3T52A

L29i mutation in an aryl esterase from pseudomonas fluorescens leads to unique peptide flip and increased activity
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
271
structure length
271
Chain Sequence
STFVAKDGTQIYFKDWGSGKPVLFSHGWILDADMWEYQMEYLSSRGYRTIAFDRRGFGRSDQPWTGNDYDTFADDIAQLIEHLDLKEVTLVGFSMGGGDVARYIARHGSARVAGLVLLGAVTPLFGQKPDYPQGVPLDVFARFKTELLKDRAQFISDFNAPFYGINKGQVVSQGVQTQTLQIALLASLKATVDCVTAFAETDFRPDMAKIDVPTLVIHGDGDQIVPFETTGKVAAELIKGAELKVYKDAPHGFAVTHAQQLNEDLLAFLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title L29I Mutation in an Aryl Esterase from Pseudomonas fluorescens Leads to Unique Peptide Flip and Increased Activity
rcsb
source organism Pseudomonas fluorescens
molecule tags Oxidoreductase, hydrloase
molecule keywords Arylesterase
total genus 105
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.2: Arylesterase.
pdb deposition date 2011-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3t52A00
2XQKA 3ZV7A 4U2GA 5CTAA 1CUIA 3BWXA 4BCCA 5K3FB 3R3XA 5AI6A 4CIBA 3QYJA 2ZVDA 1WCYA 3H2IA 1LPAB 2XUPA 3H17A 1ODTC 1TIBA 5T4HA 3ANSA 4PSDA 4BP9A 1THGA 3GUUA 3I2HA 3IBTA 3A2NA 2OLEA 3SK0A 3DL7A 3OC0A 4AO7A 4B80A 2OGTA 4J0GA 5AM2A 2GZRA 2XMQA 1KU6A 4FHZA 1BEZA 1C7IA 1JKMA 3VJKA 3O95A 4KJXA 3NGMA 4RE6A 3STWA 2R8BA 1EVQA 3G0BA 3WL5A 1LZKA 2HA6A 2Z8ZA 1N5MA 3EQ9A 3WKEA 1CUJA 5E4TA 2YASA 1L7AA 4LHEA 5KWJA 5A7FA 2PUHA 1ZD4A 1XZKA 4UBJA 4CFSA 1HQDA 5CH3A 4BCDA 4NVRA 1HLGA 5LZ7A 2ACKA 2QTBA 5FPQA 5D7BA 4FNGA 1VA5A 3WL7A 5JAOA 4I4CA 4OYYA 5C8XA 3T52A 3WQHA 3D7RA 1FFBA 2RI6A 5LZ5A 3OM8A 1G4HA 5AK3A 1QLWA 2EEPA 3OTQA 5LZ2A 4ZV7A 2WKWA 4PSUA 1CUEA 5AM5A 5HZGA 3DDUA 3W06A 3MUNA 2HADA 2XQFA 1TQHA 3H04A 3GZJA 2CEKA 4HTAA 5CT6A 5JZ9A 3WK7A 1G66A 5CMLA 1U4NA 5CH8A 1EDBA 3BL8A 4BDSA 1N5RA 4HXGA 1J2EA 5AK4A 4K6HA 3ESCA 1G42A 4OB8A 1QO7A 1QOZA 4BRSA 4HS9A 3G02A 5AK5A 2QUAA 2RHTA 2FX5A 2GBIA 3I2KA 4NS4A 4GI1A 4J0CA 1R9NA 1AQLA 1J1IA 1H2XA 3A2LA 5JD4A 4Y2QA 3AJAA 4FLFA 1P0IA 1RWQA 3MVEA 2X8BA 5JYCA 3HYSA 3H2KA 1H23A 5I8PA 1P0QA 1S8OA 2OGZA 3JWEA 4TVKA 5JAPA 3TJMA 3H1AA 2H7CA 4H7JA 4KE6A 4LYEA 1QIHA 1UXOA 4GECA 2AJCA 2YH2A 1QTRA 2WUEA 5KWIA 1ACJA 1EA5A 1UKCA 5HF5A 3QBJA 2WU4A 4CIAA 1O6GA 2QVBA 2ZJ7A 3DOHA 3WMRA 2OCLA 2JEYA 2ZJ6A 5T4FA 3RKSA 1ZIYA 1UK7A 2C4HA 1LPBB 3JW8A 2J3DA 4KE9A 3CXUA 5EI5A 4HRYA 5CBKA 1YASA 3AIKA 4MQLA 3RK4A 1CIJA 4ARAA 1U65A 2ZSIA 5CH5A 5AKLA 3GROA 1UOOA 2XUFA 3DOIA 4FFVA 2OAGA 3NUZA 4BVKA 4LXHA 3WYNA 5C8VA 2ACEA 2J4CA 3GBSA 5ALHA 1ZI8A 1MJ5A 2DHCA 5ALRA 2WHQA 4G4IA 3UUEA 1ZOIA 3EF3A 4XWGA 2NW6A 4BRZA 1P0MA 2BCEA 5AOCA 4QLAA 5D3ZA 4G9GA 2VA9A 1C4XA 1R3DA 1LPMA 4UUQA 4UFOA 4XX1A 4Y2RA 1XZFA 3DJYA 4BAUA 4G5XA 1VJ5A 5J3JA 1M33A 4X92A 1YA4A 4DLNA 4E15A 3AZPA 3ICWA 3G9TA 3D4LA 3OG9A 4NMWA 2QOEA 4HZGA 5ALXA 1CEXA 1TCAA 2VSQA 1EXWA 3QPAA 2VT7A 1DWQA 3Q0TA 1CUYA 3FSGD 6YASA 1YCDA 3HZOA 2D0DA 5HFNA 5ALUA 5HF9A 3L1JA 1J07A 3F97A 1F0NA 1FJ2A 3A2MA 4QNNA 2XQJA 4DSZA 5A7GA 5ALMA 1HL7A 1LPPA 2PX6A 4MQMA 4X3CA 3QITA 1XZDA 3WZMA 4BVLA 4BE9A 3ESBA 3TEJA 5BWCA 3V48A 5BWBA 2VEOA 4Q3OA 3WWOA 4U2EA 5AI9A 3QMVA 3F98A 2HHAA 1UKAA 4EZIA 3KD2A 3F96A 5DYWA 1DT5A 4MEBA 4H7KA 2Q0XA 4MYSA 4HXFB 2XQGA 1XZBA 4B83A 3HEAA 1YSCA 4OPMA 3V1NA 1SCIA 1XKLA 4B7ZA 3IUJA 1QIDA 1XQWA 2GBFA 5DNUA 4DTCA 5HF6A 1SFRA 4TGLA 3WKDA 4UFNA 2HM7A 4UBMA 1DWPA 1QFSA 2H9YA 3C43A 5F4ZA 2W22A 4ZV9A 3PUIA 3QH4A 2OPHA 2BGNA 4B84A 4QEKA 4RNCA 3C8HA 4U2BA 2UZ0A 4EHBA 1WHSA 1ZICA 1WPRA 4QWMA 2JGMA 2XMBA 4UBIA 5LKRA 4QA9A 2BUAA 3M83A 2ONCA 1H22A 2OCGA 3RLIA 3D2AA 1CFJA 1E5TA 4C89A 1XQXA 1A7UA 5ALJA 5EFZA 3FLBA 4OSEA 4AZ3A 1DINA 3LIPA 1NX9A 5ALOA 2VTVA 3AINA 4LXGA 2JGFA 5K3BA 4C6HA 5AKKA 1W4LA 5HFAA 2WLSA 1TCBA 4GWLA 5A7HA 3K6KA 3IUMA 4UFPA 4UHEA 2O2GA 4H0CA 1CUWA 5A71A 1DWOA 1WHTA 1PV1A 1GQRA 4DMHA 4BAGA 1JI3A 3FYUB 4P08A 3H19A 1CUDA 3G0GA 3HI4A 1CR6A 1AC5A 4OB7A 1DU4A 1R88A 4L3WA 1IVYA 3UMJA 4Q05A 2B9VA 4ZXFA 3I2GA 2WJ4A 4C4ZA 4C4YA 2BKLA 4HRXA 1EH5A 1MX5A 2HFKA 2HDWA 3OPMA 3R3ZA 3FVRA 1FFCA 5E4YA 4YX9A 3BE8A 2VJDA 3BJRA 4J0IA 3RARA 1XQVA 3UUFA 4KACA 3O0DA 2ZYHA 1MAHA 4TPKA 3H2GA 1WM1A 1QIIA 5ALLA 4PO3X 4Q3LA 4CCYA 1CUBA 1XROA 2G5TA 4JYMA 3SX4A 1W1IA 3HC7A 3R0VA 2WM2A 5BOVA 5EIEA 3BJMA 1K8QA 2WG0A 3LP5A 2VJBA 1QONA 2HU7A 1C7JA 2V97A 2QZPA 4KAAA 4AZ0A 4N8SA 3D59A 4JNCA 4B9EA 4EY6A 2VATA 1Q84A 4X95A 5FLKA 2VJCA 3PICA 1XQYA 3KDAA 4BE4A 4CG3A 3WWDA 4C88A 5IVIA 1IUNA 1PFQA 4XIIA 2H7YA 4CG1A 4V2IA 3IB3A 1MAAA 3BF7A 4ROTA 5IKXA 3WK5A 5AI4A 1AURA 1MT3A 1X2EA 4M0MA 5DYYA 1R9MA 5KREA 4WY5A 5ALSA 4AMZA 4W1PA 5SYMA 2HA3A 3G0DA 4AO8A 2CZQA 2JGLA 3AILA 5AKGA 5JZBA 2B20A 5EIAA 3IIIA 1LLFA 5ALFA 3R41A 4CCWA 4DGQA 4ZREA 5YASA 1FFAA 5CT9A 5A2GA 3BXPA 2XB6A 3STYA 4OU5A 2G63A 5AKIA 1JJIA 3G9UA 1EB9A 1XZHA 3DEAA 3P2MA 2GBGA 5JARA 3WWCA 3W9UA 3I2IA 2PL5A 1HKHA 1MN6A 4J7AA 2QRUA 4OD0A 4Z49A 4H7FA 1XRMA 4EB0A 1UKBA 1X70A 4KAFA 2XUKA 1CUSA 5AHXA 2ES4A 2QM0A 1ZI6A 3AIMA 5CURA 5AKYA 4ZGBA 3W05A 2WFMA 1WPXA 3STUA 4M0EA 5ALEA 5AKJA 3DL4A 1LBSA 3ANTA 5JASA 4GBGA 4IHAA 2HU5A 4OU4A 4X91A 5AOBA 2QS9A 3C6BA 1ZD5A 2X5XA 2V96A 3KWJA 3WJ1A 2PUJA 5C81A 3KXPA 2Z3WA 4X85A 3O4IA 2CUTA 1MO2A 3ICVA 2Y6UA 3FOBA 4B0OA 2GZSA 3FYUC 3G7NA 3DLTA 5AKHA 3FYUA 1HPLA 5ALVA 4EA6A 1GXSA 1T2NA 2QXTA 3I6YA 5CT5A 1DX4A 2PSHA 4KE7A 1UK9A 2C5GA 4G8BA 5HQ3A 1XLUA 3FCYA 3LIIA 1QIFA 4Q82A 1E3QA 4A5SA 2QJRA 1Q0ZA 1YS1X 2XUDA 4QDOA 1YR2A 4F0JA 1JMKC 4J0JA 4UBLA 5SYNA 5AM0A 3OOSA 4AB1A 1DTEA 1VZ3A 1BN7A 3QPCA 1CQWA 3R40A 5EHNA 1EDEA 4YK7A 5K5EA 4Y2TA 2VJAA 2G5PA 1N1MA 3BDIA 1BRTA 1KU0A 1LBTA 4BC0A 4RE5A 3ZWQA 3E0XA 4H77A 3C87A 1TAHA 2XUJA 1YA8A 5AI8A 5K3FA 2VQ6A 5T4BA 2CB9A 2XMGA 4J3JA 1QZ3A 3DS8A 4BVJA 2EDCA 1GPNA 4HXEB 3PF8A 1W76A 3ILSA 3HXKA 5AI5A 4GW3A 2PU5A 2ZYSA 1LZLA 3IDAA 2VT6A 1GQSA 4G9EA 1Y7IA 1MX9A 1MNQA 1QIGA 2JGKA 2WUFA 4FDMA 4KRXA 3V1LA 5ALPA 5ESRA 1VE6A 4WFKA 1FFEA 4I19A 1SCQA 2AJLI 3D0KA 3G0CA 1DQZA 5ISMA 3CN9A 4OUKX 2OQIA 2I78A 2JGJA 5AOAA 3STVA 4EUSA 3FYTA 3F67A 3KWFA 4U2FA 5CT8A 3GA7A 5ALKA 3WL8A 3B3QA 1EI9A 4Y2SA 3G8YA 4X7BA 3DCNA 4H7IA 2Z3ZA 3F9CA 4DM7A 5LZ9A 4B85A 5E4JA 1BCRA 3V1KA 3I6MA 1L7RA 4FOLA 2WTMA 3WWEA 3DKKA 1U2EA 1BU8A 5D6OA 4AX4A 4N8DA 4WY8A 3WA7A 1UFOA 1XRRA 1SCKA 4F60A 3B5EA 4DMKA 2WFLB 2ROQA 1L7QA 4B81A 3DKRA 4IQ4A 5CRIA 1HDEA 5IVHA 1XZMA 5BV7A 5AM1A 2ZSHA 5T4EA 2O7RA 2P8SA 3C70A 4WFIA 3QZUA 3BF8A 1RYYA 1IUOA 3D3NA 1USWA 4MWTA 2DSNA 4B82A 1SOMA 4X97A 5C8ZA 3WIOA 4J0KA 4QLOA 3NWOA 1UK6A 4DSAA 4Y2UA 3I6ZA 2BJHA 1ORWA 1CVLA 1XRLA 1E8MA 4Y7DA 3VJLA 4IH1A 3W9BA 4Y2PA 3V1MA 3HABA 1VA4A 1GGVA 3WKBA 5AP9A 2PSFA 1EK1A 3WKCA 1XRQA 3CCBA 4LIPD 1F8UA 3ZLVA 5IVKA 2R11A 2D5LA 1LGYA 2I3DA 5JD5A 1YAJA 3WI7A 4Q1VA 3E1GA 2BGRA 4X94A 1QFMA 2JF0A 4DNPA 3WK8A 1O6FA 3I1IA 4KE8A 3BDVA 3TGLA 4ZI5A 1QE3A 4QDUA 4H7EA 4U2CA 5HF8A 1YB6A 2WUGA 4GHWA 2HL6A 4BZWA 1QGED 4D9JA 5A62A 4C01A 3QMWA 4FMPA 1AUOA 4DNFA 2Y2VA 1K4YA 1CQZA 5LYYA 3C45A 1FFDA 2LIPA 2CKMA 1YAHA 5K3DA 3VISA 2WHPB 1CV2A 1K63A 2PSDA 3WK6A 3QMMA 4OB6A 4BYMA 1CLEA 3M82A 2CJPA 3QPDA 4F21A 4PQEA 1ZD3A 1A8UA 2WSLA 3I2FA 1F0PA 2AJBA 2WJ6A 5CXXA 2WG1A 3SC2A 4W1RA 4BCBA 4GXNA 3MUOA 5JADA 5JD6A 4UHHA 2WQZA 5CXUA 2J3QA 3ESDA 1TK3A 4GEGA 3FWHA 2Y2UA 1BE0A 3TRDA 1UK8A 4H35A 3WLAA 3DD5A 4UHFA 2HRQA 3O4JA 4AMYA 3H2HA 2C5FA 2QUBA 3IULA 4N8EA 2C58A 1EDDA 4AN0A 4BATA 3Q8WA 5DYTA 4K5QA 2RONA 4AO6A 2XI4A 3D2CA 5ALGA 4Y9SA 3E4DA 2XMSA 4ITVA 2WFZA 1EK2A 1F6WA 2B4KA 4JUIA 2DFPA 1R50A 4QDXA 2XLBA 4H7DA 4PF1A 3JYHA 2OGSA 3LS2A 3WA6A 1T4MA 1VKHA 4YASA 4J03A 1BN6A 2XLCA 3ED1A 3C5VA 3HLKA 4WDRA 1ORVA 1CUFA 2WIFA 2BFNA 2WILA 1ZGBA 2Z5GA 3WIBA 3C6XA 3R3YA 3L1HA 1P0PA 4FFWA 4MJ3A 1IUPA 3EQ8A 2HFJA 2Y6VA 1THTA 3BIXA 5ALDA 3U0VA 1ZI9A 4F5ZA 3E3AA 4E46A 4DNOA 4E14A 2HA2A 5LLSA 1OCEA 5IH7A 5FKJA 1XZGA 4S0XA 4W1QA 2HRRA 5LKAA 2WIJA 3G9XA 1Y37A 3STTA 5I7UA 4BAZA 5AO9A 3FVTA 3H18A 3K2IA 3O9VA 1MX1A 3FAKA 2JBWA 3H1BA 2HA7A 4WJLA 1Z68A 5CW2A 5JIBA 4X71A 4Q34A 1K6EA 1TRHA 1XLVA 4FWBA 1UZAA 4Y2XA 4ZWNA 4QWWA 3WL6A 1MU0A 4B9AA 4EY4A 4DMFA 4G4GA 3G9ZA 4UHDA 2AJDA 1IZ7A 1Q83A 1GT6A 3BIWA 2QXUA 1ETHA 1CUZA 2AJ8A 5LZ4A 1DQYA 1A8SA 3DNMA 2HU8A 1CUXA 3V9AA 4AXBA 3D2BA 5DTIA 4K2AA 1EVEA 4G8DA 5ALYA 4UPDA 2V98A 3AFIA 4KYVA 4PW0A 2V9ZA 2VAVA 4X93A 3VVMA 1R1DA 4EY5A 5IVDA 1ZIXA 4MWSA 3R3WA 2RAUA 5A6VA 1ZD2P 2XMDA 1WB4A 1W75A 3VXKA 4QE3A 4A16A 3WYDA 1XLWA 1CUCA 2XUGA 1HBJA 3I28A 2PPLA 5AM4A 1X2BA 3PFBA 5ALZA 4P92A 4M0FA 5EGNA 1VE7A 1AMNA 4H7HA 2HIHA 2XUQA 2EDAA 1YS2X 5AJHA 2C0QA 1IZ8A 1EINA 4QZVA 2DHDA 4X6YA 5LIPA 1SC9A 1Y7HA 3HSSA 4C87A 3C6ZA 4J0DA 4MEAA 2FUKA 3DYVA 1DX6A 1XZCA 2XMCA 2DCMA 3VVLA 1EHYA 2OAEA 4G8CA 5AM3A 4ETWA 1R4ZA 5JANA 3IUNA 4B0PA 3N2ZB 5FUMA 4FLMA 3FLAA 5FV4A 4FKBA 3ZLTA 5I9IA 4OCZA 1XZJA 3ZLUA 1QIEA 1BROA 1MPXA 2QR5A 3IVMA 1VXRA 2XUIA 4L72A 1RP1A 4P93A 4KR0A 3M81A 1VOTA 2RGUA 4UBKA 3S2ZA 2C7BA 4BTLA 2GYUA 4IO0A 3HRHA 4Y2VA 3VJMA 2HA0A 3FBWA 1QIKA 1OILA 5LP1A 2WHRA 2PM8A 2OCIA 3EBLA 2IITA 1CUAA 1VXOA 3R3VA 4N5IX 2QT9A 1LPSA 5HK8A 2JGEA 4XVCA 3QVMA 2WUDA 3DYIA 5JAHA 4HAIA 1GKLA 3AZOA 4WCVA 5EHQA 4FLEA 1XRNA 3WKAA 3C8DA 4AN1A 4DIUA 4RGYA 1GPKA 2YYSA 3GELA 2X76A 4G4JA 2PSEA 3MGAA 4UHCA 1N8SA 1LPOA 3KSRA 5H3HA 4CI9A 3GFFA 2O2IA 4EY7A 5K3AA 4WDQA 1W52X 3U1TA 3I1YA 3VDXA 4AQDA 3IURA 2XUAA 3PF9A 2YXPX 4BP8A 5HK9A 3X3HA 5FPPA 1H2ZA 1JFRA 2AXEA 4K6KA 2Z8XA 2XUOA 4X00A 1XFDA 1MNAA 3ZPXA 4IH4A 1H2WA 2RHWA 5AI0A 2FJ0A 5JATA 1GZ7A 2DQZA 4INZA 2WIDA 1D07A 2GBCA 2WJ3A 3K9BA 4MXDA 1ZJ5A 5KBYA 4W63A 5ALQA 3N0TA 4DNQA 1ACLA 4LYDA 3LCRA 3I2JA 5D3KA 1XKTA 2RIPA 3FCXA 5JZSA 1QIJA 4X6UA 1TKRA 1NU6A 4BB0A 3A70A 2VF2A 5JAUA 2H1IA 3AIOA 4Y2JA 2XT0A 4IH9A 1CUUA 1JU3A 4YPVA 2DR0A 3H2JA 1K5PA 4KEAA 3G0IA 4JEIA 4MYDA 4LKOA 3PI6A 1FSSA 2OXEA 4BZZA 2PSJA 5CT4A 4X90A 1UWCA 4PV7A 3ZI7A 2WG2A 2JEZA 2OCKA 5FP0A 5AICA 4UBOA 3KOOA 2K2QB 3W04A 3HACA 4DMCA 2E3JA 1QTIA 4OYLA 4ARBA 3LLCA 1U8EA 4CG2A 1XZLA 4W9RA 5ALNA 4GDMA 3L1IA 4BBZA 3C5WP 2WIGA 4EY8A 3O4GA 1CRLA 2QJWA 5FOQA 4GLBA 4QDZA 1YB7A 4H18A 1E89A 4DYHA 2CMFA 1B6GA 2ORYA 1J06A 2DHEA 2Y1KA 1A8QA 4XJVA 5K3CA 1ZGCA 2XMRA 4QDTA 3PFCA 2VAXA 3HJUA 1GKKA 1LNSA 5ALTA 4FBMA 3SWWA 1CUGA 5DTJA 4X6XA 1JJBA 3PE6A 4PSCA 1QIMA 2ZJFA 1OXMA 1WB6A 4B6GA 2ZYIA 4UBNA 2QKYA 2JGIA 4ZRDA 2HA4A 1QJ4A 4J0HA 1UOQA 5AIBA 3NOXA 5ALWA 4RPCA 1E8DA 5JALA 2BUBA 3CN7A 2XUHA 4L0CA 4C4XA 7YASA 5DNVA 4I3FA 1GPLA 2HA5A 5FXMA 4KAJA 3EQ7A 1ODSA 2WFLA 2GYVA 5E2IA 5HKAA 1QO9A 2XQIA 3WK9A 1JJFA 1NU8A 1IMJA 2I3ZA 3AUKA 2BAGA 5AK6A 1BCSA 3EIOA 4P9NA 1G5FA 1LPNA 1UT6A 2H7XA 1BS9A 2FJPA 5DJ5A 3WJ2A 4JH0A 2BUCA 2IIVA 5LZ8A 5EIHA 3DQZA 5C7YA 1E66A 1XRPA 1DT3A 3B12A 5HKBA 3H0CA 2ECFA 5FRDA 5EHXA 5FDFA 4HVTA 3WK4A 2I03A 4U2DA 1B41A 3WZLA 3ESAA 1WOMA 4BC1A 2W6CX 4LXIA 1JMYA 1I6WA 2J4FA 1TCCA 4E11A 3A6ZA 3RM3A 2ZYRA 5AH0A 1BEEA 4NZZA 4CCYB 2B61A 4FBLA 2PKYX 3PDCA 5HQ3B 4EBBA 1KEZA 3STXA 1XZAA 3W2TA 1JT2A 2O2HA 2CBGA 1VLQA 2WU3A 1AX9A 3D5EA 1AKNA 2PU7A 2XDWA 3T4UA 2WTNA 3FLEA 1Q0RA 3F8SA 4FTWA 1ZJ4A 1VZ2A 5AKZA 1EB8A 3FSGA 2OQVA 3IA2A 4PNZA 2OG1A 5AIAA 1WB5A 2C0PA 3VKFA 3OURA 1EX9A 4JYPA 1AZWA 3R3UA 5HCUA 3O4HA 1ODCA 1AGYA 2XE4A 1UOPA 1A88A 1W6RA 3QM1A 4O08A 5AKXA 1CPYA 3S8YA 2DQYA 5DWDA 1XZEA 4Q3KA 5ALIA 1JU4A 4G1FA 3YASA 5DNWA 3O9MA 1PJAA 4Y2YA 4W1SA 1E8NA 4L9AA 2IX9A 4A23A 3M3DA 4N5HX 2PBLA 4BDTA 4WFJA 2WHPA 3AZQA 4FNMA 2WIKA 3CCCA 1CUHA 3FNBA 1MTZA 5DLPA 2G4LA 1CUVA 2JIDA 4K6GA 3WWPA 2GYWA 2PVSA 2O7VA 3IUQA 5AKEA 2QMQA 3C6YA 4BTVA 1ISPA 3PUHA 1XZIA 5K3EA 4KRYA 1H2YA 2XMZA 5EHZA 4UHBA
chains in the Genus database with same CATH superfamily
4YRBA 4RZXA 2BCGY 1F51E 2HPVA 1MZVA 1DRUA 1Q1EA 3OECA 3MF4A 3B7PA 3ON5A 4MWCA 2YHBA 4H6WA 4KW7A 4DIOA 1CUIA 3NRCA 1N2SA 5ED0A 4D41A 4TVSA 4YAFA 5DHUA 5K3FB 1E77A 2CHQA 3HS3A 1R9GA 4W8OA 3PZBA 5HKOA 2ZVDA 3S2IA 1PJ8A 1W46A 5BWNA 2SECE 1WCYA 3NXKA 1Z74A 1XTPA 2WUVA 3HV0A 1O3YA 2H63A 3IVAA 3M3HA 1JSXA 5J4KA 3K1AB 4GL4A 3RR2A 1ODTC 2BMAA 3I32A 2O0LA 2ZZNA 2PA3A 3LHSA 5CLGA 3QLEA 4INJA 5T4HA 4Z3DA 1L0BA 4LWQA 3AIIA 2HOQA 4YA6A 2IKQA 1GPJA 3VR6D 1I1HA 3A3KA 1A27A 1DG9A 4P58A 1THGA 3FDZA 4IQ0A 2DFLA 4ALNA 2RH9B 4W5JA 1W1WA 2C96A 4G23A 2GNAA 3A2NA 4ZEXA 4WXHA 2VDPB 3BFPA 3UATA 3FW1A 3OC0A 4B80A 4R1PA 3GX1A 2D0OB 4L4ZA 2C3PA 3BMOB 3KZXA 1P7CA 5KOHB 4RVHA 4FHZA 3N3BC 1IMOA 4W7IA 2WD7A 3QKRB 1C7IA 4RACA 2BDTA 3ER9A 1JHQA 2WSSA 3WNDA 1F1JA 3GCXA 3PSAA 4HYEA 2GBLA 5FTWA 1X1CA 2R7LA 4GR5A 4V38A 2HF2A 3VKGA 1OU4A 1KPIA 2R8BA 5IBRA 2YN2A 2D6FA 1Z29A 3ZQKA 1XA3A 4BNJA 1R74A 3G0BA 4E22A 4N0DA 3TEMA 2Z8ZA 2BVNA 1RCUA 2QTWB 4V0RA 2V7QA 2WAMA 3QY0A 4HCJA 3TLGB 3WKEA 4C1NA 4TRMA 5LMCA 5LMZA 2O20A 4KDFA 4O0MA 2AFVA 3T7JA 4BLQA 3RHSA 4GVLA 1A9SA 2P0AA 3KL4A 3OWHA 4MQ5A 5DRTA 1ZD4A 4Y9TA 2C0CA 4LQ4A 4XLZA 4Y67A 4E5PA 2OSBA 2VAMA 4ZI7F 1YCHA 3UJNA 3QKSA 4NARA 3TQOA 2FVXA 1BHO1 2QTZA 4XSVA 4EVQA 2X8LA 2XZDA 2E89A 4UASA 1MEEA 5FNVA 4MINA 5FPQA 3EIFA 1J70A 3NHLA 1AN9A 2PH3A 4L22A 5IKOA 3KO8A 4IOJA 3MTDA 1IK6A 1H0RA 3X44A 2ZTVA 1P2SA 4FDAA 2CK3A 2X23A 3WL7A 5HE9A 2AL7A 1INLA 5TDHA 1RCFA 2YZMA 2KHZA 5BN4B 1J5PA 1NR5A 3OF5A 3S1AB 3WGLA 1NM5C 4MQ4A 4NATA 1R8YA 2GCOB 2O0JA 1WNTA 3DBHA 5E95A 5LC1A 1KRHA 4FDUA 3TMYA 1SCNE 4N41A 4PLHA 2AB0A 3J7AC 3ET4A 1KIMA 3GNLA 2CSUA 2FG5A 2Z56A 1YULA 5HBRA 2EEPA 1SVNA 3GP5A 5LZ2A 4ZV7A 4DS3A 1EJ6A 2WKWA 3NVMB 4PSUA 4QUGA 1BRMA 1CUEA 4L9SA 5IJXA 3OPXA 2EATA 4OGKA 3IL2A 3R5SA 1FX0A 2DR3A 4QBKA 4UHKA 4XM2A 3W06A 3QVUA 2D2EA 4GZ5A 3AJRA 3IBFA 1M2NA 3TQHA 1HC7A 2CNBA 3WGJA 2FEPA 3SCZA 3EDCA 2HADA 3P2KA 4DF3A 1FXSA 4MVJD 1JSCA 4NH0A 3VYSB 1M67A 1TT5B 4N3CA 4HDSA 1VI2A 1NWCA 4PIMA 4EZEA 3ROPA 3N6VA 5IRCD 5CPFA 4NYIQ 2NMVA 5J5VA 4MV6A 3S29A 5IJ9B 1XYYA 3CPSA 5CT6A 2GM4A 3KQKA 3GGGA 4FEAA 1G66A 3DMTA 3DONA 1P5JA 4AYXA 3T3IA 4OH7A 1BXRB 4WKOA 3BL8A 5CH8A 1Y1RA 4X0EA 1SU4A 2IYXA 5EJ5A 4WBXC 3ETEA 3NTQA 1C2TA 4KP7A 1J23A 4K6HA 4ML3A 3V2GA 1JRLA 1TOAA 1WY5A 2O2XA 4R2HA 5LUAA 3BGVA 3QTTA 2O06A 1MCZA 3AP2A 1V2HE 3FGZA 4RIGA 1T0PA 3TMKA 3ESCA 3LYHA 3OLWA 4CUKA 4F6RB 4U8HA 3MGCA 5F7ZA 5K8IA 5CXQA 4BRSA 1NVAA 3PXXA 4CIVA 5HMMA 2J0VA 3G02A 1KY2A 2NZJA 3R6WA 3MQ4A 1NY6A 5E0KB 4IIUA 1DXOA 3MD9A 2GD6A 3SU8A 3WLHA 5AK5A 3LGAA 4GRDA 5EWLA 4R3UC 1BDJA 4DG9A 1X7ZB 3KKKA 4YFVA 2FX5A 1KK2A 2GBIA 3PD7A 4QEZA 1O96A 2J7PA 3LRTA 4PX9A 5GJVC 3V8QA 4CKWA 1T5HX 4J0CA 2G4VA 1AQLA 2ID9A 3NR2A 2REXB 1XF1A 1I5RA 4I6GA 3PFGA 4O29A 5IM4F 4DV2B 1H2XA 1E1MA 4J6EA 4G5FA 2EWMA 4QHYA 2H2WA 2FPRA 3AHCA 1ZN2A 3FOEC 3ER8A 4U63A 1KAGA 1L7BA 1ZNQO 3E84A 3H05A 1NDQA 2WD7B 3W5VA 4DR7B 4DLUA 1W25A 3PC6A 4Q47A 1R8SA 2OV3A 2AZTA 2P91A 1H23A 3BXOA 3C97A 1T5OA 3NB0A 2QLNA 2O4UX 3K72B 4NDAA 5F21A 3QVKA 3VOTA 1N5LA 2OHFA 3HL0A 4TVKA 4B6SA 5KYYA 5DDIP 4C5CA 4DBLC 1VFPA 3HYCA 2H7CA 1FY2A 2ZS8A 1OREA 2ATIA 4X20B 3CZAA 4BUJA 4FZ3A 2DBRA 3EDOA 4UW9A 3N2GA 5HX7A 1HE3A 1XJ0A 2VHCA 2OC9A 1NUPA 5MGBA 1UZNA 2X7HA 3LCMA 3NTXA 4JEHA 2Q3BA 5K0ZA 1F20A 2B4YA 4D9GA 1LJLA 1NW4A 3LJKA 3UOAB 2QW1A 4KMRA 3Q98A 4RETA 5BWMA 1EK0A 1W4AA 4Z7OB 1EHIA 1W8DA 4ENWA 2FCAA 1M7GA 2E49A 3VV2A 2DLDA 2J9GA 4RPGA 3BSSA 4HI0E 4TLAA 3S44A 3JAKB 4TMYA 5FBKA 5BN5B 4AZSA 3QBJA 1KE1A 1D3AA 5KJ1A 3LC1O 2WU4A 1DFIA 3B70A 4Q48A 4RCYA 2NUTA 2ZBEA 3JQ8B 4ZEMA 4A82A 2Y1EA 4D6PA 1PZHA 3ABIA 3O8CA 5GM2A 3DDZX 1X7YB 2MTBA 4B35A 4Q1BA 1Y33E 2ZLBA 2Z5VA 4XRGA 3FOZA 5D3MB 4ZOLB 1ZCBA 2AYXA 3WMRA 3QVGA 2FW6A 3AM4A 2FAXA 1NVGA 4EA9A 3CWZA 3K16A 4O4JF 3U40A 2VBCA 3VDRA 3IPAA 1OZHA 2WT8A 2J3IA 1Y3DE 1ZIYA 5G1NA 2JFXA 1ST3A 5I7AA 3V8PA 4G0XA 3JW8A 2HYDA 1QLJA 1SBNE 4NMMA 1P72A 2UUOA 1A97A 5G0TA 5KDLA 4GQIA 1YASA 3VYUB 3AIKA 4GOOD 4YQYA 3W1VA 3WP0A 3T1QA 4MQLA 3GCWA 4UOEA 4QYWA 3OPVA 5KJCA 5JBNA 4ARAA 4EMBA 4NJEA 2OYSA 5I47A 2ZSIA 4CN9A 1SXHA 4LXXA 4S1TA 3GMSA 1JGTA 1M1NA 2P3QA 4H1HA 2I65A 1SQSA 1UOOA 3O1JC 3NALA 1P74A 1QV9A 4PAQA 3DOIA 5LP6B 1NBHA 1I7SB 2V1XA 3PC8C 3R0XA 4MGKR 4IZ6A 4YJFA 2C54A 3LT0A 1JR3A 1WUYA 4EELA 5FR2A 2YY5A 2QJTA 3ZH9B 1CS4C 2C2KA 1DQNA 4A2CA 5C8VA 1X0VA 2VYND 3J81k 2VRWA 3OSUA 2YVQA 4NE9A 4ZJZA 2CGEA 3JPYA 1MJ5A 2PS3A 3DOCA 3EMKA 3QVSA 4YO8A 1ZSYA 3K4PA 4H60A 3BKWA 4HX2A 3E35A 4BQIA 1A76A 1PQYA 1UDCA 2BN4A 3GLQA 3HGTA 4UU7A 5F2EA 4DEXA 2COKA 3UUEA 2YOHA 3HB1A 4I5EA 1VL0A 3OE1A 4J76A 1TVKB 3L4SO 1B2RA 2A35A 1RJFA 1P0MA 4R1NA 3TZHA 2WJAA 3NW9A 4CMEA 5AUPB 2C9BA 4XD7A 3QEBZ 1WCXA 2YV5A 1AGNA 1A71A 4BXOB 2AQKA 3K0KA 4RJTA 4MW9A 2NNWB 2DTEA 4I9UA 3RS2A 1Z3IX 2AZDA 1SXPA 3G13A 2HSJA 1LPMA 1OMOA 3ELUA 3K0AA 2G9NA 3RU3A 3HBAA 1O87A 3P19A 4MKXA 5L3SA 2PS9A 2XA9A 3P9SA 1Q17A 3B8HA 4FDVA 1HE4A 1HOTA 1USUA 4Y2RA 2NZXA 4H6VA 3AI2A 4FT2A 4O4LA 4F8YA 5B7GA 4MA0A 3RJMA 3DJYA 4BAUA 2Y1LA 3VKHA 1EFPB 4YRFA 1X7WB 2Z2XA 3HA7A 2RBKA 4G5XA 4NSNA 2HWXA 1Z13A 2FGKA 3GLVA 1CR2A 2J8ZA 2OD2A 5JQWA 2P2ZA 3QX7A 3ML1A 4DLNA 4WESB 5JVDF 2R44A 1T2FA 1VKNA 3FYCA 3DXXA 4OG2A 4HWSA 3VAYA 1RRVA 1SXJC 3D4LA 2NWQA 3OG9A 4M1SA 3T9BA 5EJ6A 1YFLA 5J1SB 1PJ4A 2X4LA 5DOVA 2BFWA 1KFJB 1TCAA 1OX4B 1JP7A 4RX1A 1REQA 3Q0TA 3V4VB 1H5QA 4P54A 2GT1A 3FSGD 3N7TA 3P45A 4H9GA 5TJ9A 4WINA 5IYZA 1EFPA 1YCDA 3F4LA 3HZOA 1ZM7A 2X2OA 3EASA 5G0WA 4CKYA 5M7EA 1QRTA 5B58C 2XV1A 3NIDB 4BFYA 1P9NA 2EKBA 5EERA 3VA7A 3LXUX 1S7CA 1UBSB 1ZH2A 3A2MA 1TJ4A 4MPPA 4BWGA 1RPTA 1M73E 2XQJA 4DSZA 4GE0A 3IMEA 4GBED 2AOUA 2NU8A 4BEBA 3BMNB 1RWOA 1LPPA 1Z08A 3T7SA 3OZRA 1J2JA 4JLBA 5MF6A 1P2GA 5M2QA 1QLHA 2F3PA 3GLHB 1UJ4A 3CGWA 3DHYA 3HYTA 3QITA 4HQNA 4MUXA 4ZALA 3SF8B 4ENRA 3QU5A 3P0JA 3CFYA 3MMPA 2Z0MA 3WZMA 5GIPE 2WF9A 2CUKA 3GEIA 4RQBA 1CFZA 3IAFA 4YREA 5JSUA 2D54A 4BE9A 2I4MA 4CQLA 1AQUA 2P6UA 4JODA 3ZU4A 5BWCA 5BWBA 2VEOA 3MOGA 3ZWVA 4DC9A 3R9IA 5DRYA 3AQIA 1ZLXA 4RESA 1BFKA 5AI9A 4RZUA 5EIBC 4MR7B 1QQ6A 2R1TB 2HHAA 1UKAA 4RFVA 4YCDA 3WGUA 2HCRA 2MHCA 3F96A 3KD2A 2ETVA 2HWKA 1A8PA 1SCBA 2HIMA 3U19A 1C1YA 2GLXA 4H7KA 4UAVA 1GTJ1 1EFAA 4MUFA 4JR1A 2Q0XA 4RGVA 1JHDA 1C0EA 4NOLA 3PXBA 1V4NA 5KOJA 3RYHB 1DRJA 3HFSA 4R4JA 3SNKA 4XAQA 4N3GA 5I8ZA 3SGLA 4PTLA 1P5HA 1QQ5A 1LS6A 1QQTA 2X9VA 5DLEA 4F2GA 4MW2A 4WNYA 1CU1A 2NLOA 3U4MA 1NVKA 4MGZR 1XKLA 3NM5A 5JNUA 1QIDA 2DCUA 3V2UA 5CEJA 1OH6A 4KQHA 3BGIA 1JBQA 1JQKA 3BK7A 2D5AA 3OZBA 3ZC3A 1N25A 3DDHA 2HT1A 1SFRA 1Y3IA 2X14A 2ZVQX 1L5FA 4UFNA 1Q44A 4M8SA 1C1XA 2BEVA 3BTVA 3NIFB 2HM7A 2Z2YA 2C1EA 2ZUUA 5T67A 4WRRA 2H9YA 1J22A 4C4RA 3PEFA 1A5BB 4ESVA 5EG5A 2P9ZA 4ZV9A 5J4VA 1XDWA 2HEGA 4UUBA 3UMBA 1EFTA 3WP1B 1QC5B 2BFBB 1IZYA 1D1TA 4ITUA 3KPVA 4QEKA 4AJLA 2O8BA 2HNBA 1YKGA 3PFNA 1U5AA 2YXNA 4ZAGA 4RFSA 3C7TA 4U2BA 4YT5A 4OFWA 1NE7A 1K0FA 1R4MA 4D9BA 1ULUA 1WHSA 4TTPA 3PPWA 2ZIEA 5TMPA 4JR0A 3GGOA 4QWMA 5FL7D 3W4IA 1DCMA 3AL2A 3WYBA 1ZD1A 4HZUB 3WNCA 2TECE 1SVOA 5CAEA 1RQNA 5SV2A 4UMDA 1H22A 2OCGA 4F93B 3D2AA 1FTWA 4XZ3A 2ZSAA 1SHUX 2AFHE 1SQFA 5TMDA 5EVJA 4C89A 3CF4A 4I9GA 4F8JA 3IKVA 1KRWA 2FW8A 4ZQEA 5EFOA 5FR1A 3TXXA 2ZBPA 5EFZA 1CZOA 2X8WA 2BGJA 3FLBA 3M5DA 5KUTA 1DINA 3CW9A 3LIPA 1FBTA 1NQXA 3MYRA 3WNVA 1AO3A 3JTEA 2VTVA 3OHSX 5FTMA 4L9WA 2ATCA 2QVYX 5K3BA 4N9QA 3AUFA 3H3FA 1G7SA 2JVJA 4PZ9A 4QQNA 1PJQA 5HFAA 4W5OA 1U9IA 3PNOA 1VMDA 2VDVE 3FWZA 1DRKA 2RKWA 3FNQA 4TOIA 5KSYA 3A1EA 1TCBA 3U6BA 3RFUA 1WW8A 4O4HB 2DWUA 4MIOA 4RHXA 4A7PA 1XMQB 4DDWA 1US8B 5HM6A 2XECA 1VBNA 1IBSA 3WQRA 5I4KA 1MXHA 4S0ZA 3D4PA 4IWYA 1TO6A 3LBFA 3TR6A 1CUWA 3CKLA 1Q1QA 5HKKD 1M6YA 1Y3AA 4N5LA 3SLKA 3C6MA 5HRUA 1UZMA 3IVRA 1AHIA 1GQRA 3O7MA 2ODAA 4DMHA 1ONSA 2WP0A 3AGPA 4GP7A 4BAGA 4RVDA 1M2GA 2A9PA 4LZPA 1BNCA 2N75A 1PL6A 3L4BA 4Q15A 3C1AA 3FYUB 3QPBA 3RH0A 1JPNA 2JZNA 1SU6A 2ZJ1A 5I51A 3GUCA 4FDLA 5FBVB 3BBLA 3NLLA 5HQTA 3N5KA 4L3WA 3DV2A 3ZNQA 4DVGA 3NWBA 4TQGA 3VO2A 4UM9D 1GG8A 3BFVA 3MN1A 4KYTA 3MGGA 4XB2A 3I2GA 2C92A 3RRJA 4UMVA 4IV8A 4ZU6X 1ZUD1 1U8UA 4C4YA 1OLUA 2BKLA 2EF0A 1ESMA 16PKA 3KR0A 3QUAA 1WSWA 7MHTA 3OO0A 3R3ZA 1PV2A 2HDWA 5H4HA 1BC5A 1R27A 5B3JA 4MWDA 2CFTA 2X1HA 4PFJA 4OHCA 4RDHA 3WADA 3U56A 1D0VA 2HF7A 5LVAA 2R79A 3ENZA 2OO7A 3U3JA 1YZVA 5I9LA 3WTBA 1J56A 2HDHA 3IPYA 5KNBH 1AKMA 3I53A 3BE8A 3LK7A 4DA8A 3OP1A 3RUPA 4X64B 5BORA 1NG9A 2IVFA 2NXWA 4XRRA 2F9FA 1MOPA 1T6ZA 1XQVA 3CUTA 3UUFA 4LJRA 3IR7A 3B82A 1FCJA 2Q5OA 1RAFA 3WLPA 3PLAE 2VYVA 1U3DA 1GZ6A 4LJ9A 1T6YA 3T3DA 5AW3A 3NTUA 2ZYHA 5I7HA 1B7GO 3S81A 4TPKA 4RLHA 1A9OA 2OKGA 3H2GA 3N6RA 4KGDA 2QRNA 4UD2A 5ALLA 1LI7A 1XTSA 1U0NA 2J6BA 1B15A 1KNXA 4U0JA 2Q5JA 4HLNA 2GJ9A 4IZHA 3FMGA 1O1YA 3EZGA 1EXVA 1E7QA 2BFFA 2G5TA 2H57A 2K4MA 5E6RB 2BZSA 1PQUA 3SYTA 1T5BA 1G8YA 1TX4B 1ZS9A 4ANFA 1NPTO 3C8ZA 4RK6A 2C2OA 4DIFA 2H17A 3LY9A 1B6SA 3VSBA 3PEYA 2QL7A 3C7AA 3EQZA 1PKXA 5I4IA 2YR0A 2ZAYA 1K8QA 1RTTA 4UVEA 1XF9A 1NSFA 3M1YA 5JO0A 3ZCQA 1KL7A 3PQ4A 2VJBA 1TZMA 5LQKA 1SZDA 3E9DA 4OQNA 3JD1A 1RKBA 3KDPA 4C7BA 3IEPA 1JG2A 4H27A 4L4RA 2UZ1A 2NPFA 2IA5A 1GYRA 1Z5GA 2ZQ5A 3VH2A 4DB4A 4DIDA 3EVNA 4UU8A 1YK0A 1OAOC 5GVRA 3K9HA 2HU7A 4QUDA 2V97A 3HFRA 1JW9B 3MT7A 2QZPA 2ZRHA 3A6EA 4J0EA 1N1DA 4CKEB 4GSYA 4FX5A 2XADA 2EX0A 4WLNA 3T34A 4CR8A 2BGWA 1R6XA 3PLRA 4ZVPA 4M4SA 4MDEA 3HB5X 1Z2DA 1TEZA 2O05A 4GKVA 4N8SA 2QSUA 4UKDA 4BKMA 2WINI 4D43A 3VR0A 3ABQB 2PGXA 4RK1A 3LT4A 4OJQA 3U44B 3FUTA 3OD1A 1A95A 2YWBA 3VPCA 1FDOA 2D62A 1Q84A 1Z2PX 2Q3EA 3VZRA 4WZAB 2RHHA 3T8YA 2BFDA 3MTIA 1BH2A 1AOXA 2PQ2A 3CSSA 4XEHA 5D3QA 5J2UB 2J0EA 4CG3A 3KEQA 3GN2A 3A0UA 1CK4A 4K40A 4N01A 3EPHA 1RHRA 1YK1A 3AFMA 2IOYA 4OI2A 5BURA 2VCEA 2M1ZA 2YKGA 1U0SY 1DBWA 1R6AA 3D7KA 1GWNA 3GK3A 2OC4A 2BONA 5CFOA 1Z6PA 4OATA 1QHIA 3IJPA 4LHVA 4U4AA 3ZDRA 1LNZA 1FUUA 1KO5A 3MINA 1V39A 1FP4B 3ANLA 5IKXA 1SBTA 4HUJA 1DJLA 2B8WA 4JQSA 1AURA 4PBRA 4ZAWA 4M0MA 3GJ6A 3AF2A 2QYTA 2YXEA 4BB9A 2ZB7A 2II6A 2X7XA 4DUPA 2ZRBA 2Z6UA 3WR5A 3EVBA 5EXXA 5KREA 3AEUB 3GEMA 2XYRA 3W4JA 1U7XA 1AS0A 3C3JA 4ROSA 3K1TA 2WU8A 5FPHA 5SYMA 3PQ7A 5KQPA 1EGQA 3H7IA 1EK5A 3WSTA 5IAAA 4OTZA 4B71A 1GNSA 2CZQA 3WRVA 4E07A 4MCJA 5GTDA 1GGHA 2PUFA 4F97A 2Q46A 4LE1A 3IIIA 5INTA 1LLFA 1O58A 2IPAB 1CG6A 3OQ1A 4N03A 4N7BA 4Y6OA 5E3HA 1IHYA 1P18A 3OZXA 4TYYA 1J9ZA 4ZREA 3KK0A 2DGDA 5SY4A 2R8EA 3P32A 1FS5A 1TMOA 2GASA 1ISRA 1JQAA 2J3EA 2X8JB 3G1UA 1RWBA 3O94A 4OQMA 5BT8A 9MHTA 1AD2A 3N2NA 1LLDA 4Z8YA 2LCFA 5A4JA 2XB6A 1RRGA 5LXTB 1DMRA 4NFYA 4OU5A 2FWPA 1Z5OA 3STYA 4HSGA 5AKIA 4BRUA 3OM1A 3QQPA 4YAIA 4YACA 4BBPA 4OKNA 5AW6A 3SQMA 4L0MA 1JJIA 2R4UA 5EWJB 5AXBA 4GMDA 1CY7A 3PZRA 4ALMA 4AS2A 3FBTA 3KKPA 1ULSA 2GBGA 2ZIAA 4EHAA 3UMVA 2Q8QA 3BL5A 5GVSA 4KAXA 1ISSA 2JLRA 3UCXA 3W9UA 1V8FA 2XPCA 5JARA 1WBBA 4KR2A 4LF6B 4WZAA 3U61B 2FPUA 2P62A 2PL9A 4MCIA 1E1LA 1ZRNA 2F9MA 2XTMA 3GLTA 3H65A 3NHFA 3OPQA 4XSGA 3SPXA 1X1EA 4BO8A 1GTSA 4Y1FA 1HKHA 3TNYA 2QRUA 3QOFA 4LK3A 1H93A 1ORHA 1BX1A 5JS2A 1UKBA 1HF3A 3NOOA 3WMGA 4KAFA 1SXJA 3ACDA 1UC5B 1IQ0A 1XEXB 3VV3A 1Z2OX 4PC6A 1CUSA 4GZMA 3CMCO 1PDWA 2YNMD 3ZWAA 4ZC1A 2RD2A 3JQ9A 4MMYB 1BQ3A 1IWOA 3G23A 4DLSA 3B78A 4N7MA 3WHIA 1KI2A 2QM0A 1MB2A 5I9BA 4ZZIA 2DETA 2QGFA 3X1ZA 4LJ7A 1ZI6A 2PZ8A 1M2OB 1ZCFA 5K0LA 1H2BA 1WD7A 2GO1A 2NV6A 3AJDA 3FUUA 4MQUA 4PINA 2A1UA 2MSKA 2WFMA 2PJUA 3S2EA 5DEOA 1WPXA 2ORVA 3BTOA 1L7EA 3O1IC 3STUA 3DBRA 3BSWA 4I4IA 4MR8B 3RVJA 2G28A 1LBSA 4ARZB 3HE3A 4QG3A 1BU5A 1SZJG 1B43A 4Z0HO 3U09A 1J0CA 3K0SA 1JNYA 1NVEA 1MH1A 2Z1DA 2WKPA 1UC8A 2XXBA 4KX5A 4LC1A 4UOQA 4Q12A 1USIA 4DLPA 1F5NA 4TLMB 4IHAA 1CKEA 2WDPA 5HGXA 1TE2A 2HU5A 4BQPA 3GP8A 2WE7A 4MULA 4BFLA 2CNKA 4FGJA 1JG3A 3FGNA 1RABA 2YV1A 3IMKA 4X91A 5FBQB 3QVVA 3GUYA 2EBUA 1PK8A 3MHPA 2V96A 4J16C 1Z4KA 3GU3A 1Z73A 2QK4A 1T10A 2J59A 1PR9A 3ONNA 1DTWB 3ZTYA 5B6PA 3TDKA 2GEUA 3F2VA 1IXSB 4FI3C 4FPXA 1JIKA 1MO2A 1OLXB 2JL1A 1B0UA 3AO0B 3OJXA 5AJUA 4AKGA 5J59A 1P75A 1U31A 1C5KA 4OHWA 2OMEA 4MCHA 4FUTA 1H66A 1ZUNB 1XWWA 2GN8A 3FYUC 3FPEA 5J43A 3VR5A 5AKHA 3MB8A 4I1RA 2Q6LA 1NP3A 2GAFA 4E1BA 3Q8KA 4D4IA 2XGOA 4D92A 1GSAA 1L6IA 3MBKA 4OM8A 1LX7A 1VCHA 1QRDA 1Y4ZA 2HSEA 3C2QA 1T2NA 2AVNA 4EHKA 3MJRA 4IHJA 2JLUA 2C9DA 2QXTA 3WQBA 4RAOA 4UXJA 1PCXA 2PDAA 5CT5A 4KMMA 1G64A 2E4UA 2OOKA 2VPQA 5CLFA 1BIFA 3H5IA 2R2GA 2O14A 2MSLA 3LXXA 2H18A 5IMSA 2BDEA 3TUZC 4N6NA 3GLFE 4J1QA 3E3LA 2YQZA 3TQSA 3H8SA 1Z2AA 4LHYA 3FCYA 4KQ1A 2BTQA 4S1OA 1VP3A 2XHEA 1M5TA 1AQ6A 2G9VA 1E2FA 3VSAA 5GQSA 5I7EA 4L5IA 4MHTA 1RPJA 1XUOA 4BP1A 1Q16A 1Y82A 1HT3A 5ARBA 1GGNA 3P2OA 2XXAB 3R2JA 1PEKE 1GEGA 3HO1A 3E5RA 3JYQA 4BS9A 1U4OA 4OP3A 4A5SA 2NG1A 1Q0ZA 2XUDA 3CW8X 1K88A 3EWNA 4PZPA 2JJYA 4WERA 1SUSA 1YR2A 3V4LA 4OHPA 3ADPA 4NJOA 4F0JA 1KQFA 1GHTA 2IEZA 3IEKA 5SYNA 1K92A 1ZGJA 3KETA 1YR8A 2I22A 5EPEA 2CV2A 1YZUA 1E96A 3OQHA 3S55A 3AX6A 3SEAA 2YJTD 5LZ7A 4LMAA 5CYGA 4MHOA 2DWPA 1QF7A 3BFJA 3CONA 4LHSA 1SY7A 2XF2A 1P3DA 4BNFA 5FBWB 1Y89A 3IVGA 3VHLB 1EJ2A 3CEJA 2YMPA 3L8GA 4FS8A 2O5EA 2VSNA 3KPWA 3ZCXA 4B43A 1XT6A 3P9NA 1BXRA 3P9KA 3I42A 4YK7A 5TSDA 3TB6A 4Y2TA 4PAMA 2G5PA 3JVIA 1E2BA 4OHKA 1R15A 5IFKA 4C6TA 5HRAA 5JNTA 3OQMA 4MGYR 3QBVA 4K9OA 4CHGA 1Y8CA 2SICE 3L41A 1BS1A 4LGMA 1EVIA 5FF9A 2WTXA 5JI3E 1EDZA 3FLMA 1IAVA 2QBYA 1GILA 1Q1AA 3VYVA 1ZZEA 4TWIA 1JLLB 1KYZA 1Q19A 5J9FA 2BEKA 1E3IA 1I14A 3ORHA 2Z09A 1XEFA 3GEPA 3GNQA 2GO7A 4CM3A 1TUIA 2XMGA 4B33A 1QZ3A 5JNRA 3WNZA 1WF3A 2VKTA 3CX7A 3DS8A 3HKDA 3M6MD 4KXUA 4MP8A 4NTZA 1GPNA 4OJYA 5ESWA 4Q3CA 2NUPA 5CB4A 1Y8ZA 1EWQA 3NDJA 1ZM4A 1K2WA 1Y80A 4E51A 1SVIA 2OBXA 3NYRA 2VTBB 2PU5A 2CFSA 2XB9A 1QHNA 3N6XA 4GUDA 4I6JA 4RDCA 5F7JA 1X7HA 4EVSA 5KU7A 2LW7A 1PNQA 1ZJZA 2IK8A 5IZCA 3RKUA 1E3TA 2JC3A 4ZO8A 3IDAA 1T0JB 1Y7IA 3RU9A 3ZNOA 2P27A 1S4QA 4R3NA 3L8YA 3NUQA 3I09A 4MS1B 2CEAA 4WOJA 1E99A 1P9RA 5DXAA 5CIYA 1K6MA 2WUFA 2FN7A 1NNEA 4K8OA 2L0XA 5F3RA 1Y6ZA 1ZGAA 2QQ5A 1MB3A 3DW3X 2BFMA 1T1IA 1FLVA 1SM4A 2WR8A 3E7DA 1OJ7A 2EKPA 2RGNA 2X0RA 1B4DA 3DBLB 2YWJA 3A1CA 5L3QA 2R47A 4LI0A 5HTKA 1HZZC 2FKAA 1N2XA 2EJVA 1PJTA 1G8KA 4JUCA 4QTYA 3D0KA 2AJLI 4ZV4A 1MQSA 3UMSA 1GV1A 2QGZA 1DQZA 1GAWA 4OLFA 2RB5A 3JQBA 3AR4A 2J5BA 4RTOA 2BE7A 3IP5A 2CKDA 3DC2A 4HFRA 4DABA 3DKPA 3IDFA 1QKJA 2JGJA 5F5XA 4P84A 4E33A 4A1OA 3N2LA 2F8TA 2VPTA 2O6HA 2WWTA 2WV9A 3EK2A 3EBOA 3Q2OA 4FEEA 4ZAZA 2HK8A 3MQ2A 1S02A 2FDRA 2YIDA 5HS6A 3CY6A 5BW8A 1E32A 4WKPA 1FA9A 5REQA 4PPGA 3IALA 4IQFA 3KWFA 2C2MA 2RGYA 3ROTA 1SUBA 1TFUA 3EYWA 5C4MA 5CT8A 3K31A 2WTEA 3W7BA 2ATXA 4BKOA 4ZIRB 1G5PA 2IHYA 3JVDA 5ALKA 1IG3A 4WVLA 3VKUA 4F91B 2G04A 5KCMA 3A7EA 1N5IA 1YS6A 4Z51A 1V16A 5T41A 4C7OB 5GJBA 3DCNA 4D5GA 2P4SA 4H7IA 2SCUB 2XZTA 1SG9A 4IDCA 2FPMA 4MQEA 4Y6QA 1TF2A 1YOVA 1U4SA 2DWQA 3TTUA 3WGZA 3Q3VA 2KBEA 5DBGA 3U62A 1Y6RA 4QARA 1RBYA 4FCTA 1OVGA 1E6CA 3QKTA 4G0NA 1LRJA 1OV6A 3TZEA 1O95C 3VR5D 5C1IA 2GF0A 1K5GA 3ZCUA 3K70B 3T3OA 1O6ZA 4KBFA 3I6MA 2ZSEA 3OHPA 4Y6GB 3LUPA 1BJRE 1H4VB 1XDUA 3QG5A 5COBA 4F5EA 5LL6P 4YT4A 4KO1S 5AVOA 3WWEA 3DKKA 5I9NA 1PV4A 2B2XA 4J1TA 5DHQA 2NVUA 5IT4A 1BU8A 3CKMA 5K0FA 2HQRA 2AKEA 4JIMA 5ESXA 2I7TA 4P3NA 5C1BA 1RE0A 1PJSA 3WA7A 1UFOA 3U2QA 4KFCA 4X1YA 1DOAA 3R5FA 4HEA6 3C6KA 5TPZA 3T6KA 3GAFA 3HA2A 1SCKA 4LRQA 1EFRA 2AK3A 3PUVA 5F5NA 3ADBA 4DMKA 2QYSA 2P3OA 4S04A 3DMHA 3J80A 1JEYA 3G17A 4U9HS 3KR1A 3L9WA 2PH7A 4N54A 2NV0A 4N7RA 4Q6WA 1NQUA 4RXTA 3SOPA 3KWLA 1HDYA 1L7QA 1RT9A 2UZAA 1FJXA 1ZW6A 4I5GA 5GOTA 1IVSA 5LQDA 4BNZA 2ATEA 4P7BA 3REQA 1P62B 4DYVA 3RT9A 3DBRB 2BFOA 3EIEA 2ET6A 2CLFB 3JZFA 4WA7A 4MGEA 1U8YA 5E9AA 4B75A 5IWCA 5IVHA 4XUEA 1U6JA 1FFGA 2O23A 1IBKB 3ICQB 2VYVD 4Y18A 3O47A 5KSWB 4FMDF 1T6XA 1P3Y1 3AC0A 5TQ2A 3S70A 1M34E 2UVPB 4HH0A 5AM1A 5JEEA 5T4EA 1RTKA 1IHXA 2I87A 2DE0X 1BKSB 1V71A 4IV5A 4Y1GA 2TS1A 4AY4A 1QRAA 5B4UA 3BF8A 3LZCA 1NUQA 2DT8A 1VHJA 2PWZA 2QE7D 3H9QA 4QGFA 1ZA1A 4BLSA 1FDVA 1OFIA 2IU0A 3IODA 1RZUA 5CX1B 1T3LA 2HGZA 4AUKA 1NXXA 1J7KA 1Z45A 3SAJA 2WJPA 3GJ3A 3T5BA 4CGYA 1CF9A 3O21A 1OC2A 1KHTA 2R6GA 1J5EB 4JXKA 2P9BA 3CRVA 3DC7A 2O7QA 3U4GA 3HUEA 2JAXA 2DSNA 5D1HA 1H1LA 5ECGC 2IW3A 2OORA 2EZ9A 3CLUC 4J0KA 4KNVA 4MW5A 4QU8A 3ZDZB 4IDHA 2FV8A 3WOVA 3A37A 3QU7A 4Z2YA 2SKCA 4DSAA 4C78A 5K8CA 1ZJJA 3ZBQA 4K3UA 4EI7A 4L5JA 3I6ZA 1IM2A 1F5SA 2BJHA 1CVLA 3FPFA 3MWKA 5IUJC 4MAMA 3KALA 5H4GA 2ZE5A 2R1ZA 3SZRA 3VJLA 4CLDA 2Z4SA 4Y2PA 3D3EA 1KI8A 3HABA 2ZTHA 2AMFA 2VH2A 1VA4A 3JX9A 4P5EA 1VPDA 5AP9A 3BMCA 5CK4A 4CF4A 1ZN8A 4B3MB 5CP8A 4GKJB 4X5OA 1WXGA 4B74A 2UYOA 2PLFA 3EZFA 1VTKA 1OASA 1L4UA 2GK3A 1RDFA 1JWAB 1TA9A 2AXQA 2B34A 4U6QA 2ZATA 3DAFA 5DNEA 3RSFA 4AROA 1W36B 1U99A 2QZZA 3DZHA 4BO6A 2RDMA 1RQRA 1XRQA 2IHTA 5ADUS 2WSSD 2JFNA 1SC3A 3CCBA 3GOQA 5ELLA 4LIPD 1F8UA 1IBRA 3H2BA 4MUYA 2CF6A 2PUBA 1NN5A 1DAHA 2CNWD 2IXBA 4FQ7A 4QOEA 3URKA 5EMHA 1PG5A 3HU1A 1HT0A 2R11A 3MZ0A 4PTZA 1XXHE 2PGOA 1LVUA 5GZ3A 3O8NA 1OZAA 4H59A 2VPYA 4AUMA 4G84A 1W9MA 2HSGA 2LRHA 2NVWA 3ILYA 3KHKA 4XDYA 1GSOA 3REQB 4WUTA 5JCXA 2OD9A 2Y0PA 3IMCA 3QUBA 4MVJE 4B4DA 4EB8A 2W4IA 2I6TA 5A1JA 5BV0A 3AVYA 2OD7A 4H3KB 1FOEB 4KK4A 1QDEA 3VU9A 4H15A 1W8IA 4WOBA 1QFMA 1V3UA 4IF6A 3CQ9A 3QY9A 3ZOZA 1AMUA 1V5EA 1HYEA 4GGMX 2WWHA 4S35A 2JF0A 2JKZA 1GIAA 1BGXT 4FDTA 4DNPA 4S1VA 2QAGC 2R6FA 3DE0X 2QD4A 4KE8A 3SJBA 3TGLA 1L5OA 1XVUA 5K09A 1VLLA 4XVHA 4D46A 1KDRA 2CZGA 5E7MA 2WM3A 1ZFNA 3HHEA 4NONA 4RPHA 5HQJA 5I4BA 3P2IA 5BMVF 2PTHA 2QWXA 4K26A 2XIJA 1N2JA 1VMEA 2BEJA 3KYCA 1ORTA 2R7NA 1RRPA 3LX8A 4R1UA 1A9YA 2XGMA 2RI0A 4HDKA 2EWWA 2WVGA 3VHXB 1BH6A 1V3VA 1GLGA 3OWXA 4JJAA 3ZE7A 3U7FB 4YRDA 1YB6A 1VPLA 4GHWA 3U7GA 1U0TA 3NHWA 3ZLBA 2FU5C 3H9BA 5ITZB 1Z7BA 2DSTA 3V00A 1KGDA 1NW5A 4YRCA 1JZTA 1PL7A 5A62A 1DPFA 3QMWA 4FMPA 3EMVA 4EX6A 1L5KA 4L1KA 1AUOA 2X9NA 3PKIA 2ZB2A 1TTTA 1XMSA 1FSGA 1CQZA 2BT4A 4M0PA 1EQ2A 1CY6A 3PQCA 4BFSA 1FFDA 2Y05A 3AH8A 3ZCRA 3IEVA 3UHPA 2AFHA 1ZW1A 4F11A 1R6VA 5BVGA 1PYGA 2CKMA 4PLWA 5JO9A 4KPEC 2FMHA 3P26A 5E4FA 1OGIA 4FZJA 3L79A 4EO9A 4E2FA 5IJ0B 4RH3A 3X2EA 2RH5A 2WHPB 1HSZA 3QPVA 2PSDA 1FMCA 4L3VA 4LHZA 3BD9A 2VT2A 3VBCA 1VJ0A 4D0LB 5A1TA 2V6BA 4GMFA 4Q7MB 2BBOA 5FOUA 1VJCA 3STHA 1ULTA 2CJPA 2FMUA 5IW8A 1JNXX 1YVRA 4FMBB 2EBWA 1SZPA 1B14A 4I3HA 4IDGA 1ZD3A 3GLFA 2XKJE 2IH2A 1EP9A 1DB3A 1UODA 4QASA 3AKDA 1ZEMA 2AJBA 4ZOQI 3RREA 1C8KA 5LBIA 3N2EA 4BU0A 5BWLA 1LDEA 3A6GA 1DKLA 1PLKA 3GFOA 1EFRD 3MUOA 3QA9A 5JD6A 2ZXUA 4TVOA 3C14C 5BMVA 3D0RA 2BGGA 3F6BX 3IDSA 4L7VA 2PJRA 4OV6B 1X6VA 2HB6A 4DDTA 1VMIA 3IJEB 2ZIWB 1PS8A 2XTAA 1HFKA 5JY6A 5J23A 2OBMA 1W5SA 1ISGA 4QPCA 1E9EA 2OM2A 4EY3A 2W2XA 5BW4A 3SICE 2FWMX 4C43A 2GKGA 3O26A 1EVKA 2ZYWX 4F4FA 1I3CA 1T15A 2C2GA 2PWBA 1LWOA 2WNHA 4C3OB 3QNMA 3QNUA 1TU3A 3UJDA 4EECA 1WBDA 3CNNA 3MTEA 4O2LA 4ZT5A 4AMYA 4OGLA 4YT2A 3RQSA 3HWWA 3H2HA 4PSKA 5F78A 4DLKA 2C5FA 5F51A 3BIOA 2ZR8A 2XE8A 1JAHA 5ECWA 2N9UA 3EZ9A 3W1WA 1Z5VA 3AOEA 2BFCB 1UPFA 3R5HA 4Y3UA 3G3EA 1LDYA 2KQUA 4BATA 3QA3E 3Q8WA 3QKWA 3KQPA 4B48A 4K5QA 5HE8A 4YV2A 1AA6A 4YJ2A 4PIVA 2HIAA 3D1JA 4G36A 4R2XA 3ZDDA 3KQMA 5ER9A 1HFJA 3QW2A 4Y9SA 5DGXA 2J9ZB 1U2ZA 4QYIA 4HADA 4ITVA 1NOJA 3ZDYB 1WUIS 2IS6A 4UARA 4K9DA 3RS8A 2XR1A 2IXAA 1QE5A 3IELA 3REOA 4JUIA 2H31A 3X1JA 2AKYA 2DFPA 3QXCA 5JFTA 2GPNA 1GGEA 2GN6A 1JHYA 3R9KA 3NEPX 4E31A 4X7RA 4TKUB 1OF1A 1TGYA 2XVYA 3LVQE 2GILA 4QDXA 1QANA 1Z8NA 4PF1A 2YJGA 1F9AA 3UUWA 3M70A 4DEYA 5JH7B 1D7OA 1K9SA 1ZVQA 3HKBB 4PZLA 1XEWX 3L82B 2C94A 3EGEA 4KXQA 4UQOA 3T3EA 5KJFA 2GZDA 4JMPA 2FW1A 3AF4A 2L82A 3C3BA 2F8SA 1FLAA 1BN6A 2G0NA 2W70A 1M1YB 2P4EA 1W0KA 2FQWA 4F04A 5J2UF 3BGOS 3HLKA 4G41A 1KVUA 1YDFA 3F4BA 3VDNB 1ORVA 4E12A 4RD3A 4LXTA 821PA 2XW6A 1MOQA 1XN4A 1AKTA 1XU7A 3DFMA 3IMGA 5DN6D 3LA8A 3K0BA 4IFBA 3SEQA 4J8PA 1O08A 4DV5B 1YQXA 3KXLA 2CNWA 1U7HA 4GU5A 1QV7A 1KDPA 1OHHA 2D06A 3DVAA 3SVLA 1DXHA 1GNTA 3WIBA 3CJRA 3FFWA 4EFMA 1HZZA 2ZTUA 3QUQA 4H1UA 1B8PA 2QJOA 3UTCA 3R3YA 3L1HA 3WLFA 1GPWB 4XVQA 4FFWA 4PLGA 1KO8A 1ZRSA 4MJ3A 3B1FA 2IU3A 5I5GA 2X42A 4AP6A 2D2IA 4QQKA 2HFJA 5JSZA 3RGGA 1T5LA 1BWQA 4Y2HA 4AS1A 2WWWA 1L5YA 4MNTA 5KKAA 2Z95A 1BVUA 3R7BA 5IUKC 4F5ZA 4E46A 1GZDA 3ZIAD 2X8JA 3TCXB 3WXMA 4DM3A 4ZYVA 2YX1A 4ETNA 2HIGA 3KTFA 4HB2A 3UAVA 5JBIA 4UUAA 1KJ8A 1U1IA 3CA8A 2HA2A 4CM9D 1WZ2A 3E6AA 2QTNA 2BEWA 1XNGA 3F6YA 4DCJA 2RJNA 3HCBA 1L8XA 5FPSA 3NQ41 5LYJB 1JSZA 4S0XA 4W1QA 4LOAA 5FYQA 1EWKA 2ZUTA 4E70A 5BR4A 1OI7A 3AUYA 4CPDA 4OGGA 1EX1A 1TUEA 3AGQA 5JDIA 3CRMA 5LBUA 4D4GA 4BMYA 1PGPA 2C59A 4HQ6A 2PXAA 3FPGA 4H31A 4AJKA 1OXTA 5AO9A 4BAZA 3PNSA 5KMGA 2P6MA 1U5BB 5E1DA 4MIYA 3HR4A 2OM6A 1C7RA 1JAXA 1W581 3BHMA 3R6LA 4GUAA 1ACMA 4MRPA 3K2IA 4AG6A 3A05A 5FAKA 4OLAA 1QHSA 3V8EA 1U3WA 4DZTA 1WKVA 2QN8A 1E3WB 4AM8A 5BR8B 4RL6A 3SS7X 4TWRA 5JTUA 3F3MA 1QDLB 5I7WA 1PWZA 2QTRA 2IP4A 2ACVA 1VIDA 3ITNA 3JD4A 3TQIA 3VZCA 1A04A 2DPMA 3ESYA 1K4MA 1XMJA 4KUEA 2QAIA 2J87A 3PHGA 2EBHX 3CLUD 3CNEA 5KQRA 1ZG3A 1HT1E 2PT5A 3CISA 3IP3A 3LCUA 4G5SA 3TOVA 7REQA 4Y2XA 1VSTA 1EXNA 2ZRLA 1K7CA 2IGTA 2RBEA 3CNOA 3HGQA 2J32A 4B9AA 1U5BA 1T2VA 1D2NA 2BGUA 4G4GA 4KPUA 1C30B 3G9ZA 5G4LA 2O3RA 2VDRB 5LOVF 2ZXEA 3INGA 4Z9FA 3VR6H 5ELXA 1JAZA 4ZDIA 1P2FA 3KJHA 5IX8A 1VL2A 4QJBA 4G2TA 4ND8B 4Z5XA 1T8UA 5AUQA 4MUBA 1R0SA 4ZPXA 3A7DA 3GGSA 3ZG6A 2QNIA 2QXUA 2GUWA 4I50A 3TRJA 5LZ4A 5J2TF 4J07A 3KKOA 4EFDA 3I9V6 4K7JA 1E62A 3BEOA 2X0EA 2A30A 1CUXA 4ZVKA 2X3YA 4HQRA 1U8TA 1C3OB 2A0UA 2HV9A 2BDUA 1C3XA 4MB2A 3Q9NA 4MAFA 5DIFA 3ZI0A 1OXBB 1GTVA 3F49S 4AXBA 1XNHA 1TYDE 1X0XA 3D2BA 5JY1A 3AFGA 2TMDA 3KHTA 4D82A 4K2AA 1OT5A 1EVEA 4G8DA 3QYFA 2PGAA 4JU8A 1JUDA 1NWHA 4R2KA 2Z98A 4MOWA 4V0NA 1CE8A 5ECDA 5ICGA 1BW9B 1TGVA 4MW1A 4OK6A 4P82A 4ZANA 4ZGGA 1KORA 3RASA 2C8VA 3IEMA 3QP9A 5MDHA 5HOEA 1GRRA 5KSPA 3CYFA 3BZUA 4KDCA 1TQ4A 4CDNA 1T9DA 3HR8A 2ATVA 2NTJA 3H97A 4WECA 3ZD8A 4HDCA 5IVDA 2N3ZA 1EAYA 2AN1A 5JXIA 1M34A 1PBTA 2Y1CA 3R3WA 4ZHQB 1VLZA 2OBBA 1XELA 2XMDA 3QHAA 4OY3A 2YC4C 3ADKA 3NHRA 4M9XA 4RKEA 4L74A 4AWXA 3PVCA 1QDUA 3UMCA 2NTNA 4O2AB 3TD2A 1FF9A 1LC3A 4C06A 1M2EA 2Q6IA 4KH1A 4RCZA 5KTYA 5TPWB 2DUUA 1P7PA 1XLWA 4QBFA 1FLNA 3VUFA 4W99A 4QODA 3RIYA 2PANA 3SHFA 1K3UB 1JFLA 4U7TB 4WK0B 3FMFA 5EIOA 1QH1A 2YFKA 3GWZA 3T12A 2UYQA 3TFOA 2WJHA 2O5VA 3IQZA 1UH5A 1GU1A 3AESB 4YQZA 2VR1A 2GA9A 3IA7A 4NF2A 4HNVA 4XYMA 2PAFA 4F9FA 3BJIC 2J08A 4EEXA 5A3QA 1NVUQ 3I04M 3ND9A 4JL8A 4L0QA 1RIIA 3HUTA 4QZVA 5KYWB 4BJ3A 2FYTA 5LQSA 4L4UA 1FEZA 4RFLA 1SC9A 1HYBA 3FHJA 1DAGA 3L01A 4RQAA 3C6ZA 4J0DA 3PNBA 5TGTA 5K4GA 4HK4A 2C9ZA 2RHCA 4DPLA 5KNCA 3T7CA 1W7AA 2VDMB 4GFDA 1KFBB 3FOAA 3LQ2A 4IR7A 4NQZA 1P4RA 5E1OA 1XZCA 4KQ9A 3FHCB 1U28C 1EHYA 3EEYA 2OAEA 4MPJA 4G8CA 2O8VA 5A9RA 4BNDB 2C97A 2Y1XA 4H3VA 5FQOA 4Q1CA 1OOEA 3KJNA 1WDKA 5IVPA 3F74A 4RHCA 3UH1A 1CZRA 2GX6A 4YMHA 2GRUA 1AA9A 4MS4A 2IUFA 4EHNA 2AG8A 2AS0A 2ZDQA 4FYXA 4UUMA 4X1YB 1ZD8A 1FPQA 1GT91 1T8WA 3ZLTA 1KJZA 1A2BA 2AOVA 4JFRA 4OCZA 1AS3A 4YJGB 3T3NA 1CC1S 4JB3A 4QNRA 3MS7A 4K6CA 4K3VA 3SJCA 2W0SA 4IHQA 1ZY2A 5A5GA 2QR5A 2DG2A 4POAA 3AEUA 3PDUA 3B9RA 3W4KA 3HXQA 2HDNB 4L72A 2Y1DA 2Z8YA 1VL5A 3BXFA 3JD0A 5AVTA 1UKYA 3CG0A 4DJAA 3ZY3A 3GDFA 4HGQA 2I7CA 5JS7A 4Z4CA 2QVCA 1NSYA 4NBSA 4BNKA 2VQDA 2G1AA 5TPWA 4RU1A 1A9RA 4WESA 2XYVA 4YMIA 4FHCA 1BE1A 3GVPA 4LBVA 3H1PA 3LX6A 2Z5LA 3JTMA 4RQUA 3W2FA 4BJ1A 2ECQA 5KWVA 1N77A 4M0DA 4ZRNA 3OZTA 4YONB 2TMYA 4IRMA 1L4GA 1Y3BE 4HNAA 4HB0A 4XYGA 1RKVA 4BTLA 4BOYA 1V7ZA 2A59A 2FWJA 2GESA 3NHMA 3SVZA 2O4CA 4Y2VA 3CG4A 3OZWA 4HEHA 3VJMA 1NV8A 1VMKA 1U3UA 1XK6A 2WHRA 2WKSA 1E1QD 1T4DA 4C7KA 3U31A 4ZEOA 2B21A 3LBAA 2Q6KA 3E0QA 1VJRA 2FY8A 3AJ9A 1YBAA 1JDTA 4L5AA 4Q0MA 1ENPA 4A8JC 1OPXA 3V6MA 2ODEA 3E05A 4BX2A 1ID8A 1AF4A 3JYNA 3W5UA 1CUAA 1T1GA 1XEAA 1SVMA 1B1CA 3WRXC 2FK8A 3VZDA 1E1DA 2JZOA 3JWIA 4MPRA 2BFEA 1HKUA 2BP7B 4TTRA 2KLHA 5E6SA 4BFVA 4CM5A 2WWXA 1LF5A 2YYZA 1ZOSA 2ADOA 3DYIA 3B6IA 2C3MA 1JLKA 3AZOA 1F4PA 4KXVA 4DRXA 3N28A 4TSKA 3R8CA 3Q2KA 3VTKA 3WKAA 3AM1A 3WGMA 1GFSA 5KAPA 3C8DA 4YJKA 4HDMB 4U7GA 2WAXA 3ZE6A 1QGDA 2WTAA 2OCYC 3SYRA 1HNZB 4PTYA 1QQ7A 2WJJA 4AJNA 1R6TA 2W6ID 1QFXA 3DPSA 3P9QA 1YRHA 2X5NA 2CLLB 2ON6A 3ZNPA 3GELA 1C8LA 4G4JA 2XGGA 1P80A 1MFPA 3DULA 1DAEA 4MVCA 1NVWQ 1Z4NA 2OP0A 3I23A 3RTEA 4HQOA 4YV7A 3CX3A 1ZU5A 2AIRA 5JXHA 4K9LA 1AQYA 2IY7A 2HPZA 2XNCA 3HY3A 2O7NA 2AF3C 4KXLA 3OTOB 4FYYA 4DAOA 2Z4RA 2D3TA 3IVCA 1NBMD 1XMPA 4CEHB 5LN1A 3CVWA 4LJLA 1KP3A 3ONVA 1B93A 4D3DA 3G2NA 1QZTA 4Q4AB 3OHMA 2LWIA 1OYVA 1R6DA 3W8EA 1L5SA 5K3AA 4ZAYA 2CXXA 2FEAA 4CQNA 1Q7TA 3U1TA 3U7EB 1NI4B 4IY1A 3CUUA 2A0YA 2OXCA 3I5AA 5IBPA 3KG2A 5JUWA 1I7LA 1KH1A 1FB5A 1ELOA 3VDXA 1ZMBA 2KLBA 4XX0A 2A5FA 3C7DB 1KKLA 3R09A 4DJ5X 3ECSA 3P4UA 1RYZA 3DOUA 3DZFA 3K6SB 1FYEA 1KAQA 4C04A 4BP8A 1T9ZA 4MYTA 1CW2B 1V45E 3RBVA 4EYEA 3F7NA 4L6AA 5DULA 4UE6A 1JXQA 4TTJA 3W6UA 5AXCA 3L9XA 3VR3D 4EG5A 4KYIB 1TMGE 1MNAA 1YVEI 4ZAVA 4G1BA 4MQFB 4XFKA 4B3GA 2IYLD 1LK0A 3QOYA 4Q4JB 4ZEWA 3IYLW 4JCCA 4M8KA 3FN4A 4FZVA 1M9NA 7ABPA 1NPDA 2D1RA 1W19A 3ID6C 1XZPA 4PICA 2RE8A 2WIDA 1NKSA 5DX8A 2GBCA 3T3HA 4BGUA 2WJ3A 2A9KA 4XWTA 3CF2A 2Q5QA 1PBNA 3CRW1 1OR8A 1M1UA 1ZJ5A 3ZUGA 2AOXA 4S1WA 4HGOA 1BHSA 4FQ5A 1AKVA 1L5ZA 3CX8A 3DG9A 4GVPA 1AIPA 4R2WA 4YJ3F 4M1QA 4DNQA 2VF4X 5JI2E 4BLVA 4PS0A 1ACLA 1HYHA 2PGLA 2XJ4A 4CLHA 2WKQA 1XKTA 1AQIA 2B99A 2BM9A 1OFVA 5JLAA 3MRVA 5LQAA 2XBMA 1U3VA 5JCZA 4MV5A 2AVDA 1E2EA 3CXRA 1FBNA 4CQMD 3MWYW 2O2SA 5KHLB 1JHXA 2QM3A 5EXTA 3ORSA 1Z16A 2IP2A 3EXG1 4NENA 1YZTA 5TGZA 3D7LA 4YMUA 3V2HA 2XT0A 5FJIA 3QI2A 9LDTA 1CUUA 1JU3A 5EZSA 2B9EA 2GF2A 2IFTA 4IQGA 3URMA 4IVPA 3HPQA 2PBFA 3EJ6A 3IQWA 4HDKB 4NBNA 4UPEA 1P1KA 3QKUA 1XPOA 5EE3A 4HUQA 1QPZA 4HX9A 1MPTA 4OO3A 2VDLB 2NU7B 2CXNA 4ZQCB 1U3GA 3BD8A 3TAHA 3THWB 3I8SA 5CT4A 4ZVSA 1T24A 1NBME 1UWCA 1SD2A 1LBHA 1M1ZA 1YR7A 4PV7A 1R0RE 3T3PB 3UJCA 4EKYA 4WBNA 4L5BA 4Q4HB 2WG2A 3SDZA 3L93A 3UPUA 4K8RB 4R0NA 1BOOA 5EKXA 5AICA 4JOQA 1KVSA 3B1VA 4UBOA 5CFMA 1QR6A 3RANA 5CB0A 4LZZA 3LD9A 2FE4A 2YY7A 3CW2A 3CF6R 5JZMA 3DO6A 3OEED 1Z06A 3GY0A 3VR6A 1EIWA 1QTIA 2ZPTX 4PAGA 4G1VA 4GMHA 5JISA 4ARBA 3THXB 3RVOA 3LLCA 4LI3X 3IT1A 4ZCSA 1EM6A 4BV2A 3LCJA 5JDIC 3VTAA 4MVXA 1DFGA 4YRMA 5ALNA 2X9GA 3QSYA 3JSXA 4LY6A 5FPTA 3WDLA 3X1XA 3L1IA 1RFGE 1S4MA 5CJJA 5B30A 2C7GA 1V9SA 3O4GA 1KI4A 2M1XA 4MW0A 3DW1X 4GLBA 4IKOA 1E2PA 3NJRA 4QDZA 1YB7A 3N8NA 3EC1A 3CZQA 4KRGA 1ULAA 4M9RA 4UTXA 3TDMA 2NUPB 1QRSA 4DYHA 1NTOA 3WSVA 3NFRA 3UG7A 4A8TA 3K8OE 4Z4GA 2WBLC 2XAUA 1YF3A 3R3JA 4Q1FA 2AEFA 4O2BB 3KKLA 2Y1KA 1X94A 5AW5A 4PZCA 2OV2A 4K9SA 2V6FA 3GJRA 3KQWA 2ZROA 1RLUA 2FX2A 2SNIE 1MRSA 2HQOA 2YWCA 1RJ9A 1MB4A 1WXDA 3DDSA 3TW8A 3RG8A 3SXUB 2JJ2D 5LUBA 1T1JA 5LCXA 1JR6A 2VAXA 2O8FB 5DBIA 3HJUA 1GKKA 4LSWA 2N46A 2VS1A 3FKQA 1LNSA 4M8LA 3DZIA 1L4FA 2WJGA 4TT8A 3UV7A 5CFRA 1DAPA 1JKFA 1BHJA 1V7QA 2CFRA 2H4YA 3VC3A 4X6XA 2PT7A 3T1OA 3IUPA 4FHDA 3WIEA 5DEIA 1BVYF 4Z7QB 2HQ1A 3EVDA 2ZJFA 3AF5A 1T9HA 4TYPA 2D1YA 1MX3A 2B92A 1RI2A 1S3SA 5J40A 3FY4A 1M7HA 2Z30A 4WBNF 1YR3A 3JVUA 3R5XA 3UFXB 4UBNA 1GKIA 4HB4A 2QKYA 2JGIA 2NVBA 1AG9A 2QMOA 3OE5A 2HA4A 3QBEA 3CGGA 4GPTA 5FULA 1QJ4A 2BPOA 3ZW7A 3ZGVA 2P5TB 3S99A 4MW7A 1KPHA 2UXCB 1ZUWA 2MSCB 2I8LA 1IJKA 1COWD 3HLYA 3NIGB 1R4NA 4RPCA 3GLGB 2I4LA 3BTUA 1QGYA 5JALA 3A6DA 1IQPA 1LI5A 3CN7A 1GNVA 5B64A 4XR9A 1WTAA 2PX5A 3GMDA 4A2QA 2YHUA 2O59A 4L0CA 4OUDA 7YASA 2PXHA 2C00A 2VRNA 2HA5A 2QYHA 3K53A 2JLBA 3D0QA 1GAEO 2Z04A 3O8QB 1HETA 5FXMA 3TE6A 2PWYA 4EFNA 4KAJA 2C57A 4G56A 2WFLA 3TBHA 1MW8X 5E2IA 1A5ZA 5DU2A 5B6IA 4AF6A 3MBOA 5JYBA 1QO9A 2XQIA 3VR3A 3WK9A 1NRWA 1UJ6A 1XD2B 2B5VA 4O4IF 3ZD6A 3BMQA 1NU8A 1U3TA 4X1OA 4NV0A 3UY4A 5IJZA 2BAGA 2JBAA 1C1HA 3B89A 2NN3C 4BV9A 4DT1B 5J5AA 2V9CA 1G5FA 2IKSA 3EGVA 2J09A 5AUOB 1BS9A 1DJQA 5D01A 3I1JA 4ZMRA 2Q3CA 3Q8MA 2C98A 1X1SA 4H0FA 5ILGA 2R8OA 4OHZA 2JASA 4FM9A 2FJPA 2BR4A 2Z9BA 2BUCA 3F6CA 1T9CA 3WO1A 1Z25A 2VZ0A 2GCGA 2X19A 4GNRA 5BYAA 3ZJUA 5CNMA 1JEAA 4MWOA 5KC9A 5EHXA 5J4LA 5FDFA 3KS9A 3PK0A 3VKWA 4HVTA 4WCFB 3DO5A 2UXBB 4RHTA 4DLZA 4GOLD 1MHPA 4FJ1A 1ENOA 4NBVA 5JS1A 4QYIB 2AEJA 2O3SA 4WN9A 4EYKA 4EUNA 1XBTA 2PUVA 1T3HA 1AK2A 1CRQA 3Q15C 4ND4A 5BO5A 1IY2A 4BC1A 5DOZA 2W6CX 5HDQA 2BMEA 3JQGA 4U8GA 5CG1A 1H3EA 4LXIA 4G25A 3R74A 1I6WA 3AVPA 3B3JA 3QQ5A 4AY5A 4CM1A 4PO9A 3VPHA 1E64A 2QRJA 2JNWA 3DTYA 3A6ZA 3O2JA 3S68A 2SKEA 1C3VA 1L1RA 1RLMA 4LAFA 4R0MA 4P22A 2Y4NA 1IRIA 2GN2A 5HQ3B 5IEJA 3KAKA 1F2TA 1FSZA 2PH5A 2R6DA 2REQB 4II2A 5EP1A 2P2NA 3E9MA 1HDGO 1F1BA 1V8ZA 1IN8A 5JMPA 4CKWB 3ZHUA 4WL0A 1YRQA 3INTA 5A6SA 5AT1A 3EDQA 1ZNXA 2G83A 2VNSA 4ZT4A 1YUMA 2A1UB 3PQ3A 1IWPB 4NYJR 1AKNA 3L0IB 2WZQA 5EZ5A 5GONA 1FP7A 1NKTA 3CIFA 5H70A 3CJQA 3NWJA 2GN9A 4W5RA 1GADO 5C51B 3PNPA 3O75A 3OCXA 4P31A 1I7DA 2QBYB 4G24A 1P2TA 4MO9A 3LKDA 4YC7A 2VVTA 4QU9A 5F9FA 1N9KA 2VPWA 1HTBA 5EP3A 3BD7A 3AHHA 2OZPA 2PL3A 2CFOA 5CCBA 1VZ2A 1I9GA 4C4PA 4PGAA 4RC9A 1Q7RA 2OFFA 1EB8A 1V3TA 2AT1A 4FR0A 1C0IA 4TXHA 3L6DA 4DDKA 1PAUA 3D6JA 4RMNA 3U7QB 1VPWA 4PNZA 5A6SB 4POOA 2R7KA 4ZHQF 1WZUA 4E30A 4EQZA 2IQ5A 3K0FB 3ZWYA 1ORIA 1SJ9A 1WB5A 1NP6A 4ARUA 2I4RA 4L50A 2EQAA 2XSZA 2ZJBA 1DXQA 2H48A 2Z43A 1XJCA 2BM0A 3L7DA 5JE8A 5BNFA 3SKXA 2XRZA 3ERCA 2PQMA 1V25A 2QL6A 5B7NA 1P1RA 4YJ3B 2R9VA 2DJ5A 1AZWA 1QC5A 1FVHA 2OHVA 3KAQA 5JV5A 2XWBF 1M6HA 2UVPA 5FJJA 1U9YA 3QEJA 2XE4A 2QUKA 3R20A 3T9DA 2BMVA 4U5QA 4Y6RA 1MLDA 4M0CA 1E4VA 2FR8C 4RSGA 4CU5A 2O57A 4QG7A 1XXLA 1OBFO 2G40A 2G6BA 3QM1A 4KREA 2G5GX 2EQ5A 1SUIA 2ZSBA 1MENA 1OWPA 1J33A 1Z34A 1DKOA 4WNAA 4DWWA 4M1MA 5GJWC 2JRCA 1KI3A 1NX6A 3AV3A 4JJ8A 3S8YA 2DPGA 2DQYA 2FWNA 4P8RA 5DSZA 4NFHA 2PYDA 2O2YA 4R2MA 5A5DA 3OT1B 5ALIA 1L4HA 3Q3CA