3T52A

L29i mutation in an aryl esterase from pseudomonas fluorescens leads to unique peptide flip and increased activity
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
271
structure length
271
Chain Sequence
b'STFVAKDGTQIYFKDWGSGKPVLFSHGWILDADMWEYQMEYLSSRGYRTIAFDRRGFGRSDQPWTGNDYDTFADDIAQLIEHLDLKEVTLVGFSMGGGDVARYIARHGSARVAGLVLLGAVTPLFGQKPDYPQGVPLDVFARFKTELLKDRAQFISDFNAPFYGINKGQVVSQGVQTQTLQIALLASLKATVDCVTAFAETDFRPDMAKIDVPTLVIHGDGDQIVPFETTGKVAAELIKGAELKVYKDAPHGFAVTHAQQLNEDLLAFLKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arylesterase
molecule tags Oxidoreductase, hydrloase
source organism Pseudomonas fluorescens
publication title L29I Mutation in an Aryl Esterase from Pseudomonas fluorescens Leads to Unique Peptide Flip and Increased Activity
rcsb
total genus 105
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.2: Arylesterase.
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3t52A00
3T4UA 3OPMA 4HXEB 4FLMA 3FLAA 4C89A 4MYDA 3FYUC 1E89A 2VA9A 3FWHA 4DYHA 3HC7A 4M0MA 4HRXA 5AP9A 1QO9A 1F8UA 4EY8A 1JMYA 3NWOA 3DOHA 3RM3A 2B9VA 4RNCA 4B80A 3FLBA 5HK9A 1LPMA 2VQ6A 1XKTA 2FUKA 4UPDA 3I2HA 3RLIA 4UBIA 1MAAA 2XMDA 4WFKA 2XUAA 4AO8A 4G4JA 2P8SA 3BL8A 4ZREA 5D7BA 4H7KA 3WKEA 5CT4A 4Y2SA 5ALNA 1YB6A 1XZLA 1VOTA 1CUUA 2DFPA 1LZLA 2JEYA 4GBGA 4TGLA 4UBNA 4PO3X 1XQWA 1VE6A 2O2GA 4E14A 1DT5A 1CUGA 1T4MA 3IUQA 4PW0A 4G4IA 2XI4A 3IBTA 5ALIA 5JYCA 4MQMA 1CUEA 1U65A 2C0PA 4FKBA 1HPLA 4OB7A 1BRTA 2PSFA 1C7JA 1DWQA 5EHZA 4QLOA 5D3ZA 3S2ZA 1ETHA 3VISA 2I78A 2J4FA 4LXHA 3PE6A 2CUTA 4ZI5A 4H7IA 5AKHA 3AILA 2PSHA 5CURA 4H7DA 1EVQA 4W63A 5JZSA 4G5XA 3U0VA 4ETWA 5AK3A 4B84A 1IUPA 2XUFA 4BVKA 4EBBA 2AJLI 3OC0A 5A7HA 4DSZA 3QPAA 4OYYA 4IHAA 2HU8A 2PU7A 1H22A 5K3AA 5ALXA 1W75A 2VJDA 1XZMA 4ZGBA 3DQZA 4Z49A 4W1PA 4LHEA 4KE6A 3HSSA 4H0CA 3KWFA 4YX9A 3FYUB 4E11A 2HA4A 2WJ6A 2XUOA 4V2IA 3YASA 4X00A 5AKJA 2PSJA 3QITA 3AZPA 4BZZA 1IVYA 1UWCA 3F98A 3KWJA 5BOVA 4DNQA 1JU3A 4QDZA 4P93A 1EK1A 3SWWA 3B12A 2CMFA 4NZZA 1ZIYA 2HM7A 5CT6A 3RKSA 2XB6A 1OCEA 3WK6A 2C58A 2XUIA 4K6HA 4QWMA 2RIPA 3GROA 4XIIA 4ZWNA 1XQVA 1K6EA 2NW6A 1ZIXA 3HLKA 1DU4A 1N1MA 4BAGA 4X93A 4FFWA 1VE7A 1A8UA 4CG3A 3PUHA 3OM8A 1DT3A 5FXMA 4NS4A 1BN7A 1E5TA 1H23A 4B82A 2RONA 3BJRA 3I6MA 5AHXA 5JADA 1TIBA 3ESCA 1CUIA 4BVJA 3DL4A 2GBFA 5DNWA 4N8EA 1JI3A 1VXRA 3WKCA 2ZSIA 5AI6A 5LZ4A 1JJBA 1C4XA 2HA2A 3QBJA 5C8XA 4C01A 4Y7DA 4UBJA 3KDAA 1UZAA 2CBGA 4UUQA 4C87A 5K3EA 1EX9A 4U2FA 5ALOA 5T4HA 1CLEA 3V9AA 1QZ3A 1P0PA 1BS9A 3PF8A 2WHQA 3WQHA 3EIOA 5CRIA 3I2KA 6YASA 1UOQA 4N8SA 2VT7A 3HABA 1SFRA 3IIIA 2PSDA 5AKIA 1CQWA 4P9NA 1SCQA 4ROTA 3W9UA 4C4ZA 2YH2A 1VZ2A 5AK5A 3A6ZA 5A2GA 3LP5A 2VSQA 3STVA 1A88A 4O08A 5AO9A 5ALPA 5EHXA 3WK7A 5A7FA 1FFDA 1QO7A 4AO6A 3R3VA 3F67A 4QDUA 5CXUA 4DNPA 4X6UA 5AI5A 3H04A 4EB0A 4FNMA 2XQKA 4OPMA 2EDAA 1G66A 1ISPA 1R50A 5KWJA 1DX6A 2WG0A 2WHPA 5YASA 1J1IA 2FJ0A 4HVTA 3WK8A 4ZV7A 2BUAA 2DHDA 2RAUA 4AQDA 2O7RA 3AZQA 5IVKA 4OB8A 3AFIA 2R11A 4AX4A 2AJDA 4X94A 5LZ8A 4BE4A 4BP9A 2WG2A 3STYA 4DGQA 3WYNA 5AKKA 2HA5A 3PF9A 4X91A 3QPDA 4D9JA 3IUJA 1H2WA 2CKMA 2I03A 5ALHA 1MTZA 5ALKA 4AXBA 3BXPA 4Q1VA 5IKXA 2OG1A 4K6GA 3GUUA 3O4GA 2AJBA 2OCIA 1VLQA 1UK6A 2V96A 3RARA 1ZJ4A 2QUAA 1QIDA 5T4EA 5ALQA 1N8SA 3V1LA 5AK4A 3C6YA 2CEKA 3H1AA 3F96A 5IVDA 4BZWA 2H7CA 2HADA 3C43A 4M0EA 7YASA 5LZ7A 3VJLA 3TEJA 1Y7IA 4OB6A 4FOLA 2JF0A 2X5XA 3WJ2A 1E3QA 4QA9A 3WWOA 3AIMA 4G8DA 5A71A 2WFZA 4BC0A 4C6HA 4OCZA 1YA8A 5IH7A 3G02A 4E46A 1TKRA 4WCVA 1CVLA 1XZGA 1ZI8A 5JATA 3E1GA 1H2ZA 5A62A 1KU0A 3PICA 4FLFA 5AKGA 1E8NA 1KEZA 1AC5A 4X6YA 2WIGA 4FMPA 1G5FA 1XRMA 1ZD2P 5FLKA 4BTLA 2GYUA 2XMZA 1ZD4A 3G9XA 5CT8A 5CBKA 5JASA 5LIPA 2Y6UA 2VJBA 3H2JA 1VJ5A 3BF8A 3O9VA 3WMRA 1I6WA 2XUQA 4J03A 3N0TA 1HBJA 4BRSA 5K3FB 3OG9A 5ISMA 1GPKA 1QIJA 2WFMA 4DNFA 5HF8A 3ZPXA 1GQRA 5DTJA 4I19A 4M0FA 4UFNA 3GZJA 1QOZA 1QIEA 2DHCA 2I3DA 3C70A 3HZOA 3STTA 2CB9A 3O9MA 4PSDA 3TGLA 3WA7A 1R88A 3OURA 3VXKA 3V1KA 1O6FA 3ZLVA 4KACA 3WWPA 1W4LA 4JEIA 1QIIA 2E3JA 3U1TA 1DQZA 2XE4A 4Y2YA 4L72A 2O2HA 5AI0A 4X6XA 4OD0A 5CTAA 1ZI6A 1EH5A 4B83A 3QMMA 4QE3A 1M33A 3M3DA 4UFOA 2ES4A 3I1IA 4N5HX 4FBMA 3BIWA 4UHFA 3G9TA 3D2BA 1B41A 5AKZA 1ODSA 4J0IA 2JGFA 4WFIA 2JGMA 1P0MA 2XLBA 1NU8A 2HFJA 4BTVA 2YYSA 1YCDA 1JFRA 2X8BA 4CCYB 5AKXA 1WOMA 5JAPA 1ZGCA 2WIFA 3H1BA 4MWSA 5FDFA 2QXUA 2FJPA 1EI9A 2PUHA 1CUHA 1EDBA 3C6XA 1CUSA 1JJIA 2Y2VA 1XRLA 1BE0A 5AM4A 1R3DA 5ALSA 3DDUA 1AZWA 2D0DA 3IDAA 4GEGA 4GDMA 1DX4A 1QFSA 3EF3A 1W76A 5DYYA 2EEPA 4WY5A 3ZI7A 2ZYSA 3S8YA 1J06A 5AIAA 1F0NA 3F8SA 4KRXA 5T4FA 2V97A 2ECFA 4G1FA 3DCNA 3QH4A 1THTA 2G63A 5E2IA 4AB1A 2O7VA 2VJCA 2VEOA 5AM0A 3CN9A 3WZMA 2QM0A 4AZ3A 2WU3A 3NUZA 3D4LA 1B6GA 4FNGA 1MNQA 2VF2A 1EDEA 3JYHA 1EB8A 4XX1A 3HI4A 4H7HA 2YASA 2DQYA 2WILA 2CJPA 4BAZA 1AKNA 2Z8ZA 2ZYIA 1GPNA 1LBSA 1GKLA 4JYPA 1IZ8A 2AXEA 5AICA 2GBGA 4Y2UA 1G4HA 3G7NA 1QONA 5CH8A 1YA4A 1QGED 5EGNA 3BWXA 2WKWA 1G42A 4H35A 2BKLA 1U4NA 5F4ZA 1W6RA 2W6CX 2WUFA 1U8EA 5ALTA 1UK8A 1IMJA 2B4KA 5C8VA 2C5FA 2R8BA 4F0JA 5ALDA 2XQJA 4WDRA 5BWBA 4KR0A 4BB0A 4MEAA 5HQ3B 2HL6A 2VTVA 3HYSA 3K9BA 5KBYA 3EQ7A 3BF7A 4EUSA 1QIFA 3EQ8A 3R0VA 2WUEA 3WK4A 4BDSA 5HFAA 1XZBA 4JNCA 4YK7A 2WHRA 3ANTA 3MUNA 3UMJA 2HU5A 2WJ3A 3ZLUA 4Q3LA 2IX9A 2WG1A 1ZICA 3R41A 5EIEA 3SK0A 1XZKA 1EVEA 4HS9A 2BGRA 3WWDA 4IH4A 4CI9A 3OOSA 1Y7HA 2QJWA 1FFCA 3DKKA 4W9RA 1QTRA 2WTNA 3TJMA 4TVKA 5AM3A 4F5ZA 2ORYA 1QIKA 4KAJA 1TRHA 4BCDA 5AM1A 4UBOA 3PFCA 4OSEA 5HQ3A 5JAHA 1AMNA 4B7ZA 3ZWQA 1UFOA 5E4JA 3FSGD 4EZIA 2JGEA 2XDWA 4MXDA 4DNOA 1N5RA 4LXIA 4LYDA 2ZVDA 4E15A 1ZD3A 1XROA 4UBLA 3STXA 2WIDA 3W05A 2RGUA 3L1IA 5AM5A 3WLAA 2AJCA 1WPRA 2VATA 4AMZA 3FCXA 5FUMA 4QEKA 4JUIA 2BJHA 2JEZA 4UBMA 1VA5A 4GHWA 1ZGBA 4LXGA 4K6KA 4Q05A 1DWPA 3DNMA 4BC1A 3ANSA 2VJAA 1GZ7A 4DMFA 2XUKA 1WB4A 1Q83A 3O0DA 4C4YA 2OXEA 1TCBA 2WUGA 3IA2A 5JAUA 1K4YA 3WA6A 2WM2A 2C4HA 3W9BA 1VZ3A 3QVMA 4J3JA 4PF1A 1TCCA 5EHNA 1ORWA 3KD2A 1XZAA 4UHDA 5FV4A 5I7UA 3WZLA 2QMQA 2XQGA 4ITVA 4X85A 3PDCA 4KAFA 3DKRA 3D59A 3O4HA 2PPLA 2Z3WA 4YASA 3NOXA 3WKBA 3MGAA 4X97A 1OILA 3WJ1A 1UKAA 2I3ZA 2ONCA 1DTEA 3VDXA 3WK9A 3HJUA 5JAOA 5JD6A 3FLEA 3FVRA 1Q84A 2ZJ7A 2ROQA 4LYEA 3FOBA 3FCYA 5AJHA 4H18A 2WFLB 4GW3A 1R1DA 2V9ZA 4J0JA 1VA4A 1CPYA 3WWCA 1WB6A 4LIPD 3CXUA 3ESBA 1MX5A 3WKAA 3H0CA 4B9AA 1HL7A 5DJ5A 4CIAA 3EBLA 3QZUA 4XJVA 2DR0A 5AKEA 4FBLA 5HK8A 3AZOA 3G0CA 4GI1A 1RWQA 3FNBA 2EDCA 1WHTA 4MEBA 5SYMA 3O4IA 1ZOIA 5DYWA 2XLCA 1XQYA 4OUKX 5CH5A 2BAGA 3AIOA 4EY4A 4NMWA 1UKCA 5LKRA 3GELA 3NGMA 1HKHA 5EFZA 4CG1A 4Q3OA 2XMBA 1BROA 5HCUA 3FBWA 3MVEA 4X71A 2OAGA 4Y2JA 2WFLA 1ORVA 1QE3A 3I2JA 3R3YA 5AI8A 4J0DA 1FJ2A 2BFNA 1AQLA 4J0HA 2ACKA 3EQ9A 1HDEA 1BN6A 2WSLA 1CUAA 5AOCA 1EB9A 5HFNA 2XMGA 1S8OA 2WIJA 3DYIA 1UT6A 4G4GA 4ARAA 4H7JA 5AH0A 4DIUA 2QUBA 3W04A 1U2EA 2HFKA 4BAUA 3CCCA 3IURA 5C81A 3ILSA 1LZKA 1CEXA 4KRYA 3C8DA 3V1NA 4W1QA 2XUHA 5DTIA 3WI7A 1YS1X 2OGTA 1J07A 1P0QA 3HACA 1E66A 1SOMA 2HA0A 5DWDA 5JALA 1D07A 2HRRA 3B5EA 5K3BA 1ACJA 4A5SA 5K3CA 4WJLA 4H7EA 1FSSA 1BCRA 3D5EA 5ALVA 5AKYA 1NX9A 5FPQA 2VAVA 2JGKA 4DSAA 5CXXA 3KSRA 3D3NA 1H2YA 3AJAA 3I6YA 2G5PA 5SYNA 3C5VA 3STUA 3A70A 3AUKA 4IH1A 3C8HA 2Q0XA 5JZ9A 4I4CA 3M81A 1A7UA 4TPKA 2G4LA 4P08A 2ACEA 4G8BA 1EXWA 4HTAA 5AIBA 4B6GA 4B0PA 2XUJA 4X95A 5HKBA 2XMCA 1CR6A 4U2EA 1JU4A 5HZGA 1CQZA 5ALUA 1JJFA 4XVCA 1T2NA 3BDVA 3BIXA 4B85A 2OLEA 1KU6A 3BJMA 3R3UA 1JT2A 4KE9A 1ZI9A 5LZ9A 3KOOA 1UKBA 1CRLA 1A8SA 5K5EA 4FLEA 2QJRA 4AN1A 4ZRDA 3W06A 1EA5A 1AX9A 5AOBA 5HF6A 3C5WP 1XRQA 1Z68A 5AI9A 3VJMA 3O95A 4QDOA 5CMLA 5AM2A 2W22A 4W1SA 4J0KA 4U2GA 4BCBA 1XRPA 2K2QB 2GZRA 2DQZA 1AURA 2WUDA 2IITA 4AO7A 1WB5A 2XMSA 5DNVA 2H1IA 5HF9A 1PJAA 2QZPA 3N2ZB 2OCLA 1ODTC 2Z8XA 3D7RA 5JARA 2H7XA 2QTBA 3QYJA 2H9YA 4IQ4A 3G9UA 1QFMA 3LLCA 4YPVA 2QR5A 4DMHA 3D2AA 1GKKA 1UOOA 1YS2X 5E4YA 1XRRA 4UHBA 4MWTA 1MX1A 5HF5A 5CT9A 3I6ZA 2JGJA 2PUJA 5FKJA 4BP8A 2QRUA 4QZVA 2ZSHA 4RPCA 5EHQA 1F6WA 5DNUA 5AOAA 4J7AA 3A2NA 4I3FA 4G9GA 1MJ5A 1UK7A 5I9IA 1MN6A 2DSNA 3LIIA 5J3JA 4L0CA 3D2CA 5ALGA 2GZSA 3H2KA 1X70A 2V98A 4U2DA 3I2IA 4K2AA 3X3HA 1BU8A 1QTIA 4HRYA 5FRDA 1BEZA 3WL7A 5EIAA 2WU4A 2G5TA 2X76A 4H7FA 1IZ7A 3FSGA 4WFJA 1MPXA 2HIHA 3JW8A 1TQHA 5FPPA 2JBWA 2H7YA 3H2IA 3IUNA 1GPLA 4XWGA 1E8MA 2PSEA 2WIKA 1YAHA 3QMVA 3KXPA 2DHEA 5JZBA 1R4ZA 4N8DA 5A6VA 1JMKC 2ZJ6A 1E8DA 5BV7A 4L3WA 4QWWA 5ALWA 1BEEA 3SC2A 1CUCA 5ALEA 5EIHA 3FAKA 1EHYA 3WK5A 4BATA 4BYMA 5ALJA 2OCGA 5ALMA 1XLWA 3R3ZA 4FTWA 1L7RA 1MX9A 3H19A 4F21A 4LKOA 4PQEA 1VKHA 3FVTA 1K63A 4Y2QA 3DS8A 1MU0A 3ICWA 3SX4A 1USWA 1QIHA 4JYMA 2O2IA 2XT0A 2WQZA 4B81A 5ALFA 2BUCA 1ZJ5A 2PVSA 4C4XA 3MUOA 5JD5A 3GA7A 5BWCA 3B3QA 1MT3A 1QIMA 1HQDA 3A2MA 2JGLA 3G0DA 3CCBA 2OCKA 4QNNA 4HXFB 1LPNA 1ACLA 1ZD5A 3ED1A 1XLUA 3M82A 2OGZA 4Y2XA 1MAHA 1WCYA 3IB3A 1MO2A 1LPSA 1GGVA 3R3WA 3E0XA 3WIBA 2RI6A 2YXPX 1LPAB 4CCWA 2B61A 3CN7A 2Y1KA 3VJKA 5E4TA 3V1MA 2Z5GA 1L7AA 1EDDA 2D5LA 4PSCA 1CUWA 4DMKA 1CFJA 1GQSA 5D6OA 1CUVA 4C88A 4DM7A 1GT6A 1YR2A 4U2CA 3V48A 3I28A 2C0QA 4KE7A 1CIJA 3C6BA 1F0PA 3QM1A 4OU4A 2LIPA 4CG2A 4Y9SA 4Q82A 5FP0A 1K5PA 4DLNA 5K3FA 3FYTA 4OU5A 4WY8A 4HZGA 2J3QA 3W2TA 1Q0ZA 3OTQA 1CUDA 3Q8WA 2FX5A 4X3CA 2PU5A 5IVIA 2XUGA 5FOQA 3K2IA 5D3KA 1C7IA 5LZ5A 2ZYHA 4DMCA 1UK9A 4MJ3A 1W52X 1FFBA 3I2GA 4INZA 2HA3A 2WLSA 4J0CA 3UUEA 4ZXFA 1A8QA 5AK6A 4UBKA 3C87A 1TAHA 1BCSA 4QDTA 4GECA 4MQLA 1FFAA 1JKMA 2ZYRA 4U2BA 1XZJA 3A2LA 2PL5A 3PUIA 4GLBA 1UXOA 3E4DA 1O6GA 4EHBA 2OPHA 1QLWA 2HU7A 2PM8A 1XLVA 3JWEA 2OQVA 5ALLA 3D0KA 4A16A 4Y2PA 3G0IA 1NU6A 1XKLA 2OQIA 2XQIA 4UHCA 1K8QA 1XZFA 2OAEA 4CCYA 4KAAA 5JIBA 3ICVA 1XQXA 1XZHA 3DD5A 4HXGA 4QDXA 4B0OA 1HLGA 4FDMA 1WM1A 5C8ZA 3DEAA 3AINA 3I1YA 1R9MA 4W1RA 1LPBB 5LLSA 5JD4A 4IH9A 4Q3KA 3WL8A 4EY5A 3ZV7A 4ARBA 3GFFA 2RHWA 1EK2A 2XUPA 2QVBA 5AKLA 2J4CA 5JANA 4PSUA 1SCKA 2GYVA 2OGSA 5I8PA 4X92A 3ESAA 2WJ4A 4GWLA 4AN0A 4RE6A 4B9EA 4X7BA 1LBTA 1H2XA 2HA6A 3K6KA 5KREA 2Y2UA 1YB7A 4J0GA 1YASA 4FWBA 4IO0A 4X90A 1TCAA 3VVMA 2PBLA 1XZDA 4EY7A 5T4BA 1SCIA 4FHZA 2VAXA 3R3XA 4BBZA 2PX6A 4PV7A 1CUFA 5KWIA 3G8YA 5LKAA 1XZEA 4S0XA 4EY6A 2JIDA 1LGYA 3DJYA 3WWEA 1VXOA 1LPPA 3WIOA 5K3DA 4GXNA 3WL6A 4UFPA 4AZ0A 4Q34A 5HKAA 1LPOA 1PFQA 1RYYA 2IIVA 5CW2A 3IVMA 3FYUA 3STWA 1IUOA 3LIPA 4H77A 1WPXA 4QLAA 1X2EA 1TK3A 3PFBA 2QS9A 4Y2VA 4HAIA 1LLFA 1P0IA 5ALYA 1XZIA 5EI5A 1YSCA 3DOIA 1N5MA 4KJXA 4UHEA 2BUBA 5LP1A 1AGYA 3P2MA 3Q0TA 2UZ0A 1UOPA 5LYYA 4F60A 1X2BA 1FFEA 5A7GA 3H2HA 3VKFA 4BCCA 2HRQA 5ESRA 1ODCA 2J3DA 5CT5A 3L1JA 4KYVA 1Y37A 1DWOA 3LS2A 2XMRA 3QMWA 2XUDA 4A23A 4AMYA 4K5QA 1EINA 4FFVA 1XZCA 4Y2RA 3L1HA 3VVLA 2VT6A 3T52A 3C6ZA 3DYVA 1THGA 2AJ8A 5H3HA 1CUXA 3IUMA 1W1IA 1RP1A 4RE5A 2JGIA 3HRHA 2BGNA 1J2EA 2QOEA 2RHTA 5AI4A 2QXTA 4UHHA 3G0BA 3DL7A 1PV1A 2ZJFA 3G0GA 1GXSA 3C45A 3HEAA 1XRNA 2HA7A 3R40A 5DYTA 2DCMA 1WHSA 3WKDA 1CUBA 2C7BA 3F97A 4BE9A 3GBSA 2C5GA 3PI6A 2Y6VA 4N5IX 3RK4A 1LNSA 2QT9A 2GYWA 4DTCA 3E3AA 1CUYA 4G9EA 4EA6A 4BRZA 1R9NA 1Q0RA 2HDWA 3H2GA 3DLTA 1AUOA 3WYDA 2HHAA 5ALRA 4Y2TA 3ESDA 4P92A 3ZLTA 2BCEA 3F9CA 1IUNA 3HXKA 3LCRA 2XQFA 4WDQA 1MNAA 5CH3A 3I2FA 1L7QA 5LZ2A 4L9AA 1SC9A 3UUFA 3M83A 3TRDA 3AIKA 3H17A 3O4JA 2PKYX 3G9ZA 4BDTA 3WL5A 3H18A 4CFSA 1DINA 2GBIA 2CZQA 1DQYA 1OXMA 2GBCA 1XFDA 4JH0A 1QJ4A 2QKYA 2B20A 4KEAA 4KE8A 4OYLA 4BVLA 1CUZA 1CV2A 2XMQA 4NVRA 5ALZA 3BDIA 1YAJA 4MYSA 1QIGA 4CIBA 4RGYA 5IVHA 4G8CA 3BE8A 2WHPB 2WTMA 4ZV9A 3QPCA 4PNZA 1CUJA 5C7YA 5DLPA 3IULA 2Z3ZA
chains in the Genus database with same CATH superfamily
3T4UA 5K6AC 2RBGA 3VUFA 4JLJA 4LRTB 2XIJA 2ZS8A 3U3KA 3T9BA 1EZ1A 1P44A 3FLAA 4HBGA 3M0EA 3WRVA 3P9SA 1E0DA 4MYDA 3ZNQA 1BX3A 3DULA 1C1HA 1E89A 3QOFA 4CKYA 2YXEA 3HC7A 1PVDA 1X87A 3IRVA 5I7OA 4HRXA 1VPEA 5FLXA 1UDAA 1U1IA 3VDQA 4YROA 3P0JA 2R0QC 3SQXA 2O2ZA 1EX1A 3CWQA 1GNRA 2AUMA 2VZLA 3IE1A 5DHQA 4BXOA 1Q7BA 2HPAA 4OQEA 2CMKA 4KN5A 1AHHA 3C6QA 2C4NA 2C8KA 4HN9A 1U6JA 4LVCA 3C16C 2FW6A 3NJ8A 1R00A 4HDNB 5H1YA 2NUAA 3RM3A 5LM3A 3T3EA 3PLAE 3ZY6A 1XKTA 2V03A 2PV7A 5JQGA 4UPDA 1BJRE 3V3KA 1Y42X 2AOUA 2VWQA 3RLIA 5EWLA 2SKCA 2C92A 3BULA 3C7CB 4KVAA 3WR5A 4BJHB 1Z6PA 4G4JA 2P8SA 1YKSA 3ML1A 4ZCIA 1JDUA 4NESA 4RKFA 5K01A 3GMDA 4MMYB 1J09A 2NT3A 2ZE7A 3MGCA 4H6WA 4H7KA 1J1ZA 4QPPA 5LBTA 5DNCA 1UQRA 4MLCA 3UJ8A 1O4VA 3T95A 4HNTA 1IHYA 3C3PA 5ALNA 2HOQA 3ZCVA 3U9SA 4HYYA 1XZLA 1V1RA 4HWGA 3LA8A 2VHXA 3OQHA 5EYPB 2NM0A 1NLYA 3V32A 2DFPA 3F46A 4M3NA 1BO6A 2H7VA 2IEBA 3CW9A 2YJ5A 2GILA 3GRCA 3IJEB 4KQEA 3VNUA 1XQWA 3RYHA 3FPHA 1P62B 1U5AA 3PWSA 3LBFA 4S0ZA 2JJ8A 2LGJA 3IQWA 5TV2A 4EFMA 5AUOB 3CLRD 4CM9A 2II6A 3E0QA 4B40A 3O3CA 1ECLA 1N1EA 4B8WA 3R09A 4DR3B 2OFXA 1ZVQA 3IUQA 4GSKA 1XJWA 4JUCA 1YZ3A 3MPUA 4OG2A 1LF5A 3UKJA 2YY7A 3HLYA 2PLRA 3OUZA 5CVCA 3IBTA 2ZQ5A 4RK4A 3U2QA 1TMKA 1MW9X 8OHMA 3LK7A 4TN5A 4MPTA 2P9TA 2LDBA 3K35A 5D86A 1X8XA 5TARA 4IW3B 3OPQA 4URHA 2EGGA 3UT5A 5A5DA 3TLEA 1YACA 1HPLA 2B4RO 4OB7A 4RD0A 4HPWA 1KYQA 4PRLA 3VNAA 4IMJB 4QLOA 2OFWA 1Y82A 3VR0A 1M5TA 5DXAA 1YO6A 4AWAA 3BH0A 4RADA 3Q1KA 2O8BA 5JECA 3CV3A 3VISA 3IOBA 2AN3A 2J9RA 1TI7A 1FRFS 1RW4A 5JQGF 1PKXA 4IUYA 1N6OA 2VCHA 3ZWVA 3FZGA 2WJGA 5JZVA 3EGCA 4JXJA 1AXEA 3JQBA 4LBYA 4AKEA 3CURA 2XZLA 2VIIA 3HHEA 1TW3A 4WPGA 1DG3A 3IOMA 4TMFA 2QTWB 3X2FA 1G59A 1UFVA 3W2EA 1J9EA 1UM8A 5IVPA 5CDYA 5L7TA 5LN1A 5TDHA 2PSHA 4H7DA 1QK3A 2EL7A 3KXDA 5JUWA 4MRMA 4C08A 3QX7A 4XM1A 1JKFA 3EBPA 2R6HA 2E5FA 3U0VA 3HGTA 3N7AA 4DV2B 3OQMA 1GL6A 4EBBA 3O73A 1R27A 4L73A 2HUPA 1H2AS 3AUYA 2BHTA 3OC0A 4MUHA 4N3AA 4HMOA 2QUIA 4CFZA 1OH8A 1KI6A 1ML3A 1OXTA 2D62A 1IVNA 1Z7WA 1IM2A 1ZMTA 2VP2A 4H1WA 3SG0A 4F72A 4PLYA 1MRZA 3Q15C 1J2RA 2H4ZA 4DSZA 4JJ7A 3RTDA 1NPTO 4C2UA 2AC4A 4LXQA 1XXHB 3CNEA 1NUSA 1J39A 5GQSA 5ALXA 5BR8B 5CCXA 1X8JA 4UASA 2UXDB 2Q3MA 5BT9A 1G4UR 2VO1A 3PQEA 5BSMA 5HIKA 3AF3A 1U8UA 13PKA 4Y2GA 4I66A 1MC4A 2V5AA 2YWXA 1FNSA 3DQZA 4NIMA 4WZBA 4ZOCA 2NLOA 5BQOA 4W1PA 2ZKIA 3RAGA 1DIRA 1I1NA 1PFYA 1X8LA 1OFGA 1IFXA 1YQUA 2V7EA 2Y1DA 2H0AA 1JDBB 1HFJA 3ELYA 3HSSA 4H0CA 2XCRB 1SBQA 5I3ZA 1P4AA 5D51S 5DOVA 4E11A 1CERA 1M6YA 2G04A 2WJ6A 4F46A 4MUKA 1NVVR 3V1UA 4YCDA 3ZHCA 1I1QB 4X00A 4I4IA 4L0QA 5F1OA 1Z56C 5IYZF 3QITA 3AF5A 4YUVA 1O9BA 4GBED 4PYIA 3EN0A 4BQNA 5KTMA 4KODA 2B7CA 2WEKA 3OECA 3KTFA 5EVCA 4OL0A 1TLFA 2WJHA 1JR3D 5U1PA 5KSYA 1O54A 2GZDA 1IN1A 2Z2YA 4MJLA 5JE8A 3G2HA 3JZFA 2A33A 5FD8A 1R2QA 3JTEA 4GKKB 3SOPA 2VCEA 5KC9A 4TZ6A 4FOPA 3PEUA 2CMFA 2ZWPA 1S3GA 3A10A 3IIJA 1ZIYA 3EWNA 4CT0A 2PKRA 2CXRA 3X1YA 4FC7A 4JWKA 1DSSG 2ETVA 5CT6A 5DM70 5F73A 4FIZA 2GAOA 2Q6KA 2F43A 3MQ4A 1XRSB 1YNSA 4JI5B 5L3SB 3I9MA 1D9ZA 5KPJA 5FTJA 1E9SA 4MCIA 5B4UA 3BCRA 1ZJYA 5FYQA 2HWXA 3MB8A 4K6HA 1MFPA 1ECGA 3JRNA 2RIPA 2XOKA 2X9GA 2I6QA 4P3KA 2ZS7A 4HAUA 4CKBB 1NQXA 2J7KA 1SUAA 3WLRA 1BE8A 1K6EA 2FEWB 1BX1A 2B4AA 2VTDA 4LHVA 1F2TA 2QBYA 1HQYE 1ESNA 2H8KA 3HLKA 2YJZA 4UU0A 1KDPA 4RVDA 3NPMA 1N1MA 5ITSA 1A72A 4X93A 3BE5A 6NULA 1RDFA 1Y3IA 3ZXYA 2IQIA 3KTOA 4RO0A 3ND6A 4CG3A 1YFZA 2VP0A 3OM8A 4TMKA 4E32A 1KO4A 1ZW1A 1JH8A 1E5TA 1II0A 1WVMA 4AWXA 2RONA 4MR7A 3LCCA 2Y1CA 3OO0A 3EZ6A 1S2GA 3Q2KA 4JL8A 3TOXA 1ENPA 2FP3A 1B6TA 3I6MA 4WN9A 2P2YA 2BM0A 2V1XA 5FBVB 3IXMA 3KR0A 2DYKA 4JX8A 1IXZA 2DFTA 2EJTA 3LX4A 3MMNA 3NC1C 3ESCA 1VE9A 2PUGA 121PA 3WLFA 2BGGA 1QFXA 3U48A 3P0FA 1MC8A 3FZQA 1CUIA 4CQNA 1VG1A 3SIRA 1QX4A 1W0CA 3CE6A 1XHEA 1GTVA 1U2RA 2QM3A 3DL4A 3LCVB 5CYFA 1FK8A 2XVXA 1M1NA 2QN8A 3UICA 2NUAB 1Y0BA 1IB0A 4KKVA 4N8EA 4U7JA 1IY9A 4XGNA 1V6AA 3SQWA 4AP5A 2XXAA 2AOUB 1O5OA 3FFBA 1QH1B 3JQGA 3I0MA 4L6IA 5I9MA 5IEBA 4Z1OA 1M6VA 5AVSA 2SCUA 1HLDA 1ECBA 3HFJA 2JHCA 1C4XA 5A04A 3MSCA 1JA0A 5J40A 2XCTB 1ONPA 4LV8B 2YNMC 1C5KA 1T2AA 4QBHA 3RF6A 2H65A 3WG9A 4D92A 4ESHA 1OF1A 5IULC 2CZCA 2CBGA 4MKGA 2ZSDA 3IR6A 4E5PA 4QQRA 2VFAA 1ZWLA 3JU3A 3H3XA 2QTVB 4MV9A 1R5NA 3SS8A 4PRYA 3B2NA 4LWPA 4PONA 3ETNA 4GPIB 2CVOA 3CW2A 3G1TA 3PQ5A 2I71A 4KOAA 3V9AA 4A0SA 3KOYA 2QD1A 4E7PA 1QZ3A 1UJBA 3C3YA 5FO1A 1P0PA 4X8LA 3SLKA 1U7UA 2D7DA 3ZNNA 2P9BA 3C7DB 4CU5A 1NVAA 3DBHA 2ZVPX 1JHQA 3EIOA 5C34B 1ZY2A 2P4SA 1YOVB 1ZGJA 5JY1A 2OCPA 4YBZA 1DKUA 4QYMA 3CUWA 4U6QA 2FPPB 2FPOA 2QRKA 3AEKA 3I2KA 3OQVA 4WT7A 3RS2A 4OKSA 1VBMA 3E9ZA 4YCCA 5J2UF 3EXFA 1GLVA 6YASA 1T43A 3JQ9A 3NONA 2CXNA 2B8TA 5HUJA 1CZOA 1EDOA 1HE4A 1JWBB 4IZOA 2OHFA 2VT7A 1NJ8A 3D0RA 3HABA 4UNNA 2IYTA 5DBEX 2ZXUA 1UJ2A 1U8AA 3DOEA 1RYEA 4JV5B 3M5WA 3QVKA 1LTKA 5EZQA 5H02A 4HDQB 3A3NA 3EUAA 5A6SA 3BGDA 4CLOA 4P9NA 3A6KA 1KL7A 4DPKA 3T3NA 4FKMA 1I4LD 3HO1A 5CB0A 4MQ5A 2BONA 3FGZA 4AJHA 4CLDA 3RLFA 2EX1A 1GITA 4ID3A 4QFDA 1R8JA 2GXSA 3ENKA 1Q1BA 3A6ZA 3ORHA 4RJKA 4ZGGA 1DDGA 2VXYA 2Q1YA 3HSYA 8MHTA 4RZHA 3VI4B 2DFDA 4E3WA 3LP5A 4B3FX 2Z56A 3LT1A 1KJQA 1MA3A 4KXYA 1WUHS 1Y3HA 1P1HA 5AO9A 4RENA 1ZSNA 4JT4A 1XNGA 4O2RA 3LDFA 3RPEA 1DBPA 1NN3A 2NTNA 3GT4A 3OJ0A 2GARA 3OQPA 2ZRLA 4J1SA 5HKKA 5JO0A 3CKYA 4FSDA 5IAKA 4C3VA 4F91B 4ENSA 5CEFA 3E8SA 1G5HA 4AO6A 3R3VA 1FPQA 1RJEA 5TQJA 1F8FA 3DFFA 2RGNC 4LDRA 3AEQB 4M0CA 4WK6A 4YMHA 1ZCJA 2O4UX 4DNPA 4JT9A 3HYTA 2I22A 3C98A 3WP0A 3DSRA 2QY9A 1NP3A 4LTDA 4FNMA 3THOA 1VG9B 2Q8NA 1ZH4A 2BTEA 1IJEA 1SQ5A 5A3QA 1K6XA 2W0MA 3ADKA 2CLDX 2EDAA 3JVEA 2VXBA 2OLKA 1EGHA 2G6TA 1ISPA 2A7QA 1GJRA 1LLDA 1T9CA 2PX4A 4NYJQ 3T5GA 3V1TC 4UTNA 2W5UA 2FR0A 2GD0A 2B82A 4RY8A 1J1IA 3VH2A 3QIVA 3MUFA 4HDRA 4HVTA 3TTWA 4ENWA 1KK2A 5HDQA 1A2KC 1SWWA 1WPQA 3P2OA 1NUTA 4CM8A 3DFKA 3QE9Y 1UJ6A 1V96A 5L4NA 4NCNA 2FQWA 3EZ9A 4I1RA 2YFHA 1DO0A 2IEZA 1P4HA 1V16A 1J0DA 2RAUA 2BI7A 3NHBA 3AETA 1W94A 3R1IA 3RU3A 3I92A 3U1BA 4OB8A 4XWWA 4DR4B 1OLSA 1C4OA 1H0RA 2R11A 5IKPA 1AXRA 2QJFA 1OROA 1FUYB 3ABRB 3PKIA 2XW6A 4DGSA 5BQ3A 1E2HA 2VSOA 4BE4A 1C9DB 5H68A 1A9QA 2D0PB 1LK5A 3ZU3A 5CFOA 1O8CA 1E2IA 2W6JA 4Q1AA 5AW0A 4QQNA 1E77A 3KL2A 4UTZA 3STYA 4R2JA 4E1VA 4DGQA 4DRXA 5K3SA 4EEKA 1K08A 4XWYA 3UENA 4BGIA 5A0TA 5IJAA 2IU6A 4ACBA 3OM0A 3PF9A 2CLLB 4AYTA 4DQXA 1EGQA 4WW0A 3ABIA 3SFTA 3QPDA 5CVEA 4CF5A 5SY4A 1H2WA 4TUYA 1II8B 3P0HA 5DXFA 4DCCA 1Y1PA 3G0HA 4HUQA 3IP6A 2AB0A 1A27A 2I03A 3CJRA 1NMZA 1OB2A 3PUVA 4FZ5A 2WKPA 3U3OA 4W5NA 3A2KA 3FRIA 2J1LA 5JD3A 4AG3A 4RANA 4Q1VA 4MSUA 3NNNA 4ZVMA 3B1KA 1KVUA 4HWKA 2YRWA 2JATA 1VHWA 3QNUA 4B6FA 1Z07A 4DUPA 3SVTA 2IPLA 3GUUA 3OE4A 5B3AA 2QYTA 1RM3A 1RIFA 4OOFA 2AA3A 1VLQA 1K88A 4QVIA 4KH0A 3LQFA 2R68A 2FFBA 1X0XA 2WTXA 5E9JA 3TZHA 4BO0A 3HXMA 2FOIA 2IXEA 1ZR4A 2JS7A 3DWGA 1Q92A 2J9XB 1SUSA 1Z2OX 3FVQA 3JVVA 4J4TA 3RARA 3H2ZA 4DDTA 5KYUB 2PL9A 1QF6A 3EB9A 1SCNE 4QUDA 2IXAA 3GJ3A 4JSYA 2XKJE 3T9FA 4DTIA 4JK3A 2JLYA 4OTZA 4O2AF 2QG9A 2CMHA 4OREX 2QLLA 3TL6A 5AK4A 3H1AA 2HUNA 4OL9A 3RGWS 1R12A 2G28A 5DGHA 3LRXA 3DAFA 1FVFA 1Q14A 2NU8B 4EGJA 3VHXA 1AMUA 2RHBA 1WP9A 2H7CA 1DDOA 3AX6A 4CUKA 2HADA 1OAOA 5B5SA 1JJ7A 1MVNA 3SE7A 2QB5A 1NBOA 1XQ6A 2FN8A 3PQ7A 2A14A 3QOXA 1SOVA 7YASA 2Z9BA 3EIHA 3EQ6A 4G5HA 1BZYA 1CY4A 3QUSA 1P2FA 3ZC3A 4CKEB 4D9GA 5FBHA 1CY6A 1O94A 1HE8B 2Y77A 1AF4A 2AG1A 4RESA 3OF3A 5EUCA 2ZRDA 1N6KA 4HDCA 4ZC8A 1W36C 3ZHRA 3GF4A 3M4YA 2F3TA 3LP8A 3QQPA 3NAQA 4TZ0A 2R1VB 4RZUA 3RHZA 2QYSA 1CX9B 1XQ9A 3OAAA 5JSZA 1F17A 2P40A 5A71A 3W78A 4KBFA 2F3PA 2YFYA 4C6HA 2BKVA 4OCZA 3AKDA 4EOGA 5F9HA 4TTAA 4F45A 2PMBA 3CVJA 1DOZA 2O2SA 3U9LA 1Y34E 3SEZA 4KHZA 2FVXA 2GKSA 3GRKA 3M5CA 3TOZA 3G02A 1VIDA 4DN6A 4NHOA 1VP3A 3R9XB 3IB6A 4E13A 1W9MA 2H85A 4NSNA 3RUIA 1F4VA 4W7SA 1R74A 3LQ1A 4YAIA 2A7XA 1PGOA 4LJ6A 4AS1A 4N6NA 3PE4A 2CLOB 1S2MA 2E89A 5CLLA 5E6RA 2WOJA 1P4SA 3NUGA 3HHPA 2FW8A 1TMGE 3NKLA 3A4YA 2D06A 3E1GA 4OQMA 4ADSG 4C6RA 5A62A 1N0IA 1U8FO 2QVYX 4O29A 1QRRA 2WYHA 4G41A 1J00A 3JYOA 5TQ0A 4MHOA 3RUPA 1E8NA 3A6FA 4X63A 4G5QA 2I99A 4AF6A 1OHHA 1C1XA 2G70A 3I9V1 4BNFA 3ETEA 4HUJA 1ULBA 3LW8A 3NEYA 2ZVQX 1FSGA 4A4DA 3O84A 4GQAA 1KYXA 1DFIA 2P9JA 4DA8A 1PI3A 2KPOA 3WWZA 1PIWA 1UPCA 3L0ZA 4FMPA 1G5FA 1W88A 5IJ0A 2CCGA 5LP6A 2D4HA 1XJ0A 2DY0A 3VC7A 1ZRSA 3AIIA 4PZCA 1C3OB 2QMEA 1FXWF 1XNHA 3OFJA 3OZEA 5CBKA 4IVPA 2C61A 2Y6UA 1U5CA 3G2IA 3DLAA 4MVCA 4WD3A 3HUFA 3TJRA 4B7CA 4RS4A 4LJKA 1UBFA 1ZA2A 4R7ZA 4B74A 5B12A 3E7XA 1NIJA 4J03A 2VDPB 1J5XA 2FFRA 1KFEB 3EDOA 4GI3A 4LJ9A 3CRMA 1A8HA 1SIWA 2ZTSA 3A3PA 4JC8A 4BRSA 5ISMA 3BMXA 1QIJA 4F5WA 1QG2A 4DNFA 3MMSA 2VRWA 3ZPXA 1L7XA 2YVAA 5DDIP 1E1QA 5FL7D 2ZVJA 2I87A 2O1XA 4Z86A 4A8PA 1AUVA 4I19A 4UFNA 1WCIA 4RC9A 1VPVA 4V0SA 2NSJA 5IMBA 3U4AA 1QOZA 1QIEA 3SIPA 5KMGA 4E09A 1V11B 3B6ZA 4Q0MA 1K68A 3QELA 1JG6A 3UJ3X 3TZCA 1RXUA 1P1FA 2F00A 4CCSA 3H9UA 3HWSA 3LP6A 4GOKA 1WOYA 2PJRA 3TGLA 1JQAA 3PFKA 2JI7A 1R88A 4G56A 4KGVA 5LQMA 1OV4A 3I62A 1BU5A 1PVOA 3OURA 4E6EA 3JYLA 2XB4A 3ZGZA 4R83A 3W5CA 5F78A 2F3QA 1SG0A 1D2MA 2R8XA 4NARA 3V1KA 1O6FA 2BGLA 4HDMA 3A1NA 3NGXA 1PZEA 1M8KA 1ONSA 2QEQA 2RBKA 3G6KA 4MV1A 3C6MA 4PM4A 5H7XA 3GC6A 3WXBA 1YZVA 3F7NA 4JEIA 5C3MA 4EG7A 2UXCB 1QIIA 2FI1A 3LECA 4ZHQB 5DEOA 2HNAA 3U1TA 1DQZA 2OHJA 3R9IA 4YQZA 2QMOA 1GKIA 3MMXA 4Y2YA 4L72A 5CVDA 3VR4D 4O2AA 2NPFA 1KI4A 2I62A 3SEFA 2F62A 2VDWB 4AUMA 3I72A 1K66A 4Q19A 3U44B 3SS9X 2OP0A 3SE0A 3V8NA 1DC8A 3RFCA 4DCJA 2PUEA 3F8TA 3UZUA 3FPEA 3QU5A 1WV0A 4AK9A 1KAGA 3EOZA 3E84A 2O23A 4RMGA 4MVJG 1RFGE 5HPYB 1EUYA 1WSWA 1LW7A 1LWOA 3Q3JB 5JSYA 4IIFA 2FSVA 3DT8A 2FPPA 2K87A 5K2OA 1ZK2A 3LZDA 2WM3A 3T61A 1ISJA 2CN1A 4IO1A 2A0XA 4D4HA 1MQAA 3FZEA 1H93A 2FKNA 1Z6YA 1ADCA 4OHVA 4ZPJA 3F73A 5MGBA 4ESEA 4GZLA 1ULAA 4F4CA 1WETA 3BIWA 2FSHA 2YZMA 3FG9A 4BB9A 1S01A 3COYA 4KI0A 1VLHA 3PRJA 3R3SA 2IT1A 2Y0PA 1WUYA 1FUKA 3Q7EA 1E5DA 4GF5A 4AN1A 1CXZA 5AKZA 2JRLA 2RHLA 3H9BA 3W6ZA 1IDN1 4J0IA 4C1BA 4YLEA 4MCAA 5FR1A 5CDHA 1JILA 1P0MA 3MGGA 4K6FA 2XLBA 4RQUA 1PK7A 4O4HB 1G9TA 1D1TA 2EZ4A 2HFJA 4DG5A 5EXDA 3NMUF 1AQIA 2QNIA 1LRJA 3ASUA 4KFRA 3FVWA 2AOVA 3CT4A 4ZO8A 3QVXA 4QVKA 1TRKA 1JFRA 1YCDA 3AO0B 5CBPB 2SICE 3VA7A 4EYEA 1C7EA 4QARA 2Z8YM 3CBQA 3IT3A 5EJ2A 5KOIA 2ECPA 4PTYA 1W49A 4LMAA 2O0LA 1ZGCA 1G3UA 5K0FA 3H1BA 4XASA 4HT3B 4GYJA 2V6GA 2W83A 3QYPA 4KN9S 2PUHA 4CEHB 4FJ1A 4M76B 4ZYLA 1HTWA 1VYVA 1UBHS 5FH9A 1QG4A 3S81A 1OVGA 3M33A 1U8ZA 2O0HA 2RAPA 4G0XA 4RTRA 2AKEA 3M9LA 1A5BB 4H3HB 1JJIA 1VP9A 1XRLA 1NG9A 4NYMR 3S2GA 3H1TA 4TOIA 5ALSA 2RGNA 1YMQA 2A6PA 3V2IA 5TGZA 1ETUA 1ZN7A 3K1AA 4XVHA 1U5BA 5LQKA 4W9MC 4BS9A 1C0LA 5FX2A 4GEGA 4G3XA 3AJ9A 4OBXA 3UK6A 3KKPA 2A35A 5B2EA 2D74A 4EFNA 1BMQA 2J6CA 2N1BA 4X1KB 4ZU3A 3WLOA 4V1CI 5HQJA 3M3HA 5CD9A 3AI7A 3L0SA 3AONB 2I6XA 4TV8B 1I5OA 4QUKA 1J06A 1GG9A 4S1WA 4JYZA 4DWJA 4KIJA 4MV8A 1CTQA 3D8NA 2A88A 5GTDA 1E6UA 4BNDB 1V16B 2VQ3A 1RR6A 2V97A 2C9BA 3NBKA 4UUNA 5CXSA 4UVHA 4E70A 5FWAA 5G3YA 4TYQA 1OLSB 3G5TA 1M66A 5IW8A 2IYOA 3FTQA 3A6HA 1I24A 3PQ6A 3QH4A 4U5QA 5EFOA 5B7GA 3IV7A 2HTFA 4F5YA 3KUXA 2BGIA 3EXHB 1N2CA 2F9LA 4G5GA 4H1HA 2GAJA 2X0RA 4ALIA 3GJ6A 1R6TA 3Q7SA 4QG7A 2FPGB 4Z9YA 5DGCA 4FNGA 2R6R1 1CY2A 3LQ2A 3AB7A 3GJ8A 4G0YA 4WE3A 2V59A 5EWJA 3TUIC 4L85A 4TTSA 4L4XA 1C2YA 1L4YA 3JYHA 3RUAA 4F6LA 1AA9A 3TZBA 1WW8A 3I6IA 3KWMA 4HJRA 3GFVA 4XX1A 3BAZA 1Y3CE 3HI4A 8ATCA 4H7HA 4X61A 2VPIA 4XD7D 3G8AA 3NVDA 1UDRA 4LFAB 4LVNA 1R5BA 2NWQA 4XM0A 1F4PA 1N5KA 2XTMA 1M0TA 4BAZA 1QGDA 1TKBA 5EE9A 1H8ED 5CCEA 5U9CA 1GKLA 4OK5A 4EG5A 2AHRA 1Q77A 4B31A 1E7MA 3AEUA 3O8LA 1IBSA 3O90A 5AUPB 3ESXA 4E7OA 3KTDA 2DEUA 5AICA 3UG7A 2Z2IA 1I4TD 2IV7A 4CL0A 1T4CB 3G7NA 4X20A 4D8TA 1QONA 2PT5A 3T9DA 3UAOA 3U7RA 1YS9A 4KWEA 5J2UA 4GLJA 1EJ2A 4K8RB 4LGMA 1F12A 1L4KA 4RY2A 5EGNA 1SUCA 4ARIA 2DU8A 4AJ9A 3Q87B 4NENA 2VEDA 4KQWA 2ZRHA 4EHDA 4WZBB 3E7FA 5ER9A 4C4SA 3DE6X 1QZZA 2A0UA 2BEVA 1P4RA 4RTMA 1V8FA 4L75A 3UWPA 4FS3A 4TLBA 3H9QA 3IQGX 4EGQA 3DPUA 3ITKA 1IMJA 2I1VB 2FK8A 2HRBA 3DP9A 3TN7A 2FB9A 2B4KA 3NM4A 3ILVA 3P4UA 3IUBA 4BLSA 3V8QA 5C8VA 1SWVA 2G5GX 2RFLA 3U19A 1I0IA 4N3BA 3NDBB 1KNQA 4DC9A 3D6MA 5KU7A 5ALDA 3HJNA 3ZQUA 1GRVA 5AVWA 2O1WA 5IZCC 2QMZA 5TLSA 3LE8A 4MULA 3L92A 5FOUA 3UPDA 5K45A 2G36A 1RQNA 2G1JA 4TL6A 5I9TA 3DHYA 2RI0A 4KR0A 4JJAA 3MOGA 4A9AA 4F5EA 2DKOA 5KVQA 1GA4A 2XE6A 3IXLA 2IPNA 1GGEA 3M4ZA 4PPNA 3ZLJA 2GZMA 1W36B 3TL3A 4G0PA 3WTBA 3K9BA 1NC3A 1Y7LA 1EFVA 1YOBA 2ISCA 4BLUA 5KBYA 3EQ7A 2NUTB 2PMKA 1VLMA 3DOCA 4IXDA 4R6WA 1IHOA 421PA 3R0VA 4EUSA 3SDSA 1MLDA 3LKZA 2WUEA 4ZTBA 3UXHA 1IXYA 5HFAA 2HJRA 1ACMA 3BQNB 1IRXA 1YFJA 4Q9DA 1XZBA 4JNCA 1FYEA 3H4TA 2WB4A 5G0UA 3RI3A 1YQ9A 3FWKA 3BFVA 3N2KB 3DNFA 3ANTA 4GS5A 4ZEXA 1PS8A 4EECA 1JG4A 3LOPA 1XJCA 3GNLA 4JXXA 2BH2A 1NSYA 5JJLA 4FDVA 4KLZA 1O95A 1GD1O 1FDUA 1V48A 3T4EA 1VJ1A 4BV3A 4IPTA 1F2TB 1WA5A 3PPYA 4WKCA 2QBYB 4FFDA 4Q3LA 2V9PA 3ANLA 1WTAA 2WG1A 4MCJA 4ZAWA 3VR5H 2XWJI 3EZFA 5COAA 3EH1A 3R41A 4J94A 5SY9A 3SKVA 1C0EA 3FUXA 3RWMB 4IINA 3VU8A 1L5MA 3QWHA 4HQ0A 4LGCA 4AZSA 1XZKA 2HMYB 1AA6A 3UXYA 4QUEA 3MWFA 1Z08A 5EZ6B 2VWPA 4HS9A 3FFTA 3WQBA 4LEIA 4RZQA 1E79D 5E7JA 1P29A 4MVJA 2AC2A 2AHOA 3V3TA 1XVUA 3GFTA 4CI9A 1Q95A 2A4KA 1L6RA 5KTOA 2OE2A 4URWR 3DKKA 1LS1A 3E61A 1J97A 5K0CA 4P53A 3T4XA 2PS1A 4IUDS 3HRIA 3V6MA 3NPAA 1GKUB 3H5WA 3O5AA 1KDOA 4XRRA 3U13A 1QOQB 4Z2YA 1YTLA 4C06A 1W9HA 1W87A 4ON9A 1BFUA 3KJEA 1POWA 2PUDA 2M98A 3L0CA 2IIPA 3EODA 3QENA 3OZSA 2Q27A 5AM1A 4EPXA 3LPAA 1Y81A 4L5IA 4MAMA 1QP8A 1TTHA 1JDBC 1W5BA 5DW3A 5ENDA 1W8DA 4ESVA 2HWUA 1T5TA 3KPJA 1YQXA 3K1ZA 3Q5DA 1QVVA 3Q3EA 4JYBA 1UXJA 4JHLA 4D57A 2XKBA 3BAFA 2X0KA 3IEKA 4MQ6A 4DNOA 1N5RA 4ZO7A 5K8VA 4AKTA 1UKEA 4WOKA 1N6LA 4KV7A 2ZVDA 3TLBA 3FF4A 3JARA 3G82C 2HMWA 4FP9A 3U3XA 4PLVA 4CQJA 3W05A 5GVSA 2CHVA 1YL5A 3QK7A 3ZHBA 3EVNA 1Z0DA 4QBIA 3SM3A 1KC1A 3FHLA 1P7WA 2RGUA 2B35A 1W85A 4XRGA 2BN4A 3RUEA 3WLAA 2V54A 2XR1A 2SBTA 5CK5A 2AJCA 2W90A 3ZDQA 1ATZA 3CUVA 4AMZA 4LN1A 2BGWA 2J6BA 4FIDA 3ZS8A 5FJIA 3MFQA 4M8SA 2CHFA 2FPWA 1AM4D 2PLAA 3A3OA 4FEYA 1ND5A 1XTVA 2ZDHA 4AJNA 2PZGA 3CZ5A 2VJYA 5EQFA 3GPBA 3OPVA 4DADA 2JIPA 2VVTA 1VA5A 2AT1A 2QAIA 3EXFB 4M8KA 4NE2A 1ZGBA 1N6PA 2FN9A 4LXGA 5FL7A 5DYIA 1XKQA 1NKSA 4QT0A 5DEIA 2FR1A 2I3AA 4CMEC 3BMQA 3DMHA 3DNMA 2X19A 1GNTA 3J7AC 3ANSA 4PIPA 2VJAA 2REQB 3IAM6 2D8MA 4XAQA 1EUDA 2EFGA 4WXHA 2XUKA 1WB4A 1YK1A 4LBZA 2AUNA 5EUQB 3S27A 4R5HA 5AQEA 1ONNA 4RFVA 4RM2A 5K0LA 3TTYA 5EUBA 3GOHA 4Q4AB 1KZ1A 2JVKA 1IHUA 4C4YA 2OXEA 4F2GA 3N0XA 1Q5PA 2QPTA 3W77A 1EP9A 5F7JA 2BPOA 1D0SA 3IA2A 3KLMX 4J1TC 1E2PA 1N9GB 4K9NA 4YJ2A 4N01A 1VZ3A 3C3AA 5E4FA 5GM2A 1FXSA 5LJLA 2JD0A 2QL5A 4PF1A 4XD2A 1S89A 4Q9LA 6AT1A 3EJ6A 1LK0A 1OZFA 5LDHA 3OKAA 4LUCA 1RXYA 4QJIA 1N6HA 4WWHA 1DJOA 2O14A 3KJHA 3FM9A 3NAZA 4MO2A 4XI9A 3UJHA 3T99A 1HQKA 4BKRA 1M2FA 3R20A 3X44A 1XYGA 2GGSA 1XZAA 1YTUA 1T2EA 1XEAA 1GVNB 1B0UA 3C14C 4V0NA 2C54A 2AKYA 4NJEA 3WZLA 3WGTA 4XA8A 4ZI7B 2XQGA 1Z47A 4ZYTA 1YJXA 5IABA 5HRAA 3HNRA 1EP1B 2DKFA 3DBOB 3F5QA 2QAGC 3KJQA 4KAFA 4MRPA 4P7JA 4X85A 5E9WA 1PT8A 3G6WA 4B8YA 3U4MA 1ZAYA 3LWZA 2C9DA 2W2PA 3BJIC 3DLCA 4JJ6A 1E4OA 3NDPA 2LIVA 1Q3KA 3BB1A 5D8DA 2Q3BA 3BICA 2Z3WA 2NU9B 2ZPAA 4RYLA 4YASA 3UTDA 1I10A 2H0RA 4HP8A 4OQQA 1GDHA 3ROQA 3MGAA 1QQ6A 4LE1A 2XSZA 4X97A 3WJ1A 4C0LA 4EGSA 4WK2B 1CSEE 2H63A 3H11B 1RWOA 2AX4A 4J49A 1HDXA 2WTBA 3CSDA 2I3ZA 5JISA 4IJKA 4EKGA 1SHUX 4CTMA 5B1YA 4P4NA 3VDXA 2EKDA 2TECE 4EA7A 3Q4GA 1FTWA 4N82A 1NX6A 1ZJWA 2XZOA 2ONYA 2YNMD 3KS9A 4M1SA 1Z5GA 5JD6A 3KE8A 4HNRA 3B1FA 3RC1A 5EJGA 1DXQA 1E99A 2PQ2A 1HF3A 4NBLA 4QM7A 2C03A 2ZJ7A 3KKEA 5BORA 3DE0X 3R0QA 2O8CA 5IBCA 3RT1A 1WULS 5AJHA 3TOVA 2ADOA 1XOIA 4RTKA 4H18A 2WFLB 1R1DA 2TMDA 4QGSA 4J0JA 3L8CA 5FTKA 3TXAA 2EFHB 3WWCA 3O8CA 3ZEAA 1JXQA 1PYDA 2QR3A 1QP0A 1Z12A 1X74A 2PO5A 4M86A 3L8HA 3N1UA 3W1VA 4HLUA 3ESBA 5K09A 1MX5A 3HJCA 3QTLA 2DPYA 4Q16A 1SOUA 4K28A 4XJTA 4G5FA 4ENQA 2DFLA 4CKBA 4MV6A 4D8XA 2WU8A 1HL7A 1I94B 1L7EA 2OBXA 3NJ4A 3F78A 4BB5A 2VKQA 2ZIVB 3MT9A 4E5VA 3QKWA 1TEHA 1JUDA 2DR0A 3OFVA 2AZTA 4TWJA 1TQ8A 5AKEA 4FBLA 4C14A 1U0FA 1NQ5A 4YV2A 4D4IA 3SYLA 4INOA 3G0CA 1U94A 3DZIA 4NQRA 4YAWA 3VZSA 3T7IA 1O03A 2AV6A 2YQ5A 2JIMA 4AKGA 1YF3A 3A1DA 4PXYA 2Q1SA 1J8DA 3EC7A 3N0RA 4BNKA 1K6JA 3GFBA 3EAFA 3OJLA 4ZCSA 3ROKA 4X0EA 1KWKA 1KAEA 2EIHA 2IPAB 3FTDA 4JBWA 5SYMA 2FK7A 1M8JA 1OXUA 2GDZA 4Z9XA 2C9MA 1C3XA 3D6NB 3GPDG 3HDGA 3AQIA 2ZOSA 3ZXUB 1NMYA 2I6UA 4TMVA 5CH5A 3M70A 2BAGA 4HSGA 1K6MA 4YI5A 5EE0A 3HCFA 2GCPA 3AIOA 2PHZA 4V0MA 3C8MA 3QKIA 5GADl 1AOXA 2IZOA 4BWFB 4UCXA 3ZKAA 1JTEA 2NO9A 3AM1A 1USGA 2O57A 1NL3A 1WLYA 3G89A 5LP6C 3RU7A 4DJJA 1RJ9B 2YINC 2YV4A 3NM6B 4OXIA 2ZGVA 3JZAA 5ECYA 5FTNA 1QMPA 2V58A 2WT9A 4XLTA 3CUKA 3FNEA 4JJGA 3HBAA 1SO8A 3G49A 2Z3VA 3H1PA 2FG7C 3BEOA 3PXCX 1D5WA 4AN4A 1K0UA 4ARVA 5TNXA 3DLPX 4RVOA 2IH4A 3S1AB 1NAIA 2KYRA 3GLHE 1L1EA 5AXAA 1ORVA 2FRXA 4DG9A 3RS7A 3TSWA 5C32A 1QV7A 4OIMA 1KH3A 2AC7A 3EJWA 4U2KA 1EFHA 3UMMA 5AI8A 1EG2A 5SYAA 2OC9A 2PRSA 1HURA 4EMUA 1Y7PA 2HB6A 2BFNA 3TFWA 4GFDA 4LQDA 3SZUA 1BN6A 2OQRA 4FHEA 3FOAA 3DF7A 1OWPA 3COSA 2JAXA 3LPCA 4IZ6A 3VFDA 1CEQA 1GPUA 3TZ6A 3EVGA 5HFNA 3PVCA 4RJIA 2QL7A 5IPFA 5BWOA 1ST2A 3TNJA 1WXXA 2WLTA 4BO6A 2KLHA 2OXTA 5HJ2A 1F1BA 2RAVA 1I4DD 1JR2A 5EMMA 3W5SA 1FMCA 2COEA 5J4HA 1YKGA 1EMDA 1E3SA 4DIUA 4JIGA 4PRZA 3ZHUA 4D0RA 4UTXA 3VPXA 3NT5A 1C0PA 1ZL2A 3HE3A 2F1JA 2R86A 3WFZA 4OVKA 4BLQA 2JAWA 3IURA 5C81A 2Z4TA 4ZI3A 5JV5A 5IANA 3RAEC 4WNCA 4JEHA 2BF4A 1G9XA 3MC1A 4YRRA 2ZCUA 1HFEL 4PAGA 3VYSB 1ZK3A 5JI3E 5IBRA 1NHWA 4X41A 3B7WA 1FE8A 2JLCA 3ZVNA 1ODKA 4QGFA 4JB2A 1CEXA 4HFNA 4C4TA 3GLFE 2VDVE 2X0JA 2UUCB 1VSUA 1P2UA 4CG0A 5HZHA 3O75A 1ZUD1 3WI7A 1QWOA 2VDUE 3FPFA 1YS1X 3OBBA 5TQ2B 2Q1TA 3AUJB 3LF2A 4D74A 3R7WB 8ADHA 3WVNA 1EK0A 3CF0A 1LBHA 8LDHA 4A6XA 1SOMA 3OQ6A 1IQUA 4N65A 1RWKA 4WL0A 3LSYA 2NNLD 1LQUA 4OHZA 4RETA 2DQ4A 1BD3A 1AV7A 1B1AA 1U8CB 5F7OA 3L8FA 2X2EA 1KSJA 2O5RA 3WXMA 2ILTA 1FSSA 2O2XA 4C30A 4R3WA 1XN1A 1LK7A 4TSFA 3EY4A 3JASB 3LGSA 4Z8YA 3I8OA 2C4TA 3IKMB 5ALVA 1QCYA 2GJSA 2YV5A 3L5KA 4BNDA 1TT5A 1MIHA 2I2WA 4BWVA 2OGUA 3VI3B 3HZZA 4BQFA 3GJRA 2R1UA 2ZI3A 4CM9D 1X7YB 3BEDA 1N9ZA 3UOWA 5LQAA 3I6YA 4M22A 1KR2A 4HUTA 1NXOA 4X65B 1SBNE 5CAEB 3P94A 1MO5A 2AG5A 3UAVA 2VCYA 4RF3A 3AUKA 2HMAA 4IH1A 5EPOA 2B1RA 2QMYA 2REOA 3CR7A 3QVSA 4MW9A 2GZ2A 4URUR 2C5BA 2BJVA 4FONA 2NN3C 3II6X 1ZMXA 2GA9A 4Q4HB 4U9HS 4PNPA 2KBFA 1E9FA 2YUIA 5FNVA 3LYHA 5E9QA 4G8BA 2UZ1A 2XMPA 3ONNA 4ZU1X 3LUJA 3UA3A 3HJHA 3VPDA 4TQGA 3QHPA 4LF4B 4PCVA 1ZAKA 2QE7D 3NBFA 2EFYA 1U6KA 2QG6A 4MVJP 4RS3A 3TRIA 1BKDR 2EX4A 2D2FA 4X95A 1N3LA 3KKZA 3TIXB 4BO5A 1T6XA 3IS3A 5BSGA 3REQB 4U2EA 1JXOA 3EW7A 1V8DA 2P1DA 1LV7A 1NSFA 4UXJA 2P91A 4NONA 5KYYB 4D9MA 5HZGA 1CQZA 3T9CA 5ALUA 1KVSA 2DPHA 2I4MA 4WBNA 1JJFA 2WM9B 2ESRA 3EDCA 1VPDA 1EAYA 4ML3A 3W2HA 2IFTA 1FBTA 2BBOA 3ILHA 1E6CA 1FUEA 2EBHX 2Y1WA 3BKWA 3IP1A 4FFMA 3AOEC 3VHXB 4EMBA 5BQFA 1DQRA 2CHUA 2EKPA 5K51A 1AZTA 4B6OA 2COKA 3BHNA 3G0OA 3S68A 2RKWA 4HVLA 5BW6B 4MR8A 2YDXA 1ZNYA 3IOCA 3LWDA 1YR1A 5HJEA 2QI9C 1GQFA 2E49A 4YHBA 2GAFA 3SDZA 1UADA 3P45A 4HFJA 1JLHA 2KJQA 1G8YA 1U4OA 1NR1A 3AP1A 1D6MA 3PGXA 4YJ3B 4QU8A 1AK1A 3M4JA 3Q72A 4M36A 3QNWA 4KIUA 4KX5A 1WPGA 3QWAA 3CGWA 5CVUA 4B4DA 1R37A 5KQMA 3R3UA 2GPJA 2QGNA 1QORA 3NBAA 4OX9B 1LWNA 3OU7A 3R76A 2PUVA 4AIRA 2XNDA 4RIFA 1LSSA 2QQFA 1VKNA 2Q49A 2JFPA 3EXIB 3FHCB 3KXKA 7REQA 4HO1X 3HDTA 4RUKA 2AK2A 4PYQA 2OL4A 4ZT3A 3RT9A 1UDWA 3OUTA 1EX6A 1CLUA 3WLIA 3ZIAA 4DLAA 3UFXA 2WABA 3GVPA 1JH9A 1AX9A 4S12A 3WDSA 1T3ZA 5HF6A 5IARA 3GMSA 1SUBA 4BRUA 2W2KB 1RI5A 4AURA 1M34B 1OBOA 2J6IA 3NBYC 3PDWA 5AWFC 3TTXA 3LOQA 1L8LA 3TCKA 7GPBA 3VJMA 2X4LA 2H92A 4DSNA 3G2MA 4QDOA 3A1CA 5DTMA 4F3RA 4WZ6A 4MWGA 3RC8A 3F7TA 1ZC3A 1VG8A 1SVUA 1EFUA 4J0KA 4PLTA 3GGPA 1H1LA 1XRPA 2K2QB 1T5LA 1MO3A 3FMIA 4LZWA 3TPCA 3PR2B 2DQZA 3WY9A 1QBGA 2VJMB 4QRIA 5EQDA 1P17A 1AURA 3K8OE 3M6XA 5EJ6A 1OIWA 4TTIA 2GN4A 4BQQA 5KNCH 1KR5A 2Y0EA 4YUWA 3HXTA 2EW2A 3IQDB 1DFHA 4NP6A 3KQWA 1VSTA 3KOXA 5JVDB 1JYSA 3AUTA 2X1VA 4AO7A 1U1CA 1M75A 1EKXA 1UEIA 3F4LA 1DKOA 4OMDA 1S0UA 1PJAA 1X38A 5K8CA 1UBKS 2OCLA 3BK7A 4TV8A 5J2TF 4F4UA 1X80B 1ODTC 3QVVA 3T5BA 2NU8A 1QS0B 1J7JA 2HPVA 3D7RA 3PX3A 5DIFA 2A5DA 2WTUA 1XAHA 5EJEA 5LYJA 3B60A 3TCXB 1UMDB 2P6NA 2D2XA 4JJIA 1IY0A 4QUAA 5L40A 2F8SA 4GRIA 4F9EA 4DLUA 2AW5A 1R0WA 3HJRA 4YN3A 4RVGA 2J5XA 1BA2A 2QR5A 2R6GA 1YONA 2HJVA 2VDLB 2Z57A 1XB2A 3QE2A 2BFCA 3STHA 2JLVA 3I9FA 5ICSA 1YS2X 3Q3HA 3V5NA 4F56A 5HBGA 2UZ3A 3DO8A 4RPLA 4UHBA 1AGNA 3KZOA 2I7TA 4MQEA 3LHFA 2M2IA 4QXRA 4JQSA 1M1YA 2HGZA 3QXCA 3CH5A 4JZYA 1F0YA 1XCPA 3AFHA 4B7XA 3FOEC 2VJNA 1C8LA 3QMPA 2RD2A 5FKJA 3GUZA 5BMVA 3D2LA 4YRLA 3ZHYA 2EGUA 1RRKA 4CCAA 4DXDA 5DNUA 1U1EA 4B32A 2WF9A 4D9EA 4J7AA 1T8SA 3A2NA 4XUGB 2PFKA 1MJ5A 3LLMA 4FZJA 3V2UA 3VSEA 5LDDC 2GN6A 3R5SA 2HF7A 2ID7A 3O2SB 4ME6A 4QFMA 5E6RB 3RRFA 1MN6A 1PGPA 4MWEA 5EEHA 4BO4A 4XJSA 4XE5A 2OCBA 2G9VA 2QN2A 1IN4A 2FV8A 2R48A 2WFAA 5F1YA 3QF4A 3D2CA 4PHCA 4AMUA 4JCOA 2NYVA 4TWIA 3IQHX 1BS1A 4KDFA 2GZSA 1F8XA 2YWEA 3H2KA 4RZXA 2RHGB 2AWNA 4FYJA 1X70A 5B1SA 1H0SA 2YZKA 4LV5B 5KYWB 4PC6A 2I0FA 4YUXA 3EH2A 1LVGA 5ECWA 2EU8A 4K2AA 5COQA 4G8JA 1QTIA 5CFRA 4HRYA 2J30A 1JVNA 1YBMA 5TIIA 2NMVA 2BMFA 5TQVA 4QULA 1KSGA 2X5JO 3AETB 5EIAA 1BXZA 1JP7A 4R1SA 2F2TA 2ZAMA 3GO4A 1SZDA 4X64B 3T3HA 4KIWA 3QU7A 1IZ7A 3ABSB 4GPD1 2WJVA 3GRZA 4INPA 4OK6A 1NF9A 1KYVA 3JW8A 3ZK7A 3WV5A 4FI3C 1WZIA 2HQRA 2XTNA 1U3VA 2XYGA 5FPPA 2AMFA 2D2VA 4Y9UA 1YB4A 3NHSA 2FG6C 1M54A 1N4DA 2NSYA 1JE0A 4MYTA 4MRVA 1BVHA 1SKBA 1W8IA 2PKXA 1CWUA 1C0KA 4YIHA 2VDMB 5TMBA 4KXFB 1A97A 1JXMA 3F6EX 4PBTA 4IF6A 4XYMA 3UEOA 4AJ1A 4BGVA 1I01A 4JUDX 1EXNA 5FUXA 4AJ4A 1NC1A 2G7MC 2WIKA 3QMVA 4M49A 3UAWA 5JXGA 1X0VA 3UYKA 1RRCA 3CH7A 4L76A 1RAGA 3DXFA 1NXVA 4N8DA 3L18A 2QSYA 3QG5A 4LRXA 2ONZA 4MMXB 2HV9A 3MLBA 4JGGA 1GVHA 2WC1A 4M98A 1E8DA 1ZIDA 1GZDA 4F12A 2ODWA 4R2HA 4WVLA 1SKMA 3VH3A 1KFBB 1VBNA 2VC2B 4L9WA 1SUDA 1LNZA 2AXPA 2YN0A 5ALWA 1FYWA 1GCOA 4LX8A 1H5UA 3I8SA 1THZA 5EIHA 1DDIA 1V9LA 1I3MA 1DQSA 1SC3A 4K26A 1CJBA 1RPNA 3H6HA 1SU8A 3FAKA 3GQBA 5TF4A 4COKA 2FVYA 3RYFA 2IZ0A 2DF8A 3VDNB 3I32A 1IEVA 2QE6A 3CW8X 4NCXA 3SC2B 1TEVA 3MS7A 4OFBA 1PYOA 3A3KA 2ENUA 4TN1A 4CMIA 4M2LA 1G8JA 2EFJA 1L7RA 1NDUA 2Q6TA 2WZCA 3IQEA 4FTWA 2X7XA 4PFSA 3TOCA 3EVBA 5AHOA 4LKOA 4NV3A 2UUAB 2ZJ0A 4WKOA 3THSA 4PTLA 1JEAA 2OV1A 1O57A 4MIEA 4RZ2A 4KO8A 1NM5A 3ICWA 2D5BA 2IHKA 2ZT6A 2HJ9A 2QRZA 3DVLA 4HTFB 2JGDA 4L78A 4JYMA 3UXMA 2XT0A 3ZLBA 2ZRGA 1F20A 4KJZA 3NORA 4M0LA 3BHMA 1BW9A 1DL5A 4RFSB 5K4AA 4BNTA 4KPUA 3NDIA 5IC6A 1YZYA 1ZK0A 2GN8A 3NU1A 3GEPA 4B81A 3K6RA 1NR7A 2IW1A 1HSOA 3MAAC 3ZJYA 1G2OA 1XU9A 1RMYA 1N2CB 1PFWA 3FMGA 4TT3A 3VDMA 1CRZA 1Z36A 1O6BA 2HY7A 2IIBA 3N0WA 5HIAA 5BWCA 3E27A 3LUBA 4R9RA 5JPDA 3MWJA 2MOKA 4B3DA 3IUEA 1PJTA 2P3LA 4PINA 1AHNA 1ZGZA 4ZU6X 2HCFA 4R2IA 3UAXA 2AOXA 2VK1A 4Q4JB 2WPNA 4RWEA 1L1RA 4YT5A 3Q8XB 1Q12A 2PSSA 1OWNA 3AVOA 4AKIA 4W5QA 3UGTA 1EUCA 4LSZA 1CR4A 4J1NA 3VU1A 1LPNA 5A9SB 2AI3A 4NMHA 4WZBE 3ED1A 4CIDA 1YBVA 3CBGA 3E9CA 3TQFA 1FVOA 2AL7A 1RTKA 5B3JA 5JBNA 4Y2XA 4XLZA 2YS6A 1QAQA 1WCYA 1V7CA 4EELA 3W7BA 3GLGB 3FPJA 1LPSA 2QK4A 1GGVA 3DVAA 3LDAA 4BNIA 4BMOB 3R3WA 2P9FA 2M1XA 1F5NA 3JRXA 3OE5A 5GP1A 4YAJA 3WIBA 4BFSA 2RI6A 1T8RA 2AFIB 2J7PA 2YXPX 3L1VA 3U4IA 4M9XA 1T10A 2PVCA 4ILKA 1XHFA 1C7ZA 3SC4A 1A9TA 1G60A 2CE7A 4RDCA 5BV8A 1FU7A 2OO5C 1UPFA 4J29A 4LCJA 3LX5A 1JSRA 2D1TA 4QSHA 3U26A 1DC3A 2Z8YA 4CKCB 1GZ6A 3OZXA 1G6Q1 4YRCA 4ZA2A 1PWEA 1JHYA 1X14A 1CFJA 4J07A 1GQSA 4AQ7A 3THYA 3NFRA 4UCWA 1O08A 4V0QA 3M1AA 1W5TA 3N07A 3WGMA 4L8YA 3RAFC 1V7ZA 1JG3A 4WK4B 1TUBA 3K9HA 1HTBA 2CLMB 3V48A 5KNBA 8AT1A 2YKGA 3QEOA 1IN8A 4M1ZA 4UZEA 3NNSA 1VI5A 2BTOA 3A6LA 1RYMA 1Q2XA 2BR5A 5EMHA 3ITEA 2X7HA 3CNHA 3H5OA 4UMFA 3A1UA 1GT91 5C80A 1NASA 4BUJA 5JH7B 4BKUA 3K9WA 5F9FA 4MDYA 1XTQA 1NFQA 5ESDA 5BV1A 4B3MB 3OOHA 1DEHA 3CX8A 4DC1A 1GZ3A 2NAPA 4E4YA 3DO5A 3FYTA 4DEXA 2FNAA 3HKBA 4QRDA 4EKNB 2AQIA 2VA8A 5KHAA 3BB4A 2G88A 1FFGA 1P1IA 3OIDA 5C0OE 4E1AA 1PV4A 2MSWA 3LPLA 3U56A 3L7JA 3U3JA 1QGZA 3ET5A 1ZBQA 5EJ8A 3T7CA 4DBLC 4DQUA 1Q0ZA 1YUNA 3Q7RA 3OKCA 4KRGA 2B30A 3TF5A 1NUPA 2W98A 1HE1C 2J07A 4X3CA 5E6SA 1QHGA 1RMQA 2B99A 4P7KA 5IVIA 3HK2A 2SKDA 4K9QA 4W5TA 2V74B 3GLIB 2WF7A 1WD7A 2XUGA 3WSTA 1VIVA 1UJCA 5KWSA 2FZVA 1KH1A 2CDRA 4P3XA 5IKOA 4C2BA 2F4VB 5H0IA 4YPFA 1PR3A 3SZOA 4DMCA 4KREA 4IILA 2W4IA 2F8MA 3JQ6A 4JBHA 2PMDA 2CL6X 4MJ3A 5H59A 4G0UA 2P27A 3OOYA 1AKWA 1KFKB 1JLMA 2XRYA 4QG3A 3QWFA 5H8WA 4A3SA 4JLBA 2B1IA 1QGAA 1CDOA 2LPMA 2DMRA 2PRIA 3DBVO 3OJFA 4ISBA 4Y9RA 5CLIA 2HA3A 1E2EA 2KB0A 5DRYA 3DHEA 3QY9A 4Q3NA 5EIEA 4MLPA 2C5EA 4ILEA 1YQDA 3D6UA 6REQB 2ONJA 4BNUA 3KJFA 5ADWA 4ZXFA 2GRAA 3BXOA 2X0FA 1T9AA 4KYTA 5ILGA 1BHQ1 3WQRA 3OFND 3BSSA 3CNLA 3VR1A 2B3DA 2WT4A 4RLHA 1DKNA 4LECA 1FYDA 3PHGA 4FHCA 3O21A 4QDTA 1II9A 3I1JA 5FOXA 1C9YA 5HA5A 3WP1B 1YA6A 3OT1B 4MQLA 1FFAA 3UT5B 2PL3A 1SZCA 3O9ZA 4H6PA 3P4YA 4YV1A 4KQHA 4BRWA 3TEMA 2IYEA 3BGWA 2PL5A 1AZLA 1JE1A 1MEJA 1TJ5A 2BISA 1NNI1 2ZW9A 5GAJA 3EFHA 1T0BA 1H9BA 2BFEA 3GMTA 1RSZA 4PZZA 4GP7A 4KGXA 4R98A 3AWDA 4RJLA 1V95A 1L9KA 3PENA 2HU7A 4OLHA 3N2NA 2ZSUA 5B1HA 3PUWA 4M8IA 5EVJA 1Y1RA 3PJEA 4MQFB 1EXVA 3J80A 2OECA 4HLQB 1YDMA 2YZNA 3AY7A 4Y30A 2BKUA 1JFSA 4P7GA 5IZ4A 3PVSA 2ZB7A 3EMVA 3VVBA 2DE0X 4OGWA 5ALLA 5F2EA 2FXIA 3INGA 4D7AA 2HEGA 1TC1A 4KXWA 2LNDA 2E0IA 3GZ4A 4AY5A 4LCEA 1Z16A 3O03A 1P74A 3RYFB 4AC9A 2DQKA 2OV6A 1Y4ZA 1EFRA 4JN6B 3SX2A 1IN5A 2OV4A 2OQIA 4YYZA 4OJKA 4R2KA 2UU9B 2XQIA 1SH7A 2OUIA 3L0IB 1UMCA 4TM8A 2QU8A 1SEVA 4NY1A 4D1YA 3WLPA 5C8YA 2IS2A 5C18A 2ZRAA 2VDRB 1DPGA 3OEED 4IJQA 5JIBA 4IDGA 4H0NA 4R0MA 4BV2A 1D2GA 1WSAA 4NH0A 2WJAA 1WU8A 9MHTA 2NZJA 1TIKA 1XEWX 4DA9A 1Z75A 4QVGA 4CQMA 1Y5RA 2H17A 4JY7A 1IYZA 1JHRA 2J3LA 3CLSC 4FGUA 4RK0A 4XARA 8ABPA 4MGKR 4FDMA 3KZNA 3LQ4A 2P9CA 5THQA 1CQXA 3HA5A 1LCIA 1Q2UA 2FQQA 1XV5A 3RVRA 1C41A 3I09A 2K5UA 4RIEA 3LVBA 5C1IA 3FOFC 2C2OA 1YMUA 1QG6A 1E0JA 5JD4A 5SZJA 2IYXA 4KQFA 4ECEA 4EY5A 3CH4B 5HCIA 3ZV7A 3IE2A 1D4ZA 1O7JA 2FLWA 4DPMA 3VNQA 3KZVA 3RC7A 1FMJA 2R1TB 2RHWA 2Y67A 2BHSA 1DFGA 2QVBA 5AKLA 4M1WA 2J4CA 5JS7A 3TG8A 1M74A 1P39A 4Z7JA 2OGSA 3K1TA 5NLLA 4RSHA 4WZAE 3ZU5A 3IPAA 4D3ZA 4GU5A 4AN0A 5J58A 4RE6A 1QHYA 1S2LA 2E5WA 4X7BA 2VRCD 1QDLB 1QQTA 1Z7YA 2PXXA 5KREA 3B9PA 4N0EA 2FU5C 3R4VA 2HRZA 1BMDA 4J0GA 3X2SA 4B3TB 2EWWA 3QVLA 5BVHA 4C5AA 3LQRA 2OHVA 2H16A 1DAKA 3PYLA 4JVSB 3ED5A 1KMNA 4PC7A 1K3FA 5DWQA 3UJBA 1SCIA 1EP3B 2HIMA 2FWIA 1M2EA 5AVRA 2H29A 1FZQA 1JBQA 3M4XA 3P19A 4B4UA 3R3XA 4LC9A 1T8TA 3B53X 3FHJA 5HVNA 5SY6A 2ATCA 2W6JD 1AV6A 1CUFA 4M88A 3T5AA 2PXAA 5LKAA 4KPFC 3N8NA 4RSRA 4EY6A 3DOOA 2BDEA 4TXNA 5J59A 3AF6A 1E20A 1XD2B 1NUQA 1VXOA 4GRAA 2Z95A 3JVUA 3C3XA 4JLVA 1RZRD 2Q6VA 1XZNA 3TLGA 2AE2A 4GXNA 3WL6A 3JY6A 1LTHR 3OMLA 3A32A 4M21A 4H17A 5K6TA 5J2TA 1SXQA 1JPVA 3N3AC 4B76A 3ZJVA 2J67A 4BO2A 3P9QA 5DSZA 2A5GA 2XAAA 3IVMA 4BFCA 2K7FA 2R5FA 2O8CB 2C94A 2IEIA 5H9VA 4E5UA 6ADHA 1SELA 2ZI4A 2FHSA 4UEJA 1PGQA 1IUOA 2H5IA 3LIPA 2XX3A 3M9WA 4WGFA 3KRTA 1WPXA 4ZQCB 1CP3A 1X2EA 1XN4A 3VO1A 2WOOA 3PFBA 5I9BA 4BLVA 1DB3A 4QL3A 3LUPA 4BHTA 1LLFA 1WXGA 5FJJA 4ZEWA 1HE3A 3WAGA 2OTCA 2YL2A 3OCXA 4FMDF 1XZIA 1JHPA 2GX6A 3VYVA 1FLDA 4CJXA 4PXSA 4KPUB 4NPCA 2NZUG 2XDYA 1X7YA 4AJEA 1JBEA 4M1EA 1DKRA 4JSTA 3UH0A 1X7DA 1Y8CA 2V4ZA 1NXXA 4G4SO 2R1ZA 1Q16A 3DOIA 4DCGA 4YRMA 5A4AA 2H31A 3PR1A 4IIXA 4EW6A 5AXCA 3F3SA 1TKAA 1JEQB 1WW2A 2WPDA 3NX4A 4MIOA 4RU1A 3W8FA 3L8ZA 1E6MA 4ZEOA 3PVZA 1Z7EA 3B13B 5LP1A 1KZ7B 3PQFA 1HR0B 3ENWA 1AGYA 1UBJS 1SBYA 2JAOA 4NZYA 1P5FA 1JKJA 5JC1A 3BWBA 3KCNA 3HO8A 4JI7B 4Q3DA 1L5SA 1GPJA 2GLXA 3GFPA 3HNOA 4YALA 3ZZNA 1IN6A 5LYYA 2JIZD 1X2BA 1ZYUA 1NJ1A 4CN8A 1HZZA 1GUZA 2P6MA 5AW9A 4BCCA 4I50A 2ZIAA 5M29A 3DAHA 2P6RA 2J5QA 2VWGA 1N5IA 2AMYA 3CNOA 3PHLA 2R7KA 3HH8A 4OHPA 3W9SA 1NW7A 2IZ7A 3CRNA 5GJBA 5JOQA 1ECPA 1ZESA 2DPMA 3RJ5A 3EGXA 1HNXB 4WNYA 3WLJA 5EC8A 4B3SB 3P9CA 4KYVA 4Q4DA 2IA5A 3BL6A 2QD2A 4PIMA 1NRWA 5IT5A 1XVAA 3SHOA 2ODEA 3A6JA 3R6DA 2FP4B 1DWOA 1L7VC 4K7JA 1Y1QA 3DZ8A 2ZBEA 2HSZA 4I1SA 5AW7A 4AMYA 3DCJA 2BM1A 1AKTA 4GPAA 1K7SN 1PZXA 1R8XA 1BTOA 3C3CA 4FFVA 4FR2A 4GMKA 5FV7A 3U7JA 4H1TA 3K70C 2ORED 1JJAA 4ZQGA 1IOZA 3ETGA 1XPJA 2NAFA 3O8OA 4UCQA 1N57A 2YFKA 2J33A 1S2NA 3T52A 4DJ5X 2GPTA 1ADYA 3EGVA 4OQXA 1Y8ZA 3MJRA 1THGA 2CNWD 3A1SA 3GDHA 3Q9UA 4K0RA 4IHJB 4EF4A 3M3PA 4DLZA 4IIJA 3WLEA 3AR5A 1E0KA 1I2CA 1E3TA 3HRHA 1GCUA 4PLHA 4CKXA 1ICEA 1FLNA 1E96A 2NUPA 3DEKA 3EVZA 3HKDA 3COWA 3B70A 4NJMB 1UP7A 1GAQA 3AUAA 3DB1A 4CGZA 3L0PA 3C24A 2VBCA 3A9VA 1PV1A 2ZJFA 4MP6A 3UUWA 1IULA 2PZAA 2YHSA 2H1HA 1IATA 3UT0A 1XRJA 4TRMA 4D46A 1LVHA 3B1JA 2CCKA 3GDWA 4C4PA 4PGGA 1DV1A 2YOGA 3A6GA 3Q7PA 1QFYA 2XYVA 3CJQA 3L07A 4R8VA 1IXKA 2WD7B 2CD7A 1I1HA 3WKDA 4I6EA 4WLUA 2C7BA 4XFKA 1O95C 3H6GA 2XVMA 4WOJA 4BE9A 1PG2A 3GBSA 4KO2S 2Z5FA 1LNSA 3N6XA 3BA1A 4GQIA 4AAYA 2GO1A 2AD1A 1MVOA 2C95A 2QT9A 1QDUA 1N0UA 1Y8AA 2UUPA 4HH0A 5ERGB 3AV3A 4DTCA 5KTNA 2PKEA 1E2QA 3HXPA 3U7IA 1Z0ZA 1Q1EA 4BX0A 4EA6A 2ZBUA 1Q7TA 5C8DA 3MRSA 3B51X 1R9NA 4QYIA 1R0SA 2UVPB 2HDWA 3I9KA 4WZAA 4EA8A 3CVUA 3D9QX 5KNDD 5ALRA 221PA 3D6TB 4LI0A 4Y2TA 4HDRB 1J6UA 5FADA 4P92A 2D5AA 3KYIB 4BB6A 1IZ0A 1BOFA 2BCEA 2Q3HA 4F4IA 1EVYA 2B2CA 3DKVA 4G0QA 3HXKA 2Z98A 3WICA 3JASA 1U0JA 1S7GA 4FDTA 4U6SA 1OBHA 1RAAA 2B83A 3I2FA 1ZEJA 4ZXPA 4LJ7A 3RRNA 1L4EA 4CMJA 5LZ2A 1KJZA 2BFDB 4OKNA 2NU6A 4PR3A