3T5PA

Crystal structure of a putative diacylglycerol kinase from bacillus anthracis str. sterne
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
298
structure length
287
Chain Sequence
KTKFEKVLLIVNPKAGQGDLHTNLTKIVPPLAAAFPDLHILHTKEQGDATKYCQEFASKVDLIIVFGGDGTVFECTNGLAPLEIRPTLAIIPGGTCNDFSRTLGVPQNIAEAAKLITKEHVKPVDVAKANGQHFLNFWGIGLVKAKLGKIGYYLSTIRTVKNAETFPVKITYDGQVYEDEAVLVMVGNGEYLGGIPSFIPNVKCDDGTLDIFVVKSTGIQAFKDYIGKKLFEDSNENDIFHVKAKSIHIETEEEKEVDTDGESSLHTPCQIELLQGHFTMIYNPAVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative diacylglycerol kinase from Bacillus anthracis str. Sterne
rcsb
source organism Bacillus anthracis
molecule tags Transferase
molecule keywords BmrU protein
total genus 76
structure length 287
sequence length 298
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2011-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00781 DAGK_cat Diacylglycerol kinase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.40 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 3t5pA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 3t5pA01
2I2AA 5EJIA 3V8RA 5EJFA 3V80A 2I2BA 2AN1A 3PFNA 2I2DA 2I2FA 3T5PA 2BONA 2QVLA 3S40A 2I1WA 1U0TA 2Q5FA 3VZCA 5DHUA 5DHRA 3V8PA 1YT5A 1SUWA 4WRRA 1Y3IA 2I2CA 4L02A 3V7YA 3VZBA 1Z0SA 3V8MA 2JGRA 3V8QA 4WERA 4HAOA 5DHPA 2QV7A 4DY6A 5DHTA 2I29A 5EJGA 3V8NA 1U0RA 1Z0ZA 3V7WA 5DHSA 5DHQA 3VZDA 3V7UA 4V24A 1Z0UA 1Y3HA 2P1RA
chains in the Genus database with same CATH superfamily
3KE9A 2DGDA 4MRMB 4CDGA 1QYVA 4GM1A 2ZI4A 3HY4A 1W9MA 3HWX1 5T5QA 1ZUNB 2I9KA 2VDJA 5DJ5A 1SXJD 4P7FA 1R5JA 3WK7A 2FF5A 3B9RA 1NJ8A 4IDEA 4LRYA 3A36A 3ZDDA 4Y6QA 1MOZA 1PJSA 5DTEA 4ZKEA 1OVMA 3RUCA 4EF5A 4K9OA 2WWRA 3RBAA 4CFZA 4MUKA 2Y76A 4LVCA 1VRVA 1XWWA 1PCXA 5IKOA 3ADDA 2GXSA 4R98A 4EMBA 1YMUA 4B44A 1G98A 3CSSA 1X1SA 3W5AA 1RKUA 3E6AA 3I4LA 3TSCA 3TN7A 1CQXA 1AB6A 1VRCA 2ZJZA 3GN1A 2PWZA 3MGCA 3NBZC 4PHGA 4W8GA 3T3GA 4B34A 3WY9A 1P2GA 1GADO 5JC1A 4HWTA 3GLGE 2QQEA 4HAWA 5BR8B 3EAQA 2R8XA 1CJSA 2FK7A 1PZHA 2N1BA 2YYYA 3ABIA 3FBTA 4WN3A 4Y18A 1H05A 2CCGA 2OGSA 3A9SA 4V03A 2BCJQ 3Q3EA 3EW9A 4IGFA 3SFVA 2IF0A 2Q4OA 4PX5A 1SC6A 4NATA 3BRCA 1Y6RA 3B13B 1DAEA 4K6MA 2RAUA 1VXRA 1N5KA 1FVOA 1N5RA 1LU9A 2OMKA 1B23P 3SDSA 3BTUA 1DO2A 2ID9A 2OWEA 3TUJC 1NY6A 1U4NA 1A88A 2FJUA 2IF2A 2NNWB 3RC7A 2GBPA 3P2IA 2BPOA 4KXYA 1TYCA 1F8FA 3FPJA 3D2LA 3PHBE 3PKZA 3MCUA 4GRDA 1SIUA 2DMRA 4HHEA 3ZDQA 4B1FA 5BN1A 1TK3A 3B2QA 1Z38A 4AKTA 3K16A 4XQEA 4DV1B 3KJZA 1ZI9A 5JY6A 2IXDA 1PS9A 4URHA 3ZZ1A 3G2KA 1GA1A 4HJXA 1C1XB 1XPJA 5TQ2B 1V41E 1TPZA 1DHRA 1O8BA 2B2XA 2OHFA 2ZAYA 4KN9S 1OGIA 3H8SA 2J3EA 1ENZA 1E3LA 3T0FA 1PEDA 2XGMA 2C42A 3EYAA 3T9FA 1R8QA 1RQXA 1FS5A 1JSRA 1ZY2A 1FFXA 3EZYA 4AX8A 2HXSA 5JSFA 1OLOA 4HB0A 3B1ZA 1TZKA 3D6HA 4V39A 4WWHA 2D4AA 3ZX5A 4A0GA 2UXBB 2QYHA 1P9RA 1J4LA 2W4IA 4GSLA 4KJXA 4M6WA 5FRDA 4BO5A 1W36B 2O2SA 2CL5A 1CFJA 2ZAMA 3EXG2 5CG2A 5AM5A 2HMSA 4LNAA 1E4EB 4A0RA 4PAWA 2HLDA 2H1FA 5EMJA 2ZBPA 1Y1SA 4Q1CA 4LXGA 4KN5A 3ACDA 3LQ4A 1ONNA 4GYWA 4I9UA 3SHQA 4YXFA 4CKBA 2JVKA 3RT1A 3MGBA 1NQWA 2CMFA 3K8YA 2OCIA 2TYSB 5KWSA 3U56A 1V1JA 4EECA 3ZE2B 1XYGA 3W9YA 4QOJA 4J1QA 2EWVA 3AHIA 3EYWA 3I52A 4TT8A 1JHAA 1SNYA 1G55A 4A2WA 5JCOA 4X64B 3ZBQA 1NUHA 5DV9A 5KYXA 1HWYA 3PRJA 4LDPA 2Q8PA 1KO8A 3C14C 1YS1X 3HUTA 2PIAA 4JFAA 4UTOA 3J81k 3JRWA 4KV7A 2YMPA 5BMVA 1QTNA 2IY7A 3OCXA 2NVUB 2V97A 3ES9A 5EXSA 5I4CA 3HXLA 1W34A 3PUWA 3W79A 5U4QA 4CKEB 1P0IA 4EM6A 1HE5A 1VC2A 2I4IA 2ZS7A 3FUUA 4PLHA 1PN3A 4YCMA 4DGSA 3WNDA 1D7AA 2AB0A 1VHWA 2R7LA 3E1KA 3QWFA 4L8YA 3FROA 5JD4A 1YR6A 2HSWA 3IULA 3QKIA 1XFDA 3HBFA 1RWOA 5DGXA 1IQRA 2GAFA 3QEMB 3RRYA 3LYUA 1NXQA 2J4CA 2C7VA 2P40A 3IHKA 4RY8A 4DA7A 1SBTA 3M1LA 4YV2A 4C5AA 5IAGA 1UBHS 3PQEA 3KALA 4UOEA 1Q0TA 2PE5A 3PGMA 4MR8A 4Z51A 2BGWA 1SVUA 3R3JA 2I7DA 3NYRA 1GRQA 3M9LA 1Z6PA 3MZ0A 3AL3A 2QJTA 3K9CA 2CSUA 3NYIA 4GKVA 4Q19A 2I34A 5BOVA 1L5HA 1E7WA 4JVSB 4MUAA 4OHYA 1UT5A 2AFFA 2QTVA 2P4HX 2BKVA 3DE4X 4MYCA 4Z1OA 1R1DA 2FYTA 5KYYB 1YCFA 2IT1A 5KNBD 5HKBA 2Q7XA 4GRIA 3C98A 5EHIA 2ZOSA 4KAAA 2QBYA 4LCBA 5ALSA 1L5RA 1TYAE 2JZNA 3ZS8A 3OT5A 4JKOA 3WXBA 3LUBA 1KE2A 3OFSA 5SYAA 3W6ZA 1MT3A 3AOEA 2D5AA 3H9QA 2GTPA 3QELA 3VUFA 2BTEA 1R12A 1MJHA 4KVZA 2I55A 2RGWA 3A6ZA 3EISA 3RADC 1E63A 1MIHA 3FUCA 2F1HA 2BE7A 3PDWA 5F23A 2J08A 1N0HA 4KN8A 4V0SA 1ORRA 1XCBA 2IHTA 4IXTA 4KPGA 3POAA 1J5EB 3AF2A 1MD9A 1G19A 1PKXA 2RCNA 2H1WA 4KXQA 3PD0A 1JE1A 1PF7E 2Z4RA 2PMBA 4LKRA 4MAAA 3RR2A 4AZ3A 1CUVA 3E2IA 4OQ4A 5JZVA 1M33A 1CS0B 4KACA 1C7JA 5FEMA 3R6WA 3ZW9A 1PDWA 4EB3A 5IAAA 3QKUA 3TM4A 1IPFA 1TTHA 5E4FA 3KQOA 1N5IA 3CT4A 2CVQA 3LOUA 2BUAA 3Q0IA 4C3UA 3PHGA 4P98A 1N6NA 2ODWA 3FTPA 3NTOA 4F97A 3PFFA 4OXNA 2ZWMA 2CNNA 3A9TA 3GLSA 4H7PA 4UCXA 1UK9A 1APBA 5HKKD 1JAXA 4Q1DA 1JQDA 4BBPA 3B9QA 4UHDA 2QMEA 1T4GA 1NI5A 2DX7A 2WMYA 3OEYA 4P33A 2JVIA 3WV5A 2OTCA 2JFQA 2Q49A 3FOFC 1Z88A 3B89A 5I7AA 2F62A 3ZNPA 3LGAA 1J1ZA 1Z0SA 1PJCA 1XKLA 1AG9A 5F2NA 1SHJA 2PANA 5B4TA 2PXXA 5BSMA 1K08A 1T1SA 4U1RA 2HNKA 3USCS 4H31A 2IW3A 4J4TA 2VUUA 4F6LA 5IVPA 2XZLA 1CJKC 1T4DA 4TSKA 4I1PA 4ZO4A 1WQ3A 4Q4AB 5K45A 3HBAA 5A04A 1OFIA 1MO5A 1TKAA 2HXGA 1Y5MA 1YRWA 5KKAA 1L7RA 2TRSB 2ESRA 1OGYA 2VAPA 3T7EA 4QVIA 2R1ZA 1B14A 1OF1A 1R4AA 3UBMA 4KWHA 5B36A 1KC3A 2BD0A 3VR4D 5MFZA 2HHHB 2J9ZB 4CTKA 2EL9A 3MB8A 4HAXA 2E4ZA 3TW6A 3UWKA 2DJ5A 1BA3A 3OCYA 3D3EA 4B6SA 1EG2A 2DFNA 6ABPA 2WSLA 3EEYA 5FOSA 3KR1A 3W1WA 3OCZA 4HUQB 1J4AA 3ZK9A 4NCAA 4B46A 2O7NA 1MQSA 1F8YA 3EODA 4DT1A 4YRZA 1PG2A 4KGZA 3RTGA 2OM2A 2XYVA 4FZ3A 1YI0A 4MO2A 1R0YA 2RK4A 2X4LA 4K9KA 1FUKA 1T9HA 1C81A 1Z5VA 4P08A 4BNUA 3ACCA 3RVDA 2QYOA 1JG2A 1R0SA 3PO8A 1P5JA 4R2WA 2ZETA 1E2EA 1EGVB 1VIAA 3GEEA 1P4SA 5KUTA 1QNFA 1TU3A 1OD6A 1KOGA 3ICCA 4S35A 1ODJA 1BCSB 3K31A 2GKOA 5JJCA 2I4TA 4AYWA 2JIRA 4CIBA 3EZ2A 4LF8B 1GPAA 1IB0A 3UB2A 1S6YA 3G89A 3K0AB 3QX3A 3I76A 1NN5A 3LH5A 3RTCA 2GXAA 4DYHA 2VP6A 3GPLA 2LKCA 2D00A 2X7JA 3EZ6A 2YNMD 4N3CA 5HDBB 3AZQA 3FVQA 2SICE 4RF3A 1BVYF 4D3FA 2PPLA 3G8YA 5L7TA 3NC4A 1W25A 1HZZC 2GVDC 3LX6A 1TJNA 3HYRA 4JROA 1XZQA 3GUVA 5AHXA 3ER9A 2UZ3A 4WBNB 1HLGA 1Q7RA 3IKLA 3LUPA 4K9DA 1FUEA 4I36A 4KREA 2V4MA 3SLKA 1A69A 3PWTA 4LGCA 1RJDA 2JFBA 3AVPA 4EGXA 1DBIA 1R0CA 3N6VA 4I55B 3A9RA 2H29A 4K3VA 1TNDA 2LNDA 2QG9A 2VRCD 1E8DA 3AWDA 3LT0A 3M33A 1LDYA 4KWIA 4L15A 4F60A 5IJ9B 2D2IA 2Q5CA 3VPBA 1E1MA 5EPOA 1UF9A 2YWGA 3H0KA 4OY3A 3O9MA 3RLIA 4E11A 5A4FS 1X9IA 1WPGA 4MV1A 3IJ5A 4JBNA 5HE8A 4PYOA 4X9XA 4JA0A 3IT2A 3RYFA 1F8XA 1UMDB 1MENA 1RMTA 5ERGB 5EVJA 4WZBA 4AJPA 4MS3B 1BE6A 4BKUA 2XT6A 5EZ5A 5K09A 3FHOA 5FFFA 2N46A 3VOSA 3AVUA 2WYUA 2WICA 3RBXA 1Q0HA 4N0EA 4Y9SA 3HSYA 1CRQA 1NZDA 1OV4A 2FG6C 1ZM3A 1Q7EA 3O93A 3NBMA 2NZ8A 2QEQA 3CF2A 3UMVA 4A4DA 4F2DA 2IU3A 2CL7X 1BWSA 4I9GA 2ZUCA 1WCXA 4TL8A 4V1CI 1XZBA 2QT9A 4RAQA 4YDQA 1Q2UA 2G5PA 1M74A 3LM8A 4RE6A 3O3CA 1LRKA 3UBTA 4D9MA 3H5AA 1U0TA 4HPJB 4YMUA 1TUEA 3GEIA 4MWGA 1J0BA 4ZOQI 5CJPA 1EDBA 3MUOA 3PGJA 4X7PA 1FP2A 1IJKA 1U0LA 1ULSA 1XROA 2WF6A 3PXAA 1QRAA 4HDMB 3DLAA 2GNAA 4P7GA 5DN6A 4F4HA 3WX0A 4BO4A 4A7PA 1Z17A 5G2OA 1U2PA 3WS7A 5F3DA 4AMGA 1BXGA 2VUTA 4IRMA 4JGIA 2PY6A 4URVR 1CUWA 4R69A 2HIAA 2FP4B 3ABRB 3RVQA 4MWDA 2XUQA 3TRKA 5C1BA 5IPFA 3D81A 3D0KA 1WDLA 3I04A 1P75A 4DBVO 1OKKD 1XTRA 4JAVC 4ZK2A 3O8RA 1KMMA 3C7AA 4Y3UA 1UOPA 1DD1A 1U2DA 3DPSA 5HJEA 4UHFA 1IN7A 1XJ5A 3NYQA 3W8EA 2ZAGA 4MIOA 1KXZA 1AC5A 4NBNA 3A1VA 5CTJA 3Q7EA 3ZWNA 5AVQA 1FMJA 2CFSA 2ZUBA 3UCXA 3W0LB 4H7HA 2A0TA 4QYIB 4DSTA 2QMUA 5F7XA 4OQNA 3FM9A 2OFFA 4QQRA 4PSCA 1EFRD 1ABEA 1DEXA 1A5TA 3O8NA 4OHWA 4UQPA 5IBPA 5I47A 3UKOA 3PFWO 2QTLA 1M1YB 3WGHA 2XMBA 4AWBA 4C6RA 1A4XA 3I2KA 3K4PA 2Q1TA 2K2QB 5F52A 5HA5A 1XLVA 4KIGA 2DEUA 1B0AA 2CC2A 2I6SA 4W8HA 5ECGC 2J0QA 2VBGA 3CNOA 1YRLA 3OT1A 3F47A 3RSZA 3IQEA 1YE8A 3HWWA 1NHGA 3BMCB 4TV9F 4K5QA 1BXRB 5IC6A 1EXNA 1TQDA 2RIPA 3W2GA 2BE9A 2WJGA 2EL7A 4TUYF 2VDUE 1XV5A 4DLUA 2ATCA 3CF6R 3QYAA 2CLDX 4E2YA 4C9BA 1IN8A 1QO0D 1XXHB 5D2CA 5TXGA 3RUFA 1AUPA 1RQLA 3C6BA 3PF8A 2X5OA 1MMFB 1CX9B 2H0RA 1ZK3A 2HSGA 4GI1A 1KOFA 2KPOA 4K9SA 1QHFA 1O0SA 2HHLA 1GZ3A 4JI4B 1VGVA 3UMYA 3ZVMA 1BAPA 4HWOA 3KJNA 1AKUA 4BO1A 3LBYA 3AY6A 2Q3JA 3WP1B 2B4RO 4QT4A 2VK2A 3KX2A 2O4UX 4EMUA 1RP1A 3JYOA 1WE2A 1AHHA 3CA8A 4HWGA 2AN9A 2EJWA 3JQBC 1AKYA 4PSKA 3FDJA 4TKZA 5JI2E 5BYKA 5KQMA 1KMCA 1K2WA 3KT6A 2ZATA 3TQCA 1XPOA 5C4IA 3EVTA 1C7FA 3KSZO 1OWMA 5F1KA 1Q74A 2B0CA 5EFZA 5HJ7A 1DXHA 5HZHA 3QKRA 2DKNA 3LCMA 3ZWBA 5JD5A 2GEDA 5KTRA 4ND6A 1JEYA 1VMKA 4PS1A 3EPHA 3BIJA 1UZAA 3OVMA 2AEEA 2ZJYA 4G25A 4LOKA 1L4MA 3L93A 4JQCA 1CJTC 1NF2A 4JKIA 2X23A 2NO1A 1W9HA 1FTNA 4MB6A 4OK3A 3IVCA 2NM0A 3DOUA 2BZ1A 4MNTA 4E32A 3R5SA 4I08A 1JDTA 1ECFA 3IGFA 1RJ9A 2ZPAA 4H59A 3F4BA 3MMSA 4IR7A 5D1HA 3W90A 4E5MA 2C78A 4RMHA 1BG6A 4IGIA 3DVLA 5AI6A 4Q00A 2Q9UA 3A6KA 2Q07A 1C9EA 2E4YA 4C0HA 4DLRA 4NU0A 1SU8A 4DA6A 4LTDA 5D5QA 1WW8A 1XRQA 5B1EA 4ZZ1A 3GDFA 2JFVA 2VAVA 1EH5A 2QL9A 3LQ2A 4BE9A 1DS6A 3SC4A 2IUEA 1IM8A 4MW5A 4RETA 1HDXA 2EW2A 5AJXA 1S9DA 2ZTUA 3BAFA 4ALNA 4HV4A 4UAVA 1VL0A 2PGDA 3OHPA 3UK6A 5DNUA 4W5QA 4OKIA 1E9RA 3JD0A 4P1ZA 4BFVA 1F60A 5CM9C 4G81A 2VSYA 4X3CA 3SFTA 1BEUB 1Z6XA 5GPBA 2ZIAA 1U3TA 4QUBA 2G70A 4CMKA 5J43A 2QUZA 5KYYA 1OH7A 4WINA 1WLNA 1D09A 2VQ3A 1QRDA 3F5FA 2NX2A 3MSCA 4WCVA 1NNEA 4AI6A 3KEFA 1DIHA 1LS1A 2WP0A 1P1BA 4EAQA 2JAXA 3A1SA 3D31A 4KYVA 1EA5A 1GRRA 1OXMA 4RAOA 1E7MA 3AGPA 4MR8B 2FETA 1ZUD1 3AJEA 3U16A 3WB0A 3IPAA 3INTA 3QVUA 1MAWA 4P86A 4Q4DA 2ZBFA 2V7WA 3X43A 1U3FA 4A4YA 1PR3A 3WGUA 4FMPA 4J0QA 1AOXA 3G5MA 3NWJA 3DZCA 3IIIA 4PQEA 3SG0A 3PUHA 3TLGA 3IMFA 2JFOA 1XCOA 3MT0A 4YMTA 1LPNA 3BH6A 4GNRA 2OQRA 8MHTA 1N4DA 2G76A 5FI0B 3OT4A 5AXAA 4ZC8A 3Q3IA 3T8YA 3R40A 3N28A 5TQJA 1FQJA 4N40A 1RLOA 2WR8A 4QTXA 2PSDA 5G3ZA 3SQMA 2OGZA 3ANYB 3JZAA 3PC8C 4BX0A 1ISSA 4IDNA 4PZDA 3UK2A 4YIHA 3BFXA 1Z8FA 1UZUA 1LJLA 1T0JB 4H4CA 1UBOS 3L7KA 1XA3A 3RWOA 3VC7A 3GUHA 1FS6A 4H6PA 2C9BA 4JH0A 1OZ0A 2XZTA 3MERA 4GR5A 1E89A 1P1CA 2OHOA 1PJTA 2QNRA 3BCUA 1KDZA 1Q2XA 3PKJA 5L3QB 2FA9A 4J0FA 2AG6A 2GEFA 3JQ9A 2QGNA 3FB1A 1GYQA 4ZK6A 3I61A 4DIUA 3U4IA 5ALYA 5JBQA 2V7BA 4ZAFA 3DBHA 2XF8A 4AJ2A 1XZMA 3BIWA 2AS0A 4X71A 4WUTA 5LDHA 1C1DA 1YB5A 2HREA 4HMQA 4OYYA 1G21E 2OHVA 3AKCA 2BM8A 3FTDA 5ARDA 5EPEA 1A77A 1OZGA 1CRLA 1JLSA 1TD9A 2ZYGA 4MYHA 4NU5A 3N0VA 3WB9A 1R00A 4IW3B 3RQSA 4AY5A 2J9FB 3VZBA 2Z57A 3OWHA 3HZRA 1QIDA 2ZI5A 4P4LA 1WV1A 3RFCA 1AKNA 1XD2A 4RLQA 1Z12A 1Q3KA 1Q95A 1VBFA 4KX3A 1YRBA 3VA1A 1PJQA 1M2VA 1PFYA 2PZBA 1CUJA 2QTAA 3AWIA 4IQFA 4IMRA 3PJFA 2CGEA 2HEGA 2IYAA 1WXXA 3LT5A 3OY2A 4G2TA 4PPFA 3DTTA 1VSQA 1FDTA 4N8DA 4WESA 2NMVA 5U4XA 4C7MA 1GA4A 1K7SN 1PJBA 3WC4A 3WNQA 2YR0A 3OFJA 2K7FA 1Y3HA 1TT5B 3DT9A 2PGJA 1NW9B 1XWIA 3BRWD 1XCGB 3FI9A 3L92A 5IDVA 2V6MA 3FNHA 4NFSA 4RPCA 3O8OA 1KQ3A 1ATIA 4LDRA 4KO8A 4UHEA 1YL5A 4HSGA 4MVJH 3VNRA 4A0EA 1TQHA 2AJBA 1BXGB 3TPCA 2VJLA 1TUBA 2AN4A 3GRAA 1LVGA 3DR3A 4RK1A 1PNQA 3WQQA 4H3KB 4UAGA 4F5WA 3AFGA 3CZQA 3MWDA 1Q7GA 4IKEA 4B4DA 2F1RA 4A2PA 2Z1DA 1DAGA 1X0VA 1AXEA 2QRQA 4M55A 4FCCA 3C3KA 4UNPA 3SK0A 4QHTA 4TVKA 5A7HA 4OLJA 3EZGA 4QXOA 1T24A 1CZLA 1RQPA 1UAAA 1UMKA 3S81A 3PTLA 4P9NA 3AKYA 5EZYB 4AIIA 1GTG1 3A1CA 4QSMA 4D44A 4AN1A 2WNHA 3IKJA 3LO8A 4OK6A 3HJNA 3FUVA 1IIBA 3EXFA 5IDYA 4GWGA 5JO9A 5DHRA 1ODFA 2DJIA 1M66A 1R16A 3LPCA 4XGRA 1EFKA 5EWLA 3HHEA 4F4CA 1OH5A 3RS9A 5CIWA 2V5AA 4OIFA 5D5HA 4I8XA 4FMCF 4PX3A 5B2ZA 1QZXA 4Z3DA 1V3TA 4FKMA 5G4LA 3MWYW 1YHYA 1YF3A 4EF4A 5I8ZA 3S7TA 1R0RE 5JDCA 2J3QA 1EX9A 2WSSA 3E9QA 2W7TA 1G18A 1OTYA 4Q1FA 1LDNA 3OLXA 5JNWA 4Q12A 3EPLA 1INLA 1N75A 4DCPA 5D3KA 4BTEA 5DCLA 1S3FA 2C5FA 3FYCA 2RGEA 3ULKA 2CDBA 3SZRA 4AB1A 1FY2A 4K86A 3UUFA 4LW8A 2VHQA 3BXOA 2XYHA 3OZUA 4E51A 3ZGZA 1DDOA 3C6MA 4C78A 1C8KA 1SCUB 5F9HA 1NULA 1DHTA 3TNFA 4ZJUA 4ZI2A 1FFDA 2C7GA 2AEJA 4MS1B 5C2JB 5LFAA 4NRDA 3M7IA 1G9XA 1ZR4A 3AF0A 3BDAA 1P3Y1 5FXMA 5IWCA 5JCZA 1X7WA 1PZMA 3VR5H 3REQA 1GRVA 3QVSA 4JELA 3KSUA 2P2CA 4CUZA 3GH1A 4J16C 5JASA 4DN6A 4M9ZA 4TTQA 1JR2A 2AEFA 2XPCA 3EZNA 1TYEB 4Q3LA 2QIOA 3EA5A 3OBBA 1KPGA 4C1BA 1GSOA 2IQIA 1ESMA 1U31A 1XJQA 1Q0RA 1D7OA 3D7MA 1SCAA 3GV0A 4U7JA 5DFAA 3ZQUA 2JGEA 2FFBA 4TLEA 5JXGA 3U61B 1ZL0A 1B4DA 3COZA 1FLDA 1S9HA 5F2OA 3O75A 1Z0JA 2WB4A 3Q2IA 4Z9AA 2V8OA 5C31A 5C81A 1UJCA 5DRYA 3OKPA 4JUIA 5AIBA 3LRPA 3CJTA 2YXPX 2YHBA 3GQBA 2ZZNA 2EBUA 1DRWA 2QM8A 2B36A 5K0TA 1IDOA 1Y4AE 3ORSA 4MRRA 4JLKA 3V48A 4AS2A 3USES 3OZIA 3ZGVA 1KP9A 3L8CA 4F5EA 1U0HC 5KYUB 4NL4H 1IY1A 5B1DA 1YBVA 4GP6A 3WYDA 4U7PB 1VE9A 2I9PA 3Q2KA 1QK4A 5G0SA 1L7EA 4B87A 1G7TA 4XRGA 5JS2A 2PN1A 5HZKA 3I4FA 2RBGA 2O4CA 1DX6A 4CEIB 1MO4A 3HRIA 1YB4A 1XL1A 1G8MA 4D9FA 1XE3A 2AVNA 1E6WA 4R2HA 1I2ZA 3FMIA 1VLZA 3A0RB 1X1DA 3GVHA 4YGYA 2WD8A 3TMYA 2J5RA 3ZDYB 1G1MA 2P9YA 3ONVA 2XJ4A 5EXTA 3IEVA 3I2FA 3QPWA 3AHCA 1LTHR 1P2FA 2XT9B 4M2LA 1LI7A 4ALJA 4IHQA 2WWXA 3PXUA 1O97C 4RDHA 2DQZA 2H48A 1XRJA 2W2PA 3WLTA 1N33B 1NIPA 2M1XA 3FGPA 5LLTA 2QX4A 5BUSA 4Y0VA 1ONOA 3WK8A 4M1EA 1T43A 1S2MA 3RHZA 1ABBA 2IYWA 1XVLA 2NYUA 3CUUA 4J16A 3KDPA 3V4SA 4HYTA 1H6DA 4EYOA 2PUEA 5CVJA 1ZM9A 5JWOA 3PFNA 1N9GB 2EFHB 3NDPA 1IY8A 4TN1A 3UJHA 4QQFA 4C07A 4X95A 3B1WA 5DT9A 3QPVA 4G24A 2FZ5A 1E1CA 3RSSA 3FPCA 1KI1A 2A3NA 2QN2A 4KR0A 4J1TC 4ZZ0A 3LC7O 1SA0B 3W5VA 2A2ZA 1KK1A 5K7SA 1XVTA 2XUIA 1W0CA 3OD5A 1TM3E 1ZCBA 4BTLA 3NP9A 5CVDA 5EG5A 1PNTA 5FTLA 2G08A 3CZPA 4Y7CA 1YZHA 1I3KA 1U0GA 5JRJA 1F12A 2IXEA 2PKQP 1WXEA 3A25A 2PJDA 3KKMA 3L8HA 4Q9HA 5DHSA 3WMEA 4DNOA 4RYDA 1RKVA 1S1MA 4KU4A 2O7SA 1Y4SA 3OPVA 1U8FO 3ADOA 3PXXA 5EMHA 1K06A 1G8FA 2V98A 2G63A 1UDXA 1XKTA 4GP9A 3DLHA 2RG1A 1V4VA 3BWMA 1JDJA 3JQGB 4OBBA 2VATA 3SMQA 1HNZB 1UPBA 2PDAA 3GW8A 4MVJG 5EE5B 1H9AA 1AO3A 3EVEA 2HADA 3UCFA 4LF6B 4B2LA 2E1PA 1WKVA 2C92A 3DDZX 1NJ6A 3BWEA 3QFFA 4L5BA 3WAJA 2XVYA 4L3WA 3QU5A 3KIPA 5HM8A 2XZOA 1ADYA 2XA2A 1I14A 1UWKA 2GEBA 4RH1A 3M5WA 2P3LA 3EGEA 3IBTA 4MHTA 2JJMA 4MS1A 1UFQA 2D74A 3C97A 3D6AA 3OE4A 1MIOA 5K3FA 3RBVA 4HVTA 3TNJA 4YXWA 2UZ1A 4PLVA 4QUKA 3ACBA 4R8KA 4ZT2A 3WDLA 4DIMA 5KQGA 4R9UC 1KBZA 3PHJA 4M0KA 4CM9D 3THWB 3Q98A 4UVDA 3FSJX 3PGKA 1XDSA 2M32A 2NG1A 4RHYA 1Z56C 1ZSVA 1NQTA 1MVOA 3SSMA 5HS4A 3IP8A 2KB0A 5LMUB 5D3ZA 2ZROA 4XM2A 4XPIA 4EKIA 1GNSA 3RC9A 4YP5A 4U7FA 3AEXA 1J2JA 1NHWA 4R1OA 3L7LA 4GPAA 3R7AA 3TTWA 3OZXA 3ZNQA 2VDLB 1HYHA 1USKA 1HSZA 1OREA 1QO7A 2FPSA 1VSUA 2G9RA 2AR7A 2AOTA 1KE1A 2QN9A 2YRFA 3D1LA 3QVGB 4KUGA 2H00A 4Q34A 4ZVPA 3UCEA 5IRCD 1X74A 1I6LA 1YVEI 3UGKA 1GGVA 2W2KA 2YRXA 4HGPA 3MWKA 3GEMA 5CBKA 4I5EA 5JPCA 4AK9A 3FDIA 3LT4A 3N5CA 4DQ0A 4Z2AA 5KU7A 2B82A 4D41A 4EPTA 3HA2A 3NIDB 2LCIA 4P7KA 5A62A 4ZOLB 5L3QA 3FIJA 1PWXA 3JPWA 1A1SA 4C01A 4UU8A 2ODNA 5LDGA 2I4MA 4CN9A 2NVUA 3ZDAA 4BQIA 3HCRA 2VHEA 3MTQA 3H5VA 5BT8A 1MGOA 1WD5A 3G7UA 3ILVA 4DCNA 5IT5A 1MTZA 3S2UA 2P4EA 3DV0B 5HOQA 3GLIE 2QRHA 1E59A 1M7HA 3N2YA 3QA3E 4MIEA 4CYMA 5FBRB 3DD5A 1WU8A 1ADBA 4Q7EA 3SP1A 3KPUA 1N8KA 4QUIA 2R1UA 4UOQA 3VSEA 3ZYZA 121PA 4CKCB 1CSEE 4YUVA 3IDZA 3W6NA 5HQTA 3B6ZA 1ITZA 3HCPA 1FSPA 3ECCA 4UTNA 1XKQA 4URFA 1NQOA 3FI0A 2JBAA 2YN0A 1J6UA 2VYND 3BFVA 3UAYA 4MGEA 2F48A 4BNXA 2VAXA 3CW2A 4NOLA 1H1TA 5JYCA 1BW9B 4QCJA 5B1HA 3FYHA 2C9YA 2FWNA 3M2TA 4MUJA 2J5XA 4Q7JB 5HF9A 1BMFA 4JSYA 5CIQA 5KTNA 1SCBA 1W76A 1NSYA 3TDNA 3I64A 4HGOA 2ZS8A 3RKSA 3N6XA 4ZICA 1K5DA 1T4BA 3A8TA 5AJYA 1VI5A 3GIWA 2O8BA 4OM8A 3MQFA 4O2BF 3QE4A 3SQNA 4MGKR 1UAYA 1UC4B 3AP3A 3KZKA 4H7KA 4MW9A 3E84A 4P4SB 3D3KA 4IMIB 2G1PA 3SS8A 4G9GA 2HAEA 3ABZA 1GGFA 4D74A 4DNFA 1X70A 1JDZA 2WIDA 2Z2XA 2EYUA 2M9MA 2JIOA 1T9GS 1YMQA 2TMKA 3JAKA 4M0CA 1KO4A 1V9SA 1VQ1A 2Q27A 1DEAA 4R2XA 5ICMA 3VKFA 3KJEA 4PQYA 1TRHA 4URWR 4CF4A 5GADl 1DIGA 2VF2A 3H42B 3RJ9A 5BSHA 2BR5A 3ZI0A 1E5DA 3O2JA 4RK7A 1KARA 3BWXA 4AG6A 5IJWA 5A9SB 1W5BA 4FOTA 2OCGA 1XAGA 1BN6A 4CMGA 4A2QA 4WCFA 2ZTMA 4WKNA 3ZJTA 4NJOA 3ENVA 2GDZA 3LBHA 2AFIE 1XCPA 3K9LA 3L43A 4MCJA 2B4TO 3DONA 4JI5B 3EF0A 3KT9A 5CG1A 1XXLA 3P71T 2XBMA 1TPYA 4ZU3A 2Y66A 3EMDA 5LKAA 2BZSA 3DMTC 4IUYA 3KVOA 3U9SA 2DRIA 3WNCA 2QSJA 1CT9A 3A14A 4OHBA 4FGWA 3WBBA 4C0WA 5M5BA 4A6XA 4RY9A 3LK7A 4B6JA 1CJMA 1M83A 1ZNQO 4MP6A 3EE6A 4KQHA 3DSRA 4G36A 5CGZA 3TTSA 4PICA 2EWMA 3WRYA 5DX0A 4J94A 4N3AA 3HVJA 3HTXA 3VV2A 2BM0A 3K0BA 1B8OA 3W4KA 2HTFA 4C4OA 1FRFS 2EEZA 1WHSA 4PHHA 4EBFA 3ZWMA 4IDHA 4QOGA 2OV3A 4BEVA 1UDBA 4QD3A 5H68A 2OY0A 5HRUA 1DEKA 1ZIDA 3B1YA 3MGGA 3NMUF 2EGGA 4YMVA 5DM60 2OK8A 3ZU2A 2WVGA 1D6SA 5D7NA 1E2MA 1RI4A 1QLJA 3GDOA 3HYSA 2WQ6A 1WXWA 2C4NA 5JNTA 1B41A 3EN0A 4Q9IA 3UKJA 4HB2A 4ZU1X 4U2CA 1SH7A 3EGCA 4GOMD 4C0AC 5LBTA 2GD6A 2N75A 1YFLA 3KSAC 1AGYA 2ZI9A 9ATCA 2PRJA 1OXUA 2XBLA 5J1SB 2W2OA 4RM3A 1SHTX 5REQA 3V8PA 3VU3A 5EE3A 2XTJA 4D3SA 4N03A 3OJLA 3JQFC 3HSKA 4PRZA 4M98A 5PGMA 1PL7A 2G9ZA 1O6ZA 4Z54A 1D5WA 1TCCA 2AUTA 1CEYA 5HYVA 1DX4A 1THMA 2FWIA 4LVUA 4YMIA 5E8RA 4E5YA 5ADVA 3H1PA 1ZXLA 5DU2A 4C30A 5LB2A 4QXQA 1N36B 5ITZA 4BL5A 2F3PA 2NW6A 4Z8XA 3LHFA 5A7FA 2XRMA 1MQAA 3RK0A 3PQ7A 2CJXA 3PNOA 5ALHA 4EPWA 4KSBA 3MA0A 2ODQA 1SKMA 5JR3A 2GFIA 1C3JA 4ZHSA 2EC5A 5DYGA 4YP9A 1X9GA 1DOHA 4RTLA 1UKZA 3QBEA 1M67A 4OLFA 3WL3A 4DLVA 2GN9A 2JD1A 3AHDA 1TE2A 2C2MA 3P52A 5BQ3A 5E50A 1V1MA 2UYOA 1QGED 2J4DA 3JD4A 1VMIA 5AO9A 1KU6A 2YNMC 5KMGA 3L77A 1CVIA 3H1EA 3I72A 4YDHB 4GP7A 1RBYA 3FKSA 4AQYB 2E5FA 2V55B 4D9IA 2W6QA 1YR9A 4RTPA 3RS3A 2JI7A 2QRUA 4EGQA 1ULZA 4HNAB 1FJ2A 1G6KA 2X5NA 1KR2A 4CQMA 4EF6A 4OCZA 5LZ9A 2H1OA 2QTBA 4KYUA 3H1TA 2ACWA 1Q1EA 2H2FA 2WJPA 2RONA 3FF1A 4GOXA 4I66A 5G1OA 1KHUA 2ZVDA 4NV0A 2MSEB 4Z1MA 1FCJA 1N5MA 2ACKA 3U3ZA 4BCDA 4BRSA 1U1DA 3NONA 2J67A 1D2CA 10MHA 2H4ZA 1MORA 4L2IB 2XWJI 3ZLBA 4K9NA 2C54A 3OF2A 5T4HA 2C4MA 1J4PA 1V35A 3AERA 3AFMA 3SJZA 2RHHA 2AYYA 2W2LD 4RFSA 2P6PA 2CF5A 2PV0A 4I4CA 2UVQA 3NWOA 1ZU5A 3OJWA 4HFJA 4A1FA 5KQLA 3LCUA 5BWOA 1ZD9A 3T4UA 5JDIA 2A78A 1Z0ZA 2PUTA 4FMDF 3TEFA 3OHSX 3VR3D 3MAGA 1N92A 4HQKA 4O33A 2AOUA 1JQAA 2CEKA 1T3LA 3CKKA 3IB3A 2HA0A 1BA2A 5HFJA 1SXQA 1KTVA 3EB9A 4TZ0A 1Z4NA 4R2MA 3TLBA 2H51A 1Z0IA 2XIJA 2WIJA 1AQIA 1PJLA 2FMHA 2YJNA 2BDTA 2CVOA 3CZ9A 2Q3BA 2RJ3A 4A8JA 1EKXA 2VCEA 1GU1A 1XAIA 3M3DA 2W11A 3WWDA 1A8UA 3HJAA 3AIIA 4AP5A 1MQ8B 4B33A 2GWRA 4FYVA 4TXLA 1H6AA 1OW3B 4MQ4A 4D4LA 2ARKA 2IHVA 4JYAB 4YECA 4J0GA 3ZKWB 4O4IB 3F6RA 1G21B 4AJIA 2DPGA 3CLRC 2QROA 1LQ2A 1QH0A 3DL7A 4GKJB 2E89A 4JP5A 3WYEA 4HLCA 3BA1A 3FLAA 2X0JA 3G2OA 4AO7A 5KNDA 4K6HA 1OAAA 5K6TA 4ARZA 1HQYE 2IPMA 4K8RB 4CEHA 4MI1A 4ZIRB 3TZLA 5AVTA 2IS2A 2NZYA 4DR6B 2FFJA 2GM3A 3GFVA 4G5OA 3EIXA 2ZQ5A 3M82A 1DFIA 6YASA 1CLEA 3MJFA 1SXIA 2OMEA 3C1AA 2A33A 2DFTA 1L7NA 2R86A 2MU1A 1ZSNA 4WJZA 3VR4A 4YRSA 2CXRA 4ZRMA 1VBNA 2FPGA 3TOCA 1L6RA 3ZJVA 1CIJA 1QQ6A 1X7DA 1YIAA 2PBZA 5GQSA 5H70A 2AMVA 2EZTA 3GH3A 2B4YA 3CR8A 3I2YX 3N2NA 2EX0A 2O48X 3CXRA 1I3OA 2ZLBA 4YQEA 2R8ZA 2Y1LA 1DAKA 2XGJA 2P77A 2P2NA 5C7OO 1UEXC 4HSEA 4PGGA 1J9ZA 3JSXA 1X1EA 4FD3A 4GE3A 4P38A 1RWWA 3ZE0B 2R6AA 1KZ9A 1SBIA 2ZJAA 3GBSA 4H87A 2WUGA 3KG2A 1WMFA 4EP1A 1EZZA 1GNVA 3E5RA 5FA5A 4ZVMA 4CMIB 2AF4C 1QPZA 3VTKA 3CUSA 2GCPA 2R1TA 1ZOSA 2PLFA 3CUVA 4CHGA 1NU6A 2B7BA 3KB2A 1OWOA 1DTWA 1GL7A 1NUPA 2WMDA 3EQ6A 3Q40A 4HTFA 4NX2A 5ITVA 3HCOA 4LDJA 3O47A 1FP1D 3U3DA 1T8RA 4YDRA 5DISB 4S24A 1E1QD 4Y98A 2VJAA 3CNBA 4ZMBA 2FX5A 1FHQA 5T6BA 4EEKA 4D9HA 3S0JA 4TQUS 5AQ1A 1ZZGA 2B3DA 1N5JA 1RKXA 2ZYWX 3RNLA 4RL4A 3I0NA 3M6MD 3LECA 3MJEA 4QFMA 3UUWA 1LPMA 5JHHB 3C41J 2Q3CA 1MJGA 3K5PA 4LJ9A 2R8PA 2W0SA 2J59A 1KF0A 3K32A 1J8YF 3KYCB 2J0EA 2J9XB 4IO1A 1NN0A 4IGAA 3QUSA 2IOFK 3RROA 2AJLI 4B3BA 3U26A 2O2CA 1MLDA 1RWPA 5TE9A 1YQDA 3UWOA 3BMXA 4XVQA 3IJEB 4CMIA 3O1IC 1TCVA 3N0TA 1Y3FE 1RC1A 4KNVA 4D8UA 2OG2A 2QQ0A 3VNAA 1MAAA 4K9MA 5F1OA 1JDVA 5CEJA 4TMYA 1CQIA 2JFHA 3QG5A 1W581 2C2GA 2ZRIA 4FQ5A 5AVVA 2QZPA 3SC3A 5E2BA 1Q57A 1A9YA 3GG2A 2Q1UA 3QXGA 4HNRA 2GDJA 4IXWA 1KJJA 3EXFB 4LYAA 2O52A 3E3NA 3WGKA 2FFQA 2W58A 4QBTA 1AXGA 1P4HA 4S2UA 2C9CA 2OT3B 5D8DA 1O6BA 1Z0DA 4GYYA 4XDGA 3G6KA 3Q8WA 4PQGA 3PEVA 2BKAA 1E2UA 3NO4A 2W6NA 1EXWA 2ZDGA 3PDUA 2WABA 4GOLD 3MFQA 3JWJA 4ZI3A 4JBYA 2WIGA 1N0IA 2RH5A 3LP5A 3A6EA 2DPXA 5COBA 1MPTA 5ALIA 5FWYB 5C3MA 3IEIA 3BTSA 4JJ4A 4EYSA 3K1AA 2XDQB 3W5JA 2FQWA 2QPLA 2BBSA 3HYTA 2A35A 5BWMA 3MBIA 5DLDA 4U5QA 5T57A 4NZ9A 1XELA 3KPVA 1UPCA 5BR1A 4ITRC 3UJ8A 1XMSA 5AW0A 4MVCA 2WD7A 1P6XA 3PRKE 1Z13A 1QH8A 2J1LA 2B5VA 2Y1OA 3D54D 2Z8XA 4N12A 4BO9A 2X2PA 2WJVA 4JVOA 2JJ1A 1V8DA 5I7OA 3ZY3A 3C3AA 4URZR 4IVRA 4LIPD 1Q22A 4BNKA 5H4HA 5JTUA 2O8EA 2HA4A 4P4SA 3V4LA 4IHAA 5K0CA 3SLGA 1YDEA 1A7UA 1H8HA 1S8NA 4QUDA 5JJBA 1OKKA 5T4BA 5J5AA 4KFRA 4DV0B 1C5KA 4CV1A 4EG3A 3PLRA 4DC0A 4H7DA 4EX7A 2VHCA 4H08A 1T9GR 2RGXA 2GFHA 1N34B 3WKBA 1XWFA 5EIBD 2R5NA 1Z2OX 2G1KA 1SQGA 3LQ1A 3R9XB 1Z3IX 3RKRA 1G7SA 1XTSA 3FTQA 1QH1A 5LYYA 1TGYA 1CUGA 4CCYA 3VYUB 2P5YA 3RS2A 4BNMA 3A6LA 2JI6A 4M1SA 4OBWA 4TWZA 1UZLA 2J7KA 3DCNA 1C29B 2D4HA 3PL5A 4QRHA 2CLFB 1IL0A 2V3VA 2QT1A 4KIJA 3TZBA 3WMRA 1AQYA 4ROTA 2R48A 1HA3A 2VG8A 3PI7A 4KLCA 1ZMXA 1U9YA 3N07A 1U0NA 3GLKA 2OZVA 4DV4B 2ILVA 4D3ZA 2YIDA 4P80A 3EVFA 3BSWA 1PV1A 5KJEA 1CF4A 2FGJA 3G1TA 1P4GA 2CK3D 1TIKA 3QWHA 4H35A 4NWIA 1Y63A 3RCBA 3KC2A 4C4YA 3GRUA 1P1RA 1Z68A 1PGJA 1IZ9A 4RIHA 3WI7A 3F49S 2PA0A 2ATIA 2LXNA 2OCLA 3O83A 3I45A 4R8SA 3REFA 2DR3A 4OAPA 2ZAOA 1HLDA 2XB6A 5T8KC 1Q44A 1QGYA 2ZYUX 3B3FA 2XCLA 4B6PA 2J3KA 4I55F 4GPTA 1QRRA 3COJA 3NYWA 1K6EA 1T10A 2X0EA 2P9TA 3C8MA 3MVEA 2LPMA 5ELXA 1K27A 3PFIA 3BDVA 4HQOA 4ENSA 1NVXQ 4G4GA 5F4ZA 5TSDA 3ZEAA 2OXEA 5FLEX 4I4IA 3MTDA 2WWTA 3WO1A 1DLJA 4XJVA 5JSKA 1PG0A 5EAIA 2E55A 3EEOA 3WIOA 3H4VA 3PA6A 3ZQ6A 2GETA 2Z04A 4O4IF 4QIHA 2P27A 5LUAA 4QQKA 3L0ZA 4UBLA 3NBQA 5E7QA 1W5FA 1Y34E 4IMPA 1YNOA 4OEHA 4BKOA 4W5HA 2BYTA 3FRJA 1SHZA 5BURA 1VJ1A 4PG6A 1G5TA 5MGNA 4DMFA 1KAQA 1QC5B 3HVHA 3AJDA 1U28A 3R0QA 4JVLA 3QJ5A 5KZMB 2AJ8A 1WL8A 3GD5A 4OU4A 5C51B 1ZRMA 2IXFA 4RO0A 3EK2A 3UHPA 5IM4A 4L0MA 1JLLB 3AF4A 3SYRA 2R47A 4MB0A 4GECA 4JUFA 2ZJ4A 1KY2A 3TGWA 3WFJA 2C96A 5CDSA 2BMAA 4MVJM 2WM2A 1E2NA 3ESRA 4L74A 3JS5A 4ZOBA 4B7AA 4BVLA 4F2HA 2HBZA 1XU9A 5E4TA 3R7WB 1SPXA 4IGEA 2NTEA 1U3GA 3AVXA 4W1RA 3ODPA 4W8OA 2R6CA 1QIKA 2BJWA 2YHUA 4HNTA 4JXZA 2YOFA 3KBBA 3KTAA 1ZZEA 2VHVA 1BDBA 2XF2A 1OIVA 1VI2A 3AP1A 3D3WA 3TLJA 3ZDZB 1E69A 2YQZA 1YOVB 2DTEA 3V7YA 2UZ4A 3CSDA 3SC2B 3HHPA 4JJEA 1CR6A 4FW9A 1TZJA 2WJAA 3L7DA 4JR0A 3WGJA 3CH4B 2EJTA 2RI0A 3OSUA 2O14A 1R50A 4PGMA 1GZ4A 2HU2A 4JBIA 4F86A 4K28A 1XAJA 4DDWA 1AZLA 4MO9A 1W4RA 2J33A 4XRRA 2G06A 3S1SA 1NPDA 2NUPB 4NHOA 1RPJA 1T26A 2AFHB 2KS6A 3A27A 2WZBA 1PT9A 4C7JA 5B6JA 2JJ8A 1U1GA 4EW2A 2ATVA 1QNLA 2BKUA 5KPJA 1V7PC 1EVJA 3RUAA 3W6UA 3LY8A 3ZWXA 1VPDA 3GJ6A 1ORVA 2YBDA 4J4HA 5E9JA 3TL3A 3EPKA 1ZEMA 4YJKA 2NXEA 3V8MA 4ME6A 1FNCA 1LPSA 1PLLA 2KWIA 2W37A 1W47A 3Q15C 4XLTA 3R9KA 2XLBA 4QTZA 1OLUB 5TQ2A 4DJ5X 3H2IA 1FU8A 1U4OA 2HDWA 3AESB 1XTTA 4G09A 1DC5A 1IIRA 2DF8A 3FSGD 1P1IA 1QR6A 2CWDA 2VXCA 1XG5A 2FMFA 4RPKA 5FNZA 3VYTB 4AKSA 1KP2A 1QCCA 3KLOA 1ZCAA 3QVJA 1UOOA 5L51A 3U4HA 4LF4B 1JR3E 5BUCA 2W8BB 4ONEA 1TB4A 2X4GA 3PUZA 5F7ZA 4JWKA 3TRIA 4O1IA 3OOWA 1O6FA 3JAKB 1LB1B 2PL3A 3L41A 3WVNA 4CV2A 221PA 4HH3C 4LHEA 4YUZA 3HKBA 2BWJA 1UFRA 2WJIA 4KO3S 3CCBA 3QQ5A 2EZUA 3SX2A 1KI4A 3ZWYA 4GXQA 4QELA 2JCYA 2IOHA 1T5SA 4EFLA 5LMZA 3TRJA 1DCKA 4D4MA 4PZLA 1NUAA 2FR8C 3CZAA 1BWRA 1DBWA 4R3WA 2JLWA 2I4LA 2UKDA 3WJ2A 1DRUA 1NBEA 1UL1X 1E3EA 3FUTA 3RIGA 5FV4A 3UANA 4GW3A 5B12A 1XVAA 2BAGA 1RPAA 5THQA 2WW8A 4R9NA 4ZGWA 3ISJA 4Y8VA 4RVHA 1PK7A 3KUCA 5I7VA 2J6BA 4QJIA 1VL5A 1EBUA 3IE2A 2MR5A 3U6BA 2WM8A 2IYZA 4OXIA 3DAHA 2EJCA 1EHIA 4UE6A 4DWWA 4E5VA 2NAFA 4EB6A 3E4CA 2CUKA 1FNMA 1HQDA 4KMRA 3J7AC 2QE7A 3CLKA 3DBLA 1PSZA 2J5BA 2VNSA 1G6HA 3PQFA 4TVBA 1M0WA 4R51A 1FDWA 5C1OA 1L7BA 1KKMA 2CNKA 3I3OA 5E6SB 2F43B 4DCSA 4O2AF 4EQZA 3R6GA 3MIIA 2A9JA 4ZQEA 3G0GA 2P2DA 4JX9A 4JHLA 1ADGA 4JJKA 4Q4HA 4QFCA 2ORVA 4RS4A 4XB6B 2PBLA 2YV1A 3UMRA 2CLHB 1U2GA 4YAWA 1GN9A 5L45A 5LQKA 2G72A 2F2TA 2O3QA 4QRDA 1YQUA 4GF5A 5K3BA 4DMCA 4JUBA 3TSYA 1QGUB 4Z8YA 4DV3B 1L5OA 1O87A 1E5VA 1TM2A 3B8HA 1C9DB 2R8YA 1MAVA 2VP0A 1FRQA 1GAQA 1T8UA 2PGOA 4QGHA 1IBKB 1P5RA 3IXLA 4G26A 3KOWA 3T34A 4FSHA 4LE1A 4B9AA 4RANA 1XTUA 5EHGA 3HFRA 2O5EA 1X1AA 3CR7A 4G5YA 5JEEA 4FC6A 1YS9A 3G13A 3KHSA 3VPFA 5LPNA 4V38A 4UUNA 4GSKA 3PQ4A 1PEAA 5FHRA 1NOJA 3K5WA 3O73A 4P5EA 5L3VA 4XB1A 2BEWB 2YFYA 1ZGGA 2VDPB 3AT1A 2BSXA 4IXDA 1V37A 2RDMA 1ZC4A 4CNQA 5I7HA 3Q11A 1NX9A 3CN9A 3NDIA 4K9LA 2WSSD 4UXJA 1S2LA 3NIFB 2AOXA 4FYMA 4EG4A 3E48A 4KOEC 3KL4A 4DLBA 3LTNC 3ZHOA 4MLDA 4JIVD 1CY1A 2HJWA 1GRCA 3I92A 5B3KA 3FHTA 4LFBB 1K4MA 4MOWA 1TEHA 3PX3A 2C1ZA 4I6JA 5HJ2A 3ZE7A 1I5EA 1MU0A 3UK7A 4ZI7F 1YVUA 1NRWA 1SG9A 3NS7A 3OLCX 4UFOA 3U81A 3PLNA 3ETCA 3CHYA 4OMCA 1TF7A 3KUKA 2FQXA 2MSKA 4M21A 4MW6A 2IE0A 2ZYHA 4WFKA 4Y2GA 2CSXA 3JQ7B 5CFMA 3MGKA 5T64A 5JAHA 3TX6A 2HX1A 3NDRA 2NXNA 4I0WB 4IX9A 1VSVA 3BZWA 4L4RA 4MKGA 4ZI5A 3THXB 3LTEA 1J2TA 4X60A 3AY7A 1QTIA 2VHXA 3OQ6A 3SVLA 1OLXA 2ID4A 2WD9A 3SPXA 3BWCA 4UZEA 4U9HS 2Z08A 5EJ4A 2YWDA 4WIAA 5FYQA 4OG2A 3IBGA 3NATA 1T1IA 1VLLA 2OFPA 3FNRA 4FI3C 1GZUA 2K4MA 1UWCA 3N59A 1K0UA 1CZNA 4YNBA 2DG2A 3Q12A 4ZA2A 2IW1A 1JL3A 3P2KA 3ND9A 4GC5A 4M0PA 4QXMA 4UNQA 1ESEA 2VH1A 5A4IS 1YI8A 3EOZA 3FIUA 4UNRA 3EC7A 3AB7A 3P0FA 3L8EA 3VAYA 1F4VA 4Z4HA 3AONB 5AVYA 2VA8A 2P79A 3L8FA 3BMOA 4C2AA 3FMPB 4F1KA 4Y6RA 1B26A 3KLBA 4QLBA 3WRVA 3QEBZ 5FI1B 1VG9B 5I5EA 3UMFA 2OUIA 2H1CA 1OXKB 5F33A 2H4WA 2CXQA 3QPCA 4GS5A 5P21A 1WY7A 3SIXA 3HYCA 3WQHA 3OZTA 3R8FA 1YB7A 2Q4RA 1ES9A 2PT7A 1U5AA 3OQIA 3IA7A 3KVVA 3REOA 4D8VA 3FLEA 2DFDA 4Z9BA 4B35A 4ZHQF 3COPA 4B3HA 1V2HE 5CCXA 2C4KA 4KQIA 4RZIA 3R7BA 3DOIA 3D7NA 3L7NA 1WBDA 4P22A 2JJYA 1JQBA 4ALKA 3CKMA 5FQNA 4YAUA 1HEIA 5AJTA 3UNXA 3E22A 1QYCA 2Z9CA 1N2CE 4M86A 4YRGA 2ZI6A 4QG7A 5D3MB 2V6BA 4PZUA 3GVXA 1DTEA 4ZVLA 4QHSA 3FH0A 2BGRA 4IFIA 1FDVA 5EJAA 3RVJA 3U7EB 4A6EA 5CA0B 3CWCA 2GYVA 3JQRA 4BEBA 5DT2A 5I48A 3GLVA 2C9ZA 3LAWA 2PFSA 3RG2A 3SEQA 3IRUA 4AF7A 5LZ7A 1VPEA 2J48A 4EBBA 4TTVA 1JHVA 4N3GA 1SXJE 4KO4S 1Y4DE 2JIBA 3SF0A 5L9AA 3QY0A 3TNYA 2BI7A 1HDYA 3ZIUA 3KWLA 1GXSA 3NBUA 5J2TB 2ZCUA 3HEBA 3PD7A 3W1EA 3E8SA 2Q28A 3FCXA 3UA3A 2XOKD 2R5WA 4JL6A 4GEKA 3WLLA 1F17A 1MG5A 2AMLA 2CE2X 2AGVA 3NOOA 1E3TA 3QJYA 4F3NA 4EJSB 1KWKA 4KSCA 3TR5A 3MTJA 3UG6A 1EGMB 2O2HA 3IR5A 2G3YA 2WWYA 1PR0A 4W7HA 5FI3A 2F67A 3R2JA 3AIKA 1N2BA 5AK6A 2JFZA 2EW8A 1H8EA 3AM4A 1R66A 1KH2A 1P9NA 2Q1YA 4IZOA 1HE8B 4Y2HA 4L4YA 5FPQA 1RAGA 1SGWA 3UVEA 2Y05A 2C4WA 4K05A 3PV0A 4RMJA 4XR9A 1TW2A 1U3UA 3DHEA 5CX1A 3WB2A 5KNCH 4YJ3F 4ZCTA 5HPYB 1VYTA 4OMDA 4PFJA 4WOBA 1IRIA 4YJHB 1M2OA 4OJQA 5H83A 1E0SA 3CX7A 1JA9A 4F8EA 1GGEA 1XU7A 3TECE 5E2IA 2GEVA 3A6GA 3AEUA 3C8DA 5ISMA 1SAYA 1QVWA 4IJKA 2DH5A 2QN3A 4MUGA 4YROA 4IMJB 1WVGA 4NDZA 1F3LA 1TJ3A 1X2EA 1IN5A 2FSUA 2MR6A 2QL5A 3FFBA 3LQQA 3LWNA 3NRBA 4I9NA 2OCXA 1TK9A 4C6TA 2ZYTX 3EHDA 4FNAA 4CLOB 2YC4C 2R751 4RLSA 1ZRNA 5AIAA 5BRAA 1ZC3A 4N47A 2QY6A 5EJ2A 3O1JC 5EWJB 1IC6A 1RWQA 3DLCA 3UH0A 4FU0A 2RE8A 1R8XA 2HRQA 5FJIA 5B3JC 1O9GA 4HGNA 4WZZA 5ARBA 1MFPA 1JBKA 3GJRA 3QBVA 3G9QA 4ZN6A 1E9FA 1FTQA 5B1YA 1S7GA 1NE2A 1UWLA 5I9NA 2ZUUA 1HDGO 3KKKA 4DLNA 3LHKA 1DKUA 1S4MA 3K5IA 2IHKA 2OAP1 3B38A 2DT5A 3NBXX 4PWYA 4WE3A 4B71A 2YS6A 1LZKA 2VK8A 4BFXA 4ID3A 4WK0B 3V6LA 5FWXA 1N0WA 3RSOA 1H9BA 2H3HA 2F1KA 5FNVB 3MJHA 4B3SB 3ETHA 3DP9A 3T1QA 2X14A 2DBYA 2G9QA 4KHZA 4OJTA 4BO6A 5KYXB 3MWDB 4IJVA 2LC1A 1IB6A 3FDFA 3H9GA 3MWEB 5JYDA 3B1JA 2BFCB 5BMOA 1H3FA 1QWSA 3B3GA 3L05A 2V96A 3MOSA 3PC8A 4ICIA 3NHSA 1R6VA 4WK2B 5LNK6 4ERNA 1SXHA 2A9VA 4FFWA 5ITSA 4GMDA 1OASA 1ZGCA 2A0FA 3HCDA 1O94A 5KWJA 3ZNNA 3KB8A 3T5TA 3T1NA 4PY2A 4ACBA 1FJGB 1ARZA 4XWWA 2ECQA 1CDZA 2C29D 4DRXA 1JKIA 4OLHA 3ROMA 3ZV6A 3DKKA 4IL5A 2RHGB 4KQMA 2ZUDA 3CX8A 1FZQA 5HQ3A 3GO4A 3I53A 4BVHA 2AZMA 4IJUA 3LP8A 3WGOA 4ETWA 1L7DA 3H4IA 3P2YA 3MM4A 4JQOA 3R4CA 1JA1A 4EA6A 3SX0A 4XARA 3UWDA 4TWRA 1LNSA 1WUHS 2VYVD 3R5TA 1JQ3A 2Q3MA 4TLDA 1A5SB 1MIOB 2Z4TA 1BC5A 1QVZA 2D13A 3T4PA 4CM6A 3G5UA 5JBNA 5K6AC 2Z1MA 4LNUA 1A8IA 1G6Q1 5JALA 3O9VA 4R6XA 2ERXA 1EE9A 2F3TA 1RPTA 5TR9A 4BKPA 3E9RA 4EG0A 5KB3A 1QYRA 2H07A 2EFJA 3KQMA 5EZYF 2Q4EA 1KVQA 3BG5A 4YPFA 4E07A 2EFYA 1TJ4A 2CY0A 3H99A 2YVUA 1PBNA 3ITEA 4JLNA 3AM5A 3N86A 2YFKA 3OCWA 3HMKA 1JE0A 4ENTA 1SBCA 2JFPA 1EI9A 2P8SA 4MW1A 4I4LA 4MUBA 4DYDA 1O54A 1QRUA 3LKBA 3SBDA 4IDBA 5CCEA 3DAFA 4QBGB 5IVKA 1F6BA 2PS1A 3OIYA 2BC9A 4D92A 3QLVA 4G0VA 5JI3E 1KZ1A 2FX2A 4HX2A 2OHJA 4MJLA 4QYTA 2R7AA 5IKXA 4D3DA 4DMLA 1WCIA 3U9TA 3CTMA 5JERA 1V7QA 2NVBA 1IH8A 3ENQA 4I1YA 4UPVA 3SZUA 4CLHA 5K2OA 1GZHB 3KVNA 1MK2A 2Q0HA 3VI4B 4ZYUA 3DL4A 1W0KD 2ZRMA 3VSDA 3AW8A 3VISA 2OHGA 3BBLA 2Q1SA 3ET4A 3B1VA 4PLZA 3DOJA 1SOVA 3PE6A 5CHEA 4MGHA 4JT8A 2VYCA 2PZ8A 1A4UA 4XIYA 2FN8A 3BK7A 2RHJA 4LZOA 4TS4A 2YDYA 2J45A 1U0FA 3NH6A 4J90A 5HFNA 4BMDA 2XT0A 3LT2A 5HF8A 5BQ5A 4LJSA 4X8LA 3Q8MA 1A50B 3ZWCA 4GI5A 4RHTA 5A3SA 3WJ1A 1XVUA 4C4SA 3ZN2A 1ZJ4A 2UUBB 5JSQA 4M1TA 3GZNB 3CMMA 2AR9A 2YC2C 3A3NA 2GILA 3KEQA 1EB8A 3NASA 5KOJA 1P1KA 3V1KA 1FNBA 2FR0A 1BDIA 4O63O 2GZMA 2JBHA 2GPSA 1Y1TA 3PT5A 4N7RA 1RHQA 3BQNB 2H3EA 2P90A 3MK31 4BIMA 2HUPA 1C4KA 5E6SA 1DXQA 3RHTA 1VKNA 2W00A 5M04A 4MRSA 3D7LA 4O5AA 4QDZA 3WDKA 3EY9A 3FPFA 1QAMA 5CX1B 4CTMA 3FOBA 4DUYB 2YRWA 4DSUA 1EWKA 2K2WA 2OCKA 1A9PA 1FA9A 3GOQA 3HJRA 2A9QA 4L9SA 3F3YA 4KPFC 3T5AA 4D9KA 1JZTA 4PO1A 3JASB 2O8VA 3HADA 3M4XA 1E2QA 4FI3F 1S3SA 3S27A 3V46A 3GT7A 2YL2A 3V33A 1OXBB 1K98A 2OGTA 3PQ5A 2BF4A 3JZIA 2ONYA 4BNDB 1KJ9A 4D97A 4HAZA 4RKWA 4CTOA 1NMZA 1AZWA 3A26A 1YZNA 1KYXA 3W8DA 1Z7WA 4YRLA 1SD5A 5EFOA 5NLLA 2HWXA 4PCVA 3OEED 2PNJA 3MYYA 2C8VA 4LXIA 1NPTO 1IJEA 4QDUA 2H11A 3Q87B 3EZ7A 4HH0A 3FUXA 3DEFA 3MIZA 1DARA 2R9VA 3MTEA 3HNPA 3NIBA 3IXMA 4KEAA 5LN1A 1FRVA 2GD0A 4RK0A 3VR2D 1BDHA 4YACA 1RJFA 1SM4A 2J3LA 3TMKA 1XLWA 1RQGA 1ODIA 2X5KO 1N4AA 5IAKA 5EZQA 3ZWDA 1MB9A 3DDHA 1CW2B 3O4VA 4D6YA 5ALVA 3U6KA 4W5JA 1PYOA 2A5GA 3MPUA 4F6RB 1ESDA 2HF9A 1DAOA 3CEAA 2AWOA 3IX7A 4UBKA 3IUJA 1X9HA 2QENA 3R24A 1YDWA 1FB5A 2VDNB 3PXBA 4CQLB 4GX5A 1J07A 3QXXA 3H05A 3VM6A 4NCHA 4QVGA 4CR8A 1BKSB 2DLCX 1FE8A 5TC4A 2PUBA 1G4AE 5IUNC 1O57A 1NNUA 2HK8A 3KTDA 3H9BA 4L50A 5LZ5A 4WJLA 1ZM7A 4GOJA 4RFLA 3PE3A 5JARA 3LE8A 2YZGA 5LQDA 4TWIA 2PH7A 1ESCA 1U02A 2FSVC 3FX2A 1Y6JA 2ZSIA 4B9EA 3QUCA 4G1MB 4B0PA 1VJGA 4CM4B 4L6IA 1XOIA 2G9VA 2ZE5A 4M49A 4F38A 1JHZA 3HKEB 1VSBA 5JQWA 3NHRA 1ZISA 1PTKA 3I0ZA 4YRPA 3DEIA 1W73A 1XEWX 3PWSA 3EPJA 1N6RA 5AT1A 7GPBA 4NHEA 4JJGA 4JP8A 4G23A 7MHTA 2NIPA 4YCLA 1ECBA 3R5HA 4JLSA 1WHTB 4V0KA 4E5UA 3ZJ4A 3SS7X 2J3MA 3Q3HA 2YKGA 5JMOA 2BEJA 1LK7A 2EZ4A 5DYIA 3WK4A 4YUWA 1E3WA 1KGSA 4BGDA 3D8HA 3HU3A 2EU8A 4K9RA 4AMVA 2W2MA 1U99A 3F73A 3QSGA 5TQ0A 2QNBA 3TB4A 1M54A 4ZGGA 4QOIA 2JI8A 5IDWA 1Y98A 3UK0A 1TMKA 2QY9A 7REQB 3HM2A 3D2BA 3EUFA 2EDCA 4OJKA 1AVTA 1MH1A 1XGKA 3G6WA 4KO1S 2CLLB 4IQ0A 4LSMA 2JLAA 3YASA 4KB5A 5ALOA 3MJSA 1SFRA 4TL9A 3USZA 1P2UA 4G5GA 3ELWA 2MYUA 1VIMA 3N1UA 3N0RA 2BN4A 4NZOA 4EYEA 3I8XA 1CETA 4FKZA 1QQAA 2V0CA 4G5HA 3OPYI 2YJ4A 4HN2A 4IOMA 4LSWA 4DEXA 3UN1A 1YS2X 3PQCA 2ZYRA 4RIIA 3HRKA 3PJDA 3UJDA 1FYFA 4YRMA 3JTEA 4GEGA 3LSYA 3X1MA 1TT5A 4ZAWA 1PQ4A 3E1SA 2PYDA 2Z3ZA 3BIOA 3H1GA 1GY8A 3EF3A 3LY7A 2YJGA 1ND6A 5K8IA 1HDEA 4QPZA 5T3YA 4AX4A 4O3MA 2DXIA 2Q2WA 1K92A 3E7DA 3K70C 3OUZA 1IHDA 4RZUA 5GV7A 3UXYA 4OREX 1K88A 1SC9A 2WI8A 3NM5A 4TV8F 1BX3A 1EWTA 2EP7A 2R8BA 3LW7A 3FKSD 4XTCS 2VBCA 3DMYA 4RDIA 4ZZ3A 1Q12A 3RS8A 1J9GA 1PEKE 4FHFA 1V8ZA 3B2EA 4CCAA 3NM4A 2BGNA 1LUAA 3GDWA 1YRYE 4PM4A 2Y1KA 2D2FA 3ZH2A 3AF1A 1ZOPA 3QEMA 1Y5RA 3DHNA 3QHPA 4E5SA 3KNZA 4R2LA 2BEVA 1Z7GA 3TINA 4JOCA 4TXNA 1PW5A 3CWQA 3K1YA 4Y6LA 4ER6A 5CA1B 4OQFA 4DAOA 3T3DA 5A3JA 4DXAA 1PNRA 1W1UA 1X3LA 4QREA 5CLHA 621PA 2ZCJA 3T3OA 2VJPA 4H7FA 1SK8A 5TB5A 3DD1A 1N6KA 2QIPA 4QPNA 1QDUA 1KI6A 2PEYA 5JEDA 2DFKB 1NKTA 4FJ0A 2NZJA 1YBMA 5JEKA 3KWFA 5C5CA 1ZKMA 2Q6KA 2R00A 4DIBA 1KFKB 1YB1A 2CXUA 1DO0A 1YR8A 2Z2KA 3F8WA 1SOUA 2XXAA 1E64A 1PD1A 2A5FA 4B47A 2WKQA 4OUKX 4PX9A 4RL6A 1QTRA 1HPLA 3G88A 3LPNA 4ZVRA 4G0QA 1YK0A 3DBLB 1Z37A 2BFDA 3VYSB 4ZJPA 4D6PA 4Y7DA 3PLAE 3SC6A 3K20A 1REQB 2UVPB 1ZXXA 2HU7A 1TAGA 1WW2A 2QHXA 4OI1A 3QEJA 3AINA 5CDYA 3WL4A 3RO7A 4GLOA 5TS2A 4NK5A 4M1ZA 5HKOA 1DXOA 1O94C 2JW5A 2H16A 3B3AA 5IJAA 4FFOA 4J4BA 2YV3A 4N7BA 1JNYA 3FN4A 1UBJS 3BUSA 4RKQA 2WKSA 4OXKA 1EQAA 2OFOA 4BAUA 2BFBB 1PG5A 3MMXA 5FOWA 1KJZA 1LSJA 3N87A 2JIQA 3ER8A 2RIRA 4EG7A 4LHXA 2WYWA 2CHUA 4LZAA 1JZQA 3E35A 3MW8A 3MS2A 4NE7A 1U3WA 4X5OA 3IMGA 2X13A 1DOZA 2RGAA 4BPRA 3OZGA 3PEEA 2A0XA 1OYOA 5K8LA 3ZU6A 1CQJB 2N3ZA 1E3JA 1FP7A 4J9VA 4L5JA 4X97A 3JALA 3R7WA 4ENVA 3WO0A 3KETA 1J09A 3K0KA 3LLMA 2P0AA 1LW7A 4IKOA 4S3MA 2KLHA 1X39A 2CKDA 5EHXA 3VPYA 4RKFA 4BASA 3W9SA 3KD2A 1WV0A 4PHCA 2YMLA 4BZQA 3PPYA 5F9FA 2Q21A 1Y3AA 2V4UA 1ILEA 2EBFX 3QKWA 5KTMA 4FYYA 3U40A 4PYQA 4UEWA 1W88A 3ZYCA 1JI3A 2JRCA 3C7CB 2QZZA 5KI6A 4B3RB 4BZPA 3HR8A 1JJ7A 4HATA 4V0NA 3TIGA 2O5VA 3WNZA 2A5JA 2QWXA 1IMJA 3I1IA 3W3AA 3LBFA 1XX6A 3SHWA 2QD2A 5H82A 3UTCA 2G8NA 4GBMA 4ECEA 3T15A 3I9V6 1LX6A 2P9HA 5C1DA 4R6WA 4JIWD 4CU2A 3BB3A 3ZY6A 5LQAA 1C50A 1F1JA 4IWXA 2VOEA 2B30A 2G7ZA 2EARA 3IP1A 5FOTA 4MUYA 2JHCA 1W5EA 2V74B 3P9QA 4LF7B 4XFJA 4KVGA 1JHXA 2C04A 3BM5A 5KNLA 1N32B 3VGJA 1MOQA 4C0SA 1FBNA 3DHYA 5IYZF 3R5JA 5IZCA 2PBFA 3W5IA 3MRTA 1GUBA 2VSFA 3K7EA 3SIRA 4BVJA 2W6IA 1WZCA 5F12A 1J0AA 4DQDA 1R4NB 5K8CA 1Q1ZA 4N76A 2W6PA 4MCIA 4QUEA 1CRWG 3K0EA 2CEAA 4BNLA 3ZVKA 3KZVA 1ZRSA 3NHPA 3ZCSA 4CODB 1JFTA 5HR5A 1UKVY 3KL2A 5L95A 3V4ZA 3W4IA 1GZ5A 3JQ6A 3GF4A 3O0TA 2G5GX 5JTTA 2Y9MB 1JI0A 1JP7A 1YXMA 2Q7DA 4B6EA 2EAUA 3LXUX 3QX7A 1OQAA 4FVTA 1JSLA 5CYFA 5JQGB 4ZCMA 2OUKA 1QG0A 2BV3A 2H2HA 1QG6A 3IDQA 4P3OA 3KJGA 4MV7A 4NEHB 2E21A 4ZOLA 2Q2QA 5ER6A 1U9IC 1JG6A 2FW7A 3CNNA 4OJYA 3RIXA 7AT1A 4KMSA 4JI7B 4CT4B 2QRVA 4DA9A 1XMPA 4K0RA 1Y42X 4XAQA 1E79D 3BMCA 3VJKA 4NZZA 1O4WA 2RB5A 5KTTA 2FE1A 3QF7A 3FSEA 1LVUA 4EJQA 3OT1B 4L22A 3TIXB 2LWIA 3AC0A 5FWDA 2UYQA 5TF4A 3TMAA 1T1RA 4DDVA 3COSA 3WGIA 2PS0A 3CZCA 3HRHA 4J76A 4MKZA 4BP8A 4D9EA 5HJ5A 3U4CA 4F4IA 4BN0A 4U6NA 5ALWA 1UZNA 2WG1A 3TD9A 2J7PD 4OHRA 3HY3A 1RXVA 1P18A 3CF0A 2VPQA 1ZQ9A 1SQSA 4CG1A 3PCXA 1GPMA 2JATA 3MBKA 3D8SA 2QW0X 1QQ7A 3AR6A 7ABPA 4J1TA 5DHUA 2EF0A 3Q7TA 5DW3A 2RKBA 4LRUA 2XRZA 1T9BA 1Q0LA 2AZTA 1JX6A 2B2NA 2PH3A 3GWGA 3ORRA 1GVNB 4PONA 2AW3A 4TQ9A 1XLTC 1QQBA 4DDMA 2WTNA 3PR3A 4DCVA 5K0JA 5JS1A 1IYZA 4EFDA 1XDWA 3G85A 4JGGA 3D5QA 4PZCA 1RE0A 3KAPA 4HNAA 4B82A 4M9CA 2XMGA 1VHDA 4UPDA 1VB3A 2HYIC 1LDMA 5LB4A 1BJKA 1QV7A 5MFPA 3TW8A 4WI1A 3TTXA 1GT6A 2AMYA 3F3KA 1A2QA 4MARA 2OV6A 3ZKWA 4JEHA 4RHXA 1G3IA 1E9DA 3PT9A 1LLCA 3QLUA 1T2CA 3OMXA 3VYVA 1AE1A 1ZWLA 1A7JA 3F6CA 4PG5A 1KETA 4EHJA 4F2GA 2FSGA 2XUOA 5FWNA 2G09A 4HX9A 4MVJD 1GCOA 1NLMA 3BCHA 5K2MA 4JSTA 4HNHA 1NRXA 4JD5A 3SZGA 3QPBA 4EW3A 1PUIA 3EGIA 1XEAA 4YJ2B 1RYBA 1GT91 4TKUA 2MSNA 4NE2A 1K7CA 1VPLA 2I3AA 4NV3A 4DBLC 5DK4A 4RD4A 2IUFA 4QC2A 1P44A 1N9GA 3CX6A 3G17A 5K3CA 5EN4A 3HE3A 3QKSB 2B8JA 3H75A 1KPHA 4TL7A 3ZCXA 2OCDA 2OO5A 4B31A 13PKA 4ASUA 3EMBA 4D46A 2CYCA 1RCTE 3RDPA 3RRZA 1KMHA 3NETA 4CLEA 1FVXA 4LY9A 1SVSA 5C8YA 2PKCA 2OAEA 2B0JA 2CCKA 2E48A 1ORDA 4E30A 4AY4A 1ZXBA 1FX0B 2ZBEA 3IFSA 3SDBA 1XDZA 2RH4A 4JLOA 1E61A 4IIXA 1CRPA 3LCJA 3E7XA 2OHHA 3CKLA 2RGUA 1QQTA 1JR3A 3IV9A 3K35A 4LDQA 2QZ4A 4G5XA 4C7OA 4BBJA 2PIEA 3THSA 5SYMA 1MDBA 3SYTA 3E8XA 2Y2UA 5DK6A 1HK7A 2ATEA 2X19A 1SD1A 1DTWB 2HA7A 4KRXA 3PX7A 3OWOA 2O3JA 1B74A 3K0AA 4HVCA 1WB6A 4WHMA 4IIUA 1GL3A 4NV1A 1S7CA 1R15A 2G77B 2XDQA 1RI2A 2E6UX 3VPGA 3GP3A 2V7QD 4Y6GB 3WTCA 1XJWA 4RTKA 3CVWA 1EPUA 2J32A 2OYSA 3HMQA 3INRA 3WYGA 2V6JA 4LJ6A 4U6SA 4D4GA 3D2AA 5DOZA 2WSMA 1UANA 3Q2OA 2CXNA 2O05A 2FW9A 2VYFA 3V2UA 3I5MA 2WILA 4L9AA 4XLZA 4EY8A 1FDUA 4Z4CA 5A6SA 5KVQA 1OE0A 1MRSA 2OO5C 1ZGAA 3MT8A 4E22A 3B1KA 5FQOA 4MX8A 4DB2A 4B80A 4XCXA 1G64A 4CN8A 4WBSA 4RUKA 3FR8A 4G0UA 1T35A 5J63A 3GGCA 4CGYA 1CUCA 1DEOA 2H1RA 3DQQA 5CDGA 1IQPA 4L07A 2R84A 1T5LA 3P5SA 3OSZA 3I04M 3PDIB 4IICA 1K0FA 3D59A 3IUNA 5FWAA 3V4PB 4CXMA 4INZA 3KZXA 3PWKA 4E3ZA 3BJEA 1JIQA 4EJ0A 1KYZA 4GOOD 5M7EA 2QI9C 3SICE 1GNPA 3ZTYA 2DAPA 2RAVA 1H2AS 4W5OA 3TI9A 1KHXA 3W4JA 2HLHA 3X1XA 4E08A 5HHTA 1H9CA 2AWNA 5UKDA 4AYTA 4KSYA 3PA8A 4P3XA 1M75A 4IFBA 2QVZX 4PLTA 3S5JA 1X7HA 4ZVKA 1CFZA 4LY0A 2JI4A 5J4KA 4OYLA 5ERXA 4XD2A 3H4TA 3G8DA 3GGOA 1QUFA 4MW2A 1JLMA 4OKNA 1P0MA 5MN5A 2REXB 4I5GA 4N4AA 1TC2A 2LW7A 4OQQA 4LFCB 1OFVA 1AN9A 2ILTA 3NNDA 3WAKA 1PQPA 4PPQA 2O3RA 4F9FA 2ZGVA 2XTAA 4KXFB 4OHPA 4WCDA 3N7AA 3F96A 1QBKC 2XTMA 1ZW6A 5EQFA 1VYUA 1BHQ1 3T3MB 4HAIA 4ILKA 1BYUA 1D5CA 5ICGA 1KZGB 3GN2A 2IPNA 2C5SA 3SQLA 3OJXA 1UEIA 2H7CA 4I8IA 5DXFA 1VA4A 4AN4A 5D84A 4BNZA 2ZWPA 4B17A 5AKYA 4Z7JA 4DFDA 2Y6UA 3FDZB 1U5CA 4HGZA 3TI7A 4N54A 2PTGA 2WZQA 2C20A 3B6EA 4MGZR 3QLEA 5GAJA 4ENUA 1H4QA 2ETVA 1FPMA 1YULA 4LQ4A 2OP1A 3JQAD 5EGSA 3SC2A 1TTPB 3VVCA 4GMFA 1WPQA 5BN4B 3KYBA 2WTMA 2IYEA 3IEXA 3K9NA 5FEUA 3VNBA 5D01A 2EZ8A 4EJ6A 3AERB 3HYNA 4Q3OA 2VNKA 2WKPA 3O84A 4KH1A 3DF7A 2CDRA 1D2RA 4IJ5A 4B4KA 5ALTA 3ZE9A 4XCVA 5BWNA 2Z95A 4YUYA 2C2HA 3EVZA 5C52B 1F0YA 2OXIA 2NTNA 1KI6B 3MQ4A 3SR3A 1YBHA 4CEJA 4QEZA 1QMGA 2GCNA 2WWIA 1VPVA 1JHDA 1J23A 4O4JF 2JEZA 1GLGA 2VRCA 2Z5GA 4E2FA 3KELA 3W78A 2JH8A 2XRYA 3GNSA 4O1MA 4E94A 2ORWA 3JWEA 4NOJA 2P1RA 5DLPA 1HOXA 3V4VB 3ZXUB 2IYVA 3RWBA 4B74A 3B36A 1H0RA 2ZSUA 4AUEA 4WOJA 1A2KC 3EQZA 5E8JA 3WWOA 2ZT6A 3VYWA 2QSUA 2VO1A 4KXNA 1KORA 3WL6A 2LE0A 4FIZA 3O74A 3AKZA 2WUFA 3EFOA 1SUIA 1IZZA 1Z6QA 4NZNA 2QX9A 1P81A 3I01A 3UZUA 2NU8B 1BIFA 5JXHA 2J3IA 3I9OA 1L5HB 4JS0A 4RS3A 4WNAA 3E7FA 1AHIA 1NJ1A 5BY2A 1GZDA 1SBZA 3O26A 3Q9UA 3QH4A 2G04A 4ANFA 2AFRA 5AHKA 4DJJA 3JWIA 3W2EA 2XQVA 1XD8A 2BW0A 5LA6B 4C0LA 4EKYA 1X7ZA 3N70A 4GLBA 1GPLA 1ZVVA 1V9LA 3R7SA 3TAHA 2JK1A 3FMOB 1MB2A 2XQIA 2QE7D 2JQJA 1C1DB 3UIEA 2PX5A 3KBOA 5JCOC 2ZB7A 3DEHA 8ADHA 2V59A 2Z83A 2ADFA 4GHWA 1ULUA 1RYNA 4H0CA 3WL5A 1F48A 2JCGA 3M0EA 3OIDA 4LBVA 3K53A 3P9SA 3WKDA 3KSRA 3FYTA 4NMHA 2ETXA 4UXIA 4UVEA 3MQ2A 3K73O 2PWPA 1OOEA 1PQUA 2BFCA 1T5IA 1G60A 1EGHA 4DG8A 2A0WA 4E12A 3CVYA 3VOAA 1E6UA 2RGNC 5CB8A 2Z2ZA 3SYLA 1KY5A 1I24A 1KS2A 2JIPA 2X9GA 4PNEA 1QYWA 1P2DA 2O8NA 3R3SA 3KDAA 4M8SA 2OA0A 4IILA 1H94A 2Q45A 1DRKA 4AJEA 4OPMA 2BTQB 1HY3A 2PBRA 3V80A 1EU1A 1L5WA 1Y89A 3BBPA 3CGWA 3O21A 1S96A 4NH4A 4PAMA 5JNSA 1CUBA 1W44A 5K8JB 3BWYA 2C5AA 3FSGA 3AUYA 4QARA 3L4KA 1V7ZA 2FCRA 4ZOCA 4B2PA 2J6IA 4CCYB 2FVXA 5BYAA 1FW6A 2BFEA 4RXTA 4AD8A 4E6PA 2ATXA 2PKRA 1X15A 3GARA 3IVXA 3L9WA 3TZEA 4COKA 3Q4GA 1NFFA 1M2KA 3AR9A 1TDJA 4HB3A 2A14A 2XNJA 5IVIA 3WLQA 1G0NA 1WOYA 2OG1A 2V6GA 3DFIA 4ODIA 5EWJA 3K71B 2ICAA 1OI3A 3HZHA 3IQGX 2H9IA 3AIMA 3LBNA 3LW8A 5DTMA 4J7UA 4DL9A 5CP8A 3OQOA 5CB4A 2O06A 3Q41A 2DKOA 5E6RA 1YBFA 5DULA 2I5PO 2E4UA 2AMJA 4BNVA 1MJGM 1X7XB 2BFFA 4PWZA 5GM1A 3DPIA 2HSJA 4IAOA 4TT3D 1PT6A 1IAQA 4PZEA 3AHHA 2IS4A 1C8LA 3NKLA 1X7GA 1RXIA 4G1FA 5JU6A 2OLKA 4NARA 4JLBA 4FDMA 3D0OA 4PCAA 1FVHA 4NG5A 4MGYR 3PITA 3T12A 2X0RA 2JJ2D 4HAYA 5LP6F 2R8RA 4X1IB 1ANKA 3V1TC 2C8KA 3B85A 5CVEA 3PX2A 5F1YA 2C3PA 1GO2A 1U81A 1T9DA 3CUTA 3PK0A 4FE4A 4B2YA 4FFPA 4CQLA 3BMQB 1OT5A 4MW7A 5DSXA 3KO8A 4WNIA 4X1KB 1W0JD 4Y2JA 5KQRA 1V5WA 2WLSA 1M1ZA 1JV2B 3B1XA 3JALB 4MKRA 1MJ5A 1QLHA 1KDPA 2FZEA 2GPAA 1NI4B 2R00C 4OUDA 1KMQA 1RZVA 1OBHA 3TBHA 2I87A 2XKBA 2OL4A 3EZXA 1U4SA 5DN6D 1QCDA 3GP8A 1DXYA 4B79A 3T5PA 1QMPA 3NVMB 4V2IA 2IOQA 4RCYA 2RBEA 2Y1WA 4L5IA 4IDDA 1GR1A 2H8GA 2BBWA 2H06A 4B6QA 3A06A 4E31A 5CTAA 2CVHA 5TPZA 1YTLA 3EGXA 3EXHC 4NMWA 2FMKA 2OOSA 4M22A 3CE9A 2BRUA 4NOKA 3GT4A 4WY8A 2QRJA 3SYKA 3G5TA 5J23A 3KRTA 4IJ6A 5ALNA 2CL0X 3Q0TA 4II7A 4JU9A 1Y6FA 3EXHB 3M6XA 1GCAA 4ARAA 3PWZA 3A4MA 5AK4A 3I23A 2NGRA 2Y4NA 1CULC 1PGPA 4U8HA 4Y2RA 4CKCA 2JDID 3CO0S 5LJIA 1TQ8A 3NIWA 1OILA 4LTNA 1QV9A 3BL6A 1DNPA 2ZRBA 3M6IA 3DLBA 2A7XA 3O82A 3ERCA 2PSHA 1WXIA 4WLOA 3ZHSA 2C95A 3WGMA 3WLAA 3H11A 4YLYA 4MYUA 1U2DC 2WEKA 3IUBA 3STYA 2GFQA 1ADFA 4KG7A 4OHMA 3RIEA 4C7VA 3JWHA 4BMSA 1ZA1A 1WB5A 3I09A 3STUA 2BUCA 4CKWA 5K3OA 1YKSA 1O0CA 3LC0A 4ZKDA 1TZ2A 1QPBA 3BYZA 3QLTA 3UHAA 1P0CA 1US8A 1WR8A 4FGZA 2OBXA 4MP8A 2VH2A 2VUSA 3B48A 3EVCA 3ILYA 3DDSA 1RVDA 3NTQA 2R1TB 2NYAA 4JJ7A 4CEIA 2ZTLA 1QIIA 2QW1A 1XRMA 2WU1A 4MJ7A 1NW3A 2YJ5A 1WP9A 1AKTA 1DQPA 5AICA 3GFTA 2ANBA 4WVFA 2D06A 2XEXA 1ZCZA 5COAA 1OC2A 2HRDA 3AUTA 3G1WA 4WFIA 3VR5D 4B3IA 3D3NA 2DH6A 1R5OA 1D8AA 2HK7A 5A4DA 2AV6A 3GBVA 2XQKA 4NDAA 5A3RA 3R9WA 4EJMA 1P2VA 3FWKA 1P7VA 2E85A 2O8BB 1T2EA 1PVOA 1U11A 2V6FA 2E37A 2JASA 1T0UA 4AG5A 3O94A 4IDFA 4P0QB 1EMDA 1H8ED 1NR5A 4XA8A 4M8NE 4RADA 3RNOA 4C08A 5JMWA 1IJBA 3M4JA 3SXUB 3DOFA 4NJMB 2UZ1B 4U6QA 3KQTA 2HXYA 4S1NA 2D2XA 2PZEA 3KHKA 2B3TA 5I8WA 1VOTA 1EM8B 2X3FA 1IFXA 1JXOA 4QT0A 3FJ1A 2Q62A 4OQDA 3KQSA 1HL7A 4M9UA 5EJIA 3HB0A 2YX1A 2PT9A 5ALUA 2FMIA 1JEDA 1WMSA 3MJVA 3STWA 2PMCA 4AJHA 4R0MA 2VWHA 4ZAXA 1Y3DE 3EZLA 1EWQA 4FB4A 4JBLA 1J90A 1Y5LA 1OAKA 1GKLA 4MMYB 3TYXA 1RPNA 3GCDA 4YUAA 1VMDA 1KZHA 2FH5B 3STHA 4PLGA 1OFUX 3FNEA 3ZVRA 1ULHA 4OMUA 5EJHA 1CTQA 2EF1A 3PFCA 3ETDA 3PR1A 4L5CA 4RIGA 3FA2A 3T3EA 2G83A 1NIJA 1ZJ6A 2WG2A 5TS3A 3CN7A</