3T5PA

Crystal structure of a putative diacylglycerol kinase from bacillus anthracis str. sterne
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
298
structure length
287
Chain Sequence
b'KTKFEKVLLIVNPKAGQGDLHTNLTKIVPPLAAAFPDLHILHTKEQGDATKYCQEFASKVDLIIVFGGDGTVFECTNGLAPLEIRPTLAIIPGGTCNDFSRTLGVPQNIAEAAKLITKEHVKPVDVAKANGQHFLNFWGIGLVKAKLGKIGYYLSTIRTVKNAETFPVKITYDGQVYEDEAVLVMVGNGEYLGGIPSFIPNVKCDDGTLDIFVVKSTGIQAFKDYIGKKLFEDSNENDIFHVKAKSIHIETEEEKEVDTDGESSLHTPCQIELLQGHFTMIYNPAVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BmrU protein
publication title Crystal structure of a putative diacylglycerol kinase from Bacillus anthracis str. Sterne
rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 76
structure length 287
sequence length 298
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2011-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00781 DAGK_cat Diacylglycerol kinase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.40 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 3t5pA02
3.40.50.10330 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Probable inorganic polyphosphate/atp-NAD kinase; domain 1 3t5pA01
3V8PA 4L02A 3VZDA 2Q5FA 3V7UA 2QV7A 1Z0SA 4WERA 1Y3HA 1YT5A 3S40A 2BONA 2I2FA 3T5PA 1U0RA 2JGRA 1Y3IA 4HAOA 2AN1A 2I29A 3V7YA 3V7WA 1Z0ZA 2I2CA 3VZCA 3VZBA 3V8RA 2P1RA 3V80A 4DY6A 5EJFA 3V8QA 5DHUA 5DHTA 1U0TA 2I2AA 3PFNA 1Z0UA 3V8MA 5DHPA 5DHSA 1SUWA 5DHQA 3V8NA 4WRRA 5DHRA 2I2BA 5EJGA 2QVLA 4V24A 2I2DA 5EJIA 2I1WA
chains in the Genus database with same CATH superfamily
4MWGA 2FFBA 4JP3A 1MH9A 1SCNE 3CY6A 3BPSA 2IYSA 2R97A 3GROA 3PCRB 3QUBA 4IGAA 1UBTS 1D4AA 2FW9A 4D4JA 1EAYA 4FMCF 2X4LA 5H70A 1FSGA 4DLPA 1N77A 1W44A 5ES4B 1FYWA 2BMWA 3HKDB 4G63A 1WBBA 2JBAB 1RZ3A 2ANCA 3AT1A 4EYGA 2XOKA 2XHZA 2IWRA 4C78A 2QXYA 1OFUX 1K3QA 3R0XA 1MPXA 4F72A 3M6IA 4HH4A 3K6KA 1NW7A 4B5LA 1NXWA 3H5TA 1PEKE 3HU5A 2OFPA 3Q9SA 3R3SA 3NAMA 4LOHA 4P4UA 5HUHA 5SV2A 3AUTA 5DXAA 5GZ6A 4LX8A 2IPXA 4KG7A 4MUHA 4CT5A 3OF3A 3N3BC 5EZYA 2DH5A 1Y3AA 4ZARA 1ZH2A 3D8RA 4I9UA 3V4PB 1TYCA 3OTOB 4R1QA 2IH4A 2UZ3A 1OBHA 2JKVA 3EISA 1P1BA 2CXXA 3OLVA 4LCJA 3S2ZA 2XW6A 1EQ2A 3QVUA 3U39A 1PVOA 1XZLA 1X7HA 3S4YA 1A2QA 2FW6A 3IB6A 1ZNZA 4MIYA 3K92A 5MN5A 1MJFA 2UUCB 1QHNA 3OE4A 1XBTA 3O8QA 3QU5A 1CDZA 1IZZA 2FWIA 1F6WA 4A16A 4BLRA 4MWTA 4J16A 1AGPA 4HNTA 1ODTC 1OXUA 2H1HA 3M9XA 3LE8A 1A9PA 1I4LD 2AR7A 2GH1A 2IQIA 1RE1A 1E0SA 1JHDA 2AJTA 2OSVA 1ZIXA 2ZIAA 3OHMA 2EFJA 4ZYWA 2QROA 5G41A 4CNQA 1PKEA 2YRXA 2W4MA 1LZLA 3P4UA 5DPMA 4R1NA 3JQ9A 2GNOA 2N3ZA 5ITVA 3OQ1A 1F4VA 2OV2A 2SKEA 5B36A 2YS7A 3E5RA 4L8WB 5JQGF 1YZKA 3FR7A 1FNCA 3JARA 1MA3A 2BM1A 3W90A 5KJ1A 4PG8A 1O5OA 1ZUD1 3BD9A 3IA2A 2CHFA 2IUTA 3BIXA 3GDFA 1H4VB 5B3JC 3GPBA 1KYZA 2PX4A 3E9YA 4EY5A 1KERA 1LX7A 3JQ6A 4W7SA 2YWGA 2FX3A 1SKYE 3O38A 5EP1A 1SU4A 1TVCA 1NG9A 3OIUA 4ZVNA 4MMZB 1S6YA 1QP8A 2Y1XA 4NBVA 4DCNA 4KRGA 4RPJA 2V0CA 5LKRA 5COQA 3ELVA 1N9ZA 1BC5A 1GG5A 1MU0A 4QOFA 4DMMA 2XOEA 3DOCA 5ALSA 1VRVA 1DBWA 3KD2A 5J2TB 3MWYW 5CYOA 3DB1A 1S8OA 2BHSA 4PPGA 3SZMA 1TZJA 1OI4A 2C3PA 2A14A 4QU5A 3T34A 3ONEA 1UXHA 3Q4GA 4A2CA 4PZUA 1F0KA 1RM4A 3GLSA 4YCAA 3HG7A 5JHGB 4X20A 5FOTA 5M04A 3KSBC 2Z4RA 1E3MA 4RV5A 2WKRA 3SKVA 2HH9A 3RHZA 4CM5A 5C4MA 1UP4A 2FUNB 3QVVA 4IZOA 2CW5A 4RJ2A 1CZRA 3KT3A 4N9QA 3K1YA 3SSNA 4I36A 1YR1A 3ROZA 3WZ2A 4Z4IA 4RH0A 4AF8A 5I5EA 1L1EA 4S24A 5IC4A 1KXJA 3HCOA 1U9JA 2Q1SA 4NEGA 1WSAA 3RFFA 2VQEB 2DHCA 5AI6A 1K08A 2QE6A 3FCSB 3KNZA 2VPIA 2QMQA 1JX6A 3MJHA 2QVYX 4XWTA 1TJ5A 4WXRA 3SU8A 4Y7DA 4F97A 3MMZA 4TN1A 5LPNA 3FWHA 2LC1A 3KXKA 1J1UA 3IMGA 2XT6A 2C78A 4CFZA 2YCLA 1Y7TA 2HA6A 1YR2A 3GBPA 2QTCA 4YAUA 5BUZA 2G9QA 1F12A 3SXUB 4G36A 5EHIA 3GAMA 2H52A 2QUIA 2R4QA 3G49A 3H5AA 4AKHA 3AY3A 3LRPA 4Q9HA 3LC2O 2OGSA 3GG2A 3LHIA 2IBTA 1CLUA 2OV6A 3TTWA 4EJ6A 1OI2A 1FS5A 3I5AA 2YV5A 2JHPA 1DJNA 4MRAA 1QVRA 2QGFA 3HSSA 1REQB 2D5BA 1WVGA 1WXXA 3IXLA 4IAOA 3OLZA 4PLVA 5T3UA 5JANA 1OAOC 4OQLA 3RBVA 1MQ9A 1RKVA 2UAGA 4P5DA 3JV7A 1RTTA 1XROA 3VU8A 5CYPA 3NKFA 3BGWA 2ERCA 2CV0A 3DMHA 3TOXA 5FUQA 4GAEA 2NO9A 4NS1A 3SQXA 4FW8A 4IVPA 2XWSA 3CHYA 3PEFA 2SECE 4XW2A 4EKIA 4KK3A 2A5GA 5HE9A 3KQNA 1OT3A 2Z0MA 2FPXA 1D5CA 1E89A 3W6PA 3DBLB 4YAIA 2FW1A 5KYXB 4Z51A 1U90A 1Q57A 1N5LA 1YD7A 2GD0A 3RTGA 3BMNB 5EVCA 3IUJA 1GLNA 2PRIA 4MRRA 1E7MA 4HPJB 4QQKA 4RF2A 2BFCB 1ABBA 1E2UA 1T35A 5K20A 1CUAA 4JOQA 4DRXB 2N9UA 1VI5A 4QASA 1UKVY 4DS3A 1C0KA 1PX0A 1CZOA 3LA8A 3RSQA 1WUTA 2ZCUA 3IOMA 1LX6A 1Z0AA 4HNSA 3F8WA 4LTDA 1VYTA 2GN6A 1N2ZA 4V1CB 2EEPA 1NAHA 1JXQA 2NYVA 3MM4A 3GWGA 1Q77A 2D5IA 3OLWA 1DXQA 2AG5A 5FAXA 4FDTA 3N7UA 3R8XA 4C08A 2E87A 2R1TB 4Y2GA 1KSJA 3A1TA 5ELLA 4V0RA 2Q29A 1M3SA 4X7PA 1PT5A 4X6UA 4HLCA 2YV1A 3INYA 4FOTA 5D3MA 4HVLA 1DFHA 2CLCX 3GELA 2AZXA 3AI2A 2E7ZA 3NU1A 2D1SA 1KFEB 1Q0RA 3LX6A 1C8BA 4V24A 3WIBA 1KHHA 3EDCA 3DL7A 2IDZA 2BFMA 3PHGA 5D86A 2DBRA 2ZZKA 4RV4A 4D5EA 4DLSA 4FDAA 1SC6A 4YJ3F 2JLAA 4DR6B 1PVVA 2HUPA 1A3CA 1QYVA 1UT6A 2BT4A 2VJQA 4KUHA 5DI3B 5H9VA 4Q3CA 1A27A 4WJLA 5HE8A 5IMSA 1L7AA 4ABTA 2YXNA 4YT4A 4JA0A 3HMQA 4K9KA 4CM4A 2BCGY 1KMCA 4G81A 2DEUA 1CIJA 5FYDA 4RIGA 3RBXA 5JTUA 3OPVA 4I1YA 4JBNA 3I6WA 1QGOA 1GJRA 3D81A 4GGPA 4R8KA 1GZ5A 1MJSA 5A2QA 2G9UA 2J1LA 2E5WA 3E5NA 3LO8A 3OFVA 4EL0A 3IIKA 4R16A 4YMTA 1GKIA 2HYIC 4G09A 4MYTA 1Y9AA 4R2MA 1TA9A 1NP6A 4LV8B 1YJQA 3EWNA 3PX2A 3PR1A 4EW3A 5EJIA 5EE1A 4C04A 3LU1A 5DSZA 1E5XA 4IYRA 3WAKA 3SKYA 4LJRA 3CX3A 2GF0A 4A7PA 4AZTA 4PR3A 4AYWA 2BW0A 2FZVA 1Y63A 4QD3A 1B23P 1E1NA 1TQ4A 4LZOA 4WINA 2JCXA 2ZIZA 3HCFA 3LI2A 1OYOA 3GCZA 2B1JA 4BQEA 3PC8A 4GE3A 4K87A 3QXCA 3BVPA 2GYVA 4UTVA 1NX9A 1TM3E 3ZD7A 3NPMA 1NOKA 2UVQA 1EZ4A 1ESEA 4MKHA 3C15C 3O84A 3I5MA 1P1FA 3JAWA 3K0KA 4Z4HA 2R11A 3I9JA 1ODJA 1U3TA 1T3LA 1E2EA 2VSXA 3AMVA 4H31A 5CW1A 3KQOA 3MPOA 4HN4B 1BMTA 3L8ZA 1KYWA 5JSHA 2O1EA 4IJVA 2IU3A 1JEDA 3EEFA 5CT9A 5K3OA 4QOGA 1EUCA 3I9V6 1XTKA 2RSLA 3PR3A 1DQRA 1LSUA 3KZCA 2FW7A 3NTQA 4TV8F 4TVOA 2DWCA 3GPIA 5YASA 4U7DA 1D9XA 4DJFC 1LK7A 1FDWA 3D6MA 4Q7EA 3HB9A 4E5NA 2AUMA 2AJDA 2GCIA 4G1FA 4MYSA 2XYVA 5CVCA 3HLTA 4ARUA 1GXCA 3M6UA 1CZLA 2C7GA 2OM2A 3L92A 3DEFA 2VTBB 3IBFA 1CYEA 3ZTTA 2GPJA 2P35A 3TX2A 4C21A 4XWAA 3PQ3A 4AKEA 4D3ZA 4D6YA 3H6HA 3T8YA 3TPFA 1J42A 1ZS9A 2I7VA 2AFRA 4QICA 3ELBA 1Y4DE 1ONPA 4GPD1 4BKOA 2I67A 2JQJA 5DP1A 1DRVA 1Y8CA 4JONA 2HRRA 4PAWA 3VPAA 4BWVA 3SFVA 1DEXA 1NFFA 2NU7A 3VO9A 3GT0A 1I3NA 1CB7A 3WB9A 4C9BA 3ZE6A 3QPWA 2J9YB 3TSZA 1SXIA 4AS1A 2P9EA 1TAQA 4DT1A 5TPZA 5CRIA 5FJJA 3QX7A 1DCMA 2NNWB 2R6R1 1Z15A 1EP2B 3U3OA 3VBEA 2ZRPA 2FPKA 2QP9X 3GXBA 1ZGCA 1U2TA 1SQ6A 3CKYA 3U4IA 2YOHA 5ALFA 1H0SA 3NWEA 1HNWB 2WU3A 3HVJA 3AKEA 2W6JD 2E4ZA 4FYMA 2FCRA 4YAOA 2IFTA 3ZZTA 1IN8A 2R87A 3W5DA 5EI5A 2HWUA 4H4DA 4CKWB 1GCUA 1UJ2A 5CB0A 1JR3E 4E21A 2C82A 2YWEA 3FFAA 4F3TA 1YRLA 5T6MA 2BGUA 3R77A 3FAKA 2NPIA 2RKOA 4GBMA 4UOEA 5JZBA 5K9ZA 2IZ5A 2QRVA 3K9HA 4LJSA 4RYDA 3VH2A 4M1MA 4CF6A 3JQAD 1R9MA 3D3EA 1BS1A 4HB4A 3NFYA 5BSRA 1PJLA 2CVQA 4G0MA 5K8IA 3WGQA 2UZ1A 2NX2A 3C87A 5CTJA 3VOAA 2ORED 2JGIA 4H6VA 5H59A 1ZAKA 5LQJA 3U7QA 5LP6B 2QD5A 4BWFB 3W5IA 3LGAA 4Q7LA 1JU9A 1XVUA 1O5IA 2Z43A 1P33A 3D6JA 4MITA 1RRGA 5DM60 2CDAA 5LA6A 4DCSA 3UMYA 2O8FB 4L07A 3WJ7A 4S12A 1G7TA 1KKUA 3NC0C 1QAQA 4P7KA 1ZCFA 1UKYA 4EHFA 1N2IA 1PN3A 2YXEA 1HMPA 1MTOA 3QFRA 4PSCA 2X2OA 1UOQA 2DQSA 4RIIA 4BXOA 3LP8A 4H35A 1IULA 3VNSA 4EF4A 2AS0A 3CR7A 1ZMXA 3GA7A 4DCVA 3TNFA 3GARA 4DJDC 2A5DA 5EN4A 2JEOA 4DLYA 1A8PA 4EABA 4KBFA 4KWTA 3D0OA 5FLKA 5FQNA 5GV8A 2NLOA 5CK4A 2GPTA 4YP5A 4WX2B 1O1YA 1N92A 3HADA 1JB9A 3FJ1A 1U94A 3VAAA 4F6RA 1UC9A 1Q1ZA 5IZCA 1PDVA 2W90A 4Y9UA 4LOAA 2I2FA 4TLLB 1U8ZA 3QVOA 5ICFA 2NMVA 2FZKA 4NYIR 4E3WA 3RUDA 1DQYA 3N2LA 4MR8A 3KVYA 1WLYA 3W8RA 2P30A 5H3LA 4QSHA 2E4WA 1QR2A 3EZFA 5KVSA 3QUQA 4Q4CA 3N2KB 3D6VA 3IR7A 4LBWA 4XB2A 1Y37A 4Q4AB 4IZ6A 5EL0A 5P21A 3SC3A 5HK9A 2Q1YA 4LE1A 4K9LA 2HPVA 3CBQA 3FF1A 2JI4A 1BE6A 3KALA 5EQTA 4A6PA 3AJ8A 1Z0FA 2P2NA 2GM9A 1W47A 3II6X 4WZAB 5IHPA 2PRJA 3DM5A 4M99A 2YVLA 3DQPA 4N7MA 1KI7A 1P0QA 1FE8A 3BTVA 3GHYA 3KLPX 1FA9A 2P0YA 3MYRA 8AT1A 3J81k 4DV5B 2R6HA 1DAHA 4RD0A 4WFKA 3DO5A 3K16A 5C1IA 1G7SA 1UZAA 4LF8B 1F2DA 3HY6A 4FHZA 2IZ0A 3LT1A 1QF9A 4G37A 5DGXA 3MRSA 4HL6A 4IJMA 2IK8A 4MA5A 4MVJG 5ARCA 2HCTA 1NYTA 3PDUA 4OQQA 3V2IA 2QRGA 1LFDB 4RD4A 1RI1A 5KQRA 4A15A 4FMCB 1X86B 2IYPA 1K6XA 4EDHA 5T5QA 3TYXA 3FLEA 2IYFA 3NCHA 3TQSA 2FUG1 2XBMA 3KSRA 2GN2A 2DTDA 1XF1A 3ERCA 1PAUA 4HVAA 5JNLA 3TJMA 1HZZA 4LRSB 2G77B 4L2IB 3WZLA 4JD5A 5HIIA 3DL2A 3T1HB 2EEZA 4FGKA 3B52X 4GL4A 1KVQA 3RTCA 1VJ5A 2COEA 2VHEA 5JYDA 1DKQA 4PE5B 3BC1A 3EY9A 1RBMA 3O3MB 3O95A 4LVNA 4BRZA 2FWNA 2V1UA 2ZB2A 3C4QA 3CVJA 3WY9A 2BFAA 2GJ8A 1C1HA 5B3LA 2VG8A 4ECAA 3SVLA 4B3MB 4TOIA 2G9RA 3CPEA 1PT9A 3NHZA 2QX4A 1C8LA 4ND1A 4FE4A 3DDWA 3AJAA 2WJAA 3T15A 3ANLA 5AMXA 3AVWA 1NURA 2EYQA 2ACVA 4EW6A 3P9QA 1G9SA 4YT5A 4FFSA 2C2ZA 5DNYB 1NUHA 1VLZA 1FX0A 2HFJA 3BA1A 1US8A 3S1AB 4ARZB 1W4LA 3NBYC 4FYJA 3DOEA 3K15A 3PC6A 4M9QA 2UYCA 4HRXA 2WPNA 4MVJM 2BE9A 3T54A 1YBMA 2AGVA 3QWHA 4PIPA 1P2VA 3MJSA 5CBPA 5BNZA 4QDOA 3DBRB 4RC9A 1ECCA 2XT0A 1ZBQA 3WQBA 3F8TA 4MS3B 2PS3A 3RTEA 2OV3A 3A3KA 1PDOA 2Y1KA 2DOKA 4K6CA 4J8PA 2YZNA 2WWFA 1SHZA 5JQGB 2JI9A 1K0FA 3JX9A 1K8RA 3OQMA 1DUIA 1XHEA 4UE2A 5DVZA 4BCDA 4D97A 4H6XA 5EHGA 3E5HA 1TLFA 4IMPA 4JDUA 3UFBA 4AF7A 1X7DA 2VRCD 4J43A 5I7RA 1N0VC 2ZIEA 3BRWA 1MRZA 2VWHA 1SZJG 3LPDA 4INJA 3PBKA 1POXA 3HLYA 4MVWA 4PGMA 1GP2A 4DIKA 3H0CA 4JYBA 3SIXA 4IOKA 2OHHA 3E9ZA 1N6PA 1NQWA 3PU6A 4XOIA 2PR2A 3VRHA 2XNDA 5IC6A 2RG7A 4GQBA 4JJIA 4HBGA 4QFDA 4GR5A 1KYXA 1RAIA 1CVLA 2XUJA 5AM4A 5C4IA 4G1UC 4MH0R 1PD0A 2X86A 3ZJTA 5SZJA 4FEEA 4LJ7A 1XV5A 4D57A 2IP1A 4HUQB 2B82A 5IH7A 4RMGA 4BNTA 1T15A 1QGDA 4RH3A 3E3MA 3RF7A 5LZ2A 2ZBRA 2X23A 3RJTA 3W5AA 1JDVA 1JXMA 2EG9A 4CKZA 5EEGA 1EJBA 4X93A 2HLDA 2PNJA 1P4RA 2GZSA 3LXRA 4PLYA 3R6WA 1AKUA 3GDHA 2H7XA 2DLNA 5AVVA 4C5CA 1X77A 5LDHA 4CCYA 5CDSA 1Z0SA 1DTWB 3DVAB 5L3VA 3MMSA 3Q7PA 3FMOB 3D2LA 3I2JA 4JIMA 4A91A 4ZFNA 1S2DA 3FSGD 4MGYR 4N7RA 1NFRA 3ESDA 3B1WA 2X5OA 2E4UA 1FLDA 1MEOA 2VWGA 1G5FA 2Y1DA 3P2EA 1E79A 3CV3A 3WRYA 4CKCA 4B73A 4I55A 3Q6MA 2J0VA 3KAQA 3HI4A 3CVXA 3IXMA 4QYIA 1DNPA 1PQPA 5FWXA 4WZBE 3GP8A 4MV6A 1X80B 4RMNA 2WFMA 4QX6A 4HV4A 1OX4B 1T4GA 4PWYA 3TQFA 1RSZA 1IZ8A 3RYFB 3BTOA 2VAPA 4E46A 4IJUA 1CULC 2WTBA 1WULS 3FVQA 4JENA 4JX9A 2V7TA 4FZJA 1UODA 2CY0A 4RVGA 1I4DD 2PL9A 3BHIA 4KMSA 2HT6A 3SZUA 2RIRA 1UAGA 3ZHVA 4BBAA 3JWIA 4GRIA 4BTVA 2NXJA 5KSWB 4R83A 4PC1A 2Q2WA 3AHJA 2J0QA 3NV7A 1VI2A 1SOWA 2PJRA 2VA8A 1UJ4A 2B4YA 4UBJA 3E70C 3TKYA 2HJ9A 3P2YA 3DYIA 3B3AA 2W6PA 2WYIA 4J29A 4JH0A 4MB6A 5ED4A 5AM5A 4OSPA 1Z6XA 5EXXA 2VDKB 4MK4A 2W2LD 1ATZA 2H8GA 1VC2A 3L0PA 1TCCA 4C89A 4DNXA 4H0FA 3DW1X 2EX1A 4TUYF 4WQMA 3ODPA 4PNPA 4DCUA 2DETA 1JJAA 1PWXA 3MZ0A 5DLYA 1R6AA 1M6EX 1HL7A 4LYDA 1NPTO 1J99A 4Q9AA 2O3TA 2ZETA 3WK7A 4AP6A 2XDAA 2ATCA 1N2JA 4AN4A 2GARA 2PGXA 5E6UB 4BU1A 5JD5A 1QRUA 4GSKA 4YV7A 4GI7A 1IZ7A 1RHMA 2LCFA 2PQ2A 3BWDD 2CT8A 3KAKA 1QQAA 1I0ZA 4GBGA 1H6BA 1PQYA 5CG2A 5A4IS 1C80A 2YRWA 3EDYA 4XTCS 2VS1A 5IDXA 1ZMTA 2AI1A 3R6GA 1SVWA 2J0UA 4FJ2A 5IM4F 2BAGA 3T3NA 1RPAA 4NCJA 3EVFA 2FF4A 1I6KA 1I32A 1PVDA 1VHLA 2X13A 3CF4A 2IOFK 2WM9B 1YE5A 3EMKA 3L1HA 3EXIB 4PBTA 3I6QA 3UT6A 4M0UA 5CFZA 3D64A 2PPVA 3CRVA 3UZUA 4GM0A 2ZIXA 3TXAA 1Y33E 2YX1A 1G8PA 2AB0A 4D8XA 5LXTA 2CF5A 1YNSA 2D2VA 4ZMBA 8ABPA 4MPTA 2ZU6A 3AUXA 1IY8A 1GAEO 1GQ2A 2TRSB 1L4UA 4LYHA 4R81A 3R5SA 3R7DA 1XL1A 1QVWA 1GGVA 5L8VA 3HWX1 1ETUA 4WCFB 1AA6A 4WY5A 3N2ZB 1IHYA 4UM7A 2WF7A 4YJ3B 4V38A 3SHQA 4AJPA 4BEBA 2VPQA 2ODNA 3BJRA 3TPCA 4DLWA 3ENQA 4F3NA 1QHGA 2P2LA 4NH0A 3WYNA 3G0HA 3TEJA 2OFOA 1E94E 4RCZA 4BO1A 4M87A 3YASA 4QT0A 4AWXA 5KOHA 2KB4A 2C42A 5AT1A 5BV8A 1ZUIA 4REMA 5I4KA 3F47A 4FHDA 3GJ7A 4QWMA 3BE5A 4TMYA 4I1RA 4YJGA 3KZ1E 3E0XA 3ZW9A 1GAXA 1JLMA 4YPVA 1P5JA 3WLMA 5EKUA 4BKMA 5CB4F 1OU4A 1F8XA 5BWNA 4QIHA 2EU8A 1BEZA 3NOXA 5FNVF 4KR9A 1DQNA 1TZBA 1MX9A 3GEPA 4KDFA 4C29A 1WUIS 4AYTA 1B6GA 2VRNA 1KJYA 1FTQA 2WFAA 5D3QA 2WTXA 3RFCA 4Z7OB 3KWJA 5I4IA 1YU6A 5FI3A 1KVSA 4KGZA 3QE9Y 2MWMA 5JD4A 3DE4X 4YGXB 1AGXA 5AKHA 1Z2DA 2X76A 1PJAA 4ZICA 4HADA 1RLOA 2IEDA 2Q21A 4ON9A 3M3HA 4RA6A 1SNYA 4J1TA 3FIJA 3V4FA 2ODTX 2V5VA 2B4AA 4NIMA 3RSFA 1T43A 1Y9DA 1ICIA 1M33A 1YBVA 1KI8A 2DJ5A 2HA7A 4ESHA 1BG6A 1PQUA 2CCKA 4PAGA 5HCIA 5D7NA 2FHSA 2GZRA 1FTWA 1W1IA 2I7XA 3ELWA 1AHPA 2ZWVA 2X8LA 4MVCA 1Z0DA 2C92A 4R2WA 2ZJ2A 3AFOA 1YVRA 3GYBA 4X0EA 4TV8B 4OBEA 1UBUS 3ZZ0A 4QPZA 4G0OA 4M8NE 1UZUA 2CN1A 3IERA 4O4JF 1YTLA 4S2EA 5BXQC 3IEMA 2XQGA 1Y4AE 5EPUA 4J0DA 3T99A 2KLBA 1G6KA 3PUVA 2ZWOA 1YB7A 1E20A 1QYWA 2FSGA 2YQ4A 1SVNA 4GHWA 1ZI9A 1RRPA 1SUDA 4KLZA 3JQEA 3K0FB 4M1TA 3HUFA 3GAZA 3HKEB 4Z9XA 4YMVA 3GV0A 5L7TA 5F1YA 4Q3AA 2NU8B 1D04A 2AEMA 1V26A 3FMVA 1CIVA 1L3BA 3NTLA 5TF4A 5C5DA 5C8ZA 3FNEA 4JLWA 2Q3CA 2AXPA 3QX8A 1CU1A 3K9NA 4M36A 4RIHA 2Q5OA 1M6HA 2C59A 2KB3A 3MN1A 3UNNA 2HV9A 2WIFA 1O96A 4U2FA 2EBFX 4JVMA 1G21A 3LWNA 1SIUA 3KJQA 3MWEA 4HHEA 1NSYA 4C7JA 4JYAB 1WXEA 3GJSA 3ECCA 2P4UA 3ABOB 5FPPA 4XZ3A 5TQ0A 5JADA 4V0LA 5T7BA 4R2XA 1VMDA 2HK9A 2BUAA 2QPOA 2J32A 1G88A 2C9ZA 5E8JA 1SMKA 1T5SA 3STWA 4HCJA 5FFMA 4Z4FA 4RCYA 5GOZA 4JXKA 3MUNA 5BQPA 5CA1A 2JJYA 4BWGA 2P3SA 2XQVA 1QTIA 4HDKA 4LHXA 5DW0A 4EVSA 2FZ5A 1MOPA 1O2DA 2WQZA 2X19A 3QHAA 3FKSD 3NIBA 1IPHA 1NQXA 4NENB 1ID8A 2AHOA 4AJHA 4GMXA 1WIWA 2XNCA 1L0BA 2X4DA 4HSGA 3OHSX 1QIFA 1FPQA 1S9HA 5LDDC 2V97A 4OCZA 2IEBA 1EX1A 2AYXA 1LPNA 3I9V1 1EDOA 2FWRA 4PZPA 4TXHA 3ZY3A 4FYHA 2IHJA 3RVJA 4W6QA 2HREA 4OMFG 4RE5A 3I05A 4IY1A 4I0WB 5G4KB 4RDIA 4RTJA 4PZEA 3F73A 2F55A 4KGDA 4JIVD 4Q03A 1MC5A 4JR0A 5BSEA 2ZBVA 4JVSB 1KO5A 4KLCA 1AXEA 3L9WA 5EQDA 3PQCA 1FLNA 4FGLA 5K3CA 3WYFA 4AJNA 4BGDA 3U60B 3EZYA 3LLCA 1BX3A 1NRIA 3P9YA 4II7A 1CVIA 3W6NA 2PS9A 3LZDA 5BSHA 1W0KD 3CWZA 3L7KA 1RYZA 4NONA 4RPLA 4OHOA 3K1TA 1N1EA 4AG5A 4JBIA 1GNPA 2AW5A 4GMFA 3JWPA 4QA9A 2EKLA 3KQMA 5KC8A 3AEUA 2C5AA 2XUIA 3IJEB 5LIPA 2VK4A 5ALPA 3AL2A 3ZWQA 3HA7A 3RAFC 1FXWA 4LI3X 2EGGA 1GIAA 2LKDA 2XTZA 4GPIB 4TPKA 5CCEA 2A3NA 2MT9A 5F1KA 2R5WA 4BE7B 1NR1A 4M1WA 4OHRA 2O8DB 1UK8A 3GOQA 3K0BA 1NBHA 5TC4A 4WGFA 4O2RA 4O5OA 5GIOE 2JLRA 1XNRB 1FYFA 3LIPA 4CM1A 2HQOA 2VBGA 2ZYIA 3SNHA 2ZI3A 1BGVA 3R5HA 4YDQA 4RU1A 3W2IA 4L85A 5HS4A 1CJMA 2YCBA 3FPJA 3EDQA 1SVOA 2X1VA 3DBHA 3GZNA 4YS6A 5C4GB 5B2ZA 5IN4A 3K0AA 2D7DA 1TYDE 3BUSA 5LC1A 4D3YA 4EPXA 4P53A 5I01A 2Y8EA 5E0KB 1T24A 4BFVA 2Z3WA 3RAGA 4EG6A 2YKGA 4A2QA 4EUNA 4GLFA 4KPGA 1KBZA 1VE5A 2J6BA 5KTRA 3UY4A 2NPFA 3QX9A 1V25A 3C3AA 5F1OA 1EGHA 1G98A 4RQBA 4XDGA 4PSAA 1NVBA 4RTPA 1YQDA 4ZHQB 2Y4NA 2X9GA 1K89A 1TJPB 3UUGA 3VH1A 1CNEA 3TAHA 5AHWA 3D7SA 3NEPX 4CDGA 1O6CA 1TKAA 4LBVA 1W19A 1Z4MA 1T8PA 1X0XA 2JFOA 4GP7A 4LXGA 4ESOA 3NBXX 2YMLA 2RJOA 5A7FA 2XUFA 3EOZA 2IOHA 4C4AA 4S05A 3JZMA 1QFSA 3K9GA 2C3MA 1W49A 1L7OA 3OICA 3VR5A 3KJGA 1FSSA 3G0GA 4DREA 1YQUA 2ZR0A 2ZWPA 2EBUA 3QPBA 3H1TA 4GZ5A 4M98A 1XK6A 3M3DA 3EYAA 4LC0A 3BWCA 4UCWA 4XGKA 3NC4A 4IQGA 1Y9ZA 3RS4A 3TLCA 1XLVA 4RFSB 3DOUA 1RHQA 3OKCA 4KQ1A 3ZDEA 4A8PA 3FA2A 4FD2A 1T6NA 4ZU6X 4UKDA 5M7EA 4DLKA 1CUYA 3MWDB 1U7HA 4I9FA 1F0NA 2G8NA 3I34X 2QMYA 1XNHA 1WE2A 1AUVA 1STOA 1UADA 4TYQA 2C61A 4XVRA 1MABB 1PJRA 2GZ3A 3H6KA 4Y0VA 3N1UA 1NF9A 1HE3A 1UXIA 1EWYA 1AXRA 1NL3A 2FDXA 3C3CA 4KQEA 5AKLA 4R8RA 2VI5A 3ET5A 3Q7RA 1U8CB 3UJBA 3B6JA 4M89A 4CJXA 1LBEA 3RWBA 5TF0A 3ZUGA 2XADA 2ZZMA 3PCXA 4Q24A 7REQB 3CNLA 1XE3A 3T61A 3F5SA 4W5TA 1QYDA 3UW3A 4QRHA 1CYDA 4L3OA 4BU0A 3O92A 4EEKA 3N75A 2QG6A 3AFNA 1DELA 1CUCA 1L4NA 2CB9A 3GAAA 1N3LA 3NZEA 3NYRA 3QHPA 1TAGA 2HMWA 3W7VA 3CC8A 4DRYA 5JYEA 3RU9A 2WZBA 3IXQA 1LJUA 4A5SA 1TYZA 3JATB 3CT6A 3PUKA 4HAVA 4BBPA 3LLUA 3BWEA 1J56A 3FBWA 3VR4D 4DUPA 1S2OA 4TYWA 5L40A 3U3MA 4FCTA 3PZBA 1RPTA 3CJQA 1PSWA 2RAFA 1U3WA 1ZNQO 3A6DA 3EASA 3H17A 4K03A 4NWIA 2YFQA 2Z83A 1TQ2A 3B36A 4JJKA 1JIXA 1W2WB 1IXYA 4AI6A 1NXSA 3C3WA 3GGSA 5B7GA 1E1MA 2HPZA 1G20E 2SKCA 2WWGA 1O89A 2XIQA 4CN9A 4RUKA 1W93A 4ITRC 4W9NC 5DM70 2I6FA 5AICA 3OZCA 3R41A 5EIWA 3AIMA 5JD6A 5JI2E 3PSAA 4C4TA 2VJKA 3H9UA 1T3TA 1VYHA 3F6RA 1SK9A 1THZA 2O57A 4MRVA 2JANA 1B0AA 3LPNA 4NV0A 3TW8B 3PR2B 5F23A 4N0DA 2WQ6A 4CEJB 2AZ4A 1UAYA 5JEEA 3BRCA 4S1TA 5IBPA 3RVSA 1U1EA 2GLXA 1ZIOA 1R5BA 3F2VA 2NUBA 2YJTD 4HDMB 4PPNA 2HWWA 5DDIP 5IZ4A 4Y2HA 5BR1A 3KT9A 4QJBA 5TV2A 3A1VA 2CLDX 2Q2OA 1XRNA 1FOEB 5LBIA 3I2IA 5KJ6A 3HFJA 3L7CA 3RG8A 4DF3A 3HGMA 4INZA 1V71A 4CDMA 4ENPA 4RTNA 2AFFA 1FB5A 1CUBA 1ZM9A 2JAHA 2JD1A 3IJ5A 5LR6A 1HT1E 5C8YF 1NMYA 1X2EA 1YDFA 4C6SA 1YZ3A 2W6ID 2E49A 3AETA 4YAFA 4ZAWA 2QV7A 2D0IA 4RETA 1R0BA 4X7BA 1GUYA 4JJZA 2G4VA 2XKAA 3A9VA 3BJIC 4LSGA 2J41A 1NT2A 3HN6A 3IBTA 1OD6A 1VP3A 3EZLA 5FF9A 4F9EA 4CEHB 1WPXA 5AHKA 5A3SA 3UJ9A 4DQKA 4KRXA 3LXUX 3WRVA 3FCCA 4MIOA 4HGOA 3P5BA 1H1LA 7ABPA 3CEJA 3GEIA 3WAJA 2PKEA 4CLHA 3AU9A 4FT2A 4KH0A 3CX8A 5IJ0A 4QQRA 3WGZA 1Z0UA 3PEEA 1BHSA 3OE7A 4YONB 3TI7A 3IVRA 3W79A 5BN4A 1HE5A 5EHQA 3IR5A 4MS1A 4ZXFA 1P2FA 5CU7A 1P4AA 3AVQA 1EE2A 1KJIA 3RFUA 4LMAA 2XVYA 5FEUA 3C1AA 5EJ5A 1VCMA 4C0QC 1NJSA 2C2WA 4JBLA 4I4TF 1Y8ZA 2QLJA 3BG5A 1J2UA 3AW8A 3ECSA 3HXOA 1RRFA 3MA0A 2QJOA 3Q87B 2ZWIA 2UKDA 2J3QA 2GLTA 3ORYA 4FFBA 4M83A 4EPYA 2QIPA 4EY4A 2IKQA 1FEZA 1N2CE 1UJMA 2B61A 2OUKA 4G2NA 4TUYB 1Q6YA 2DBYA 3SOZA 1DC6A 1W76A 1XKQA 3VU9A 2XMPA 4F4HA 1QU5A 5DX1A 4MUXA 2HMUA 3TLGA 1EHIA 2YMQA 3D0RA 5FR1A 3SC2A 1I6LA 1MX3A 1M75A 1OV6A 1WXWA 3CNNA 3QU2A 3EC7A 4FBMA 2CVHA 4TZTA 3VPGA 5BN1A 2VXBA 2IEAA 2HU7A 2OOKA 4NJEA 1NU8A 1Y5NA 4TT3A 4J7AA 4POAA 2A1TS 2CZCA 4PX2A 3CEMA 1OXBB 1WCV1 2BHTA 4LWQA 4P32A 4QTYA 4BDSA 1D4ZA 2W5UA 2Z8YA 2GPBA 1Z2NX 3ITDA 1JJ7A 1RYYA 3DZIA 3F6PA 2GVZC 2Y2VA 2Q0SA 4HZGA 3W6ZA 1WZCA 4PFJA 2BKAA 1V8ZA 1R10A 1WDMA 2E85A 3PXBA 4ZZ1A 1WVMA 1Q2UA 3Q3IA 1E69A 1WMAA 4TS4A 4US2R 1R6TA 5CFMA 2QGNA 3IP7A 1GGEA 3LWZA 6LDHA 5J2UA 3K0SA 2ZE5A 3ABZA 1NC1A 3QLVC 5F9HA 3K5WA 3M4YA 4G5XA 1JTFA 1QSGA 3PSHA 2A3RA 1SBHA 1ADYA 1GLGA 3RRFA 2O8FA 4MI6A 1QO9A 1FFSA 5HKKD 4R3UC 1KZ4A 1T9GS 4KE6A 4MHTA 1XZFA 2J5BA 2WZCA 4YALA 2KLHA 2ZUEA 3H7IA 4G0ZA 1FTGA 2D7JA 2ZVDA 4QU9A 3DXFA 1WZEA 4MYCA 3TMYA 3VISA 5EIBC 4YRGA 4QNRA 2RGNC 4URHA 3OX1A 3SZ3A 2XXAB 3SJZA 3G9XA 3I9MA 4FTWA 2CEAA 3ZBTA 1ZJZA 2QS9A 2MJLA 2CXSA 2JCYA 3N2IA 4M21A 5FUYA 3RWOA 3U4DA 3CLTD 4BASA 4YPOA 5CB4B 5CFOA 2EKZA 1N7JA 5JTTA 2IPNA 4IV5A 1HTTA 4JEUA 1YMVA 3BK7A 1Z12A 3M82A 4FUTA 2FEWB 3HRIA 4NZNA 1BCRA 4OUDA 4R6XA 3EFOB 5B57C 3U7IA 3KQSA 4BP1A 2YZGA 2PQ0A 1PEDA 2C4TA 2CXUA 2PYZA 4HXYA 3UK0A 3OF2A 4NZYA 3AEYA 1CXZA 3E3AA 4D41A 1JWLA 1J6UA 2DPYA 4M8LA 3UAGA 4CTNA 3FLMA 4E5SA 4ND8B 4URXR 3ZJ4A 5HZHA 2LPMA 1J8FA 8ATCA 1H6AA 2XVMA 2J9FA 1QH1A 4BPRA 5DIZA 3HFGA 3N0VA 2WJHA 3A6GA 1S89A 5ENDA 4JQSA 5LZ4A 3WQRA 5HM6A 3DHYA 4PYJA 1Z6TA 3KQUA 4DSZA 1H2WA 4UJ5A 2BTQA 2I2CA 3WK6A 2WAMA 3IT0A 4IDFA 3A6HA 1RCUA 4W1SA 1T5HX 1WUKS 3SLKA 5TGDA 4GOND 1SKUA 1U0NA 2PZMA 4RLSA 1T1SA 1U28A 3WKCA 2DB3A 1BNCA 4RX1A 3P9IA 1KARA 3JQGA 4WRRA 1ZOPA 2IGBA 1BS9A 1FHQA 4LRQA 4X1YA 5H83A 2WTAA 5JFTA 3Q7QA 3IOCA 3NDPA 1E9BA 4GKKB 3IILA 1V7ZA 2MTBA 3BKWA 4O4JB 4X90A 2HO4A 5DNEA 3DA8A 3ND9A 1HO3A 1IQPA 4H7HA 2JFHA 1FRVA 3W6UA 1XZAA 3KWFA 1ONOA 1P2UA 4AMYA 2XF2A 1BWRA 4BNGA 1MB0A 5AM0A 2BFPA 2VH2A 3OU7A 4PCUA 3TTXA 3DT6A 2MR5A 3DTVB 2VJCA 3TW0A 5ALHA 1Z8DA 4EZIA 4HYTA 4LRUA 3VOBA 1FDSA 2HIMA 4PXAA 1U0TA 3A4IA 1Z9BA 3HFRA 1VRWA 4YVFA 5JHHB 3Q8KA 2P3LA 3LW8A 1KO1A 4KVFA 2XUAA 2NPOA 5T4BA 3T3GA 3RHTA 2ZJOA 1U98A 3FBTA 3FB4A 3PYMA 5FWDA 3UXEA 3QIAA 3LQ1A 1WXQA 4R8LA 3VYTB 4PXYA 3WMXA 5AM3A 5DRYA 3IBYA 3COPA 4U6QA 3J7TA 4BO0A 2Q5JA 1Z8NA 1RR6A 4JI5B 1MVLA 2VF8A 5TARA 2H2WA 1KIAA 1YXMA 5H0IA 2H1FA 2PUBA 5F51A 1PF7E 4QGSA 4S2UA 5HJEA 5FBVB 5KUTA 4PGGA 5AVWA 2BCEA 2AI3A 2YQ5A 4GU5A 2H3EA 3IEPA 1RJWA 1XYGA 4Z7JA 5DSTA 1Z4JA 2H06A 4BN5A 1PKXA 5A3QA 4JXXA 2OESA 2BYTA 3DWEX 1GGHA 2GYUA 2C54A 1FFGA 4O8ZA 5HFNA 2BR3A 3UA4A 2XEDA 5JEMA 2BGJA 3GAFA 3IDAA 1IPFA 3FVRA 3AW9A 4UHDA 1GPUA 3B70A 1F17A 4LF5B 3ZK8A 1NV9A 3HV2A 1JG7A 3R9XB 1Y5RA 4QO8A 1GGFA 4XGQA 3EF1A 4HATA 2WD9A 3PPIA 3ZU4A 2GBCA 1XELA 1JG3A 3VNVA 3L82B 4EGAA 4RTMA 5H81A 3WL5A 1Z36A 2JEYA 3B3FA 2XA9A 3QF4A 3C48A 3K0CA 3B1JA 5EPEA 1UJNA 1C7QA 1FU8A 3KX2A 1AMNA 1WDTA 3K0EA 3EPJA 2Q5QA 5C80A 2JHCA 5E2IA 1RXVA 3NEAA 1VBMA 3SICE 2VJMA 4GP9A 3DEKA 4M0KA 4Q1EA 3VJRA 3HCWA 1XVTA 1PZEA 2DY1A 1XXHB 3PUIA 3OUZA 4RKEA 4UUBA 5FNVB 2VQFB 3MPUA 1VKJA 4BTLA 3E18A 1XAIA 3GEMA 4FR5A 4M6WB 3ZIAA 3FCAA 2W4IA 1RKXA 1IOVA 5KOJB 5FPTA 1PR5A 1RAFA 5IX8A 1SXJE 2LNDA 3NOQA 2OCYC 3IPLA 3WBKA 4CMIB 1XQ9A 1Z7EA 2I99A 3AM4A 1TYEB 2O5RA 4LOKA 2FH5B 4WK2B 5ER6A 1HF3A 1N1DA 3KT6A 4IDAA 4FFVA 4WIAA 4YJ2F 5DGHA 3GLFB 2AR9A 1RXEA 5TPWB 4C01A 2HPAA 1I3OA 2YC4C 4FSDA 5ILGA 5CA0F 4P3OA 4Y18A 1TUBA 3IE2A 2QTLA 3QVSA 2I9KA 1L7VC 4PTYA 3PKZA 1C1XA 4DMUB 5F2KA 1NIJA 2ZUBA 1KRHA 3KE8A 4OVKA 1JR6A 2D6FA 1PJ4A 4AU1A 1GVHA 3DMTC 1OAAA 2PMFA 2Z8ZA 1Q21A 4CR6A 2W3OA 1ORVA 2APJA 2DU8A 2Z2ZA 2ZSEA 3BRQA 3CG4A 5DMXA 4A92A 5GGXA 3G8DA 2JF0A 3OQ6A 2P8SA 4FBGA 4MINA 2JLXA 1Z4LA 2XX3A 1EM8B 4TKVB 4N01A 2EBWA 2ZI4A 2GPWA 2C2HA 1X92A 3HO6A 4PYLA 4Y6LA 1C3XA 4F2PA 1U9IA 4EYQA 1HDEA 1UPCA 4IXDA 3UJ7A 1JLHA 1M2GA 4N8DA 4OM7A 1Y48E 1ADGA 4RANA 3T3EA 1E4OA 3NORA 4E94A 3HDJA 4HDNA 3GN1A 3L8DA 1YZLA 4EB6B 1N7GA 2HDOA 4MVJE 2WINI 1UXGA 3T7CA 3RBAA 4ADSG 2NQ8A 1IHDA 3G0DA 1Q2XA 2B37A 5CJPA 5EG5A 3RLIA 2QENA 2QG9A 1SM4A 3ZE8A 4AJ9A 5H8WA 2MYPA 5A4AA 2O8CA 1YZTA 5M2QA 3Q98A 2ZJFA 2FLWA 5DTRA 5JNUA 1RC1A 1DAIA 3GCXA 3RT1A 3S6JA 4C87A 4CM3A 1NUSA 2SCUB 5JS7A 2JFXA 3HVIA 3DKIA 3KRTA 1MQSA 3CSUA 3IQEA 4UBNA 2PU7A 5CT5A 5BSFA 4NU5A 4GI2A 3U4MA 2FP4B 3N8NA 3RFVA 4GE0A 1NW9B 3BBLA 1I13A 2QN7A 2NTEA 5KS2A 3AEKA 2I2XB 2NU9A 4LHWA 4MROA 5E1BA 5EMMA 1I5RA 1USKA 1IN7A 1VZ2A 5CGZA 1FP6A 1L5LA 3WLOA 2I1WA 3M6WA 5ECGC 4E6EA 3W4KA 5E6SA 4C3OB 1I7NA 2OAP1 3BMOA 2VIIA 1VJCA 2R4TA 4WD3A 4E88A 4JFRA 4B8YA 4N6GA 3KE9A 3PQ5A 1J23A 3JYLA 2C77A 1ZC4A 3GGCA 5BVHB 1L5YA 3CJTA 2DWPA 2L0XA 4XWGA 5AI5A 2OCBA 1HFJA 4S35A 3B12A 3ILXA 4Q4JB 1ZXBA 2KKLA 4MKIA 3RYCB 3BCSA 1GTJ1 4KSYA 4ZI5A 2P1RA 1RJGA 3S0JA 3AHEA 4QUDA 4DSNA 1DC4A 2P27A 2XKBA 2REOA 4HPXB 2IV2X 4LQDA 4F9FA 3RREA 3DAOA 2Y0EA 4B6SA 3NG1A 1CKEA 5FJIA 4HB2A 1NJ2A 1NUUA 3BXGA 4JODA 3U3DA 3SJAA 3P0EA 4YLYA 4RK7A 2OXRA 5ALKA 2H0RA 2X8AA 1PZFA 3MT0A 2P79A 3CZCA 2V98A 2VLBA 4UDYX 5CNMA 4NQRA 1IH8A 1T4MA 1X14A 2O9JA 4K7JA 2HMSA 1N6HA 4RVSA 5CLQA 2W0SA 1C2TA 1I6MA 3G8BA 3MJ4A 3OVMA 4NYMQ 3MRTA 3V1KA 2R8YA 4ARCA 1FU7A 4L9SA 4AJ4A 5TVKA 1Z6AA 4QBFA 4PCLA 1RWVA 3OIVA 1QAOA 4TYNA 1SCUA 4KNVA 4TTSA 3UENA 3QUAA 4KE7A 3S1SA 3H9JA 3ZXUB 1KRWA 5AOVA 1JS1X 3NUZA 2DKOA 3QPDA 5GP1A 4J3NA 2FG6C 2EJUA 2I54A 3THYA 1W48A 1KY3A 5HWSA 5KNCH 1GSHA 2CLFB 3SEAA 4IIYA 1N4AA 1G55A 1R5OA 4B8WA 5NLLA 1Y7PA 3F4LA 3TD6A 3JASB 3ITKA 1E7RA 4DV2B 4YGYA 4CM9D 4C5AA 1TQDA 4OOEA 4QPDA 3ABRB 5BVIA 3CEPB 1S7GA 3CH6A 3EJ6A 1FDOA 2P41A 2R6DA 3AFGA 2OLJA 1KMNA 16PKA 2GN0A 1YJ5A 3CONA 3IBGA 3IKMB 3PXEA 4GQIA 4I66A 4EA7A 1CF2O 4UNQA 5C8YB 3CSSA 4B9EA 1F2TA 1IB6A 4DY6A 1IN6A 2A6PA 3FTNA 3L4BC 5INTA 1J0CA 2AFHA 1L4FA 3VKUA 5CVTA 4C7VA 4TL7A 3MTEA 3PKJA 2IODA 4IDBA 2DGDA 2YIMA 3E3NA 2X42A 3IC5A 4IRMA 3TNJA 3IIJA 2WHPA 1QKKA 1LEHA 3RK4A 1XZQA 1U9CA 3D1VA 3ZGXA 3OU6A 1LBIA 1W5FA 1ZI8A 2V45A 3L46A 4N5MA 4WNYA 4QQNA 4IM7A 4XWWA 4I8XA 3PEYA 3QLEA 2VDQB 1O0SA 2XDWA 1SD5A 3VYWA 2XUDA 2CWDA 2IELA 4BP3A 1U3VA 1XCLA 2REQA 3KLMX 4GNKA 1U9ZA 4DIBA 4WV3A 4URVR 4HK4A 3VU3A 5CAEA 3ZV7A 3ZW8A 4AZ3B 5E8RA 3C3MA 1D1PA 1RYHA 4DPKA 2DLCX 1QM5A 4OB6A 4B4KA 3HDVA 2EW2A 4A10A 3JQBC 3A58B 4X5OA 4HAIA 3ZUPA 4LZPA 1IMOA 4AZ0A 2CJWB 4I4TB 1J07A 3TFOA 1O97C 8OHMA 1B26A 4KHPB 4JP1A 3QKWA 3VNUA 3QNMA 3A9UA 2O2HA 3IH5A 3K32A 4URFA 4Z0TA 4RSMA 3RM3A 2QMZA 2DECA 1EESA 1I2AA 4Q3NA 3SEZA 1X94A 2B8TA 1HA3A 4EH1A 2VT6A 3PGKA 1Q91A 1UPBA 2QRLA 2W6QA 4HDOB 3CRZA 3I9FA 1H85A 4B6EA 1XTTA 2XDQA 2PUTA 5D3ZA 4YCLA 1GGNA 1RE0A 2WMNB 3K70D 2XA2A 1VKOA 2ZSHA 3V00A 3GI1A 2QN2A 4UDOA 1JHYA 1H2ZA 4YECA 3IPYA 5AW6A 2TSYB 1OB2A 3GLGE 1M2NA 1PNVA 4XPZA 1V4NA 4ZRNA 3R8CA 2JEZA 3ZWXA 2K7FA 1O3YA 3W4IA 3OE1A 4N39A 2IOFA 3RUPA 2ZYWX 3SMVA 2WJWA 5HQ3B 5EIFA 2DXIA 1SVIA 3H2SA 2G82A 3KDPA 3LKZA 1GQSA 3IV9A 4MQLA 4WOJA 2DWQA 1O95A 2GCOB 5LDGA 1KDZA 3ZGOA 4H7IA 1P44A 1IVSA 3UN0A 2WM3A 1Z2AA 1ITZA 1DXOA 1NATA 1XDZA 3UPDA 3NDJA 2I4TA 4YQFA 3SQLA 4HSEA 1CY2A 1A9QA 2WP0A 1LDGA 2DH6A 4ZCQA 4C4XA 4OOFA 1QGED 1CBUA 1TU0A 2I3ZA 5HJ2A 3NHFA 3I01A 1P17A 2VT7A 3WYAA 1WAMA 2O14A 2CLSA 3H4TA 4P81A 2R48A 3F6EX 4ZTBA 3CRNA 1XJQA 1Z6PA 3WYDA 2IU4A 1N0HA 4FOPA 1JHQA 4PTZA 1ULZA 1E9EA 1Z6YA 5AW4A 3BXPA 1TU4A 4KNYA 4LYFA 2ZM6B 3OT4A 4HAZA 3ZVRA 4EQ6A 2RFLA 2XUGA 1XJ5A 1YQXA 4ZQCB 4PC7A 3QSGA 3AO0B 1KMIY 1DBVO 4CMEC 4D7AA 2W2KA 1AGNA 5B30A 1J2FA 1DBRA 1HRDA 1OE0A 2I76A 4HGZA 4TL9A 3AHGA 3VVMA 3W34A 5EWLA 4L8VA 1GRVA 1N5IA 1L4MA 2P91A 1KJJA 4HAOA 1KIFA 2IY7A 3SWWA 2WNIA 2HD4A 5KKNB 1N7IA 1QCZA 2D06A 3BULA 2HNKA 2QY6A 2RGBA 4I9GA 1KH3A 1E1LA 4JT9A 4OP1A 4RQUA 5BSUA 3ZJYA 1GZ4A 3PJGA 2QJFA 3HB4X 4LFCB 3LK7A 3T7JA 3CLUD 3D8BA 5E2AA 4Q00A 1DD1A 3O8DA 1I1OA 2G80A 3GEGA 1YS2X 1E4EB 1KYQA 1CQXA 1L1RA 4FGJA 1DCFA 4QXRA 3RNLA 3VZDA 2ZSKA 3K6RA 2VF7A 4IDQA 5D5HA 5EJ2A 5LMZA 5AJZA 3IIMA 3ZU3A 1I7QB 5F3DA 1NNI1 3G2HA 4CQLB 5L4SA 2C58A 2J5RA 2UUPA 1ZNWA 2DVMA 3TSCA 3I04M 2ZUVA 3L8MA 1I01A 2NTJA 2W7TA 3KM0A 4GFDA 3RS2A 3OQBA 2ZXFA 4DLXA 2HBZA 3LMKA 3N0TA 4CV1A 5JCPA 5KMGA 1F2VA 4AYXA 4M88A 2R00A 2JFVA 4B0PA 1MQAA 5ECDA 1UBGA 4RHCA 5E1MA 3UAZA 4DPMA 4LMRA 1K75A 5THKA 2A78A 4FMDF 1Q17A 1TT7A 1DCKA 2H65A 4HWSA 1KE2A 4QLOA 4UAVA 2ACWA 2VHVA 2HJHA 3N2NA 3I58A 5G2OA 1CQZA 1R5JA 2WSSD 2PEZA 3D6HA 2D3WA 2PD4A 2RBGA 3OMXA 4X63A 3NALA 5FL7D 3AFHA 5IMBA 4FVTA 4QECA 4N03A 2PJDA 3RR2A 2A35A 1KPIA 2ZGVA 3OPYI 3U1VA 5J43A 5LD2C 4DR2B 2BP7A 3AGQA 2QLBA 2FPGB 3VGPA 1OKKA 3PUJA 4I2NA 1CR4A 5K3AA 1VE9A 3L77A 3PIDA 4RTSA 3A4VA 4UHKA 1GA1A 3A1CA 2Q3LA 3PNMA 1E5TA 4Z2YA 5LQCA 3BSSA 3O4FA 4J1QA 1MOSA 3TBHA 3TZ6A 4CIWA 2XB9A 3WBFA 3GJ6A 5JO9A 3LUBA 4QEKA 2JPEA 1KI3A 2HHAA 4OQXA 1XEXA 1ADJA 5FBHA 3AF1A 4H1VA 2PWZA 1Q0LA 1JR3D 3GDWA 4JJ8A 3IQIX 2QW0X 2JATA 4WY8A 4EY7A 3C85A 3HNRA 4ESVA 1OSNA 4PZDA 4K9OA 1U99A 3S40A 3SX2A 3ZS8A 4WNAA 4CLDA 4B7ZA 3AK4A 1CY4A 2NNLD 3OIFA 5JS8A 1JT2A 1L6RA 3CISA 3SYKA 1P4SA 2GZHA 2HMYB 3LX8A 4X00A 5KZMB 1AB6A 1NJ8A 4CL8A 4TROA 5G4LA 3QELB 5EZSA 1D2GA 3CXRA 4OP2A 4UMEA 2MHCA 2IHKA 4OXQA 2MU1A 4NJMB 3HJAA 3KSDO 4BUZA 4OHWA 4H3SA 5ALIA 3VNBA 1T3HA 3R0QA 4BNFA 3FYUC 4O1IA 4G84A 4NNOA 1O97D 1LKZA 2CDCA 4ND2A 5CW2A 1OJ7A 1ISPA 2IF0A 2Q8NA 1I6WA 2A57A 3GRFA 2M32A 2BBOA 4NJOA 4R0VA 4XR4A 4C0WA 2EYUA 5FWNA 4EHJA 1QFXA 3FVVA 4HWKA 4R8SA 3U61B 2WM8A 4NMXB 2IF2A 1XMSA 9LDBA 4JQYA 3V2GA 2OVBA 1PYDA 2Q5EA 4YQZA 4KAFA 1T2UA 3HVUA 3L8HA 3OKPA 2VO1A 1J2YA 3ZXSA 4W9MC 5JXGA 3ND6A 1X7GA 4B17A 3W1WA 3HN7A 4W5QA 4D98A 3WE7A 5JASA 2VTDA 3VHXB 4YEDA 1RNLA 3GRUA 3KYDA 1W5AA 3SD7A 1LGPA 3RT9A 5B6IA 3ZWNA 2GCNA 3COWA 1BCSB 3PUHA 3A04A 4OQYA 2VP5A 4P36A 1QCYA 1WF3A 1NASA 2FQXA 4MWOA 4YJ2B 5C2JB 1ABEA 3DEHA 1HSZA 2Z95A 1ZCJA 5CA0B 1ND6A 3Q7SA 1KY2A 2HWYA 3C1OA 2OM6A 2OTCA 4BNIA 3UNMA 5GZ1A 4DV7B 3GRPA 2FN3A 4I81A 1UAAA 1UK9A 3MD9A 1CE8B 2I4MA 1R27A 2Y67A 2NU6A 2C95A 1GGMA 3K20A 4LDZA 3WK8A 2X7HA 5JAIA 3LBHA 1YIDA 3UG6A 1PUXA 3AF5A 1EDEA 5CYFA 1O54A 1OI7A 1RWMA 1WO8A 3V7NA 4PC6A 1P73A 4WUVA 4RKWA 1W36D 2A2ZA 1HNZB 2IHZA 4WNIA 4WT7A 4P8RA 4JLDA 4U2BA 4IWYA 2V96A 3H16A 1JQEA 1LPOA 2GB4A 3KO8A 1IFXA 1VSUA 1Z34A 2Q9UA 5D8DA 3RC1A 3VM6A 3GJQA 1O94D 4U1RA 4CQMD 2VZ9A 1T8SA 4FBLA 3S81A 1EM6A 3LL7A 3QFSA 1BZYA 1YQTA 3B5IA 4MLPA 4DBLC 4DUGA 2Q2VA 3WRWA 3MWGA 1FNDA 1AU9A 2YHIB 3M6AA 3WMFA 4Z8XA 3FOEC 3ZWMA 5U1PA 1AOXA 1ZDMA 1C8KA 3JVDA 2EFHB 2OGUA 1JHOA 2QB5A 3DC2A 2FV8A 3IHLA 3Q7EA 4Q9NA 3WQQA 5JMTA 5HRAA 4BNWA 3M1IA 1KK1A 3RYHA 2VRWA 3PLNA 1JV2B 3L7DA 1A04A 2I2BA 2ZIVB 1IBSA 1K4KA 2C84A 3QVGA 2PL1A 5FTKA 9LDTA 3PGA1 3RSHA 1NP3A 3JQPA 5E1OA 2NO4A 3SMQA 3KQKA 1GTL1 3AUKA 1E3TA 1P5HA 2PS1A 2VSOA 4UTNA 1COZA 2HUNA 4KVAA 1AMUA 1WUYA 5JH7F 4M9UA 1QKJA 1SHKA 2QTMA 2ZYGA 4LX0A 3RTBA 4PX5A 3MHPA 1E2HA 1NE2A 1MFPA 1BAPA 2GTIA 4PF1A 1G59A 3JWGA 2MOKA 2Q3BA 3F9RA 4YDSA 2H07A 2JFNA 3A25A 3AZOA 3G5LA 5F4ZA 3TJRA 3V55A 4Y7CA 1MG0A 1XSEA 4PINA 1WD7A 2ZVJA 1QYRA 1WDLA 2NGRA 2O7VA 1GZSA 3B5JA 5IJXA 1T3SA 4OL9A 3AVTA 2Z2XA 5KX5F 1K1EA 1BO6A 1NZDA 2JL1A 4C4ZA 1XCBA 2CNDA 2YW2A 4JB8A 1DAMA 1NRWA 1GEEA 1P1KA 1V95A 3KB2A 5D84A 4QVGA 1XMQB 2JFGA 4X97A 1GPLA 1JIUA 2F3SA 2NVOA 3MF4A 2G0TA 3V4LA 1FRFS 4UEKA 5EJMA 5CIYA 4GC9A 4C6TB 4OHZA 2AEJA 1NBME 1R0XA 2EG5A 1R15A 3QP9A 1K3JA 2Y1CA 3M1LA 4C4YA 1ZK3A 2UV8A 1F1BA 2JBHA 5JCJD 4X64B 4MAMA 3KFVA 3DE6X 1XHFA 4OU4A 4GWGA 1O87A 1V1MB 3SP1A 1UEJA 1KAMA 2FZCA 1LPPA 2VNAA 2YHAA 4I6GA 4M9SA 4TKZA 4FOLA 4YTEA 2W2XA 1UJ6A 4OBXA 4DB4A 1P75A 2B7CA 3PO8A 1NQUA 1Q3TA 1NUAA 3M9LA 4M9XA 3DEZA 4BFCA 4YLEA 2H2GA 2YUTA 3I4LA 3K72B 3PCTA 1DP4A 2EP7A 3IPRA 3PP8A 4UREA 3S2UA 1FSPA 4ZJZA 3DEYX 4DLVA 4XRRA 3TIXB 3G59A 4HNAB 2NV0A 3TSYA 1CZHA 3NQ41 4D4LA 4JJ6A 2BIFA 4IDEA 1TUIA 2GBIA 3RASA 1ONNA 1U8XX 1C1DA 5FWYB 2JCBA 2REXB 4QXQA 4UU8A 3LUDA 3A2NA 2QOEA 4R1MA 1Q5PA 1HWYA 1J7KA 3MB5A 1UDBA 3PF8A 2DUNA 3TVYA 2X0RA 1AG9A 1MPTA 3ZOKA 2QZZA 3HJGA 1KR5A 4A0EA 1FP7A 1WZNA 2G4CA 3E58A 3GJ8A 3GLKA 3GMTA 2QRNA 2H4WA 3MB8A 1GD1O 2FPSA 4UEQA 5EC8A 1T2VA 3D3JA 4NNJA 3CNQS 1JHXA 1L8AA 2DHDA 1EUQA 4OBWA 2FU5C 3LM8A 4UAUA 3QG5A 4AXXA 4HVTA 5SY9A 2BRUC 3Q6IA 1XQXA 2B20A 3TR5A 4YR9A 2Z8YM 3NTVA 5TS3A 3FDZA 3EHEA 4UXIA 4C0XA 1ZN9A 5BN5B 1AZTA 4JT4A 5THXA 3HUUA 1KMHA 5TQ2A 1CNMA 3O7WA 3K0HA 3NWOA 4R2HA 3R3HA 2OZVA 3NB0A 2B30A 2WI8A 5HJ5A 2I6XA 2JAUA 2OMKA 1KEEA 3E6AA 3N2GA 2IVFA 3TZCA 2BBWA 3H5NA 1AN0A 3WGKA 3W8EA 4JITA 4CEIA 3TNYA 1QZZA 4G23A 1MVOA 1KS9A 1BJRE 4ND5A 1KS2A 3UF0A 1ZY2A 2C1XA 5KTYA 4N47A 6ABPA 3G5UA 6REQB 3DS8A 1BS2A 3PA6A 4IMJB 2X5JO 4XB6B 4JMLA 4DG5A 5C1DA 6GPBA 4A36A 2GA9A 3VZQA 3GUYA 4ZRMA 4O5AA 1IVNA 1X8LA 2GWRA 1M8KA 4KW7A 5DGTA 1LI5A 1TZMA 5JCOA 2QT0A 4PPYA 4FYYA 1W5EA 3DXYA 4OHBA 4XLLA 4KFUA 2BSXA 2AEEA 2XODA 1ZO8A 1E2NA 4GKJB 1ENOA 5KQLA 1KE1A 3QOYA 4G4JA 4AW9A 1X7YA 3R6DA 4IYJA 1KEZA 1T0JB 2FN7A 1NBAA 4KQWA 1F4LA 2HN9A 3KJFA 2JAQA 4TXMA 3M5WA 5IASA 3DZDA 2CMFA 2Q27A 4KN9S 2EFEB 1U6JA 3N0WA 1QQ6A 2AMVA 4MW0A 4DJJA 2B94A 3VR3D 4OHYA 2FW8A 4LA4A 3EARA 3KXLA 3A0UA 3EIXA 1UMBA 1OFIA 4Y8VA 2O1XA 5EMHA 2Q45A 1KIMA 2H1CA 4XSGA 1ZOLA 1NSFA 4L28A 5J4LA 3EDOA 4RAQA 3TQIA 1QH8B 2Z09A 3U19A 2YFYA 2OP1A 3IIIA 2CSXA 2GASA 4J2OA 3ZH9B 2YIVX 3BWMA 1JNYA 1UJ5A 1USVA 3WNCA 1E1CB 1RIIA 1IB0A 3ASVA 4MP8A 4AS3A 4ZVVA 2ADOA 3C70A 4KRFA 3TBFA 2QRUA 2W8BB 4KMRA 5JWOA 1WY5A 3MC1A 3TTUA 3HM9A 2O3QA 1CDDA 3QY0A 3ETDA 4YHBA 3IP8A 3SF8A 2P1ZA 2V9PA 4JZKA 4P4TA 1HORA 5KVVA 5LQNA 1UK7A 4P4NA 2C99A 2POQX 2WYHA 1B6RA 4G41A 4AXBA 3TZEA 4ZDJA 3IKTA 4PO8A 2UVPA 3IQFA 4OLFA 2DTEA 3JS5A 5IAAA 3NYQA 4NBLA 4B35A 4GG1A 3SYNA 3C5VA 3ZHBA 3P2JA 5HZMA 1EI9A 4LRWA 5F52A 4QHYA 2OHVA 2OQRA 4LC1A 1EG7A 2D1TA 3EZNA 3X1KA 5BMVA 4N3NA 1JG2A 4TTIA 3USCS 4H7KA 1WV0A 2IPAB 4Q9LA 3INNA 3RK1A 2D5CA 2HSJA 1IIBA 4OQZA 4DJAA 1RAGA 1RHJA 3U7GA 4LNHA 2VPPA 3JQRA 3Q3JB 1CUDA 5K6AC 2XLCA 2HXGA 2A30A 5G0SA 2CJPA 2PKCA 3JWHA 2ST1A 1Y1QA 1QK5A 4WXYB 3SLRA 4HH0A 1T4CA 2NZJA 1HT0A 4LHYA 1W85B 4BZXA 4Z7QB 3O8RA 3O7MA 2GBPA 3U4AA 2YR0A 1NF2A 2B0JA 2GEDA 4BIMA 3EBOA 3IE1A 4R9VA 3RS5A 1ZJ4A 3C6YA 2G67A 1B8UA 3MIIA 3IVXA 3ML1A 4TM7A 3THOA 1T5LA 3NUQA 1K92A 4XVCA 1LSSA 5JAQA 2YHUA 5I8PA 3GU3A 5EAIA 5H7XA 3ZHSA 1Y8RB 4L3VA 4B48A 2H5IA 2IHBA 4M2LA 4PU0A 1FFDA 1VLQA 5WRFA 3IT3A 5ECWA 2ETXA 1QHFA 4LGVA 3NTXA 4WLNA 2QNRA 3O94A 2A0UA 4HS4A 2JJ8A 1DLIA 1M72A 5G3ZA 1OXSC 3DLIA 1QRSA 2ZYSA 3TI9A 1KI9A 1C3LA 2ENUA 1U7FB 2G36A 3B9QA 1D4OA 2QD2A 3R0JA 4RENA 4TLBA 3A11A 3MWJA 4GEGA 3UHAA 4U2DA 1G3RA 4JC0A 4F4UA 3NMUF 3PNBA 5FBQB 4KO1S 3BERA 1UF9A 4JVNA 3MJVA 3PXDA 5IK2D 2ZROA 4F5WA 4FMDB 1HE2A 4HP8A 5C37A 3IALA 3WL7A 1XZBA 3M1YA 1ETHA 2XB4A 3UQYS 3W2EA 1CIPA 1GA4A 1ZSVA 2YS6A 3GZJA 5DJOA 1B2LA 1LQ2A 2BUCA 2V54A 3JD4A 4Y0NA 5FP0A 3HVRA 4ED9A 3L1IA 3J80A 4UVIA 1G16A 2FKNA 4CQNA 4TL8A 1FDIA 5LLDA 4B7AA 3A4NA 4NAHA 4CLRA 5IYZF 2JQIA 5KOIA 3A1NA 1KGSA 2YINC 3ISTA 4DXAA 2ODBA 1HG0A 1DG9A 5HTOA 1XD2B 2QR5A 2WJGA 2OHFA 4P9NA 1EE9A 1EXNA 1PX2A 1GPWB 3TLZA 4QG3A 5IPFA 1V45E 2B6NA 5FTNA 4BB9A 1FZQA 2L69A 5ESXA 3U7JA 5L3QA 1FUKA 4BQQA 1E0AA 4H1HA 2DLDA 1WNFA 1KI2A 4KKXB 1PFYA 3OCUA 1LPBB 2QQEA 3RC7A 3EDMA 2ES4A 4HGPA 4LDRA 2Q1TA 1LLDA 2G6BA 3UMJA 3NW9A 1PTJC 4KV9A 5DRTA 5K2OA 3LZCA 1S3GA 1X39A 2VATA 4IJWA 3UC5A 5C7LO 3TIGA 3STXA 2ZVPX 1K97A 1MDFA 3F1LA 4QBIA 5L4NA 3WHLA 5B1SA 5KYTA 1JUDA 3M81A 2J67A 4F3YA 2GDZA 1CR2A 2B98A 1J2JA 2R8RA 4WGGA 3HJCA 4MDEA 2QI9F 2W9XA 3FVWA 4JLJA 2IYYA 4AKIA 3SS9X 1X74A 3GFFA 1OREA 4BCCA 1QMGA 3KBBA 3UMCA 1WPGA 3PPYA 3MAJA 4G1EB 5COBA 4IVQA 2F1HA 4A0GA 2ABWA 4YRNA 3HUDA 4MQ4A 3IQGX 3IPXA 3W0LB 4KPYA 2M6LA 3WKAA 4U2GA 4CM8A 2DPLA 4BC0A 3KKKA 4AY5A 4DV1B 3WJ2A 1SUPA 2QYOA 2Y9MB 3HYCA 4FDMA 4RK4A 3KPUA 4IIJA 4O63O 4JV5B 1UC8A 1MEJA 3BQMB 1GCGA 3TTTA 2ASEA 2PVCA 1RCTE 2G09A 3BDIA 1FQKA 1NA5A 3ZWAA 3OOYA 2VYQA 2HF2A 3MHTA 4QU0A 2PL3A 3R1IA 3D2AA 3WK5A 4TXJA 4ZOLA 1V47A 4NBTA 3UV6A 1R4NB 3UUEA 2EBHX 2ZSAA 3Q9UA 2QX8A 4W8OA 5EJ6A 3LQFA 2I80A 4F38A 2QTVA 2O8NA 5IVIA 4G0XA 1YL5A 3ZNQA 5F3WB 2ON6A 2V03A 3BKXA 4KSBA 4TKUA 4C4PA 5DYYA 5CEJA 3DV0A 5I7VA 3CKLA 4HLUC 1L7MA 1R00A 1NZJA 2XZPA 3P5SA 3QFCA 5LL6P 2G06A 1B6SA 1ISIA 1ZISA 4QPNA 1M8PA 2BFDB 2B3DA 2I34A 5CURA 4WOCA 1RACA 3ND5A 3PYXA 4G0QA 1E3WB 1YU9A 4OQPA 4Z99A 3I4CA 3OJWA 3WC4A 1TCBA 3EFHA 2PUJA 1OFVA 3OAAD 3TMAA 4GYJA 3I2KA 2GAFA 1OXVA 3DAHA 4LMPA 1BYIA 1SCKA 3CZ4A 1NHGA 2FR8A 3DF7A 1PGJA 1R64A 3DXXA 4O59O 1VCNA 1W6RA 2NO7A 3G2NA 5F76A 1RZVA 2QX6A 5CFRA 1V5WA 1E60A 3RRNA 5BN3B 1E8MA 3EZXA 1XTBA 2GS9A 2IY8A 1B1CA 1EZZA 2VYCA 1XB2A 3K9BA 3EXFB 4WOBA 4QYMA 4E2XA 1D2NA 2XB6A 4K6HA 2JZNA 2OFWA 3MFQA 3OT1A 1QX4A 2I2WA 1QMPA 1A5BB 5SZHB 2ASVA 2FSUA 2Y76A 1EINA 2O2DA 4TKLA 2OXIA 1Z5UA 4PEVA 1ZCAA 3RF6A 3B1YA 2EHDA 4HX5A 4F6CA 4E51A 1GAWA 5EESA 3BMCB 1RZUA 2G08A 4DB2A 1BH6A 2QK4A 4QUBA 5TQVA 1B73A 4LHZA 4UMVA 5B6JA 4KTTE 1ZOQA 3KAPA 1TPZA 2X8WA 3SG0A 3LBIA 3K8YA 1W88B 2WT9A 3D9QX 3RS9A 1GFIA 3QTTA 1ZM3A 3IUSA 1P31A 4IEEA 1D07A 3REQB 1CWUA 3RS3A 5HKAA 2IHNA 2W6JA 3NASA 1WHTA 2AFIA 2LR0A 1SPBS 4L16A 4Z4GA 4J0KA 3GMJA 1CS0A 3TD9A 2ERYA 3HK2A 3P52A 1Q92A 4E11A 3HR4A 3P4YA 1KHXA 1K6EA 3K09C 4HZUA 5KYGA 5JH7B 4F21A 4TRJA 1V11A 3C74A 3G5AA 4L5CA 3UB4A 3JQAA 4JC5A 2BHNA 1U7VA 1V9LA 2H92A 3B1VA 3IBSA 1VJTA 4W5HA 4F4IA 2IJGX 1R9GA 2ZRAA 4EI2A 1FYXA 5KPJA 2VDPB 2XE8A 3AF4A 3HEBA 3ICOA 3PPVA 2H2FA 1JVBA 3OLXA 1E3QA 3H75A 4IRXA 4XDZA 4F8EA 5TDHA 4JAVC 4ZI2A 2AI2A 2XD9A 4OEHA 2XJ4A 3B3QA 4XQ9A 3LPMA 5F33A 4PRZA 4AP9A 4CI9A 3BQ9A 4BKQA 2Q50A 1JFRA 5BPHA 5I9IA 5K0ZA 5KX5B 3IT2A 1CQPA 3OZBA 3CUVA 4OFBA 2XZDA 5CX1B 2HEGA 1M76A 2FMUA 2R8XA 2VXCA 2NUAB 1U0GA 2QTTA 4RKRA 1IY2A 2ZAIA 4XAQA 1P6QA 5AIBA 2IBMA 5BT9A 5HGXA 2FPIB 2W6MA 3E7PA 4N18A 1N7HA 4TWAA 4NCAA 3ZNNA 2H4HA 3BRSA 3RVLA 4FIZA 2C5EA 4ZOBA 3EIOA 1P3DA 1GKLA 1JYSA 1NBOA 1JLLA 2NYAA 2ZB3A 2G7ZA 1W4ZA 2QAJA 4CGYA 3WKEA 4HBZA 3GEEA 1PNOA 4JBGA 1G63A 4TMWA 2AF3C 4JVOA 3TRKA 1YCHA 3WHIA 3PL1A 5ER9A 5A4JA 1FBNA 3DMFA 2WJJA 2WA1A 3Q72A 2R7KA 5AM1A 4IDCA 1J0EA 2XGSA 2UU9B 5E50A 1Z07A 4FYWA 2O2IA 3LUCA 4FSXA 1EMDA 5AOBA 5KTNA 1W96A 1J0AA 4CNBA 2EZ4A 1IIRA 2AZMA 4ROSA 5AVUA 2GHIA 2C2YA 3R4VA 5DHQA 5JDCC 3TFWA 3ZD8A 1XEWY 5AVTA 3H86A 1VLMA 2C04A 2ZQZA 1ESNA 2AMJA 4RY2A 1LWOA 3CSDA 1XC7A 5EKTA 2ZAMA 2SKDA 4GT1A 5BOSB 4YCCA 1VDZA 3E22B 4N3BA 4RXMA 2EFGA 3UFXA 3ZOZA 1YSCA 3QW4B 2Q9CA 3R9KA 1UFVA 4OB8A 3V1TC 3ZHRA 3NDIA 3UHFA 1YUBA 3QG1A 4TYPA 3PL5A 2L18A 2ZANA 3LGSA 3GUHA 3L4JA 1MNQA 1DU4A 2E4VA 2I78A 3B6MA 5A4DA 3QVWA 1KVTA 2PUWA 4ND3A 2M98A 5CFPA 3E8SA 4X84A 2O2GA 5IBQA 2GFQA 3QTLA 1GPYA 3EGIA 4AMVA 2J5QA 2YVKA 1C3EA 4HWRA 2QDXA 1TW2A 4JS0A 1YZFA 3ORSA 4PO9A 4B3GA 5AI4A 5LD2B 1H2HA 3QYJA 2NVUB 1NMZA 3ANXA 4W1QA 4K81B 5KJFA 1E1RD 1NUQA 1CQIA 4YRBA 3O9MA 4MVJP 3GJXC 3DD1A 2FDRA 4FC7A 2P2DA 4YRFA 4D25A 1SA0B 4LVOA 4Y6SA 3LQQA 2RDMA 5EOVA 1HE8B 5IHXA 1MO3A 4G1VA 1K3UB 3I01M 5I6DA 4FWTA 3R3VA 3STUA 5EWMB 3WJ1A 4DRZA 4FT4A 4DPLA 1M0WA 1NGSA 2B21A 2PZBA 4N6NA 3ZYZA 3V80A 2O50A 1Y6FA 2GBLC 2A0WA 2VBFA 3TVTA 3UAYA 1WEHA 2IY9A 5C7YA 3B3GA 3FI9A 2ZIWB 2FTKE 5FBKA 2DQZA 5LZ5A 3RYIB 3EC1A 4GMDA 1A9XB 3PDWA 3I45A 1WBDA 2TMDA 2Z6AA 1YZNA 5IKXA 4MS4A 2QU8A 4M1YA 1H5NA 3TOZA 4D8WA 4J1SA 5JEOA 2WIJA 3BA6A 3TXXA 3UGQA 4EENA 1JDZA 5FI0B 3WFIA 2ISSD 1SHTX 4BUJA 3AV3A 3KU4A 3U4CA 3M4NA 2GXAA 4M7RA 3W3AH 3LKDA 3BJZA 3R0VA 3F9CA 4GZ3A 1KMQA 4EJFA 1CY6A 4KYIB 4DIMA 2FN8A 3OM9A 2B9VA 3N2EA 5TGZA 3OA0A 1JFLA 2FJPA 1SCQA 2VRCA 1Y6JA 4BNNA 1G41A 4QATA 4ZGGA 1J70A 4TSFD 4DV0B 4B3RB 2HO5A 1Z75A 4UU7A 2OLEA 1I4EB 1TYAE 3OH8A 3V5NA 4B6OA 2AOTA 2ZAOA 5ALRA 5MGNA 1N5JA 1PFQA 3GO4A 1DZ3A 1G7CA 3ND8A 4TLCA 1G21E 2UVDA 3WDSA 3CRMA 5DYTA 3BXEA 3WXMA 3WI7A 4HEHA 1SWVA 5E2BA 5IN5A 4HQLA 1WHSA 2FKAA 8MHTA 2A86A 1TIBA 1PJZA 4HDCA 2QDKA 5AWFC 1GCAA 2O06A 4B6RA 4YRSA 1YAHA 1T36B 3GFBA 4PRYA 1FK8A 1V6CA 4N48A 3P0HA 5AJUA 1GLVA 1EXVA 3K4QA 4K9MA 1TVKB 3O5AA 4FEGA 2WIAA 2OQVA 1K6JA 5IKEA 5A3VA 2BFEB 3PE4A 2WYOA 4AL4A 5KTOA 3CVVA 1FJ2A 1H1DA 2QVZX 3N7TA 1RC8A 3QKIA 2RH8A 2F3TA 5CNIA 3G82C 2BF4A 4OKNA 3RGWS 1JAXA 2GK7A 3A1UA 3PB3A 4BMXA 4CCAA 4JLAA 2G6TA 2XVZA 3V8EA 2PE5A 3AG6A 4G5RA 1WZ2A 1MO6A 2PUGA 3O1HB 2LZ0A 3FSGA 4ZVLA 4DYDA 1KYTA 2VYVD 3K1AB 1MN6A 1QH0A 2XTMA 3MUFA 2BEUB 2V4UA 1MDBA 3FCXA 4NR0A 4NDAA 4ZA2A 3TQHA 4A0SA 1LPAB 4XSHA 1U0JA 4E5YA 1JR4A 1HYGA 2WICA 2XQJA 3CKMA 1XDSA 1Y6GA 3GJ0A 3ZIUA 4DIEA 3WKDA 5CT8A 1LNSA 3AUJB 3NP9A 1E92A 1U7ZA 5CLFA 1B6TA 2FOLA 1P3JA 1NXVA 3BEOA 4M4SA 2BEKA 5D85A 2G1KA 4Q93A 1ZD5A 5L3SB 1R6UA 4FR2A 1ECJA 4R9UC 2OZKA 1EQUA 4WUTA 1QHSA 5TMDA 3EPKA 4NBSA 1AF4A 1BGWA 1A9ZA 1JI0A 4RDHA 5K51A 4EPTA 4LNUB 4DV3B 3AJDA 1TOAA 3PXXA 1CUSA 2RKWA 4ZQFA 3W3ZB 1OXKB 1NVGA 3U1BA 2XKKA 1ILEA 1ILWA 4XUGB 1R0RE 2DPMA 4QXMA 2QX9A 4XVQA 4IHJA 1Z35A 2H5JA 2W2LA 3IMCA 1OBVA 1BFUA 3CLSD 4NPHA 3RIMA 5TS2A 1FP1D 4E1BA 4PC2A 1TCVA 3D31A 1KRXA 1R4MB 4YJFB 1QHXA 2WVAA 3QITA 3RUCA 2P0AA 5E7QA 1R7RA 2AJLI 5IYZB 3CO0S 1OMOA 1P9RA 4DAOA 1N6NA 1N1MA 2IE0A 4UNIA 1SGWA 1F2UA 3TR0A 3ZY6A 3PTAA 2I33A 4INOA 3TE6A 4YROA 2WDZA 3LF1A 3G7UA 5B1EA 2JKDA 2QU7A 1Q19A 2OMEA 3JU3A 1JP7A 5KYYB 3OWOA 5DZSA 3BBPA 4E2FA 2ONCA 4C07A 2ZJ7A 2BRFA 4MUGA 4Y6RA 2O52A 2B6HA 1YRHA 1Q16A 1CCWA 3GG9A 1XLTC 5LB4A 3NH9A 5B1HA 2PT9A 3KYIB 2BI4A 2ID9A 2AX4A 2ZRHA 3BXFA 3KR9A 4K6KA 4LXYA 3AESA 4RJLA 3TLXA 4D0LB 1QGUB 2H0QA 4WOKA 4EKEA 4AQ7A 5HKLA 1EFAA 3X44A 3TRHA 4UARA 1D9ZA 4OFZA 1QHHA 4BB5A 3KLOA 3L9XA 1SBIA 1ZN7A 3WOHA 1FBTA 1V2HE 4Z3OA 3DDNA 1FPMA 3GGGA 3VSBA 3WK9A 1FCJA 1R16A 1KQGA 2IPMA 3LW7A 3PFKA 4MSUA 3TD2A 3WLFA 4DA8A 2O54A 4JL8A 2V55B 5J40A 5JOQA 3OG9A 1N75A 1EWKA 3GLIA 5FUVA 4GZLA 3V4OA 5A5DA 4I1PA 4MPPA 4D4KA 4E33A 5M29A 2QLNA 3C1TA 3M4XA 4ZO7A 5FBLB 1RXUA 4YCMA 1MJGA 4WFQA 2H11A 2PLNA 3WWDA 3O93A 2MSWA 2PRKA 3HKCB 4N65A 2N1MA 1EHCA 1DADA 2ZDQA 5DTEA 3ZDXB 3A8TA 1USGA 3INRA 4MWZA 3BJMA 3NJ8A 3UAXA 3WLIA 5IUJC 4DOMA 3CNHA 3R5XA 6NULA 1V3TA 1SVKA 4BRSA 5LOVA 3FPCA 2NADA 4XCQA 4AKSA 4JU9A 4CKBB 2BGGA 2C7OA 4MR9A 4LXHA 5K0FA 1ZEMA 4AY6A 2ZPAA 1XYVA 2YN4A 3G8YA 4V0OA 1D2MA 2R6JA 3UK1A 2EERA 1U2RA 4FN4A 3JWJA 3H2JA 1KJZA 1LDEA 1UUFA 2Y68A 4MRSA 2RI1A 5SZKB 3ABSB 1P72A 4V03A 1XTUA 2AG6A 1OHHD 1X8XA 3IULA 4OXYA 5DM2A 1LRLA 2GN8A 4A73A 3ZDCA 1LZKA 3WL4A 4BLPA 4DHEA 5B7QA 4LZJA 4RDXA 4G8DA 4YJKA 1QO0D 4UNSA 2EDAA 3EMDA 4KWCA 1WETA 1SXJD 1CERA 1B76A 3ZLUA 3OOSA 5EFOA 2XNSA 4F46A 1ZXLA 1ESMA 4HVCA 2ZE7A 2R1ZA 1IJBA 2F3PA 4LXTA 4MW1A 5KOYA 4LF7B 3THWA 3GVIA 2GPNA 5I7HA 4MHOA 3IUEA 2JK0A 1ZK4A 2OK7A 1PI3A 2UZ4A 3H4MA 2N75A 3NIDB 1I36A 5EXDA 2JGEA 2X1LA 2AD1A 1ZM2A 3ME5A 1Y5MA 3HCRA 3PD1A 4M1OA 3GVCA 4F8YA 4CMGA 3TAXA 3VSCA 2ZRFA 1K06A 3G02A 1GRCA 1E2IA 3AI7A 4I3FA 4D43A 5C1PA 2PHZA 5KJEA 2Z3ZA 3M5PA 1Z0IA 3ZGYA 2BFBA 2NO1A 4RTQA 4C2TA 4LKRA 1XKTA 5DT9A 3QU7A 4GWLA 1UM9B 3OLCX 4DZTA 3AR7A 4P35A 1NR5A 3P9ZA 4M22A 1QC5A 1XZMA 1TT5B 4N4AA 2PMEA 5GTDA 5KDLA 4MWSA 4K05A 1LBHA 1PCXA 2IZ1A 2J7PD 2R6FA 2W2MA 4FQ7A 1N36B 1U3UA 3IAHA 2DBVO 3C3YA 3Q9NA 1TO1E 4IO1A 4MVJD 5TSDA 1D6SA 2EWWA 2J46A 5HFJA 4CETA 3CR8A 1DDIA 3FMFA 4QDZA 4E22A 3TEMA 3KXPA 4DADA 1KGDA 4LWPA 3VU1A 3F90A 3KOMA 4OD0A 1C1YA 1J8QA 1IN5A 3Q2IA 5KU7A 2WYWA 3LHDA 1H2XA 1ZYUA 3S68A 4ER5A 5K3FB 2RJNA 4PO1A 3BT7A 1C7RA 5C3MA 1OH5A 1CUIA 4C7OA 2CDBA 2QGZA 2OV4A 1ZSNA 4XUCA 1ZK1A 5EMLA 3AXSA 5KJCA 3PVCA 4KAJA 2Y3IA 1YKSA 5IUKC 2NO5A 1M1NB 1YKFA 3AI1A 4HGNA 5T8KA 3T7TA 3UXHA 3KQHA 4N76A 3ESYA 2Q7OE 3FKSA 5AW8A 3PX7A 4BIIA 4D8TA 1QUEA 2KBFA 2PFGA 1TKRA 1JA0A 5I48A 4LCBA 2IIQA 4M1SA 3FUTA 2WFLA 4Y1RB 5F77A 1V2GA 4MJXA 4QREA 4UUMA 5JY6A 1V1JA 4P31A 1OFHA 1YNOA 5JIBA 1MIOB 1TJ3A 3FYCA 2VAVA 4GVLA 3RS0A 3BMXA 2VH1A 2HADA 3D4BA 2HMTA 3PNPA 2RGAA 3E2PA 4I08A 4A26A 5CEEA 4DA4A 1S2GA 4TTRA 1VE7A 2DBQA 4FCWA 2OBYA 4GSYA 5BQ3A 1LNQA 3LWBA 2CHGA 3JVEA 2PKYX 4YXWD 1TQ6A 3VPYA 3UUWA 4H7DA 5ITZA 1EDDA 1ENPA 3LDFA 2C0CA 3UGJA 4MP3A 1GG8A 5I4CA 1R18A 3V4VB 2AJ8A 2GWHA 2R4UA 3SKXA 2C03A 2EKBA 3H2KA 5A9SB 4A8TA 5DIFA 2Q1WA 3N74A