3T5PA

Crystal structure of a putative diacylglycerol kinase from bacillus anthracis str. sterne
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
298
structure length
287
Chain Sequence
b'KTKFEKVLLIVNPKAGQGDLHTNLTKIVPPLAAAFPDLHILHTKEQGDATKYCQEFASKVDLIIVFGGDGTVFECTNGLAPLEIRPTLAIIPGGTCNDFSRTLGVPQNIAEAAKLITKEHVKPVDVAKANGQHFLNFWGIGLVKAKLGKIGYYLSTIRTVKNAETFPVKITYDGQVYEDEAVLVMVGNGEYLGGIPSFIPNVKCDDGTLDIFVVKSTGIQAFKDYIGKKLFEDSNENDIFHVKAKSIHIETEEEKEVDTDGESSLHTPCQIELLQGHFTMIYNPAVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BmrU protein
molecule tags Transferase
source organism Bacillus anthracis
publication title Crystal structure of a putative diacylglycerol kinase from Bacillus anthracis str. Sterne
rcsb
total genus 76
structure length 287
sequence length 298
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2011-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00781 DAGK_cat Diacylglycerol kinase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.40 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 3t5pA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 3t5pA01
2I2CA 2QV7A 1YT5A 3V7UA 3V8NA 4DY6A 1Y3HA 1Z0SA 2P1RA 2QVLA 4L02A 3T5PA 5DHQA 1Z0ZA 5EJGA 3VZCA 2AN1A 3PFNA 3VZDA 2Q5FA 2I1WA 2I2BA 1U0TA 2I2FA 3V8MA 2I2DA 3V8PA 3VZBA 5DHRA 3V8RA 2BONA 1Z0UA 2I2AA 3S40A 1Y3IA 5EJFA 1U0RA 4WERA 3V7WA 5DHPA 4WRRA 5DHSA 5EJIA 5DHTA 5DHUA 3V80A 4V24A 2I29A 4HAOA 1SUWA 2JGRA 3V8QA 3V7YA
chains in the Genus database with same CATH superfamily
4EW1A 3M70A 2I34A 3W3ZB 1Y48E 2QRHA 4OEHA 2CXQA 4RTMA 3ZDAA 2B0JA 2C9DA 4MQ5A 2EHJA 1RE0A 3KPVA 3PYLA 5ALJA 4LBVA 1N3YA 4TMXA 4TVOA 3DKRA 4HCJA 2OO7A 4HGPA 3UAYA 3FOCA 1XWIA 2C7OA 3ZJVA 3P7MA 1C7RA 1OH6A 1UKBA 3LTEA 2EL9A 4DT1A 4LV5B 2D1QA 1TAHA 3WHKA 1BW9B 1NBEA 2Q5IA 3ENZA 3HB9A 2JGAA 1VBNA 4K87A 4RBNA 3BSYA 3W5HA 1ODCA 1SVNA 4N0QA 3ZI0A 4A0GA 821PA 5CGZA 1ZJ5A 4GX5A 1WS6A 4QQRA 1OFUX 2J0QA 2K87A 6AT1A 2BF4A 2R7LA 4G86A 1A97A 4NPCA 2FLWA 3JRXA 2Z9CA 3FYUA 5KCZA 2WJZB 4JR1A 5DHAA 4N9QA 2XZOA 1YB1A 4JSRA 1Z2DA 4DJ5X 3OQMA 4D0LB 2P1RA 1LPBB 4F91B 2IP2A 2YJTD 3QLVA 4MPJA 5EMLA 1ZNWA 2MMCA 3FYDA 4JR2A 5JPCA 4U7GA 2JK0A 2QD5A 5J2UB 1DQPA 2DR3A 1HLPA 3CVJA 1NUTA 2QVBA 3BE6A 3G0DA 5AK6A 1L1FA 5GINE 3D9QX 1VHQA 1U3GA 3UN1A 1DLIA 3E7PA 5KJ1A 4AZ3A 1JQLB 2IPAB 2JH3A 5AHKA 1FDUA 2VHZA 2QHXA 3KP1A 3W8EA 5EZYA 5FORA 1A72A 1GAQA 4FYXA 4NJMA 1QDUA 3HJCA 1AA9A 1C7IA 1M1NA 3OC6A 5G40A 3WP1B 1TEVA 1L8AA 4CLDA 3SKYA 3OAAD 4TZTA 3WRVA 3SWWA 3HFGA 4FB4A 4Y2UA 2QXTA 1P19A 2R4UA 2FMUA 4PPFA 2Q45A 3CF4A 3HPRA 3IE0A 4DM3A 1HGXA 3RSLA 1MJGM 3IDFA 4CM9D 1D1SA 1XZNA 3E1GA 5JWHA 3MMNA 3DJFA 2WQ7A 5I7EA 1G7CA 4X54A 3UKJA 3H2IA 1LSOA 3BFPA 1T3GA 4DSOA 3IDSA 4MVJH 4UM7A 5LA6B 2FRDA 4NTZA 2CNWD 5L7YA 2IVZA 4RNCA 1T2AA 3RUAA 1SG0A 3MJFA 4AP6A 2LCFA 1D2AA 1NTRA 2OQ2A 3O31A 4KPEC 3LQ2A 4YY3B 4NU6A 1OI3A 2E37A 5SZIA 1E2BA 4UULA 1EX9A 4UUBA 2ZRLA 4Y2YA 4FGKA 4CN8A 4ZT2A 3E9ZA 4GM4A 4P4NA 4JXJA 5EVCA 3FD8A 3LL4A 1V6CA 1RM5A 4BO6A 2VK2A 4Z7OB 1IBMB 2QX4A 2X23A 4KWHA 5HK8A 5TV2A 3P9NA 1GNPA 1H0SA 5HF9A 1V39A 3QJYA 2Y0PA 3PCXA 5JMTA 4YJKA 4DCJA 5IG2A 4JGBA 3KZMA 1EFDN 1QVWA 2OB2A 3ANXA 4G1CA 3M4NA 4XGQA 3ZJTA 4INOA 1ZJYA 1F0PA 3BF8A 3KRTA 4KVFA 4PQRA 3WLEA 4BB9A 2OVBA 2QRNA 3R3ZA 4PHTA 4RK0A 2QW8A 3ELDA 1U0EA 5BQXA 5JI3E 4FZVA 1DBWA 1CXZA 3CX7A 1DHRA 1YDMA 3RC7A 2NO5A 3KWFA 2YJ6A 2IUEA 3PHBE 1FDOA 4L78A 4XYEA 5EIWA 2BT4A 3A6LA 4D8XA 3OZDA 1PT6A 2X3UA 4KAXA 4ZHSA 4R68A 1SVOA 2CF5A 4AKGA 4TTQA 2GA9A 2NAFA 1CUJA 3LQ4A 2ATCA 3G0GA 4RM3A 1U7VA 4JIMA 4X1IB 5DK6A 2VT6A 3LW8A 4IIJF 2RGNC 4XPZA 3C5HA 2PYDA 3KBOA 3VJRA 4NCBA 4JVNA 4RULA 4X92A 2I78A 1L4NA 1OWNA 1A3CA 1YZNA 2XNCA 1D6SA 3LGSA 5HHTA 4IIEA 4IUYA 1E7WA 3BHJA 4K0RA 3G0IA 1MJSA 3D6MA 4QASA 3Q3CA 1QH8A 5AUNB 2V96A 4P5EA 4ZXFA 1DKRA 4JC5A 3RF6A 4X3CA 3ZNPA 2Z2KA 4CIXA 5ICMA 1NJFA 3ZW7A 4XXHA 3WL5A 3RC8A 1GKKA 4O5OA 3MTDA 4Z2AA 1DUIA 1KAGA 1ITZA 4FT4A 1BU8A 3DYIA 3O8LA 1GNQA 1P1RA 1OAKA 2MR6A 4GSYA 2EP5A 2VJPA 1N9GA 2FKNA 1EH5A 3USCS 5D5QA 4B7UA 4Z9FA 1P7PA 1SIBE 2HU8A 3FCEA 5FQOA 4BU0A 4ZKDA 3GJ0A 2OAP1 4R9VA 4OFXA 1Z6PA 1GZDA 4MULA 4M53A 1C29B 3V3TA 5I9MA 4LOHA 3GRRA 2CLKB 5C1PA 1Z22A 4K1XA 4D6XA 5JYEA 4RZ2A 5AO9A 1P2TA 5JAOA 1DP4A 1Z9BA 2OB1A 3A7DA 3EZGA 2GWRA 4NOMA 3OBIA 4DDVA 2C2WA 1Z0IA 3RRJA 4O2BB 1EVQA 4BFUA 1E9CA 1MJHA 1ID1A 2Q9CA 3ZE8A 3HP1A 3K9LA 1FP1D 5KCMA 3H2SA 3HN7A 4YTEA 2VK8A 2W93A 4ZCQA 3V7YA 3KQOA 1AN0A 1X1SA 3EDRA 1MC4A 3KTDA 1RVV1 1ND6A 2ZVPX 3VPYA 2Z8YM 4CE6A 1TNDA 1YVRA 3V2UA 2ERYA 3IB3A 1J70A 1R5BA 3MRSA 1U3VA 3MYYA 3WK5A 1WB6A 2I3DA 3L3BA 3KQUA 3O3OB 3UQYS 1JA1A 1O96A 1UFKA 3C39A 3I30X 3WGOA 1Z0KA 4E4RA 1ODSA 1OYYA 3UPDA 2YHSA 1YE5A 5A9TA 5CDYA 4QU8A 3B38A 3DXXA 2HZBA 2VP9A 4ZI7A 1IXKA 1PKXA 2NM0A 2HIHA 2JHFA 1JDJA 2VLIA 4CU5A 2Z57A 1V3VA 3FVVA 3Q10A 3WGZA 4LQDA 4CF5A 2F43A 5IKMA 1JHAA 3H4VA 1F4VA 1U31A 3S99A 3WMFA 2HHLA 4DMLA 2BFAA 1XKLA 3EYAA 2AFFA 2ZBGA 3LC0A 2DJ5A 3NHSA 5U4XA 3ZOKA 5JW6A 1H22A 1A4UA 4F1JA 1SELA 1VE1A 1I0IA 2DH5A 3MAJA 5BUCA 4A0SA 4AP5A 2UUOA 4HXEB 4FYIA 2XVZA 3D6TB 4EKDA 2J87A 1JAXA 3TNYA 4IRUB 3QUBA 1BXKA 1KI9A 2PK3A 3ETJA 3OPMA 4QICA 3ZLTA 2WWFA 3FHTA 4KJZA 3ETHA 4G36A 3PT9A 4BEWA 4I9NA 4Y8VA 1WB9A 3JWGA 3QM1A 5LDGA 5KU7A 2H31A 4B6RA 4CFZA 3DVSX 1GQQA 4MW6A 1GM5A 2X0KA 4KI7A 5LP6B 3PNKA 3RRXA 2ZXEA 3W5IA 4PLVA 2G1PA 3C7TA 3PQ5A 1PTJC 5L3ZA 4A8JC 5T3UA 3SF8B 3ICOA 1E9FA 2ZZKA 4EL0A 4JASB 1YD7A 1YS4A 2E4VA 3KSMA 4J2HA 3TLXA 5IP5A 2UXDB 4BAUA 4IIVA 1RYDA 1UT8A 1TVKB 2NXEA 2PFGA 1SC4A 1G38A 5DTRA 3SE0A 3A1EA 5FP0A 2R1TA 2YUIA 3LCUA 4EVIA 4C05A 1M5UA 3QG1A 5L6LB 4F71A 2YJZA 3GFGA 4J91A 4NESA 1QQ5A 3SSMA 3TW8B 4YAFA 4OL0A 1ZM2A 3E4CA 3ZE1B 5AYVA 1Q1EA 3FUXA 5CB4B 3LJKA 2WAMA 4UU0A 3WLPA 1INLA 3E8SA 4DQKA 1E20A 2AFIA 4Y6RA 5T4HA 2ZUBA 3G0BA 3CW8X 3JQQA 4BC1A 3I8SA 2V5AA 3P9SA 3VH4A 3HDQA 2QG9A 3IXQA 3KT0A 1T2CA 2C8LA 3P2MA 3R41A 3SG0A 1CY0A 3T35A 2ZVDA 3B52X 4YRDA 2ZPUA 4OGWA 1D2RA 3JZAA 2RGUA 1C9DB 3DBRA 4LY9A 4C4OA 2JQJA 1TRHA 1O96B 4C2AA 3H18A 3EISA 3OJEA 4KYVA 1LX7A 4XRRA 3CWCA 1K8QA 3KHTA 1YF3A 2GGSA 2N47A 2X40A 2XQGA 5BR8B 5JJKA 1YC5A 5EYPB 4INAA 4NZMA 2BFPA 5CB6A 5HQJA 1MENA 1GQOA 3IVMA 1DUVG 4EMBA 3R5KA 4RGBA 1B8OA 1KGDA 5E2BA 1JILA 1XDBA 3U0BA 1W4LA 3V1MA 1YCFA 1E0JA 4BYGA 3U37A 4W9RA 1IM8A 1BCRA 1T4MA 3DBHA 4M1OA 4PLYA 1Y6ZA 4Z0HO 5JAHA 3AKZA 1A5SB 1CR6A 3GNQA 4LISA 1EXWA 4RMIA 5DJ5A 2HMAA 4YH1A 4HVCA 3JYNA 4NFYA 3T9EA 5JALA 1V1RA 3DMHA 2FW0A 5IJ9A 4D56A 5AD1A 3D1VA 2VP6A 1SCJA 2OC4A 2XQJA 2P9JA 1YQTA 1E3WA 1VIYA 3HHPA 3PDIA 1PJSA 1VKJA 4JIWD 4TV8F 3ZWBA 2WG2A 3TF5A 2QUHA 4MLDA 2ZFUA 3THXB 1N6LA 1LRJA 1ML4A 2X7XA 3PXUA 4U0JA 3OTWA 1PGOA 3EVGA 1BKSB 1Z75A 3G68A 2OHGA 3O4RA 3VZBA 1T3SA 1YK0A 4Y6OA 4AMVA 3CVVA 1JQBA 1UBFA 2XNDD 2WUDA 1IOWA 1Y6JA 3KYCA 3R77A 4J1TC 4B6GA 1T5DX 1QC5B 4MX8A 5FULA 3A27A 1J1IA 2PLAA 1NYLA 4DXDA 5AI5A 3MTQA 3L8GA 5B1SA 1ZLXA 3IEKA 5KDOA 5ENVA 2QD1A 4B4WA 2XUDA 3WLOA 4C04A 3HXQA 2AJCA 1R6DA 1FXSA 1TK9A 1M10A 3ESRA 3QKRB 4UHCA 1CIVA 4HXGA 4K7JA 1JDNA 3PFKA 3U80A 1P81A 2P1DA 2ZROA 1GQRA 3BJRA 4RVNA 4EFNA 2PL5A 4HDSA 1YQWA 2R6FA 4LFCB 2Y1CA 4LVCA 1K3NA 2MSWA 4F5EA 3IURA 3JZFA 2O8DB 3L1HA 1NRXA 4PX5A 6GPBA 4CCYB 3UGJA 2JGMA 1U3FA 1XLVA 2BKXA 5BT8A 3OAAA 5EP1A 5EJ4A 5AJYA 4EENA 3FFXA 4WZZA 1EE1A 5KOYA 1MN6A 4ZVLA 1WDWB 1DSSG 2ZJ0A 3CX6A 4LVNA 4JU9A 4U2FA 1PZEA 4J2TA 5IH3A 2JCBA 1EFVA 4UBIA 1VFNA 2M6SA 1P29A 2Y05A 4MMXB 4PAGA 3UGKA 4B34A 5BYKA 4I4NA 5ILQA 1XTPA 2Y1XA 1NW8A 3UOTA 1S7CA 1SQ0A 4M9ZA 4KO1S 4B6OA 3ROMA 1NW4A 2P5SA 4DRXA 2PXHA 1GZ7A 4KXWA 5FTNA 3RBAA 4EUFA 3PFNA 3ABRB 3KL4A 4BNGA 3PPIA 1YR2A 5EMNA 2C31A 4DREA 1KQOA 4C2UA 4MW2A 1ELOA 1C1DA 4BYMA 5LP6A 1WZ2A 1PJZA 2VC2B 4FOSA 4MGIR 2I2AA 3O7MA 4H6PA 5A3SA 3DHNA 4B2LA 1UKAA 3FPBA 1KYTA 3L49A 4A8JA 2I6FA 2OQRA 2P3QA 2B8WA 3V55A 4EFMA 2FOLA 2WD9A 2ECOA 1RM0A 1DC6A 2DSNA 3CV3A 1RBMA 2E6UX 4DQ0A 3I45A 5HQTA 1JZQA 4K6KA 3PVZA 3LWNA 4ZVPA 3S7ZA 4BEVA 2XMCA 4ESHA 6CHYA 1MF7A 5J4YA 1REQA 5CLLA 1VPEA 4HDCA 1HDGO 1NQAO 1XEXA 2WNHA 1FNBA 2DC1A 3DLAA 4BTVA 3NRCA 3Q8WA 4Q4HA 3ZDYB 3S7TA 2E3JA 1ESCA 5HKBA 2H2FA 3PD1A 1T3LA 3T7AA 4LOIA 1EQ2A 1PEAA 4EG8A 5FEUA 3RUEA 1L4BA 1I9CA 1Q14A 3C3DA 1IJFA 5CXXA 2NXJA 3L93A 3ZJ4A 4A82A 3SXJA 4IJWA 3KUDA 3BWYA 3CJTA 1NG9A 4QHTA 3D4PA 3H11A 3FTDA 3GDWA 4FCWA 5A5GA 5AM3A 2PGNA 2AG8A 3ZKWA 2OT3B 1E5LA 1YIAA 1FYDA 1KA9H 3JAMA 5CXSA 3V1UA 2BH2A 2ROQA 1LDMA 4BV3A 2Z3ZA 2F3TA 4J3NA 2WI8A 3K09C 3KKQA 4EABA 3DZBA 5K09A 3WYAA 4GSLA 4ZT6A 1UQUA 4H1HA 4HQNA 2VP4A 3AM3A 4LX0A 4DOMA 5CA0B 3NMUF 4FNAA 4ZIRA 1UWLA 2C59A 2Q0SA 4LWZA 3EZFA 2R97A 4QEZA 5AVXA 2Q6TA 5FYDA 5J2UA 1MJNA 2YHBA 5J5CA 2M1XA 1AGYA 2GYVA 2J3DA 1WO8A 3EIWA 4WEOA 5FTMA 3P8ZA 3MGKA 4ZGGA 3I5XA 4WVLA 1XDZA 4RD6A 2V3WA 3NHJA 5DM1A 5BRNA 4Z4GA 2NU7B 3L6EA 4PC2A 1EM8A 2VF8A 1BJTA 1CZHA 3B6JA 5EIAA 3PQ8A 5ES3A 4F9TA 3ZBPA 4KLRA 3MRVA 1NN1A 1T6XA 1WCIA 1LVGA 4Q1VA 4Q48A 3CURA 3V7NA 2GBLC 1EX1A 5DXFA 1TL7C 3WNVA 3QUQA 3GLGA 4TQ9A 2R8ZA 4N6NA 2GASA 3DVQX 1O77A 4M1KA 4O4HB 4ECEA 4LDRA 2H18A 4UU1A 4IIYA 4TLLB 5AJUA 3EPJA 1ULUA 2MWMA 5LXTB 4FHEA 4YRNA 2B25A 3UXYA 1R9NA 4JDPA 3B78A 3ZUGA 2PBRA 3L4JA 3P5BA 1H6DA 2FEAA 1DC8A 1GP2A 4MV5A 3COZA 1LQ2A 2YY7A 3UATA 1X80B 2Q3LA 2MSKA 1CY4A 3C7CB 1KY4A 3DS8A 4RABA 5THKA 1TKCA 4DQDA 4P81A 2WYUA 4XR4A 4MRVA 3EFHA 2H5LA 1N8NA 1YS9A 2JD0A 4RTSA 4H7IA 1C30B 4LDAA 4LDPA 4AYWA 2X0DA 2Z8ZA 2YXDA 1HNZB 4ZJYA 1KPGA 2NO9A 2VP5A 1UPUA 2BUAA 1LY1A 1K7CA 1W2WB 4BMCA 2RH4A 1XTZA 1RC1A 1XAJA 3KEQA 2R6HA 1BGVA 1C4OA 4RIIA 4Y6PA 2FLKA 1I14A 3H16A 2ZSDA 1PWZA 1W8IA 3HRIA 3PQ7A 4YACA 2XX3A 3LVRE 2IEZA 5LVAA 2OENG 4ND4A 4DBLE 1XTRA 1PWHA 5THXA 3T4XA 3ZDZB 2R5NA 4B3TB 1LI7A 1PEDA 2WUGA 5JDIA 2QPAA 3FDZA 3V80A 1FFWA 2V3VA 3IAXA 4M37A 1NATA 3DHEA 4K3VA 2OGWA 2P2CA 4LQLA 1BE8A 2WVJA 2IP1A 4LOJA 3S70A 2HB6A 4MYUA 2UKDA 4ER3A 3D6JA 1ACLA 3LYHA 3WO1A 1WIWA 4JBIA 2QMZA 1TQ6A 2HTFA 2RHGB 3I32A 2I7VA 1H6BA 4XJVA 3EVZA 2RG1A 1IY2A 3JSAA 4CQMD 1G8FA 1MT3A 1ZK0A 1QE5A 1RTTA 3T94A 5K6TA 4KUHA 3NUZA 1E5VA 3PUYA 4IMIB 3U7GA 3WGGA 1C2TA 2BFNA 2FP4A 3E9NA 4MQUA 2LBPA 1BWRA 4MQ4A 4OLJA 3B9RA 1IXRC 2QUIA 5BR7A 1Z26A 1KI1A 1GA6A 1LW6E 1P74A 4KDCA 4P38A 2DFPA 4XUCA 3RIHA 1E1MA 1FEZA 4GI7A 2W22A 5L95A 1ZK4A 2GESA 3DMDA 1T5IA 1MD9A 3VBEA 1MVNA 4DY4A 4ED9A 1CP2A 4M7RA 2IW3A 2PU5A 3IAUA 3ROFA 4B8YA 1U2DC 2AD1A 2P3LA 3DEAA 4F72A 2CLCX 2POCA 1I36A 4FXOA 2PRZA 5EKTA 2EFDB 1CS4C 3DCJA 1LK0A 1AK1A 3P4YA 4BLUA 1A9YA 3PNLA 5KPDA 5KVSA 5E6SB 1KXJA 5ERGB 4IY1A 3WGTA 3LNCA 2IXGA 2WT4A 4R84A 4WBSA 3S2IA 3A3OA 4JKOA 4TTRA 2WC1A 1PV4A 3NHMA 3FGNA 2B0CA 3MFQA 4RC9A 3WLIA 4H7EA 2YJ5A 2BCGY 2P4EA 4P36A 4A6PA 4CV1A 2GCEA 2I9KA 1HNWB 4RCZA 2P4SA 4BRUA 2JCVA 2GD2A 3EQ9A 5DULA 4JZYA 1L3BA 1HE1C 3UMMA 1QCDA 4KFUA 2NN3C 2AGVA 3DM5A 5H1YA 4B17A 5D6NA 5EJEA 1O0BA 3FMGA 2D1TA 4AXXA 4UPEA 1NKTA 4TKUA 1UDXA 1N57A 3FCSB 1ZNXA 1D6JA 3HMKA 3HSSA 3MD9A 4L5JA 2Z5VA 4F9FA 4QOIA 4E5YA 1Y3AA 3TSAA 2KBFA 1Z5UA 4J7UA 1QMPA 3O93A 1ZGAA 1QTQA 4CT0A 3EEQA 4HS4A 2F9LA 4G89A 1PR3A 2AMFA 2C2OA 3GLHA 2WWVD 3U4AA 4KSYA 4PPQA 3BEOA 1TQHA 3E7DA 3VU0A 4IIJA 4ACAA 4JOQA 1N8KA 4GFDA 1X2BA 4UEQA 3B1WA 1Q50A 5SYAA 4WFJA 3AF4A 4CCSA 3NTQA 2Z6VA 3UF0A 4MW7A 4C76A 5F76A 5H8WA 1RRMA 4GOLD 3O92A 1HYQA 1FQOA 1MDBA 3OUTA 1YSCA 4RVUA 3U09A 1T5HX 4BKRA 2V65A 3I12A 3DSHA 1JBEA 4BX3A 2BI8A 1FNDA 1MK2A 3AF2A 1L7DA 1DFIA 3K0HA 4BP9A 2HQ1A 3OIGA 2W7TA 3WB1A 4DZRA 1BS1A 4NCIA 1Y42X 3SHOA 2JQLA 1XZIA 1ZNQO 2B5WA 3GQVA 1R6AA 1T6YA 4GPEA 2NVWA 3DZIA 4F3KA 1IVNA 2JA1A 3PEWA 4R1OA 1TUGA 3DKIA 4IFIA 3HU1A 4PONA 3NRJA 1SCDA 4AVYA 2QA5A 2Y71A 3NBQA 2C2MA 4G0VA 1IC6A 3HYLA 4W5RA 1VIAA 2FFJA 3R3YA 3AHDA 4EW3A 5SZJA 1LU9A 4BO1A 5BVHA 2A5LA 4HF7A 1KYYA 5I9IA 2GETA 3TRHA 2X22A 3T99A 4RTKA 4QJ4A 4DR1B 3PBKA 4A8HA 2DEUA 3TB6A 1P80A 1AB6A 5CM8B 3JQAB 4OJYA 1PD0A 4ZOLA 4BN5A 2IDZA 3U7EB 3GO4A 4DM7A 2D54A 2QF7A 5FFMA 1EWTA 1ECLA 1W29A 2QAIA 1PF7E 1ZAYA 1Z28A 2RGWA 5JRJA 3KOYA 2D2FA 2PANA 4OF4A 2B83A 2I1VB 3HJUA 7REQB 1BQ4A 1SUPA 2MR5A 1AB5A 1NLMA 4UATA 4PG5A 1XZCA 5FTWA 1X94A 2ZT6A 1K27A 2VYVD 3TB4A 5CEEA 2BE9A 2QVLA 2GBGA 2BFOA 3EIFA 4W5HA 5AK3A 3WRYC 5CFQA 3T1HB 2ATVA 4Z4IA 1CP3A 5COBA 4JI8B 3GVXA 4C78A 1HFEL 3MWJA 1QIEA 5DF1A 2C54A 3DD5A 1JF8A 3PB3A 1PVDA 4IS3A 4AB1A 2JFBA 4PR3A 2PKYX 2XBMA 4O1MA 1OZGA 4C7VA 3WTBA 4YV0A 5IVKA 3QE4A 4KYTA 3N8IA 3KKKA 4FKZA 5G0WA 5B5SA 1YQUA 2FSGA 3RT1A 4F60A 2R7MA 1XDGA 4YRZA 4HNTA 1ZL2A 2I2XB 4YMSA 5CXUA 3KQYA 1J1UA 1UOQA 1JA0A 5BSTA 3T7TA 2JAUA 4IUDS 5LA6F 1SGWA 1YJMA 2EXXA 1DJMA 2R84A 3RFVA 1E96A 2PUTA 4QOSA 3O1HB 2CW5A 5IUNC 2IZOA 3T61A 1H1LA 1SWVA 2IKQA 4U9IS 3U1TA 1EZ4A 1B6SA 5BT9A 2B35A 4AK9A 4MDEA 1T1JA 4MRNA 1QZUA 4Q66C 5EHQA 1QHFA 1YJQA 3A3PA 3UHJA 4HRAA 4JDUA 3LOUA 4UFOA 4O02B 2P2NA 5FUQA 3OZGA 2W6NA 3BA1A 5EVJA 5JC1A 3GDGA 3BGVA 1SVSA 1IEXA 1RYFA 1QHYA 1ZM3A 3GGGA 1X77A 3HZRA 2EP7A 1W5TA 4IM7A 4UHFA 4HKTA 3THRA 4EUSA 5DGCA 1XVAA 1C3JA 3RRNA 4UNPA 4EL5A 5KNCA 3DOOA 7ABPA 2HU7A 1XZMA 3DDSA 3JVDA 4WL0A 1OC2A 3IX7A 3QY9A 1S2LA 1T13A 2EAUA 1KVRA 3M3PA 5ITSA 3ZHBA 5ALXA 4BCDA 1XN1A 3P0JA 3NZEA 4YVFA 3NT4A 2IZ0A 5FOSA 3WY9A 2WQ6A 1WM1A 3IELA 2MSLA 3IJ5A 4DSNA 5AOBA 2FPKA 2FV8A 1QIJA 1JVNA 1C7FA 3BPSA 2X1MA 3K73O 3W7AA 2JFWA 4YALA 3EFOB 4AJPA 5EJ6A 1FF9A 2HSEA 3R7NA 4C4XA 3VR5A 4Q9LA 1A04A 1MU0A 3OETA 1AOXA 2AF3C 2RMKA 3TDMA 4R7ZA 3ST7A 5FUMA 2CD7A 3L0YA 3L0SA 3LY5A 4HGQA 2G5CA 2ZI5A 1AGNA 1U0HC 5K0SA 4B4DA 4OHMA 2XA9A 4X7MA 3IIMA 3MJRA 4I4TA 3R3WA 4Q1FA 3W2IA 5JH7F 1D07A 2PO7A 4TLMB 1L5NA 1I5EA 1FDIA 2GPNA 4QJ5A 3DF7A 6LDHA 2ZP1A 1U90A 2OBXA 4LKRA 4S2UA 2IQ5A 2L2QA 3AFMA 3OZBA 3SZRA 2YIDA 4EFLA 2YQ4A 4MKFA 3JQDA 3GARA 3C3XA 4EY4A 4ZI3A 2W6JD 4MQMA 3PD0A 1GLVA 1KFCB 1TO2E 4YAWA 5CFLA 3NEJA 5FWYB 3MIIA 4YGXB 1PS8A 1F2DA 3VVBA 1IVYA 3E3LA 4KLZA 5KYVA 2GEFA 3OLCX 4L4XA 1MG5A 4B4KA 3VZSA 3TL2A 3RUIA 4I66A 4R05A 2ENWA 1YZ3A 1A5TA 5CBPA 1SOMA 3C15C 3PT5A 4TLCA 2ZBEA 3UJ6A 2ZQ5A 4DQXA 3ADDA 3E1KA 2H8KA 3JQ8B 3KL2A 3AXSA 5ADUS 3AJRA 3WDLA 3H3FA 1U1IA 3IXLA 4CKYA 5A7HA 4C2TA 4B8WA 2VBIA 3MWGA 3QU7A 4I2NA 2HCTA 2UZ1B 4A3SA 4BX2A 5FV4A 2R0QC 4MROA 3J7AC 2JFGA 2YWBA 2DHCA 3I72A 5ALGA 2P6OA 1R4NA 5CLJA 1V3UA 5FWXB 3DL4A 5K5EA 5GY7A 2Q50A 1I33A 3C7AA 5C35A 1MH1A 4BB6A 3NUQA 3CA8A 4EECA 1BFKA 5K0LA 4M0CA 4IGIA 3I6UA 4RU1A 1QYIA 2D5CA 3C1TA 1LBQA 1U02A 4R9SA 1LLQA 3H84A 3F7OA 3X1KA 5JHGB 2P6NA 2XT9B 4RZXA 3ELSA 1GOTA 1N7GA 3JQ8A 1FDSA 1ZH4A 4P8RA 5TXGA 3WYDA 4IDAA 2LXNA 2GYUA 4UBLA 1L9XA 4EX7A 5BPHA 1X1BA 4R2WA 4RAQA 5A4KA 1WW3A 2HGZA 3MOGA 3L07A 3ZVNA 1B26A 1WPRA 3TPZA 5JDCA 4M1ZA 1ZM7A 2YCBA 3G7SA 2FSHA 3L0IB 1I3OA 4BPBA 3G8AA 1G5QA 4GYYA 1U9YA 1TM3E 1PT7A 4U5XA 3RS5A 1NXVA 2HHHB 4DJTA 3KOUA 1X8XA 5IT0A 4DVGA 4MUAA 1QH0A 1NVXQ 2J09A 4HJRA 5TMDA 3UJCA 5GVSA 2GF9A 4N5IX 2G70A 2J0SA 3O8CA 3O9VA 4PSCA 3USES 3ORYA 4UCWA 4MPPA 2OSBA 5C5DA 2JIQA 1RHUA 3FF4A 2HUNA 4RZUA 4RJIA 3MCWA 1MXFA 2ETVA 2AR7A 3EAGA 4V3BA 1CJKC 3A4LA 4PG6A 5BNFA 2OK8A 4MUBA 4YRJA 3BL8A 3PGXA 1N2HA 4TTVA 4W1PA 3EXAA 3BQMB 1MRZA 4LVUA 1WW2A 2FN9A 2ADMA 1EX6A 3L1VA 4XGRA 1OFGA 5F4ZA 3VFDA 5BURA 4FILA 3ZC3A 1E2LA 2WM2A 5LOVA 1NHGA 3E9YA 1FLVA 2RHHA 4LRYA 3KSDO 4KXXA 2AS0A 1ZO8A 3E58A 1CRPA 4P5PA 1NVDA 1PNRA 4N7RA 4OK5A 1NVEA 4EGFA 4D44A 1UK8A 2HCBA 1QGED 4H08A 3RKSA 2E0IA 1GTG1 2Z8XA 4UNNA 8LDHA 4AO7A 4BKUA 2X8AA 3HFSA 4JROA 5CB4F 4CR8A 2G1JA 3B8EA 5JCOA 5FX2A 4S24A 1PGJA 3GUYA 1RE1A 2PR2A 5DN9A 1V9LA 4YP6A 1IZ0A 3R6TA 1RI4A 1DWPA 2GXSA 2I99A 2NU6B 2X9GA 4OK3A 1RADA 4X7BA 2BIFA 5D2CA 4O6VA 4X7RA 2W42A 1GYQA 4MI3A 4JFRA 2WY2D 2B4AA 2F3QA 2JJ1D 3DTYA 5K3SA 5CB8A 1G6HA 1WNTA 2BKVA 3JZDA 3K0AB 1WB4A 3PQCA 2G77B 3N05A 3SSNA 1Y1PA 2FPXA 3WMEA 2G28A 3HEMA 4G8JA 1G3GA 1F12A 1NRIA 5J4VA 2EKPA 3HBFA 3LHFA 3VKWA 2YIVX 1CR1A 1LBSA 1BS2A 3ZWAA 5L3SA 2BFBB 1UPTA 1T34A 3MIZA 2CK3D 3TZBA 3B6EA 3OTOB 2YICA 3K9WA 4Q82A 4WVFA 2XT6A 1D2CA 1M67A 1W2GA 3A26A 3RFUA 1J8QA 2YYSA 4WEQA 1JQDA 5DI3B 5G41A 3C1UA 1ZU5A 3CG4A 1D2HA 4KIWA 1KEZA 3D1JA 3QUSA 4WV3A 4D0GA 2O8CA 3UQZA 2JGEA 2O0JA 3JPYA 4DRXB 5I7HA 1T8PA 4EY8A 4ER7A 3GRPA 1Z6AA 1PJ8A 1EB8A 1OBCA 2EOAA 5EKXA 3G2MA 1X1CA 3O91A 3FG9A 1BGWA 3IBYA 1JFVA 4F2HA 1MB0A 1QUEA 1U7HA 4F3CA 3IQIX 4DCCA 3TOSA 4M87A 1W8DA 3CO0S 3NI2A 3U9LA 4TYYA 4Z4QA 1CZOA 2FPUA 1PLJA 3W6NA 4HZUB 3U7FB 2NTVA 5K3DA 5AH0A 3QSYA 4MA0A 3TQHA 5JISA 2JC3A 3AY7A 1IUKA 1ISPA 5EHGA 2FI1A 1L5RA 3TI9A 2OQIA 2VUHB 4BX8A 5HJ2A 1XNQB 3H5IA 4G67A 4OP2A 3TCKA 3AI3A 2AR9A 5LA6A 1CJVC 2HWUA 3LO8A 4NOLA 2X5NA 2Z0MA 3VISA 5HVNA 4DMRA 3U7IA 3ORHA 3NT2A 1JIXA 1T2DA 5K8VA 4PLGA 4ZALA 3T7EA 1B3RA 1QFMA 3PKJA 4YGYA 5AM2A 4X1OA 1ZEJA 1BNCA 1D0VA 3MA0A 5LIRA 1RLTA 2WD7B 3VRHA 2GCOB 3TKYA 4D2IA 4DIUA 3H1TA 2YINC 4OJQA 3UENA 1CUDA 5FBWB 3IIKA 1M1ZA 3VUFA 2FUEA 2MYTA 3ET5A 2RHLA 4N7JA 4BGUA 3S55A 5DSTA 1K5GA 1NNSA 5ERXA 4IILA 1I6WA 5CA1A 4MP6A 3SQDA 1GN8A 1M33A 5DBIA 2HBQA 3HBJA 3NDJA 1E64A 4F7WA 1XZAA 2DPLA 4NNOA 4ARBA 2D4HA 4D9IA 3AHGA 1G7RA 3VR6A 2VDMB 2WM3A 2VXCA 4CM4B 1EINA 4MS4A 1A1SA 3A05A 2AN9A 2PRSA 1SBHA 4RHTA 521PA 4H7HA 1XAIA 4GU5A 3K1YA 3I1IA 2Y1LA 3KTFA 2FFBA 1I7DA 4TWRA 4TV9F 3Q2KA 1Y9DA 1TU3A 2GZSA 2X2FA 3CZCA 2VUUA 3PTZA 4WBNF 3URKA 1KEEA 2QSJA 1RLIA 3P9KA 3O8QB 3O83A 5DSXA 3AR4A 4H6VA 2X86A 2ILVA 3LUGA 1PJQA 3DO8A 3TTUA 2UZ1A 3C3YA 4QEDA 3M5CA 1CUBA 2WHPA 4N3AA 3EPLA 5AKHA 3P9YA 3B82A 3LK6A 2PZMA 1ZISA 1KP2A 2ZWAA 4D3YA 1JWLA 4HMQA 1N2SA 2JVJA 4D97A 4G8CA 1PR6A 5FAKA 4HEHA 4Z2YA 1TCVA 2KI5A 1XU7A 5CVDA 1NYTA 1UPBA 4RHCA 5KREA 2O1XA 1JHPA 4WK4B 3HX1A 2C0QA 3H99A 3KV3O 1BU5A 4MLCA 5GOZA 4BZQA 2C00A 3OLVA 1OF1A 1OLSA 2PWYA 2UU9B 2A94A 1NZDA 2AN4A 4B6JA 1V25A 2JJ2A 2YIMA 3IPXA 4LOAA 3H97A 4BXOA 2O6LA 1CX9B 4Z0NA 3IQFA 3KQQA 2I3GA 4UREA 3VAYA 1PGQA 5LJIA 1R88A 1QQ7A 2RAUA 5ELLA 2J9XB 4IIXA 3C8UA 4NVRA 3QWFA 5CH8A 1G88A 4HK4A 1P4GA 3K8YA 3S1AB 2HSZA 3C7DB 1HX7A 2H65A 2VYFA 1VLMA 4IV0A 1VG0B 4DA7A 1EK6A 3O4FA 3RSFA 2AX3A 3ORFA 2GK7A 3AGQA 4AZ3B 5A0TA 3WQRA 5I7WA 1J5XA 1YQDA 2G09A 2WF6A 2PD6A 3L05A 2NQ2C 3AIIA 4DV1B 1L5QA 3RWMB 4QBHA 2CJYA 3K7EA 3GHHA 3KJXA 4IWNA 4IPTA 3TSCA 3P0HA 2ANCA 2VF7A 4N1AA 4B74A 1AKYA 4RA9B 2WFZA 4DUGD 5LL6P 2WHEA 4LXIA 4JI0B 1EFRD 1JU3A 4NYJQ 3O4IA 1KIAA 3PC3A 5TPWB 5TGZA 3HDJA 4EF4A 1XVIA 1E59A 4YDQA 3ENVA 3FHOA 4PHFA 4E5NA 2M6RA 4EI9A 2VDOB 3OJCA 1JTVA 1GZ5A 2IE0A 3D0QA 3GRFA 1BW9A 3THSA 1L3IA 1BYUA 4O1HA 1QF9A 2HLNA 3BJIC 2EQBA 1FIUA 4Y2TA 3W2EA 1TAGA 4IQ0A 4KZPA 7GPBA 3FPLA 1IM2A 4RDCA 5ESWA 3RI3A 1VMDA 1GA1A 2V1XA 3OLXA 4KW7A 1JVBA 3SIPA 1OILA 1WE2A 1JSLA 1FLAA 1KERA 1T5TA 2RGCA 4K6OA 4QGGA 4P53A 2O8NA 5FBKA 1F4LA 3DL7A 2PVCA 2ZR0A 3T0FA 4JODA 1CF9A 3TR5A 1ENOA 2ZIUB 3RIXA 3EQ6A 3KOXA 1URPA 4QWMA 4BE4A 2VBCA 2ZDHA 1ZITA 4EHIA 2ZGVA 2PUFA 1E6LA 1KBZA 1XRMA 1MXHA 2FPRA 4GVPA 2GK3A 4E2WA 3CN7A 1JHMA 3MHTA 4X61A 1W73A 4HPJB 4LJYA 2X77A 2OG2A 5DOVA 1P33A 2XGOA 4OI1A 4D79A 4WOJA 3TVTA 1AKMA 5KTPA 4N8EA 4EZBA 2XV1A 2VOEA 3VHQA 1GTMA 2EZ9A 2Q46A 2YWEA 2NUTA 1B73A 1GVHA 3T5BA 4DMCA 1KFJB 2X9VA 4U63A 4F04A 4A1FA 1QP4A 3I5AA 1ISFA 1MQ8B 4PINA 4BJ5A 5D3MA 3R0ZA 4I1VA 1QDEA 2VDLB 3FOBA 1T5SA 1TAQA 5JAMA 4NZZA 1CIPA 3QEJA 4BNZA 4ZOCA 1CB0A 2MSCB 3JAKB 2V03A 2VBGA 4YJ3B 4YC7A 1BN6A 4I7EA 2ZSEA 3GDOA 1IJKA 3OEED 5HUQA 4B6FA 3W6OA 1JB9A 5CDFA 4YCAA 2M32A 3VDNB 2RI6A 1YI1A 1KR5A 4IOMA 4LXUA 2OP0A 1Q5PA 3A8TA 1EESA 3LLCA 4G63A 3KWLA 3GGJA 4QOEA 1SXJB 2PLWA 1MBZA 2GZ3A 4UD2A 1DU4A 4C3ZA 3SM3A 2NO7A 4EM6A 1W4AA 3WP0A 3M4XA 4QEKA 4LV6A 3W8FA 1KS2A 1P5JA 5ILGA 4E09A 1MO2A 1YIDA 1ZOOA 1CJCA 2A9VA 3C74A 4FR2A 1QAMA 4KR7A 3ZDRA 3O3MB 2F2TA 5IDYA 2XHEA 1TPZA 1FBNA 4AF6A 1E66A 2JIZD 2IEIA 3EIUA 5C4VA 4QNNA 2PUCA 2J07A 2Y1GA 4NABA 3BRCA 3DM9B 4REQA 1L5VA 1V71A 5J2UF 2K2QB 4X62B 3LUFA 3IPLA 1NJ1A 1A9SA 1B0ZA 4HAVA 3HZOA 2P6MA 2PS0A 1RACA 2JVIA 4EG1A 5LZ5A 1MH9A 4LRQA 5B55A 4JKYA 4XWTA 4W9MC 1E1RA 3AUAA 4BVBA 4C21A 5I7SA 3IAS6 4BAGA 4C7KA 1XGKA 1L4KA 2SKEA 3OFSA 1L5GB 3WGYA 5T7BA 2A9FA 4WASA 4IICA 4ND5A 4ILEA 4V0ME 3QI7A 3RJ5A 4ACBA 3KB1A 1WXFA 5DRYA 5FOWA 1E4OA 5GADl 4EG7A 4ZQGA 4J0DA 4KK3A 5EPEA 3BREA 3AEUA 3BTVA 3ZXUB 3EC7A 5E2AA 4F46A 4ZDKA 5JV5A 3FOFC 4G0XA 3TEFA 4BFLA 1M73E 1K92A 4ZMSA 1ZUD1 1G66A 1NDUA 1NVMB 2V3CC 3HJNA 4BDSA 2AOTB 3AB3A 3BRSA 3GGCA 4MLZA 3JQAA 4Y2VA 4ZOLB 3I2IA 2XTZA 5BMVA 3H2GA 3SR3A 1TUBA 1WBJB 3FKJA 2DECA 4GC9A 5G1OA 4W7IA 1QO0D 1HDZA 2D2EA 1OI2A 3BE4A 3IQXA 4PCUA 3H0KA 4YECA 3WRYA 1DG3A 3GIDA 2QNRA 1TIKA 3DLHA 1X1EA 1KO7A 4JN6B 4LRXA 3LFHA 1E3MA 2V7GA 5CEFA 1NF9A 2VH5R 1LGQA 4J4TA 4PYNA 2PEZA 4LTNA 3FVTA 3FYCA 4QDUA 1AMOA 2XCOA 1STOA 1CUFA 2ONCA 2QG6A 3PXDA 3L7KA 4IP0A 2XQVA 5FWDA 4ALIA 4LJ5A 3LDFA 3P2EA 2E5WA 1W0KA 1CJSA 3BH6A 4CIDA 3CNBA 3LF1A 3O4GA 4PYIA 3RAPR 5F33A 2JLSA 4FJ1A 4NICA 2LGJA 1DXYA 4UHEA 5DYGA 3SHFA 1YONA 4UW9A 2I2DA 3HRHA 3V1NA 3U44A 3G1UA 3GEDA 1GCAA 4II3A 3OU2A 4D6PA 1YCHA 3DXFA 4LGYA 1ECFA 3BM5A 1C8LA 4QLBA 2IYOA 5K8LA 3P32A 1AQYA 1BS9A 3R5SA 4ASUD 1MQ9A 3S1LA 1QK5A 3L84A 2W5UA 3VU9B 3QX3A 3COPA 3H13A 4Q39A 2FZ5A 1IN5A 5DM2A 5B1EA 2F4VB 3IUPA 3FDJA 1QX4A 1N34B 1E9DA 3W2HA 1CUIA 3G2PA 5J1TB 2FP3A 4DA0A 2GSWA 4YUWA 1B6RA 3R7WB 2P9GA 4MGZR 5BRJA 1IE3A 5A5DA 5DHQA 3ZZTA 3N39C 3W4KA 2BTQA 2VHTA 3ROZA 4BNFA 3B1VA 1WCYA 3PXXA 3ZHZA 1FMTA 1FSFA 1FS6A 3L02A 1AUQA 4FGSA 2ZIEA 1BDHA 3G8DA 5JZVA 2O8FB 1CQJB 3FUWA 1NX6A 5F9MA 2B9EA 3K4HA 8ABPA 4AZVA 2JH8A 2UYQA 1ZD3A 2PWAA 2VTVA 2QGNA 4JLMA 1Q77A 2XADA 2A0YA 5G4LA 1DCFA 4BV8A 1AQIA 2JCGA 4B4OA 5H81A 1VMKA 2YNMD 4P3KA 5GJBA 3Q5GA 2B36A 5REQB 1T2VA 4MYHA 1U8CB 2FQYA 1E77A 4LK3A 1O95A 3FWHA 5EE9A 1KK0A 3DPUA 3N2NA 3GGPA 3QZUA 5TDHA 4R51A 3LRXA 3VJMA 1DV1A 1E58A 3BWDD 3D5QA 1CETA 1UQRA 4OUDB 5C8VA 1LF5A 5KSOA 3LWDA 4YFYA 3FSEA 3AL3A 3NAZA 4O2BF 1LC3A 2DE0X 2GJ9A 4FT2A 4PRKA 5CK5A 4Z6KA 1F7VA 1N5RA 4ZP1A 2QX6A 2ST1A 5CFMA 3SS7X 3ABOB 1M2FA 1JR6A 1TT7A 4TSFA 4CF3A 3EVTA 3DSRA 2FX3A 4BNMA 1FMJA 4ARZB 5I9LA 4LDNA 3HR7A 1N0UA 3WLAA 4GXQA 4Y2SA 3WB9A 3KXDA 1IBCA 3QLEA 1VSBA 3DFUA 3T1VA 4CLOA 3MOIA 1L7MA 2LCIA 2WINI 3G88A 3CXRA 3I9MA 3ONDA 2DKOA 4IVQA 1YAHA 4L8GA 4L74A 4WCVA 3FKSD 2AJDA 2YHIA 4B3GA 1G16A 3W1VA 2RHWA 1JP7A 1HFWA 2YHUA 2UUBB 2FGJA 4DG8A 3OPQA 3CFYA 2ID8A 4D9GA 2XRMA 4LA4A 5ERYA 2PKWA 1NW3A 3NBFA 4FNGA 4G65A 2RB5A 4HQKA 1T1EA 2WSIA 2WYVA 3TLZA 3WG9A 1ADCA 4E5DA 1W7AA 4DDMA 4U02A 3OQ1A 4YJHA 5CVEA 3IMFA 1JG3A 4AJOA 3INNA 3CLUC 2BEKA 3L01A 1BCRB 2BJHA 4OQDA 4UVGA 4ZAZA 4C7XA 1EFRA 1W19A 3K70D 3L7NA 1P1HA 4IXTA 4BMYA 2XCUA 1UDAA 3DXZA 1FP2A 4ZZ0A 4C1BA 1TFUA 1VG9B 2G5PA 4TTTS 2QM7A 4ZVRA 5IDVA 1TF5A 1Y82A 1H8EA 2Q3JA 2VP2A 2VPYA 2ZOSA 3BXPA 3DPSA 3N2ZB 4I3HA 5GONF 3G5MA 3WSVA 4PS0A 2ECQA 4GECA 2F62A 4IOKA 4A5OA 4G5OA 4K2AA 2RHDA 3L4SO 4G2SA 5D00A 1HZJA 1GG5A 1NFQA 2HHJA 3AI1A 1G98A 4LK2A 2VXYA 5DYNA 4E51A 3INYA 3AVQA 3NEYA 3ZIAD 2CJWA 4HMOA 1H9CA 2BMDA 2JS7A 2GRJA 4BFCA 2ZWOA 4PHHA 4DYDA 1JIVA 4Y9SA 4C06A 1ODIA 3GC6A 3OMWA 1ETUA 1NN0A 4F7DA 4YHBA 2H4XA 1Y9AA 5G0SA 2CYBA 2VEDA 1DBPA 1YZTA 3L0ZA 3DYVA 3NXKA 3PFHA 1XDWA 3S0JA 4L57A 3FJ1A 2G08A 1HMPA 4WX2B 5EHNA 3N2KA 1CEYA 3KVRA 1NQOA 1SH7A 2EJUA 2OCLA 1UJMA 3OQBA 1WNFA 5TSDA 2GFHA 1Z0UA 2GM3A 1KNXA 3A6DA 1WXXA 2WT9A 3E7WA 2YMMA 4L85A 2Y2UA 3L8YA 1AF4A 4ICIA 2VJMA 5JUWA 2I76A 4FMBB 1E0SA 2QVCA 4JWTA 5GGXA 3SF8A 1Y63A 2QZPA 5DMXA 4YRIA 1Z62A 4P3NA 1QLWA 4M54A 2CDNA 2GCIA 5EZ6B 2H54A 4WNAB 5CG1A 5FI0B 4O2BA 3AF0A 4F4FA 4QIHA 1SPBS 2ZIFA 1U3TA 1WMAA 2BOVA 4P34A 5EJ5A 1QJ4A 3D64A 3IQDB 5AVJA 5TQ2A 4IKPA 3HLYA 3N76A 4S1NA 3LM8A 3ZD8A 4MR8B 5JC8A 1RBQA 2RFLA 4RANA 3R9IA 1QSGA 5LQKA 1EWQA 4RKWA 2Z1DA 4MOWA 1MAWA 4RSRA 5EY5B 1DCKA 3BMCB 1SHTX 1B0UA 4NG4A 3GA0A 4V39A 4XDYA 2FMHA 2DTEA 1J7KA 2NZ8A 2JI9A 2VA8A 3KK0A 2HK6A 4NNPA 2OESA 5JS8A 3VR5H 2QRJA 5G4KB 2C5SA 3CJQA 1H2EA 1OX6A 2R47A 3E70C 4BEBA 1LFAA 1V5WA 4C0AC 1HEIA 1OUMA 2R8OA 2WV9A 4MYRA 2IU3A 3VKFA 1U94A 5KVQA 4CN9A 1DBRA 4N47A 1PQPA 4HRVA 3RD5A 2G17A 1Y8QA 3CNQS 3G82C 1G9SA 4J1NA 4R9RA 4KHPB 3ANNA 4G24A 1WPGA 5AKYA 3H9BA 1TYCA 2BHLA 1LVHA 3K8OE 1BROA 3IR6A 4BP1A 3MWEB 2IUSA 4QSHA 4E7PA 2XOKD 5FI5A 4MIEA 1XQ9A 4PCVA 2I33A 2X6TA 4W1QA 5FDFA 4HDOB 1GPAA 1Z4OA 3AHEA 3ROEA 4X64B 1Z2OX 4B43A 2FW7A 1QBKC 2JIZA 1Z0DA 2YXNA 3PGA1 2B61A 1GAWA 1OTYA 2OHXA 2C4KA 3A6FA 4GRAA 5GM1A 1NC3A 2BRFA 1E2NA 1C4WA 4JR0A 4KGVA 1GPUA 5FB3A 2O0LA 2XODA 4PLZA 3L7MA 4LWPA 1Z8DA 3RC1A 2NVUB 3ACBA 4JP8A 4ZYYA 5KWVA 3K6SB 1U28C 1DAMA 1QH9A 1E1QA 2CLMB 2C92A 2CHQA 4K9KA 1IDOA 5E8JA 1WETA 3I2KA 3ZH2A 2B1IA 4J43A 2QOEA 2PMEA 5TY0A 1YJ8A 1XPUA 3OLZA 4QG3A 3BH0A 3CR3C 3I61A 1VPVA 3E81A 2IV2X 3WRWA 1M6VA 4W99A 3EZ9A 4GYKA 1PNOA 5IK2D 1YJAA 2FN7A 4RVGA 1DX4A 2HQSA 3PE3A 2YHIB 4U2KA 5DW3A 5DT2A 5EE1A 4IJ5A 1Z8HA 3ER9A 1CBUA 4H4EA 1UC4B 3JSXA 1CW2B 3GFTA 1M0WA 3ASZA 3MJHA 4Q6BA 2DWCA 4AS3A 1RMYA 1HYGA 3JX9A 4BZPA 4R16A 4S1PA 4DVJA 3L92A 3RHSA 4FVTA 3GLFA 1ORTA 4P7KA 1F8XA 1R0CA 4MW5A 5JMOA 1HQKA 1RFGE 3K8QA 3VSDA 4L16A 2IVFA 3M33A 3G2KA 4HZIA 3QF7A 4I3GA 1OHHD 2AVNA 4D26A 1BE1A 1MJFA 1SU7A 2ZRPA 3OT4A 1EQUA 5IPFA 5ED4A 2E21A 2ZXUA 3VI4B 4IF6A 1XIVA 4QUHA 5LBIA 5JS7A 3PHCA 4A0RA 3VNVA 5GZ6A 1NMEA 1E1CA 1TIBA 2QI9C 4M2LA 3HVJA 3RLFA 3VXKA 4CNBA 2DETA 4LCEA 1ISSA 2BY4A 2HBRA 4XQ9A 1V3QE 2P40A 5HBRA 5JR3A 2HRQA 2ORWA 2COEA 3R3XA 5ICEA 3PE6A 1HUQA 5JNRA 5K6AA 5TPZA 2MU1A 3M34A 4B75A 4MPDA 4GQBA 2ZJ6A 4KX5A 4GKBA 2QEQA 2HK9A 2QY6A 3HJHA 4I4CA 4NH0A 2G4LA 3U9TA 1CHDA 1G8HA 4D81A 1ML3A 1F0KA 2VI5A 4RVDA 1ZOLA 1L8LA 3H5VA 5K4AA 1QLJA 4WACA 2WJAA 3FHJA 4G4GA 5AK0A 3TUIC 1I0LA 3O38A 1LEHA 1JTEA 2QX8A 2VSYA 4XOUA 1U6KA 2B3DA 3UMGA 3RVSA 3PDIB 3GRYA 1VMAA 3SKVA 1D09A 1M2VB 3CGGA 2CDCA 1KMCA 1O8CA 5C53B 4TMWA 4GZ6A 4Q9NA 5DJOA 4TTIA 5TVKA 5KOHA 2BFFA 2YN0A 1R15A 3DAFA 2R6CA 1PUIA 2XECA 5BV0A 4CKCB 3L4KA 5JMPA 1RAGA 2GN8A 2HWWA 2ZRNA 4Q9DA 5GQSA 3T38A 1DAFA 4D4KA 5L53A 4BWGA 3DTTA 3PUJA 1FPQA 1U1FA 4E31A 4ZDWA 1G2QA 1A5BB 3GGDA 1E6UA 3IKJA 4GLLA 1W6UA 5AW1A 3L18A 2HPVA 3GRVA 3ZWPA 3UUWA 3LX6A 1G18A 1V9CA 1G1MA 4MYCA 5BUZA 1G21A 1HA3A 1UK6A 3CB2A 3IOBA 3MJDA 4QGBA 5CT8A 1II0A 5K3FB 5JIBA 1M1XB 3DR5A 4GWLA 2BHNA 5DO9A 5EESA 3U56A 1K8RA 2GN2A 1C7JA 2BC9A 2G8NA 2QN7A 3WYBA 1MAUA 3FOZA 2PQ2A 5FBHA 1TAUA 2ISCA 2X14A 3HXPA 5FPKA 2X9QA 2WICA 3W1WA 1K06A 1NKVA 4FBGA 3RODA 1UBTS 3TMKA 1ZN9A 3AB8A 1IZYA 2GSDA 2X3FA 4MPTA 5J59A 2XDWA 2OOKA 2YN2A 4OHCA 2J6HA 5I51A 2XXAB 4OLFA 2FCAA 1U8FO 2X0IA 1UZNA 4ZCLA 3B9BA 4F1WA 2VFAA 4URYR 4YRQA 1QGAA 4KYUA 1JPJA 5D85A 4PICA 4NCJA 1P2DA 4JEIA 3AB7A 4XIJA 4C7BA 3RJZA 2H7CA 2HJRA 1TM5E 4NU5A 1C7QA 4Q24A 1ULTA 3WR5A 5B2EA 5H68A 5A04A 4EAAA 5B37A 2R1TB 1Z8NA 3QEAZ 5K05A 3I8OA 2G36A 4CG1A 3NH9A 2DZDA 5K1ZA 4LEIA 1PZXA 5E50A 3WLSA 2BVNA 4Q4AA 1EB9A 3WKAA 2FX5A 4C0BA 2O7VA 1L5HA 5DHPA 1R8SA 1JE1A 4OM8A 2ERXA 5TIIA 1WVMA 3DCIA 1E89A 3IV6A 2M98A 4WCDA 4AMGA 4G1BA 1J6UA 3QY0A 4EH1A 3GGSA 3D3WB 5FRDA 3AJ9A 4ZTBA 3ZU6A 1J0EA 3F71A 2XAAA 2HA3A 3DEFA 3GEHA 4HWGA 1UC8A 1Y6QA 4KVGA 4ALMA 1VM6A 4AS2A 1Y6RA 1RYEA 2OUIA 4JLSA 3HGMA 1NXTA 2Q07A 3KHSA 1J9EA 3OTIA 4WE3A 4CM8B 2RGGA 4F4IA 1C9YA 4LXTA 4ZVMA 4CMIA 4KNYA 2OCBA 1QRDA 3SI7A 4KFTA 4XIYA 1UUFA 2BCJQ 1YL7A 4LHWA 1LV7A 5IAEA 5TGTA 1GTJ1 1U2PA 4JY7A 2C2KA 4LFAB 3ZCSA 2CNNA 1KHUA 4RMHA 4YPVA 1XMIA 1G60A 5BW6B 4AJEA 2RJ3A 5KNBA 3QTBA 1W0JA 1HE3A 2X1VA 1GEEA 1H2FA 5CBKA 3OEYA 4K1LA 4MGYR 2WT8A 2BH9A 1GKIA 2OCGA 4DLZA 2QW1A 3RJMA 4QQNA 1RXEA 2Z95A 2FPOA 2EJVA 3FFBA 1H8ED 1CU1A 3QVLA 4QREA 3M4ZA 5ALNA 1UAGA 2PT5A 3CLSC 4JP5A 5FOQA 1W5AA 2BMEA 4KO4S 5ESXA 4GLBA 3WJ7A 3IAFA 5KAMA 5JXGA 3ILHA 1I80A 3A4VA 3DAHA 3GFVA 4MWOA 2Y4NA 2E2WA 1JAHA 5JNTA 1IY0A 3TQCA 3WIDA 4AKSA 4V2UA 2O2YA 3S27A 2V97A 1OFHA 1SXJA 3LS2A 1O9GA 1QQAA 4OGLA 4KUEA 4Q9JA 2F6RA 2OWEA 4BFTA 4BNUA 3M6XA 2R8RA 1M1UA 3FOWA 4U7HA 5P8WA 2DBYA 2RAVA 2W2VA 1HORA 4K8RB 4DMMA 1N5LA 1TI7A 1RAEA 2PGLA 1FY2A 4KN8A 1NYQA 4U8HA 4D8VA 4EB6A 3LLUA 4CUZA 4RDIA 4S35A 3ZY3A 3T4UA 5GZ3A 1XTKA 3U4CA 1MEJA 1N25A 4JLDA 2HK7A 2JD1A 4DGSA 1H2BA 1ZJJA 4HADA 1VE3A 3G3EA 2X0NA 2ZI9A 4H1UA 3T1OA 4DUPA 3OD1A 1RXWA 2C99A 4FKBA 1FBTA 3EUFA 2NO4A 3LYAA 1GT6A 2H1LA 4JSTA 4MPRA 1XEWX 3RAJA 3SC2B 5BUQA 2OBNA 3MGBA 1OH5A 1XROA 4FD3A 5BSEA 1LXCA 2FZVA 2H59A 1U3WA 3VVMA 4PZPA 4O8CA 4PRZA 5C80A 3IHLA 2A0FA 1O94A 4QXAA 4P3YA 5LB4A 5EHZA 3GEPA 2AYZA 3RVRA 2J3EA 3BXXA 2OFFA 1Z18A 1E0AA 3AUXA 1GPJA 3KR9A 2RGBA 3OFJA 4EI8A 5F4BA 4GC5A 1PP4A 3R0JA 4IJKA 5AKJA 4R7TA 3LZDA 5JWRA 3E9CA 4AYTA 3BA6A 2AD5A 4ZVSA 4Z9XA 4QUAA 5JTTA 4HEA6 2VZLA 2Q9UA 1MUUA 3IVXA 4BMXA 2H5IA 2REQB 5FLXA 3UK0A 4D41A 4D42A 5JMWA 2EFEB 3KFVA 3STVA 2LD4A 4C6TB 2UVDA 1P5HA 3A6GA 3V7WA 1ULSA 2QJFA 3UMJA 4B31A 2IBMA 1VSUA 5H16A 3TTWA 3YASA 3T0IA 3K4PA 2GN1A 4DF3A 2O5CA 1L4MA 2HWYA 4RKYA 5FBVB 1X7ZA 2PU7A 4JGGA 5H70A 3C16C 4BVEA 4LOKA 5HUJA 1BCSB 1V43A 4M7OA 3HL4A 3RS0A 1A2QA 2KSQA 1TA0A 3GLSA 2QQEA 3OA0A 3OIDA 1MB3A 3QUTA 5F3WB 1DNPA 1TRKA 4LPSA 3DKKA 3NWJA 3NOXA 4UXHA 4CZ2A 3WAKA 4WLOA 3V4VB 4DIEA 5AVYA 2CDRA 1ODFA 4B47A 1XXHA 1IQPA 1ETHA 2C8JA 1YBFA 4EG4A 3LVQE 1YVUA 1KE2A 3UAWA 4BO4A 3H6KA 1B93A 1E79A 4QFBA 3QMPA 4Q1CA 1ZD1A 3DAPA 3OOHA 5LKRA 4H0CA 1W1WA 1R3DA 2ABWA 2A5FA 3RO7A 4F5YA 2NG1A 1FYXA 5DYTA 1MC8A 5CW1A 2VWPA 3HC7A 1GSAA 2CSWA 1BCSA 2ZU0C 3G1WA 3PHIA 3PNQA 1VSTA 1H4SA 2XBUA 1J1ZA 1YS2X 5HJ7A 1A9ZA 4MR9B 5DE3A 4C9BA 1NIPA 4AQ7A 3AM4A 3H05A 3UBMA 1QE3A 5FWNA 2O4UX 4YCMA 4EJ2A 1ODLA 3I4FA 3OICA 3LKDA 4FWIB 4GPTA 1YS7A 4QFDA 4XIFA 3GJZA 1QHNA 1SY7A 3HN6A 4HAWA 1KAHA 4HLQB 1EHYA 1A8SA 4HZGA 2GBIA 2AJ8A 4OHRA 1HFKA 3C4VA 3ZI7A 1QDLB 2PS1A 3I1FA 3A1FA 3OOYA 4IEEA 3UMFA 3K9FC 4FI3C 2OA0A 3L4BA 4P2GA 1KEPA 3N0WA 1WU8A 4TYQA 1YV9A 1Z3IX 3H9UA 4OBXA 4BWVA 1C3LA 1K9SA 1M7HA 1TM2A 1NM5C 1XEXB 3O8DA 1ZH8A 4RWEA 3QBEA 2CFSA 1F20A 2C82A 2Q6OA 3KOZA 3T5PA 1SOAA 3C5WP 5M7EA 2F9MA 5CDFE 4JQSA 1EKXA 1R9GA 3JQ7A 4MINA 3U3DA 4XAQA 5AK4A 1E9RA 3L1KA 4GE0A 2QV0A 3FMVA 2CE2X 4QFCA 4IGEA 3GLGB 5K7SA 3RYIB 5AKXA 3VZRA 1MX5A 3WBFA 1PI3A 5EXDA 4ZOLF 4QJ3A 2WYHA 5HR5A 1BSVA 3DV0B 3H04A 2O2CA 1PS9A 1SC6A 2GO1A 2VZ8A 4FZ3A 2IJGX 4ON9A 1W44A 5BN5A 4JNCA 3DC7A 4JELA 4RHUA 3GLIE 1T9DA 3D0KA 4PBRA 4DMUB 3KDSE 1QU3A 1WABA 2WK1A 5JU6A 4DEXA 4YJ3A 1E7QA 2YY6A 1W1UA 4WD3A 2NT4A 2VWGA 4DIOA 4IUBS 3RH0A 5CEJA 1Z56C 4K26A 3DE0X 3HCWA 4YAJA 1VA5A 1XF9A 3KQMA 4HWTA 4LFBB 4ZIRB 1NJGA 4FONA 3DDWA 3PV0A 2QP4A 4INJA 1T8SA 3MWYW 1NXPA 5F3DA 3M5PA 1QF7A 3I6BA 1G55A 3W8DA 2ZJ8A 1O5TA 3GFQA 2QR5A 2OY0A 5TARA 3TRKA 3EBOA 4IEIA 4KQ1A 5HIJA 5ED0A 2QZZA 3LHIA 3TNJA 4QTUB 3X1WA 1FDVA 3I01M 3M7IA 1ENZA 4RVOA 4Y1FA 3ZQ4A 4BNNA 1RTKA 1X1DA 5B6PA 1KDYA 3OIYA 1JZSA 1E1KA 2ZYAA 4OHWA 3AVPA 2C98A 3R6GA 1Q15A 2I9PA 4OGFA 1EPUA 5ALOA 5KJEA 1QIHA 2CMHA 1G8GA 2J3HA 3S2GA 2IS1A 1NL3A 2Z3VA 2I3ZA 3LQFA 3NIGB 4XSVA 4YDSA 1DBIA 2PNFA 4S3MA 2VYCA 5E38A 2W71A 3SQMA 5C8YB 1EAMA 1XSEA 1SZCA 3PWKA 3HCDA 4J29A 3A0UA 1CD5A 4KQMA 1LCIA 5AVWA 4OXXA 1KK2A 4M0DA 2PVSA 1UC5B 3B89A 4DLSA 3PC7A 3HDYA 1F9EA 1G8PA 1N2CB 1W5BA 4UBNA 4PVDA 6NULA 4LXGA 3R9WA 1GGFA 3KALA 3N3AC 1T4CB 2HNKA 2PL3A 3ORQA 4GDFA 4DKJA 1JG2A 2JAWA 2O9JA 4IDGA 4FYPA 5E1OA 3T3DA 1JEAA 2SHKA 2DFDA 4DJDC 2ICAA 4I50A 1J4AA 1KDZA 1WZCA 2YWFA 621PA 1R9JA 5SYNA 1HKUA 2A59A 2PA0A 5EOVA 1RJDA 2R4TA 4BUCA 3T5TA 1XHEA 4CTKA 3O9ZA 1TOAA 3RB8A 2QM8A 2PE5A 3I0MA 4KRGA 4OYRA 1XRJA 2NPOA 4Q7QA 1EVJA 4QYIA 3UJ3X 4ALLA 1E1DA 1ESMA 3D5EA 1QYWA 2C5AA 2ZRKA 3G9ZA 2VJYA 4G23A 4O0LA 1KXZA 1B4DA 1JLLA 3SBEA 3SGLA 5JVDA 1IHXA 2CKDA 1O6CA 2WVAA 3K20A 3ZQUA 1NF2A 4MHOA 4CFYA 2WTUA 1ESZA 3LLMA 2VH2A 5K20A 4FLFA 4BRZA 3A1TA 2X2EA 4BV2A 2D0PB 2KS6A 3P9PA 5DX1A 1NMSA 2BMAA 4BMZA 1FNNA 3QE2A 1K4MA 2XIQA 3IODA 1AHHA 2HNAA 2O7SA 3OF3A 5LQJA 3RG2A 1P75A 1GG9A 1XTVA 1AGRA 2JA2A 1TVMA 2VZ0A 4L3OA 4LHSA 2HIAA 3W7VA 2DTDA 3DCNA 1YZYA 3NVKI 2FVYA 3CE9A 5DCWA 4WLEA 4C7OA 1LWOA 1XCGB 2W8BA 1UBCA 2XB4A 4G97A 4YMLA 3NO4A 4HVTA 3KEFA 3QVWA 5K0NA 2AFIE 4KXVA 1P73A 1ZQ9A 3DOUA 1M8FA 2PBFA 4K6GA 4RZHA 4ZVKA 4DWWA 1ADGA 4HDNA 5BR4A 1Q7EA 3DEZA 4Q4HB 4ESEA 1Z0JA 5IKEA 2WD7A 1AQLA 2A5GA 2G63A 3D4IA 3AEKB 2ZRFA 3RC2A 3IFSA 4FSXA 3OPYB 1SHJA 4LZWA 3ZG6A 4PYRA 4F97A 4QT4A 4MCHA 4R1NA 1NR1A 3PEUA 3W78A 2J48A 3W6PA 4XWYA 1KPHA 2H52A 4U8GA 5K0CA 5KNBH 1ZU4A 5DHTA 2NZUG 5FOVA 2AC2A 5EPOA 5L4LA 2B1QA 1AE1A 1J07A 2FDRA 4DLYA 3JATA 4IUCS 3IA2A 3EG9B 2EJTA 3KYDA 4L2IA 5HKKD 4QA9A 2VPTA 3TXYA 4GMXA 3SJAA 2X4LA 4X8LA 1NLYA 2EGUA 3GJXC 3J7TA 3QXHA 4MQFA 4X6YA 3JTEA 2VDQB 1I32A 1W0CA 4CKZA 2XB9A 4RCVA 3IVCA 4GH5A 3HE3A 1D4AA 5JSKA 3UT6A 3UOAB 5KYWA 4G6ZA 2MIIA 1EG2A 1MIOB 1M1YE 5DP2A 2JAXA 4QUJA 3UCXA 5ARCA 4U7FA 2CFIA 1UXHA 3FNIA 3OX2A 1F6WA 4EGJA 3I1JA 4MB6A 4Q4CA 5GONB 1KFBB 1OQAA 4HYEA 1NIJA 3E61A 4GZ3A 2EKLA 1ADFA 2P8SA 1VKNA 1JNYA 1VSVA 2IZ5A 3HUUA 3Q85A 4R31A 4RA9A 3I0ZA 9ABPA 1AZTA 4FIZA 2ZYTX 5M04A 3CLTC 2DPHA 3C8MA 4ENWA 4GNRA 3OZIA 1MNAA 4K05A 1OCEA 1SCKA 2P78A 3Q72A 3I39X 4KL8S 1G8AA 3FYSA 1U0LA 2HA6A 3AIMA 3O4JA 4QPJC 2MYNA 4EHFA 3HABA 3H8VA 3BWBA 1FTQA 5CT9A 4YP5A 5I8ZA 5MHTA 4RELA 4D43A 3FY4A 4H9GA 2HQBA 3G2NA 1LV8A 1QYVA 3KB2A 2GYWA 2XLCA 3QVXA 1DQNA 4JXXA 3HJTA 3PRHA 1DTWB 3LD9A 3CSSA 3L0BA 1A7JA 3AF6A 2W2LD 4IL5A 4BY9E 4QUDA 3U17A 2J5XA 4BXOB 4IX1A 3VC7A 3SX0A 4AT1A 1NVUQ 3PS9A 2F8SA 2A14A 2IHJA 3TRJA 4DARA 3ZJUA 2PX6A 3FGOA 4JJ6A 1ORWA 2XVYA 3GEGA 3KZNA 3TVYA 1H3EA 1NQ5A 3GPDG 3FM8A 1CS0B 2BJVA 3NM6B 4JVLA 4BQIA 3DNFA 3PZRA 3QHQA 1R6BX 3GYBA 4RSMA 5DB4A 4X90A 2HCRA 3WNQA 1YA6A 4BX0A 2ZYUX 1E61A 4ZWNA 5AUOB 3H0CA 2HY7A 3RS8A 4CUKA 1FDRA 3LPMA 3BD9A 1QZXA 4IEFB 2X5XA 1E5QA 3LPAA 5AW4A 3CZRA 3W6UA 3PXCX 5DBOA 1JEYB 1QHXA 2WIKA 1TZ2A 3HK2A 1O1YA 2B4YA 1W5SA 3B3JA 5EIBD 2QPTA 3S68A 2DLDA 3LP5A 4Y9UA 3S2SA 1LPOA 3DQQA 3O1JC 4B83A 3X1YA 4JYAB 4DCVA 3FPCA 4CMCA 1R9MA 4MQFB 4IG9A 5BQ5A 4ZO9A 3MN1A 4FB5A 2V9ZA 1W88A 1CY7A 2P11A 3CMCO 2CVOA 3K2QA 4EF5A 1ESNA 4A6DA 2BHSA 1FU8A 1QAOA 1VGQA 3DDNA 3JATB 3B3AA 2QTLA 1XJQA 1NN5A 4M9QA 4US2R 1EVZA 2FN3A 5FL3A 4J7AA 1CS0A 2QB5A 2ZTHA 4KC0A 1JAYA 2XT0A 3GLUA 4NFHA 1MHPA 2QJTA 2SCUA 1MX1A 3T54A 1DIBA 1J23A 2O2SA 2ZTUA 4D6YA 3KBBA 3OCYA 5KYNA 2CE7A 2HU5A 4EK9A 5JANA 4QGSA 1CERA 2BEWB 2VNJA 4PVCA 1D4FA 2AKYA 4QPPA 3BSFA 5DEIA 1Y8QB 1EBBA 3IHTA 3L7YA 1VYHA 5C18A 3BIWA 3FCXA 5EQDA 4L4RA 4M8IA 4RHEA 2FPGB 4GL4A 1RBYA 4CM1A 3MTEA 1SXPA 1U4SA 4PEVA 4OBWA 4FZRA 2ZUDA 3FYHA 5J23A 4HX9A 4N0PA 5KNDH 1PL0A 3I09A 1DJOA 1AM4D 1H0HA 3A4TA 1RLOA 1ZD9A 4CIVA 2IDKA 1NU6A 4X8HA 4XVUA 3I83A 5K4HA 1LPAB 4G4IA 3AR3A 1JEOA 3GLQA 3KJFA 4L0MA 4UCFA 5I9BA 4D1YA 2QBYB 2B1RA 3ZK7A 4X1KB 1TEZA 4GBJA 1JS1X 1BMDA 4R2KA 4EQZA 2OV4A 1KI3A 1N0HA 4ER0A 1R7RA 4QDJA 3SIXA 1HYHA 3HU3A 1J8VA 1UBHS 3D6FA 3QMVA 1YT5A 3JQBC 4MJ3A 2FXIA 4NYMQ 4MSUA 3H1FA 1K08A 1WLSA 2RCNA 2F8TA 2DBVO 2JGDA 3C6QA 3F6RA 3WGHA 1VMEA 5AICA 3ZX4A 1U98A 4FMPA 4UZSA 3VX4A 4B6EA 8ADHA 5AVTA 2EJBA 4J0QA 2QRGA 3GT3A 3NU1A 2VSNA 5CUQA 5B7PA 1TIPA 1NVWQ 2Y66A 1GL3A 1EWVA 1XU9A 2IITA 2EKDA 2UZAA 3NR2A 1RPTA 1T0UA 4NRDA 4TV9B 4RL6A 3F78A 3GVCA 4L8WB 2J0EA 3PPYA 4NDAA 3I6WA 2C77A 3R7LA 1ZJZA 2X0EA 1JYSA 2KLBA 3JZMA 2QX7A 3NKFA 1RKVA 2QZJA 3KDAA 4MVJG 4P86A 3KUXA 3WIOA 4Z0PA 4BQOA 4DPLA 3F49S 5F52A 4CJXA 3EA4A 1HTBA 1ZFNA 3FNFA 3UMZA 2IOFK 2O6HA 3D2BA 3VO8A 1GTRA 2I91A 2Y0EA 2GF0A 2CYCA 4EJFA 1SU8A 4AS1A 3E7XA 3FTCA 1HXHA 2VAVA 3LBAA 2NP6A 1H94A 1VJCA 3G5TA 1DAGA 1FFCA 2QRPA 2AE2A 3MG9A 1VP3A 3H42B 2H07A 2WMDA 3IERA 3DOIA 4BUZA 3BMQB 3N0RA 1PHPA 4IINA 5DYIA 2W2QA 4JJ4A 1ZN8A 1B2RA 4DRYA 2VSOA 2OCPA 4R2XA 4XGNA 4NFLA 4KE7A 5EJFA 1KH2A 3NTXA 3BTOA 3OPNA 4HWOA 1WX1A 2OGTA 3H1EA 2X42A 2E1PA 3FLEA 3AVWA 3GLKA 4WADA 1Q12A 3DOJA 4WDRA 4NSNA 4PGHA 1YZGA 1ZHFA 1T25A 3IAS1 3QOYA 3UAGA 4QO8A 1VBFA 3FPHA 1KFEB 4GDMA 4IVRA 4K9NA 5DM0A 4FBLA 2A3RA 1B14A 1P17A 3QXXA 1ZGJA 3GJ4A 5HRUA 2G9RA 1ZXBA 3O82A 4NZYA 3HU5A 5FR1A 3JRNA 4I5FA 2C84A 4KEAA 5TQ2B 3WGVA 1AXGA 3PFCA 3D3EA 3PFBA 3KKMA 4N82A 4NOKA 4A8PA 4CDNA 4NJEA 1XLTA 3Q11A 1MV5A 3EZNA 3SJZA 1XEFA 2ZRMA 4DC1A 1JKIA 3I5UA 4H6WA 4W8OA 5FUWA 1JEYA 2H1HA 2ISSD 2ZUVA 4UQPA 3E05A 2P5YA 3RFXA 2H63A 1T36A 3N6VA 4H35A 2FVXA 4HY3A 4KIUA 3WV5A 2CSXA 1FL9A 2PKQP 2I4RA 4MV1A 1PG2A 4J0FA 4O4LA 8AT1A 2XUHA 4QJBA 1EIZA 1G20B 4RJKA 4OI4A 1USWA 3UHAA 1CVLA 3KQNA 1K8ZB 1OC4A 3FVWA 5I4IA 5KSZA 2VN8A 2GLXA 4O3FA 1VZ2A 3FM9A 3CWZA 2PXXA 4Y98A 5FPHA 1VL8A 4HL6A 4IRXA 3TLYA 2O8BB 5MFPA 2Q8PA 3A9SA 4KQ9A 2HJHA 2VT3A 3A14A 3QQ5A 3VUEA 3PUHA 1HDCA 3SJ7A 8GPBA 1WXIA 4XASA 4ZKEA 2P2LA 3FDFA 3G49A 5TJHA 2J9GA 3MGAA 1FTSA 2K4MA 1A0OA 2PKEA 4ZQFA 3K2BA 2IC5A 5C34B 1NQUA 1UEJA 2H4YA 1NWHA 2NYVA 3EK2A 3IT3A 3R44A 1DAHA 1WP9A 3F90A 4JZKA 2JBAA 1MB9A 3KFXA 4OQZA 1SUWA 2M6LA 3DLPX 1W94A 5K45A 4Q37A 1NZFA 1D9XA 1RHJA 1XF1A 1YL5A 2N0SA 2ODQA 4LDJA 3ZIAA 4AJ9A 4QM6A 4NYIR 2AC7A 3KPJA 4G41A 2G0AA 3UV7A 4BO9A 1ZH2A 2ZM5A 2P65A 3EXIB 4ND6A 3DMPA 3TD6A 1GPH1 1VLLA 4XQGA 1PG0A 2IEAA 1H0KA 4E46A 3ABZA 3D3KA 2OV8A 3FDIA 3QSGA 2FWNA 3OZRA 4PHGA 4PFKA 5D8DA 4AUEA 4U7WA 1MW8X 3EOAI 1J0DA 3I53A 4K6FA 4LC1A 4OP3A 1GTVA 1I2BA 3G23A 4JCOA 4MUYA 4Z54A 3AG6A 4L5IA 4KXLA 1U5BB 4LZPA 4PPGA 3U4DA 2H1WA 4R2IA 2IH2A 3G89A 2BGLA 4JU8A 2VUIB 1ZI8A 4WJZA 4OQ4A 2VJKA 4GXRA 1KEVA 2TRSB 3ON5A 4Y7CA 3I6YA 1M6YA 4G56A 5CRIA 1L4EA 1E1YA 1WWKA 4IDBA 1KE1A 3NDBB 3SZUA 4M98A 4OQMA 3I05A 1GL7A 3AHIA 3FSRA 2QDKA 2PSJA 1TZKA 2XE4A 4NV0A 1WJGA 1XQ6A 4LTDA 4NZNA 1XD9A 1GAXA 3IE2A 5IAJA 1J2TA 3E5MA 4EQ6B 3QNWA 1VRCA 1Z34A 2MYUA 4BJ1A 4H7JA 3JCZA 4MUEA 2V5UA 1XNRB 2IU0A 3QLTA 3OMLA 1WR8A 4CMAA 3ZIDA 5D3KA 3N2IA 4EMTA 2H4FA 1YVPA 2O3JA 4N03A 3OZEA 4JLNA 2XKKA 3MMPA 1XMXA 1KORA 4FX2A 1RXIA 2QTVA 3BWEA 3HV2A 2HLPA 3IHKA 4RKFA 4DL9A 1ZIPA 2X3YA 3UJ8A 3AL0C 3PPXA 2ACWA 3AFGA 1U2GC 1CFZA 2CLOB 1TU0A 3RTBA 1AKUA 4EJQA 3CH5A 4ZCPA 3UHPA 4G1FA 4N8DA 3NTVA 4L0DA 4OMUA 4WESA 5CNIA 4FI3F 4AZ0A 1H6AA 1R0KA 2HFJA 2BBTA 4EHNA 1XP5A 4ZODA 4DV3B 5AHOA 2PGOA 1G9TA 1QHSA 3E2IA 4MEJA 4DNPA 5JNVA 1U7XA 3ZOZA 2VT7A 2W2LA 2VF4X 3HDGA 3JVUA 4R1TA 4RGQA 1GGEA 5B12A 4CI0B 5H9WA 1XKTA 3Q98A 1XZJA 3ZJYA 2F3SA 5C7YA 1UWVA 1DEKA 1YOVB 2H57A 4ZAWA 1TM7E 1X14A 1FSGA 3M49A 2GNPA 3BD8A 2QLFA 2XTMA 3IP7A 2JFUA 4IZIA 1JHXA 1ULZA 4IDNA 4LJ6A 4TN1A 4HNAB 4BNHA 2BFDA 2ZPTX 5J2TF 4A8TA 1J99A 1LJLA 3OBBA 4YAKA 1S96A 2GK6A 2P9TA 4Z3DA 1QP7A 3HY4A 4GG1A 4FFSA 4LN1A 1PZHA 2QROA 2CUNA 3L82B 2QNBA 3FCUB 4IF4A 3HP7A 1JR3E 2PX0A 3L9XA 3TZLA 4ARAA 1FQWA 3GPIA 3NM4A 4QVGA 4ZOEA 1D5CA 5B53A 3RADC 1GPNA 1M8PA 5CURA 3K5IA 4KSBA 2AQKA 3CS3A 3D02A 2NT3A 3IILA 3DBLA 3THWB 3IP9A 1T26A 4Q4LA 2OVFA 2IHBA 2JZOA 1UJBA 2XI4A 4RF4A 1OX4B 4A0FA 3RJTA 2OYSA 3JWEA 4R54A 2Y99A 2PJDA 4RLFA 4G4SO 1IK6A 2JPDA 1UP4A 1RW4A 4ALJA 1U7WA 3AERB 2HXGA 3QXCA 5A4MS 1F8FA 3VA7A 1N5KA 2AOWA 2D62A 2KX7A 5DSZA 4E6EA 3E5NA 4JJKA 3IDZA 5AVOA 1MMFB 3C4JA 1HDEA 3JQGA 4AAYA 3CVUA 4KV7A 1RIIA 2HEGA 2JFVA 1KU0A 3M83A 4G9GA 4JOBA 3BFJA 3BS4A 3ZS8A 1M83A 5E6RB 2FMTA 5D3QA 2WP8J 4R8KA 2X9LA 5K3EA 4DUZB 1V8OA 3PP8A 4ERXA 3VV2A 4KQEA 3G5AA 3EDOA 2DMRA 2EFHB 2VCYA 1K4KA 3QFTA 4L6AA 2ZUTA 4LYDA 3JYQA 2IS4A 1Z0SA 1Q22A 1TU4A 3EMDA 2FWPA 3OZWA 1YDHA 1OSNA 2ANBA 2JGNA 3CSDA 4TVKA 4IZOA 3RAGA 3U48A 1NURA 1CY2A 3P0IA 2C58A 3ZQKA 2O4CA 2G9NA 1E9VA 1M9NA 1TB4A 3R7BA 2BSAA 1HE2A 3HZHA 1N1EA 3BSSA 4UUNA 2ZRBA 1DO2A 4ITRC 4P82A 2HSGA 3WYNA 2V0GA 5AW7A 4D4JA 1SAYA 3MJTA 1ZI6A 3GP8A 2WJ4A 2IF0A 4KPUA 1FNMA 3TL6A 2E18A 2FR8C 3IGFA 4DCSA 5LLDA 1SKYE 2D0IA 1HSOA 2BD0A 1G6GA 1K3FA 5AT1A 1P2UA 3WMXA 4HDQB 4ZQEA 3JPWA 4JNKA 5I8PA 1RCTE 3BN3A 4ZOAA 1O54A 3PVCA 4NF2A 3PSHA 3U3JA 4EDFA 2CVQA 2YJNA 4R1LA 4B09A 1V11A 1LW7A 1ND5A 2IPLA 3B6MA 4X95A 2WZQA 2AXNA 4LY0A 1JFRA 5B4VA 3WOHA 2B7BA 1ZR2A 1RJGA 1WPQA 4MQBA 4EI2A 1X39A 2ZE7A 4JC8A 4KK4A 1EZZA 1Y4UA 3VU8A 2O8EA 2QQ0A 1DKQA 2JZCA 1RRGA 3CPHA 3UMSA 5CCEA 1RI3A 2GCOA 2R44A 3JQEA 4YAEA 4C4ZA 2BW0A 5E0KB 4B9EA 2H9AA 3PNYA 4WNYA 3B85A 4GX1A 3SYLA 4N49A 2I8LA 2VTKA 1OLSB 2C9YA 4EQ6A 3BX1A 3ZTTA 3VMMA 2WAOA 5LQRA 1J20A 4KPUB 2XTJA 1KO1A 4ZREA 4AULA 2VPZA 3UPUA 1I4DD 4C0JA 4UUQA 5BSUA 2Z4SA 3DD1A 4L28A 1GGNA 2BTOA 2BJWA 2W90A 1T4GA 3BXHA 2BKLA 3GWGA 4XARA 3U39A 4UOZA 4ZA2A 4EMSA 2ZRDA 1CHNA 3AVYA 2C07A 3O75A 3AETA 2WLTA 1MIHA 5KYYB 3Q12A 1KJ9A 2XNSA 1KZ9A 1ZW6A 4Y2PA 3TG2A 2R8EA 1EFHA 1RZRD 2H9YA 2GHIA 1CUVA 2RK4A 4WCFC 5DKFA 1H4QA 4J4HA 4HAXA 4XCXA 1ZMTA 3Q2OA 4INPA 3ZWNA 3DOFA 2YYZA 1XVUA 1E6EA 4UVIA 5DNEA 4DYHA 3Q7RA 4FGUA 3M5DA 1YGYA 3GFSA 3MYRA 1Z33A 1ES9A 2A0KA 3JV7A 4LRUA 1M34A 1E8MA 3TRDA 2Z30A 3SHWA 4Z3OA 1MRNA 4GPBA 3DLIA 3ODPA 4QT0A 3I3OA 2E1RA 2VHWA 4PLTA 3VOAA 4MI9A 5D7BA 1FXUA 1S8AA 3AP3A 1RXYA 5JYBA 1KRWA 2P6PA 3BULA 3BB1A 4QQFA 2AN5A 3OX1A 3U31A 5C8YF 4LE0A 4TTPA 3BCHA 4B5KA 1Y1SA 4ND8B 1TJNA 3IUEA 4PCLA 4V0MA 2O8DA 2NV6A 3N5CA 3WFIA 2LC1A 1UZLA 1WY7A 2CMGA 1OBVA 4XB2A 2FF5A 2OM6A 4FCTA 3L7BA 1Z5WA 4MV4A 4MGEA 3LXMA 4GKJB 2BFWA 1GVNB 1FRZA 2LZ0A 4GXTA 4TS9A 1U9IA 3OEHA 4YMWA 2PY6A 3WLHA 3F3YA 1ZOIA 2W8ZA 4IHKA 4KFSA 3DL0A 2GLUA 2ZJ1A 4DZTA 1AC5A 2Y1DA 3DDUA 3VYTB 1OJLA 3IVAA 4TRJA 2V7PA 5JQGF 2EW8A 1YOBA 1FTGA 1M66A 2GKGA 4E5UA 4F2DA 1ZIXA 3O4HA 3FROA 3PCRB 3M6FA 4ZEWA 4MAMA 3LDUA 5IJXA 1JMKC 4HFMA 2WE7A 4ZCRA 2YZ7A 1M2NA 3TSWA 3THXA 3KB6A 1WXWA 3SYNA 5KMGA 2H1IA 4F9GA 4ZVNA 2PD3A 2IOFA 3TLAA 4EATA 1SXJD 3CUEF 5B58T 2P41A 5HOEA 1NOIA 5CX1B 1U5CA 1ONOA 5MFZA 1TJPB 4ZHQA 2I71A 3CLRD 3D4OA 4R4JA 1I2AA 6ADHA 1Q7CA 5EUQB 1Q20A 5FFNA 4F4UA 3RYFA 1ZNYA 4GOND 4S1TA 3UZUA 1Y5RA 1BRMA 4OPMA 4BLTA 1TX4B 1SU6A 3HA5A 4X85A 2VYQA 1J2FA 4I8DA 2DQZA