C3I H;  3QB3 A;  4YCW A;  1PYB A;  2UUA Q;  1IW7 C;  1I4R A;  3S17 B;  4DR3 L;  1GHJ A;  4HIZ A;  1QB5 D;  1BXT A;  3W1G A;  3C1E A;  2QDB A;  1FNU A;  3CKI B;  4IJL A;  4YAF A;  5I2Y A;  1ASY A;  4B3S L;  4JBJ A;  2C9O A;  4PZ6 A;  2XZO A;  2CWP A;  3GTM B;  1A62 A;  3QFT A;  1KHI A;  1KL9 A;  1CQV A;  2QIL A;  1HNZ L;  5M3M H;  1TS2 A;  4A3E G;  1CI3 M;  1EIG A;  4ALP A;  3TS0 A;  2MUY A;  1CKN B;  2O5I C;  1VLY A;  4RCN A;  3Q38 A;  3N52 A;  2VUM G;  4JYA Q;  4XN3 A;  1G7C A;  2WB1 G;  1NSN S;  2B2T A;  4ZK9 B;  2LXJ A;  2IHF A;  2FX3 A;  1WI5 A;  3C1F A;  3B78 A;  1TWG H;  1I4H A;  3WQZ A;  5M9O A;  3CCJ A;  2F0W A;  1TKW B;  2Y0S G;  3J81 L;  5G3L D;  2ZZE A;  4XOR A;  1E63 A;  4PAB A;  1U4R A;  1VQ7 A;  3HOY H;  4HE6 A;  1A2T A;  4B08 A;  4IQZ A;  1LV9 A;  1EFU A;  1YI2 A;  3EJI A;  1VQM B;  4Z4T A;  1YIJ B;  1KAW A;  1L1O C;  3CES A;  1KK0 A;  1DOL A;  4JPB W;  4LMQ D;  2D3L A;  5L37 A;  2SDF A;  4BBR B;  1ILQ A;  1RCV D;  2DEU A;  3NWT A;  4HTH A;  3VYT A;  4OOX A;  4HSV A;  4J6H A;  1CA5 A;  1RDP D;  3M4P A;  2WPD A;  4DV4 Q;  3LNN A;  4B3S Q;  2BOS A;  4XL9 A;  3RUZ A;  4XD7 A;  1Q86 D;  1J5E Q;  4YAW A;  5FA6 A;  1TQO A;  2K5N A;  1JJ2 B;  3KF8 A;  2PW7 A;  2HCC A;  3GO5 A;  1SNM A;  4UAI A;  1SND A;  1YBY A;  2QGQ A;  3OIQ A;  4NKL A;  4X3T A;  4EQN A;  3VYR A;  2CND A;  2Q6K A;  4DR2 L;  1EYG A;  1WU8 A;  3URY A;  1PJ5 A;  2B2T C;  3DWQ A;  2R9V A;  3K5O A;  4LF9 L;  1Y1W G;  5CR3 A;  2XZL A;  3AVX A;  3S15 H;  3MXN A;  3GTP B;  5FO8 B;  3PUN A;  3ICE A;  5E3F A;  3JAM L;  3H09 A;  1F77 A;  5M5W B;  4DNI A;  1I6H B;  1LAC A;  2OT2 A;  1RIP A;  3P20 A;  3U4V A;  2N55 A;  2QTL A;  3UDG A;  1SR3 A;  5IGF A;  4QFM A;  4HR7 B;  3BQJ A;  4RDJ A;  1S40 A;  3LWU A;  2BH2 A;  4XON A;  2JA5 B;  4EQO A;  3JU4 A;  3NEL A;  4Z1M A;  2XTI A;  1V1P A;  1SYB A;  2FFK B;  3RN5 A;  4A3L H;  2OTL B;  3GQB A;  2NVY B;  4B48 A;  1VQC A;  5M3F G;  1EQR A;  2MO1 A;  4OL7 A;  3QG1 A;  2C78 A;  1IYU A;  3TDQ A;  1HNW L;  1KLU D;  2F0Q A;  4L5R C;  4PAA A;  4OO1 G;  1Y14 B;  3ER0 A;  4DA2 A;  4L5T A;  2KHJ A;  4MTK A;  3ZUG A;  4RWS C;  1BOS A;  3PMF A;  3CQZ B;  3A8K E;  2LKV A;  2HMA A;  4OON A;  4B44 A;  4UPA A;  4XQN A;  2RHS B;  3MXG A;  4ZKC B;  4X7D A;  1NCV A;  2R7Z H;  3I3C A;  2JA7 H;  3ASR A;  4YCV A;  1HXY D;  1GJR A;  1JE5 A;  4BY1 B;  1VDZ A;  2F0L A;  3ZZU A;  2JA9 A;  2MJ8 A;  1TS4 A;  1J6Q A;  1Q82 C;  3K5L A;  2V7V A;  5IT9 E;  2E1R A;  1OXV A;  2N49 A;  2XNC A;  2J0T D;  3DMU A;  3DXJ C;  2BF4 A;  2PCF B;  4JI8 Q;  4IPG A;  3AB9 A;  4Q7J B;  3CCV B;  1KTK A;  1EY0 A;  4A3F H;  1FYC A;  4P74 A;  3UDI A;  1Z47 A;  4DV5 Q;  1NNX A;  1I5F A;  4XQJ A;  2DJG C;  4H02 A;  3PVD A;  1AIP A;  3OFN A;  1NAP A;  5F4O A;  1QVF A;  5IGC A;  2F1L A;  4HCS A;  2E1B A;  4YY3 L;  2K4K A;  1PH7 A;  1F2M A;  1Q9S A;  3H6M A;  2V7X A;  1B53 A;  2RCF A;  1S0U A;  5I6Y A;  3KEW A;  4DUY L;  2NN6 I;  4E0F A;  1OXS C;  4DR6 Q;  3NSW A;  4BXX H;  2ZXH A;  3I4M B;  4YAU A;  1N8R C;  1LTS D;  1YJN A;  3QOJ A;  1HZB A;  1K0S A;  2KA7 A;  2KCN A;  4QF4 A;  1E3P A;  4KJN A;  3OMG A;  4A3B B;  1D8T A;  5BR8 Q;  3NTK A;  3J7Z C;  1NJI D;  1OB5 A;  3NEM A;  4QUZ A;  2AKW B;  4ZKB B;  4BBS H;  4GNX A;  4DUZ Q;  1GUT A;  4YEJ A;  2VZL A;  4P72 A;  3CP8 A;  1PMR A;  2NVT B;  2F0I A;  3UDX A;  2OXP A;  4JI3 L;  2EPB A;  2EY6 A;  3F2B A;  1QG0 A;  1PRT F;  3VYU A;  4YHH L;  3J81 j;  3HOU H;  1V8Q A;  1EWC A;  1JOO A;  1EEI D;  1F9R A;  3ITP A;  4WZL A;  3OW7 A;  5J1Z A;  1UAP A;  2GRE A;  4KJO A;  1ICW A;  4ZGQ B;  4IUN A;  4RKB A;  4GNX C;  2F43 A;  1C4Q A;  4OIK A;  3BVM A;  5AFW A;  5C4J B;  1Q81 C;  3ERO A;  1PRT D;  4GKJ Q;  5IY0 A;  3MAQ A;  2A1A A;  3FRP B;  3A55 A;  3FHW A;  2UXB Q;  3D4W A;  3U4Z A;  1XTC D;  4MN3 A;  1ZXT A;  4GLA C;  3CP2 A;  4NW2 A;  1SYF A;  1LTR D;  1WTO A;  5IGD A;  3JQR A;  1F9P A;  3BDC A;  1GM5 A;  3GTK H;  5DN6 A;  2R7Z G;  1AP0 A;  2IX1 A;  5EAY A;  5J22 A;  3S2H H;  4C43 A;  4KN4 C;  5FLX c;  1ONL A;  4C3I B;  1XNR Q;  1YJW A;  1HA3 A;  5DM7 3;  4HAE A;  5BN3 A;  1G2T A;  4LWC A;  3AEV A;  2YTX A;  4ULL A;  2A73 B;  1JJ2 A;  4IUR A;  4DAV A;  4FXK C;  4TN1 A;  3PSI A;  4DK0 A;  1PH8 A;  3J7A F;  4FXG C;  4BA2 I;  3VR4 A;  3G6E A;  1BCP F;  1HTP A;  3A0J A;  3A56 A;  3HFZ B;  3I90 A;  1K8A C;  2UU9 L;  1GUW A;  3OJW A;  4DFA A;  1RL2 A;  3KLS A;  2VYQ A;  4NMZ A;  2EZV A;  1Q46 A;  3UE1 A;  2VBV A;  1PRT B; 
#chains in the Genus database with same CATH homology
 3A7L A;  1LTI D;  3DHQ A;  4UZU A;  3MA2 B;  2B2W C;  3S16 B;  1JE4 A;  1TT2 A;  1GXD C;  3RD4 A;  1C48 A;  4O1N A;  3WDN A;  1U4P A;  2R3Z A;  1DCZ A;  4IAL A;  3MHB A;  2R61 A;  2VB3 X;  3VR5 A;  1H9R A;  2WII B;  4N9T A;  3GTK B;  4KD4 A;  3FPU B;  5TSS A;  1CK1 A;  1YNJ C;  4JMQ A;  2A6E D;  2WV6 D;  4FF1 A;  3L3O C;  4IUU A;  1CM9 A;  1K8M A;  1U4M A;  2PZW A;  3GV6 A;  4Z9C B;  1SMY D;  1PZI D;  3GVK A;  2EYL A;  2MP1 A;  3U9S A;  1QNU A;  1WTV A;  4OO1 I;  3RZD B;  2JJ2 A;  3A7A B;  2A68 D;  5M3F B;  3GTL B;  1EY9 A;  3I72 A;  1E1R A;  4A3E B;  1RJT A;  5C0X J;  2B2Y C;  2EDG A;  1QG7 A;  1I4G A;  5A2Q L;  4XYO A;  2D2C C;  2PNR C;  1HTL D;  2IWH A;  2B8G A;  4TT3 A;  4K14 A;  3TN2 A;  1M4V A;  1ROD A;  2DNE A;  4F7X A;  2F0K A;  3GV3 A;  1BCP D;  4IZ8 A;  4F8M A;  5C4Z A;  1TS3 A;  1F2Y A;  4XIG S;  3L7Z C;  5M5Y B;  3IFD A;  4XR6 A;  1OB0 A;  4E6I A;  5NUC A;  3K5N A;  1KNA A;  3U9O A;  5CV5 A;  2NVX B;  2GJK A;  2F0E A;  1KAB A;  1H9S A;  1QCB D;  3D31 A;  5EQ0 A;  4RGO S;  4ILW A;  4F87 A;  4JBW A;  3TZU A;  1IKL A;  2XZP A;  1CHP D;  3PUW A;  2DIE A;  1MAB A;  5A2Q E;  1BCP C;  1OXU A;  4DXG A;  2CK3 A;  1B44 D;  2IX3 A;  3VR3 A;  3T4A C;  1LAB A;  1B9N A;  3E5S A;  2DN8 A;  2NTT A;  3OWE B;  4XLE A;  2IPK D;  3GTG B;  5EKK A;  1PTO C;  2BCO A;  2GK6 A;  2EYF A;  2XNA C;  1O7Y A;  2Q8T A;  5G3L F;  2E2H B;  2ENB A;  1AW7 A;  2V4D A;  2PW5 A;  2XIW A;  1WTH D;  1RF2 D;  3BC9 A;  5DAU A;  5IOC A;  3AMU A;  3HOV B;  4A3I B;  3HS0 C;  2K5W A;  3BVZ A;  1SE2 A;  1KAA A;  2EY5 A;  3J7A V;  2A6H D;  2F0D A;  1A2U A;  1PTO D;  4FXD A;  5C5M A;  2O5J C;  5I6W A;  4NDX A;  1RKN A;  2D5D A;  4X3S A;  4XQF A;  1FNV A;  4KV6 A;  3M4O B;  3VA7 A;  3S1Q B;  1EYD A;  2F0F A;  2JYO A;  3A3B A;  5JJZ A;  2ZZQ A;  4K2L A;  3J80 L;  1MD2 D;  2B2W A;  2K05 A;  2XWB B;  2LMC B;  2WAC A;  1LT6 D;  2EY1 A;  1EY8 A;  1PRT C;  3Q23 A;  3HOY B;  3HG9 A;  2PZT A;  4PMB A;  2KJX A;  4PMW A;  3OIP A;  3HAG A;  3C46 A;  1DOM A;  2HUG A;  1HUM A;  1D5Z C;  1GUG A;  1E2V A;  1PTO B;  2WSS A;  1RHP A;  1BUV T;  4C3J B;  2RBM A;  3J81 E;  1VJS A;  2AUK A;  2I46 A;  3DEO A;  4K8I A;  4PQX A;  3NXW A;  4K5W A;  4QIW B;  1NR4 A;  1GUN A;  4B9X A;  3VA5 A;  1D6E C;  3PUY A;  2ICI A;  2X6Y A;  2L11 A;  4G4K A;  3BH4 A;  2VJI A;  2G9D A;  1MSG A;  4NP5 A;  2K7V A;  4XKV A;  1BMF A;  3CRK C;  2AQ3 B;  1TWA B;  2LZJ A;  2A6H C;  3I91 A;  1UD3 A;  1Y69 U;  3K58 A;  2RKS A;  5FLX E;  1X3P A;  3K6O A;  3PUV A;  4XLA A;  3E0J A;  1LTG D;  2VJJ A;  1HQM C;  2D9U A;  3ND8 A;  1HFG A;  2PQE A;  5C4X B;  3HZX A;  1QJO A;  3PIP 3;  5ELD A;  1M8A A;  3I73 A;  3SDZ A;  3H0G B;  1BDO A;  2JDI A;  5DEH A;  2MHV A;  4TRD A;  4QB4 A;  4ZUJ A;  5C44 B;  3MXU A;  3FVQ A;  4PNY A;  1SMY C;  3NPP A;  5IGB A;  1H9S B;  2KVO A;  1I6V C;  3UI2 A;  1JWS D;  5HGT A;  4FVM A;  5M5X B;  5KEE A;  1W0K A;  4BWG B;  5KYL A;  2A68 C;  4C2M B;  4K6L A;  3D4D A;  5KRU A;  3PUZ A;  5FK9 C;  2NWG A;  4G7O C;  5FLX L;  2QCP X;  1PTO F;  4MIU A;  5FO7 B;  4EGV A;  4IFD H;  1WD0 A;  3FMC A;  4KN7 C;  5KYI A;  4S3S A;  3FDT A;  2HLD A;  3DDY A;  3KBG A;  4XDX A;  1XWE A;  4BY7 B;  4CJ1 B;  1HZE A;  2FHT A;  2G9H D;  3M7G A;  2KCC A;  3X3N A;  4XQQ A;  2X6X A;  3HP3 A;  5C0X G;  3AU7 A;  4CGY B;  1I4P A;  4ID6 A;  4HED A;  1TU2 B;  4XOP A;  1OHH A;  4HCE A;  3OE7 A;  3R2I A;  3T51 B;  1EQT A;  1I18 A;  2YU9 B;  1V0F A;  2ZXI A;  2R6G A;  2V7Q A;  1LTB D;  1TWF B;  2F0J A;  1Y1V B;  3NBH A;  5J39 A;  1BO0 A;  1PFM A;  4QUC A;  2B63 B;  1EQV A;  2NBF A;  5HUR A;  3D6C A;  5C3W A;  1O7Z A;  5EBD A;  4CBV A;  1EU4 A;  3FKI B;  5ELF A;  1UD2 A;  4A3G B;  3FKS A;  1YNJ D;  2JSO A;  2B2V C;  4KHZ A;  2D3N A;  3BDO A;  5M3M B;  5ELE A;  1SYC A;  2BE5 D;  2Y0S B;  1FR3 A;  3K57 A;  5FKA C;  4EQP A;  1UD4 A;  3MZ5 A;  4R9W A;  4OIJ A;  3GD7 A;  2N88 A;  4V0B A;  4IUV A;  1C8C A;  3R3O A;  4CJ0 B;  2K5D A;  4RGT A;  5JOB A;  3MTS A;  2FIN B;  4QUF A;  3ZYY X;  2WZP P;  3MWY W;  1E3X A;  2NB0 A;  2ZZF A;  4FF2 A;  4H44 C;  1GUS A;  4L6T B;  3FEW X;  3S2H B;  5JEA J;  5CYU A;  3I70 A;  1AFP A;  1SSO A;  1ET9 A;  4RGM A;  1TII D;  1COW A;  4V19 0;  4PMC A;  1G6Z A;  2WJY A;  2VB2 X;  3I8Z A;  1HVX A;  1A3V A;  2F0S A;  4ZYS A;  4ZUI A;  2GK7 A;  5KIX A;  1KMH A;  1F2L A;  1JWU D;  1JC7 A;  1NRK A;  1MSH A;  2F0G A;  3TBI B;  1PXU A;  3GVL A;  3PUX A;  5K36 G;  1E43 A;  4B9W A;  2ZTG A;  4TSF A;  5KNL A;  5CMD A;  2J7Z A;  1IW7 D;  2FJ2 A;  3FPP A;  2I07 B;  5JEA G;  1HQR D;  4FF3 A;  4DXF A;  2QF7 A;  5IGG A;  2A74 C;  4NNJ A;  1STN A;  5CV6 A;  2V31 A;  1CQF A;  1KDC A;  2TSS A;  1VMP A;  2DNC A;  4XXE A;  3S14 B;  4K5V A;  3EQL C;  1I50 B;  1SAP A;  1F9S A;  1EY5 A;  2QKI C;  3N6R A;  4R8I A;  1HA5 A;  3NK9 A;  1BBX C;  2RDF A;  5BN4 A;  2O2L D;  1WTR A;  2WIN B;  1Z7T A;  1WPC A;  1CT1 D;  3JAM E;  2R93 B;  3TME A;  2F0U A;  1QE6 A;  5IGE A;  2E75 C;  2HQE A;  4H0L C;  1V1P B;  1UUP A;  4DU9 A;  3CU7 A;  1B9M A;  1H8H A;  4KKS A;  1EIH A;  4A3D B;  2IL8 A;  3DM1 A;  1W6K A;  2RDH A;  5I4D A;  2IW3 A;  1DZ1 A;  1B1Z A;  1ZEQ X;  5D3I B;  1A3T A;  1HHV A;  1STG A;  1UEA B;  1Q1E A;  5C4H A;  1SNQ A;  2JXM B;  3KK7 A;  3HOU B;  5D65 A;  3NTI A;  1X32 A;  4FP5 D;  3K5M A;  4C3J G;  3K7A B;  3OOC A;  1S5E D;  1FD7 D;  1L0X B;  1KDB A;  1STH A;  1X3Q A;  1TY2 A;  3A35 A;  3BDL A;  4LK1 C;  1KZL A;  1QWY A;  4XLF A;  5C0X H;  1B3A A;  2RDG A;  1LTA D;  1EWH A;  1O7L A;  2E76 C;  4WRD A;  1VF7 A;  2NYZ D;  2ZTN A;  1Y8O B;  2CW0 C;  1EFI D;  4IUP A;  4C1N I;  3SR1 A;  5JVH 3;  3S9W A;  1EZ8 A;  3SEB A;  1EFR A;  2Z8L A;  3OAA A;  4KK7 A;  2C5C A;  1D2B A;  1E79 A;  1BPL A;  5E1F A;  3W3A A;  1EYC A;  3G05 A;  2R7Z B;  2JIZ A;  5LHY 1;  1ESR A;  1SYE A;  3J80 E;  4ZRZ A;  1W6J A;  1NUC A;  2IT1 A;  2K1B A;  1S5D D;  4TQU S;  1EU3 A;  5EPL A;  1EZ6 A;  1WP6 A;  2AWN A;  5K5P A;  4KY5 A;  1TY0 A;  4KMU C;  5HKK A;  1XYI A;  3D3R A;  5IOD A;  5DM6 3;  2AUJ D;  4J1M A;  5DNF A;  2NZ1 D;  1ILP A;  5EPK A;  1TVX A;  3I4L A;  4UDU C;  2M00 A;  1GHK A;  1D1K A;  1SFO B;  1S4Z A;  1JQY D;  4IN3 A;  2EJG C;  4XT3 B;  1LO5 D;  1B50 A;  1DYQ A;  2F0H A;  3T56 B;  2AQ2 B;  1BR9 A;  4CJ2 C;  5BN5 A;  2VXW A;  4XKW A;  3V96 A;  3MEH A;  1ZYR D;  2KEC A;  2RA4 A;  1ET6 A;  2KQ3 A;  1SNP A;  4XLH A;  1XX8 A;  2JEA I;  2WJV A;  3K0Y A;  4QCL A;  2M5S A;  3Q6S A;  3Q0A A;  4TKO B;  4DK1 A;  1H9M A;  4DNT B;  1DON A;  3PIO 3;  4K8J A;  5K36 H;  4HN7 A;  4H13 C;  1GUO A;  4FO2 A;  4KY6 A;  4CKB A;  2QE7 A;  3H3V C;  3M3Y B;  3D4R A;  3CMM A;  1VMC A;  3TP8 A;  2JP1 A;  2CW0 D;  4RH6 A;  5CV9 A;  1SJE D;  4G7W A;  5KND A;  2L9H A;  2DY8 A;  3HGB A;  2B39 A;  3PO3 B;  4DGZ A;  1B4O A;  3MFG A;  2BA0 A;  1E2W A;  2L0C A;  5LL6 S;  4KTA A;  5ISR A;  4C1N K;  3QJY A;  3QOL A;  3GTQ B;  2XWJ B;  3S1N B;  2K6A A;  4GZY C;  2E2I B;  2B8F A;  1PTO H;  2WB1 B;  1STB A;  1W9X A;  1DM0 B;  1KDA A;  5E4W C;  2K03 A;  3W2D A;  3H91 A;  2E2J B;  1I3Q B;  5CC4 A;  4L8J A;  2EOT A;  1WD1 A;  1BNZ A;  1MI2 A;  4KKT A;  1O78 A;  2YYZ A;  1I4Q A;  1SE4 A;  2OEO A;  2RVL A;  5FOB B;  1E1Q A;  3SXH A;  4F88 A;  2F4I A;  4XOT A;  3RMH A;  3NHH A;  1CA6 A;  2PPB C;  3H94 A;  5KNC A;  2JA8 B;  5C3X A;  4II2 A;  4M8A A;  2X53 S;  5COY A;  5FO9 B;  2GJR A;  2SNM A;  3PV0 A;  2TMP A;  1CTM A;  5EBC A;  1V1O A;  5C6A A;  1TS5 A;  2L1B A;  3VR6 A;  3QIA A;  1WTQ A;  3T13 A;  1AZP A;  3SK5 A;  4K2K A;  5T1I A;  2NTS A;  3L9A X;  4K5X A;  5JAV A;  1PFN A;  3LX0 A;  3M4Y A;  2A69 D;  1S5C D;  3SE0 A;  1ENA A;  1II3 A;  4RHS A;  1G91 A;  1DD2 A;  2X85 A;  5A35 A;  1SDF A;  2L55 A;  4FYD A;  2X6G A;  2Z4I A;  1CHQ D;  2EE1 A;  4WJW A;  2IX0 A;  1K28 D;  3ONA B;  4A93 B;  5IT9 L;  4ABN A;  1WTP A;  4P2C B;  4KKU A;  3O13 A;  2EYJ A;  3KLR A;  1AEX A;  1EEF D;  2WAQ B;  1PZK D;  2F0V A;  2X6L A;  3KUP A;  4L63 B;  1EY4 A;  5E4X A;  2A69 C;  4O42 A;  1SJH D;  3EVQ A;  2AQ1 B;  1K83 B;  1PLF A;  2KED A;  4XLC A;  2F0N A;  1QIL A;  3NQI A;  2WKC A;  4RGN A;  1E3Z A;  1S5F D;  4A3J B;  5ELB A;  1TWC B;  3K59 A;  3OEH A;  3C3L A;  2B2V A;  2EYM A;  2XVS A;  2XRS D;  1AN8 A;  1Y8N B;  1RD9 D;  4AYB B;  1V43 A;  4I65 A;  3ZPN A;  1BCP B;  1GOZ A;  5LL6 X;  2Z1C A;  2GJP A;  1PZJ D;  2NVQ B;  1Z6H A;  3D6W A;  1IL8 A;  1MGS A;  4DNR B;  4XNF A;  1VF5 C;  4HMI A;  5T1G A;  2O4X A;  2F0P A;  3VYS A;  1IKM A;  4G6I A;  2SEB D;  1JCK B;  3M85 A;  2PYK A;  2PO4 A;  4KD3 A;  4OO1 H;  1KLG D;  1S5B D;  1U9R A;  2ZT9 C;  5D3D A;  1JR0 D;  1HUN A;  2ZXO A;  4C3I G;  4B3G A;  5CBE E;  2BDO A;  2JA7 B;  2K04 A;  1UD6 A;  2ICE C;  2F0O A;  3OWF A;  2EJM A;  2PZU A;  3NQT A;  2OF1 A;  3EFX D;  1D5M C;  2Q8I B;  1RTN A;  4G7X A;  2Z6B D;  4B3F X;  2QEJ C;  3SK6 A;  2FMC A;  2XOK A;  1R4P B;  2ZZG A;  3BYY B;  4IUT A;  1D1I A;  4Q5V A;  4A3M B;  2EJF C;  2W6I A;  4BBS B;  1FGB D;  3I4N B;  2X69 A;  3OPO A;  4A3F B;  1SE3 A;  1YNN D;  1LT4 D;  2BDN A;  3TP6 A;  3TZD A;  4RAU C;  3DUZ A;  1WVL A;  2RSO A;  2M9V A;  2F0M A;  3BS1 A;  3DWP A;  1EYA A;  2A6E C;  4C3H B;  2BE5 C;  4RCO A;  1I8D A;  4YIJ A;  2F3V A;  3R8B A;  3P7J A;  4QMG A;  1EOT A;  4RFB A;  1JWM D;  1OXT A;  4A3K B;  2KOL A;  2NUC A;  5C5L A;  2L4N A;  1EY6 A;  4KY7 A;  1QOH A;  3A8J E;  3G6J B;  1BF4 A;  3IAY A;  1SEB D;  3Q22 A;  1Q90 A;  3M7N A;  4X3K A;  2X6W A;  1BLI A;  3T53 B;  5C0X I;  5EPJ A;  1JIC A;  3D8G A;  2B2U A;  1Q12 A;  4FNF A;  4P22 A;  1DXM A;  3V2T A;  2D62 A;  2CQA A;  1F2Z A;  3NUC A;  5F2D A;  1LLR D;  2EXZ A;  2F03 A;  4IFD I;  2NN6 H;  1LTT D;  1DOK A;  1WCM B;  2LFN A;  1H8E A;  5ELC A;  2BA1 A;  4Q0F A;  1EL0 A;  1CZG A;  1R9T B;  4U67 3;  4ZQ3 A;  4ASU A;  3S15 B;  3J7Y W;  4XT1 B;  1UD8 A;  1LT5 D;  2EYP A;  1LT3 D;  3LWE A;  4YEL A;  1T5E A;  2H1E A;  2EY2 A;  2LS0 1;  2H4O A;  1TWG B;  3C2P A;  5C3E B;  3HEJ A;  2MPM A;  3F2U A;  3BYT B;  2JA6 B;  1E2Z A;  2B2U C;  5FL7 A;  1UNS A;  4BS9 A;  4U68 A;  3P1H A;  4DF7 A;  3S1M B;  4C56 C;  1K8O A;  5JPM C;  5CV8 A;  3OMC A;  4MHE A;  1KNE A;  3KBX A;  4DAY A;  3NE5 B;  2CVR A;  1SXT A;  2JE6 I;  1JOR A;  2KEE A;  1SYD A;  2AWO A;  2DY7 A;  1JOK A;  1TWH B;  1SNC A;  3ND9 A;  5CDF A;  3HOZ B;  3NBI A;  5JVG 3;  1AZQ A;  1XXG A;  3ERQ A;  4XTC S;  1H9K A;  4DN4 M;  5CBA E;  5CV7 A;  4H7B A;  3BZD B;  4G7H C;  2FMM A;  2KUM A;  3SK8 A;  4XMY A;  3RZO B;  4IFD J;  1E0B A;  2ZXP A;  1BQQ T;  1STY A;  1EY7 A;  1T5X D;  3P75 A;  1QNK A;  3QO2 A;  2HDL A;  3MXP A;  2KHS A;  1SKY B;  2KVM A;  1PDQ A;  3BCF A;  5KNB A;  3SHL A;  4FXU A;  5JPN C;  1A6X A;  2XN9 C;  3OHX C;  1ENF A;  1OO9 B;  3MVV A;  1SBB B;  1D5X C;  3ZIA A;  1G29 1;  1MBY A;  4ZAI A;  1HCZ A;  1SNO A;  2XRQ D;  4ODG A;  3DEP A;  1CZW A;  2MGS A;  3X3M A;  2GA4 B;  1OXX K;  1Y1W B;  1TR5 A;  3R93 A;  3NWS A;  2RSN A;  1HFN A;  4ZLT F;  4Y7N B;  4RKL A;  3PO2 B;  2L5T A;  1PFB A;  4G7Z C;  2WKD A;  4WOR A;  3EA6 A;  3GTO B;  3NTH A;  1ZKO A;  4N9P A;  2E74 C;  1STA A;  4R8N A;  3S1R B;  3HOX B;  2RQX A;  4JK1 C;  1H9J A;  5COR A;  4OHJ A;  2ID0 A;  5EGT A;  3DWA A;  3KLS X;  2J4X A;  1WTW A;  2EYO A;  3WOF A;  3MFY A;  1A15 A;  1B2T A;  4XM3 A;  2K28 A;  4TSS A;  1G8Z D;  5EKL A;  1Y8P B;  4G57 A;  2K5Q A;  4XN0 A;  4HSP A;  4KHV A;  4OGQ C;  2A5H A;  1RTO A;  2HDM A;  4XYQ A;  2F3W A;  2SNS A;  1STE A;  5I2X A;  3NP8 A;  4C3H G;  3T16 A;  1ENC A;  1F9Q A;  1W0J A;  1R4Q B;  4YXW A;  4J8Q A;  4BA1 I;  3MC0 B;  3HOW B;  3TP7 A;  3E6Z X;  1Q8I A;  3A54 A;  2E2D C;  2K33 A;  2K01 A;  1JOQ A;  3GVJ A;  1IYV A;  1V0E A;  5JEA H;  2VNU D;  4M1U B;  1FNW A;  3TP5 A;  3HKZ B;  1I4X A;  2XND A;  3IFT A;  3VR2 A;  2W6J A;  5KGU A;  3BVG A;  1HPC A;  4KI0 A;  5I9O A;  4II3 A;  1ZYR C;  1PKV A;  4ME5 A;  5D14 A;  3TSS A;  3IKJ A;  5IK2 A;  3V05 A;  3Q24 A;  3BCD A;  3SK4 A;  2JJ1 A;  4K6D A;  1A3U A;  1IHZ A;  4CHT B;  4EVO A;  4DAP A;  5IIF A;  5EJW A;  1SYG A;  3IL8 A;  1YNN C;  5EKI A;  1Q3L A;  4IUQ A;  1ML0 D;  2K32 A;  4AVZ A;  1PYW D;  4X3U A;  1L0Y B;  1GJX A;  1NR2 A;  3OEE A;  2F1M A;  1J9O A;  1O80 A;  2L12 A;  4LAA A;  2Z4H A;  2LY7 A;  1HRJ A;  5CV4 A;  1G2S A;  3OSO A;  3HRZ C;  4RHR A;  4HMJ A;  2WP8 J;  2JEB I;  4CKC A;  2SOB A;  1J8I A;  3GTJ B;  1VCI A;  4PV1 C;  4CKE A;  2HCI A;  3A8I E;  4FF4 A;  2XSC A;  1FX0 A;  4RA8 A;  2B2Y A;  1HA6 A;  3WOE A;  1Q1B A;  3G7L A;  1CFM A;  2IJ0 A;  4IFD G;  3GP7 A;  1ESF A;  2X8K A;  3CHB D;  3BG3 A;  2R92 B;  2VUM B;  2NN6 G;  1NBM A;  2M2L A;  4GQN A;  4I7Z C;  1UD5 A;  1DJR D;  3QWN A;  3A3G A;  5I9P A;  2F0T A;  2XGJ A;  3SVM A;  5CGK A;  4LJZ C;  3RLF A;  1JB3 A;  3CRL C;  3S2D B;  2CHB D;  2PMZ B;  2EVB A;  1U4L A;  1WTX A;  3R2T A;  2ZXR A;  4WFN 3;  2Q8R E;  2EYH A;  3QB3 A;  1IW7 C;  1I4R A;  3S17 B;  1GHJ A;  4HIZ A;  1QB5 D;  1BXT A;  3C1E A;  2QDB A;  1FNU A;  3CKI B;  5I2Y A;  2C9O A;  2XZO A;  3GTM B;  1CQV A;  2QIL A;  1TS2 A;  1CI3 M;  1EIG A;  2MUY A;  2O5I C;  1VLY A;  4RCN A;  3N52 A;  4XN3 A;  4ZK9 B;  1NSN S;  2B2T A;  3C1F A;  1I4H A;  3WQZ A;  5M9O A;  2F0W A;  1TKW B;  3J81 L;  5G3L D;  2ZZE A;  4XOR A;  1U4R A;  1A2T A;  4B08 A;  4IQZ A;  1LV9 A;  3EJI A;  3CES A;  1DOL A;  4LMQ D;  2D3L A;  2SDF A;  4BBR B;  1ILQ A;  1RCV D;  3NWT A;  4HTH A;  3VYT A;  4HSV A;  4J6H A;  1CA5 A;  1RDP D;  2WPD A;  3LNN A;  2BOS A;  4XL9 A;  3RUZ A;  4XD7 A;  1TQO A;  3KF8 A;  2PW7 A;  2HCC A;  3GO5 A;  1SNM A;  4UAI A;  1SND A;  3OIQ A;  4NKL A;  4X3T A;  4EQN A;  3VYR A;  3URY A;  2B2T C;  3DWQ A;  2R9V A;  3K5O A;  5CR3 A;  2XZL A;  3MXN A;  3GTP B;  5FO8 B;  5E3F A;  3JAM L;  3H09 A;  1F77 A;  5M5W B;  1I6H B;  1LAC A;  2OT2 A;  3P20 A;  2N55 A;  5IGF A;  4HR7 B;  3LWU A;  4XON A;  2JA5 B;  4EQO A;  3JU4 A;  4Z1M A;  1V1P A;  1SYB A;  2FFK B;  3GQB A;  2NVY B;  4OL7 A;  3QG1 A;  1IYU A;  3TDQ A;  1KLU D;  2F0Q A;  4OO1 G;  4DA2 A;  4RWS C;  1BOS A;  3PMF A;  3CQZ B;  3A8K E;  2LKV A;  4XQN A;  3MXG A;  4ZKC B;  1NCV A;  3I3C A;  1HXY D;  4BY1 B;  1VDZ A;  2F0L A;  2MJ8 A;  1TS4 A;  3K5L A;  5IT9 E;  1OXV A;  3DXJ C;  2J0T D;  3DMU A;  2PCF B;  3AB9 A;  1KTK A;  1EY0 A;  1FYC A;  1Z47 A;  4XQJ A;  3OFN A;  1NAP A;  5IGC A;  4HCS A;  2E1B A;  1F2M A;  3H6M A;  1B53 A;  5I6Y A;  3KEW A;  2NN6 I;  4E0F A;  1OXS C;  3NSW A;  2ZXH A;  3I4M B;  1LTS D;  3QOJ A;  2KA7 A;  2KCN A;  4QF4 A;  4KJN A;  3OMG A;  4A3B B;  3NTK A;  4ZKB B;  1GUT A;  4YEJ A;  3CP8 A;  1PMR A;  2NVT B;  2F0I A;  2OXP A;  2EPB A;  2EY6 A;  1PRT F;  3VYU A;  1V8Q A;  1EWC A;  1JOO A;  1EEI D;  1F9R A;  3ITP A;  3OW7 A;  5J1Z A;  4KJO A;  1UAP A;  1ICW A;  4IUN A;  4RKB A;  2F43 A;  1C4Q A;  4OIK A;  3BVM A;  5AFW A;  5C4J B;  3ERO A;  1PRT D;  3MAQ A;  3FRP B;  3A55 A;  3D4W A;  1XTC D;  4MN3 A;  1ZXT A;  3CP2 A;  4NW2 A;  1SYF A;  1LTR D;  1WTO A;  5IGD A;  1F9P A;  3BDC A;  5DN6 A;  1AP0 A;  2IX1 A;  5J22 A;  4KN4 C;  1ONL A;  4C3I B;  5DM7 3;  4HAE A;  5BN3 A;  1G2T A;  4ULL A;  2A73 B;  4IUR A;  4DAV A;  4FXK C;  4DK0 A;  3J7A F;  4FXG C;  4BA2 I;  3VR4 A;  1BCP F;  1HTP A;  3A56 A;  3I90 A;  1GUW A;  4DFA A;  3KLS A;  4NMZ A;  2EZV A;  1PRT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...