3T69A

Crystal structure of a putative 2-dehydro-3-deoxygalactonokinase protein from sinorhizobium meliloti
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
301
structure length
301
Chain Sequence
b'YYAAVDWGTSSFRLWIIGEDGAVLAERRSAEGMTTAAKTGFHTILDGHLAAVSAPAHLPIIICGMAGARQGWKEAGYIETPAALAEIAGRATAIPDVDRDIRILPGLAQRDRRHPDVMRGEETQLLGAAAHLGAGSHLVCMPGTHSKWVRLADDRVEGFSTFMTGELFDTIARHTILSHAVAEADTFAAGSAAFTDAVSRTRENPALATNLLFSVRAGQLLHGTAAADARAQLSGTLIGLEIAGALAGSGSVDGVCLVGSGGLGTLYRTALESQGLNVRAVDADEAVRAGLSAAARAIWPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative 2-dehydro-3-deoxygalactonokinase
publication title Crystal structure of a putative 2-dehydro-3-deoxygalactonokinase protein from Sinorhizobium meliloti
rcsb
source organism Sinorhizobium meliloti
molecule tags Transferase
total genus 92
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 2.7.1.58: 2-dehydro-3-deoxygalactonokinase.
pdb deposition date 2011-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05035 DGOK 2-keto-3-deoxy-galactonokinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.300 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3t69A01
3.30.420.310 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3t69A02
3R1XA 3T69A
chains in the Genus database with same CATH superfamily
2HHUA 3KJVA 4IG3A 1RDAA 1D9FA 2QXLA 5AQPA 4M3ZA 1LOTB 3VQ5A 1RT6A 4BGBA 3CCSN 2DFFA 3K2PA 3R8EA 4X62K 4BE1A 1GLFO 1NBWA 3A5LC 4C1NI 2PAVA 3A8YA 4XIUA 4I9QA 2GELA 4CGIA 1NJWA 5J2NA 3RMBA 4CECA 1UWBA 4K8ZA 4EIAA 4NYNA 4FJ9A 1Q9YA 4FJ5A 4DSIA 4DU4A 5F2RA 1RBTA 1O13A 3P4IA 2Y1IA 5EX5A 1C1CA 4DV6K 3FZFA 1HNZK 2A1SA 3SLCA 2FSJA 3WXLA 2HBLA 3GL1A 5M1FA 3B8AX 4JI1K 3KK7A 2ZQBA 4DS4A 5C0YA 3OYNA 3WT0A 3RMCA 3CCJN 2BDPA 4BRNA 4CJ5A 3D2FB 4FWLA 4OKKA 3RSEA 5DM6L 3VN5A 3MCAB 1GOBA 4ISFA 4GNIA 2ASOA 3GOIA 1YXQA 4YNQA 3CD6N 2ZF5O 1RBUA 2ITGA 4FZXC 3NVKA 2I5JA 5FPMA 1K8KA 1BDGA 2F96A 4YDUC 2P9SB 1QSYA 4FK4A 3TR8A 3FR0A 4K42A 2Q0RA 3OS2A 3AGKA 2A40A 4LF5K 3BF1A 4CJ7A 3FGUA 4OLAA 1JL2A 3GG4A 1VQ4N 3RR8A 1VSFA 2CGKA 3VEVA 2E4LA 4DG1A 3HOSA 1MWMA 3VF2A 4CBXA 1SUQA 1VSMA 4G9ZA 2E2PA 2VG7A 2YNGA 3CF5L 3EO3A 4KHYA 3SJHA 1HJRA 4PKIA 4KV8A 2NRVA 4CHYA 4CVNE 4AHCA 4A5AA 4KHUA 4FOIA 2GEMA 3VEZA 2XY8A 1XNQK 3LP2A 5AQTA 5M1NA 4RTFD 1YI2N 3BGRA 2Q31A 3RVCA 3TAMA 3VTHA 2OCEA 3TTDA 4BACA 1DTQA 1KVBA 4FWNA 4H5NA 2D0BA 4DR1K 4QS9A 5JLHA 3S3OA 3CQ8A 3QERA 5AQYA 2IGIA 5CZ1A 3UE5A 3IS9A 2FF3B 1VQON 5AQHA 3OYAA 2VYPA 2I7PA 5AQGA 4IOCL 4M42A 4JHDB 3O5BA 5AZIA 1NGJA 1ZYQA 1RT5A 4ISEA 1TKDA 5KRSA 2HVHA 3SMSA 4HTUA 1CZ9A 4DF4A 4LF8K 3DXMA 2FLOA 3VEYA 1ZBIA 3OHRA 1IJJA 3U6FA 1S3XA 4IO9L 3THWA 4E3SA 2NLXA 3OS1A 1JLCA 1OH8A 1WN7A 4CFAA 1U2VB 4Z4EA 1KQSM 4DSKA 5CYMA 4AHTA 1I39A 2DFHA 3HVTA 2XO7A 4H5WA 3H46O 1JLAA 2OZMA 2HHHK 4CEFA 4W5QA 3HP6A 2X74A 4KH5A 1D8YA 1NMNA 2JWLA 1S1UA 4BWMA 4NXMK 2YKNA 1RBSA 4O5FA 3HP9A 1DLOA 3GBTA 4AM7A 4BR4A 2QW9A 4K43A 3LALA 3ZEUA 4CJTA 1YF5L 2F4VK 3T1HK 5GIOA 1Q82O 3HPGA 4GVMA 4FJLA 3HPHA 1K8AO 1KD1O 1GLJO 3U3YA 3T7ZA 1JCGA 4E7HA 1UOCA 3CM6A 5AQWA 2G8FA 2Q36A 3OYGA 1ATNA 4JKGA 2QXFA 1E3MA 1OH7A 1YUWA 4CBUA 1HX1A 4H8KA 2NRZA 4UQGA 1NG9A 1XMOK 1YJNN 1Q81O 2P9KB 2HB5A 3AVBA 4HTLA 4DR5K 2GX9A 4CGGA 4JK8A 1QQMA 1NMDA 2YI1A 3QINA 3CC4N 4BY9C 2OZSA 1SV5A 2HF3A 3HT3A 4FSVA 4FWSA 4B8AB 3P31A 4ZTFA 3UKUA 2KKZA 2X78A 1C0GA 3G4SN 1RT2A 1U4BA 3GDQA 2HHWA 3MCPA 5TKYA 4B9VA 5AZJA 3V9SA 3L0QA 3MN7A 1WNSA 4FLXA 3UKRA 3IFRA 2EX3A 3O1BA 3C6UA 3U9ZA 3ZSXA 4CEZA 3C94A 2VG5A 4U67L 2HVIA 3LDLA 4Y1CA 1Q7YO 4FM1A 4FXDA 4J2EA 3J80O 3THVA 1E4FT 3HI0A 1HNVA 3S3MA 3DJCA 1X3NA 1GOAA 4K41A 4IDHA 4BROA 2G8WA 3HSTB 3R3LA 5AQIA 5C42A 1RTJA 4HUGA 4IBNA 2F7TA 3O4WA 4CJ4A 4JLHA 4JKBA 3KIOA 1W7AA 4DV2K 4DQ8A 1E4GT 3SAFA 4E0DA 4CEBA 2ASPA 4FVMA 4BRMA 1T6DA 2HMIA 3CCLN 3SZ2A 2VGNA 1L5UA 3FZHA 4F9OA 1VRUA 5J2QA 5GIPA 1JLBA 3CCRN 4FWOA 5JS2A 2FBTA 3J7AP 3AO4A 3IDHA 3OA9A 1S9EA 4J2DA 5HRSA 3ZLJA 1I94K 4CJKA 3W3DA 3DLGA 3TAPA 2B6AA 3BP8A 4WQ5C 3D45A 3R1XA 3OYMA 4IOAL 4E19A 2UYTA 3QEXA 2F9WA 5EOYA 3PIPL 1YTAA 2KW4A 4MDBA 4WFBL 1K73O 4CE9A 3D2FA 4YY3K 5M1PA 5AQVA 4AH9A 5BPMA 2HW3A 4H03B 3I8DA 3CJ7A 5I9EB 4FWPA 3D6RA 1JLQA 3ZSYA 4CW7B 3RMAA 5HLFA 3U4LA 2RKIA 4Y0WA 3L2WA 3VF4A 1C0UA 3I0SA 3VGLA 3ZX3A 4DTSA 3ZETB 4EHTA 3CIPA 2I7NA 3V6DA 3LWMA 3JYTA 4KI4A 3FFIA 4CZJA 4FLWA 1NK9A 3TSUA 4BE0A 5AFUA 2P9SA 1Q9XA 4FJKA 3VQPA 2F8SA 4EP4A 2CGLA 3PX6A 1HNXK 5I3UA 2G8UA 2UXDK 1B9FA 2HF4A 1S6PA 4Z4GA 3CYMA 4OLBA 3V9UA 4FLZA 4GKJK 3QO9A 4DS5A 2G8VA 2P9IB 4R5PA 4KHPK 3IMXA 2ZWHA 1KAYA 4A2AA 4DLEA 2W40A 1NGGA 3L6QA 2GUPA 5TKWA 1T8EA 2UUAK 4HHTA 4Z4FA 3B6PA 3TWHA 4O8KA 5AJ3K 2KHOA 4CZFA 5A2QO 2KZMA 1RGIA 1LWFA 4KO0A 4QS7A 4E89A 3CFOA 4QAGA 1ZBSA 4BDZA 4EAHD 1RTIA 5GAHP 4I9LA 3VERA 2ZGYA 1L3UA 4K8XA 3OYDA 3L4QA 3K5MA 4LF4K 4CK3A 4KTQA 1J6ZA 3EEQA 3CCEN 4DHYA 2ZJRL 2YNIA 5HP1A 4BRGA 2QWNA 1J5EK 4JHDA 3BF3A 3MXJA 4OO1J 3OBYA 1CZAN 4BC3A 4DV5K 3DOLA 3ALYA 5CYQA 4FJJA 4B9QA 3OYKA 1YT3A 4OGCA 1U2VA 3SQ0A 1YAGA 4OPAA 2HHXA 3QETA 4DR7K 3I0RA 5J2MA 4OVLA 2E2OA 2YKMA 1BIUA 3N4QA 5AQQA 2Q0UA 5J2PA 2OA8A 4BDPA 5E41A 3P83D 4C8OA 3TAEA 3L2QA 3AVLA 4CJSA 4CZMA 1X9MA 2RF2A 3IAYA 3O6WA 4CK1A 1GOCA 4H0YB 3ENHA 3SBTA 2IOCA 1KFSA 4W5OA 3I56N 4CJRA 3AO2A 4H0OA 3O9TA 4M3XA 1T6CA 2YJEA 2YHYA 4OX9K 2KQ2A 2B5JA 2KTQA 1NJXA 4CD3A 3AVGA 2FBXA 1I3AA 4C23A 3AA2A 4DSEA 1KLMA 2DFEA 2FC0A 3K5LA 1S1WA 4R79A 4LF9K 4CHZA 4CF2A 3VQ9A 4BR7A 4RWTA 3LWLA 1A5WA 3HTVA 4WQ4A 4CZHA 3V9ZA 4DB3A 3RR7A 2P9KA 4CZGA 1MWKA 3HZ6A 1NGAA 4DU3A 3KD1E 5CR4A 5DMRA 4DSLA 3WXJA 3CFPA 2WTUA 1ESVA 1Q86O 4CJQA 1NJIO 1SS6A 2RN2A 4MLEA 1NOZA 1GLDG 4IKFA 2KLAA 1TKZA 1TUYA 3J8AA 4E7LA 1HPMA 2O4GA 2B4JA 3H1QA 3QICA 3VESA 2O8BB 1SL0A 3VPZA 3SQ2A 2ATQA 1B92A 3OBWA 5JS1A 4KHSA 4KHQA 1RDUA 3QLHA 3DXKB 2VGMA 1QSLA 3I33A 1SZ2A 4BVPA 4JK9A 5KGWA 1TK0A 2GTDA 3TANA 1VQPN 2X6NA 4NCAA 3LP1A 4B9TA 3CC7N 4NO7A 1CXQA 3T3FA 3AVHA 2R7YA 4WCEL 2HNDA 1LCUA 3WUHA 1QSSA 3MXMA 1BISA 5HRPA 3BEXA 1EXQA 2PFUA 3DLKA 3KLEA 3I8BA 2V7ZA 1WSFA 1GLCG 3UIQA 1QQCA 2HBMA 1R0AA 1YVNA 4IOXA 4YOXA 4W5RA 2A41A 2HBJA 2XY5A 4JV5K 4B3OA 1FK9A 4NXNK 4CIFA 1TYQB 3KVGA 1NGFA 3VEXA 1HJOA 4M7XA 1Y64A 1RT1A 2YHAA 3C95A 3BZKA 3EY1A 4F3OA 1KSPA 1KTQA 1LV5A 3THXB 2G8KA 1RTHA 3HL8A 2O8DB 4CCHA 2DY4A 5KQDA 1W0HA 4G1QA 2P5GA 3QIPA 3EN9A 1BUPA 1UA1A 3QESA 2HNZA 1VQ9N 1ATRA 1S6QA 3P39A 1WSHA 2YCHA 5E26A 4O4GA 3AVNA 3CM5A 3RWUA 4KFBA 3ZX2A 2BH1A 2QWMA 1TV6A 4CJPA 3PSFA 3Q7CA 1SAZA 2Z1GA 3VA0A 4LF7K 5BRDA 4CFCA 2F9TA 5CY4A 2WC9A 4ID5A 4A59A 1M1KO 3LZJA 1GLBG 1F21A 2E8AA 2A6AA 4U7BA 3QEWA 2FSNA 4B3RK 4H5VA 4HUEA 5E84A 1TKXA 1U45A 3OS0A 3V1QA 3VOVA 4CF0A 4JI6K 4NYFA 1IKVA 3O3GA 4ID1A 3LANA 2AJQA 2Y1JA 4CJEA 2KFNA 3K0SA 3VQAA 2P9IA 3ZT0A 5CZ2A 4M3UA 3LPUA 1HR0K 5M1OA 3NGIA 4JI2K 1X9SA 3TTFA 1ILYA 2D0OA 4FJ7A 4FZYA 1OKJA 1T05A 3L8BA 4GKKK 2AA4A 1WSIA 5AQKA 3L3UA 5KPZA 2YNFA 4CHOA 5C10A 4CEOA 3WQTA 4BRDA 4JI3K 3MMVA 4NB4A 1Z6RA 4Z0UA 5FROA 2XY7A 3P1GA 1WB9A 3D2EA 2UXBK 1U49A 3CMEN 3LZIA 4B1ZA 4BRHA 3AVJA 4JKDA 1TAUA 5AQMA 4YOWA 3V81A 1VHXA 4F2RA 4DFKA 4CJWA 4KB1A 1HLUA 4W5TA 3PIOL 4BR2A 1IKYA 2GWJA 3NAEA 3AGRA 4FLUA 4FWRA 4YOVA 1JXBA 4NCGA 3SAHA 1QVGM 3HK2A 4W5NA 4I6MB 3KZBA 3EL2A 3SMPA 4F8RA 5GADP 3SBGA 1EP4A 4YORA 2UUCK 1D4XA 3J7YP 4B9NA 3EE8A 3C7NB 3ULEA 4PQUA 1NGHA 1REVA 4FW2A 3CQYA 1T3VA 2WOMA 1HPZA 4BR0A 3F5TA 4BC2A 2NRTA 1HRHA 5EU7A 3VQ8A 4B9LA 3ID6A 3V1RA 2PBDA 3SYZA 3P5JA 2O8EB 5C24A 3BZCA 1WSJA 5KGXA 3O9SA 3QNOA 1HYZA 3O1WA 3L2RA 2FXUA 3MN5A 3DI6A 4EZ6A 2IDOA 4DU1A 1T44A 4DFJA 1Z25A 1IG8A 4BR9A 1OH5A 2GUIA 2YHWA 3SNNA 1IG9A 2Z1HA 5KPRA 3TAFA 3CJAA 2D0PA 4H4MA 4X64K 3KLHA 4ILGB 2FBYA 4CHPA 1ZBLA 3VQEA 3M5RA 1BA1A 4BRFA 3K5OA 4GMJB 1C0FA 1EWRA 1X1PA 1N6QA 4X65K 2HSTA 3IG1A 5EVZA 3A5NC 3NGYA 1TL1A 3ZT4A 5DM7L 4EZ9A 1XUPO 1NGCA 4AHVA 3TPQA 5KQ8A 4LFAK 3AO1A 2O8FA 4CJ3A 3RMDA 2OPSA 4CEQA 2O8BA 1ZBHA 2HMPA 2ZJPL 1ITGA 3NF9A 2IIRA 1XHXA 4UY8O 1JCFA 3CMAN 4JI5K 2QTDA 1NK7A 2HHQA 3VQCA 1BQMA 4MO4A 4KHNA 4Z4IA 4FWKA 2V51B 4JKAA 3WEEB 4KREA 4PY5A 1J9AA 4JD2A 2E6LA 3DMJA 3ENBA 4Y1DA 4J8FA 1KC8O 5IT9O 3MEGA 1BIZA 2XHBA 3NCIA 4WQ4C 1XMQK 1QVFM 4ZTJA 4B9UA 1W97L 1QQOA 1RT4A 1S1XA 1WBDA 1Q18A 2FBVA 2HNYA 3ENOA 4CJUA 1BI4B 4BQZA 5ADXA 1HQUA 4E7JA 1YJ9N 3SQ1A 1OVQA 1X3MA 1QHAA 3DAWA 4ZHRA 1FW6A 4KRFA 3VENA 2KFZA 2QI2A 3F73A 3K9KA 2P9NB 2CGJA 3VETA 3MXIA 1NGBA 1A5XA 4BGAA 1JLGA 1TYQA 4OJRA 3FE1A 4LFBK 1SKWA 1LAWA 2OTLN 1VSDA 1IKWA 3ISNC 2ZGZA 3QBWA 3O9RA 4KHWA 3ZCMA 4ILHA 1VQLN 3VEOA 3THXA 3HM8A 2O8DA 3WXIA 4BVOA 4KPYA 4NCBA 1WBBA 3H6EA 1YITN 4OKEA 4DTRA 4B3SK 3AV9A 3S9HA 4HWIA 5AQZA 1S72N 5BR9A 3SI6A 4IJAA 3NH1A 5SZTA 4JK7A 1BU6O 1N34K 4GV9A 4WFAL 2HHSA 4FJGA 4L3QA 4AQYK 2QA4N 2E1YA 3VEWA 2XY6A 4B9MA 1LW2A 3LPTA 4ELVA 1G15A 1L3VA 2NRRA 1FKOA 4CEDA 1BOTO 3AVAA 3NMUA 1KRPA 3G25A 3QBXA 4YDUA 4N47A 2E88A 4E1MA 1SQKA 3K57A 4K0KK 4NLCA 3SQ4A 4PUOA 4CF1A 4FJIA 2JGUA 2QWOA 2GV9A 2QWPA 3SAGA 3D0PA 2HOEA 3M8PA 3QB0A 4C1NK 1U47A 3H1VX 1TVRA 3AVCA 3M8RA 4LSLA 4CD1A 2PY5A 3AY9A 1KXPA 4BRIA 5KTQA 1RDCA 1ZC6A 3CJBA 1NKEA 4MO5A 1ZBUA 4YOTA 4FK0A 3DYAA 1CLQA 1XQSC 4FZZA 3QFPA 1RFQA 3HRGA 3JSMA 5SWMA 3SPYA 3WNEA 1RBVA 1YTUA 1XHZA 2ZE2A 4OKJA 1QTMA 1BA0A 1RNHA 4OPHA 3ZYYX 4OPKA 1VQKN 3VGKA 4CESA 3OYIA 1K8KB 3L2VA 4FLTA 3OW2M 1QE1A 5M1QA 2D4WA 1S5JA 3DLHA 3HXMA 5MLCQ 3JS6A 1XI1A 3VQBA 4DQSA 1VSLA 1BWFO 4JNEA 3EZ5A 3LDQA 3DLLL 2Q3SA 2PYLA 4JS4A 4FK2A 3O4NA 1W2BM 3WNFA 3TABA 3CG7A 4IFVA 3DOKA 4CZKA 1C0MA 4CZIA 5LMNK 3AA5X 5JVGL 3CCMN 1NK0A 4AHSA 2NRXA 1S22A 4F4KA 1HKCA 2UXCK 3E66A 4DFPA 4DQRA 4C8KA 3C7NA 3C6AA 3V4IA 3G0ZA 3K58A 4B8CA 4O0IA 3M8SA 4GVEA 4CHNA 5CE3A 1NGIA 4WFNL 1YHQN 4DMNA 3KWGA 1P8ZA 4DR2K 3TSQA 4PWDA 1VQ8N 3BDPA 4KAZA 3PY8A 4OGEA 1BQNA 1XWLA 3P38A 1WAFA 5M1KA 1EETA 3AARA 3SPZA 3QDKA 2QWRA 2YJFA 3AVKA 2D5RA 1S9GA 4L8RB 4DR4K 2XRIA 1BGXT 4DTOA 3C0BA 4MDAA 3O9UA 3NH0A 4DR6K 1WOQA 4BG9A 1VQ7N 4FLVA 4GV6A 4ELTA 1V4SA 2VWJA 4JRQA 5KI6A 3PX0A 1EX4A 4JKEA 2OYQA 5DK5A 4CGDA 4O55A 4PL8A 2E2QA 2RHKA 3V9XA 4GY2B 1C1BA 5FDLA 2IS3A 1TGOA 1JXEA 3LDNA 5FLXO 1NK8A 1ASUA 1NOYA 2YHBA 1V4TA 3AA3A 4QCLA 2CH6A 1U6ZA 2AP1A 4BWJA 4FM2A 4CZEA 3ZEUB 2FSKA 4PKGA 4H0TB 3LP0A 2Q97A 3UB5A 3SUPA 3ZT2A 3LM2A 3U3GA 4JI7K 1N36K 1UAXA 1JJ2M 1HKGA 2ASMA 1M90O 3KLFA 1TK5A 4IFYA 4JKGB 3LL3A 3WEEA 2IVOA 4K25A 2CH5A 1VQ5N 5LMUK 1L3SA 3KLGA 3OYJA 4CF9A 1VSKA 4BC5A 3C65A 1ATSA 4JAXA 5AQOA 4CFDA 1NKCA 1BL3A 2X6SA 3AVIA 2D1KA 4FO0A 4CEEA 3KK2A 4CJFA 4MQ3A 4HUFA 1BI4A 3E1YA 4DLGA 1U04A 4M3RA 4CIEA 4BRLA 5FRMA 4FM0A 2P5OA 3CCVN 3LDPA 3DRPA 4FOEA 4PL7A 3K59A 2P9NA 2V52B 1RILA 3NBPA 3C6HA 1XC9A 2VG6A 2W6KA 1D5AA 4C8MA 5AFUH 4ISGA 4CZLA 4Z94A 5JLFA 4WYBA 3VQ6A 2RPIA 3HO1A 3OY9A 1Q8IA 2YV0X 4B1UB 1VQ6N 3THYB 1WAJA 4IWVA 1J53A 1HNWK 2EWSA 5T7BA 4IFEA 1BO5O 2RE2A 4E7KA 1NK4A 2O4IA 1RDWX 4I2QA 2P9PB 3QNNA 1J5OA 2E1ZA 2VCPA 4BRPA 4CFBA 2G8HA 5C2FA 5AQXA 1WSGA 4C8LA 1BCOA 5AQJA 4E1JA 1YIJN 1EO1A 3DLEA 2QWLA 1WSEA 3VF6A 3VGMA 3VQDA 4Z4CA 3TI0A 1C0TA 4DKWA 3NE6A 2JLEA 1TKTA 3CPEA 3ATVA 3F2KA 3HVRA 4YOYA 3VQ4A 2BUPA 3ZETA 1HYSA 3OTOK 3U8XA 3ZX0A 1JL1A 4QS8A 4CBWA 4BR5A 5EXWA 4B1YB 4CERA 3QEIA 4KBOA 2EHGA 1S1VA 4DV7K 3TAQA 3HOTA 4Q5VA 4J2AA 4DCHA 3WQUA 1RCHA 2HHVA 4JN4A 4KH4A 5AQSA 3CJ1A 5ELZA 3HM9A 4DWIA 2NRWA 4LH4A 4FPAA 4IEIA 3O8MA 1NKBA 4DV3K 3A5OC 1NGEA 3NVMA 3ZSVA 1QHTA 1BG3A 3AA4A 1HUXA 3OYBA 3OJUA 4KH6A 2BGGA 1TAQA 4FJMA 1MA9B 2IC3A 3ULDA 3SUNA 1T03A 1NK6A 5HROA 3WNHA 5I42A 4F2SA 3ZSWA 1DGKN 2E6MA 1LWEA 4DV0K 1QQNA 4H4OA 2BTFA 3DM2A 2P9LB 4CGFA 2LSNA 3N4PA 5AQRA 1RDDA 3KWIA 3VQ7A 2Z1IA 4N76A 3E9PA 4JRPA 5EY4A 4PA1A 4B3MK 2V7YA 3O4QA 4DTUA 3NGZA 3MX5A 4RW9A 4B3TK 1NM1A 4AF1A 4M3YA 3ZSZA 4OPJA 4DV1K 3MWPA 1Z26A 3DRRA 4LD0A 1NU0A 4BRAA 1N5YA 3K5NA 4F3TA 1K6YA 3RRGA 3LAMA 1H1VA 3TTCA 3HBTA 3QMLA 4X66K 2YX6A 4M7YA 5KPTA 4LH5A 5D3GA 4AHUA 2GWKA 3E01A 3E9LA 4GV3A 4TSXA 1RBRA 4BRKA 5AQNA 4IXCA 4FPBA 3LAKA 1HNIA 4H0XB 3L4IA 3NH2A 4BRQA 3ATUA 1S1TA 4A62A 3KD5E 1P90A 3S3NA 4H0VB 4GW6A 1KLNA 3Q7BA 2ZM6K 2IAJA 4RW6A 5F0XA 1VQNN 4PHTX 1YVUA 4H5TA 3O08A 4XEIA 1U48A 3FZMA 3O9QA 3HPOA 1RTDA 3CHWA 2VWKA 4HVJA 4WE1A 2J4RA 1KVCA 5J1EA 4CIGA 1L3TA 1IBKK 3CETA 3VTIA 3VA3A 2OPPA 3A0IX 2P51A 4WF9L 3G71N 5LJWA 5LL6Z 4CGJA 2WFBA 3MEDA 3OYEA 3J81O 4FVUA 3AVFA 3CC2N 3ID8A 4JI8K 3DLBA 1D9DA 4YOUA 2P9UB 4B9SA 3K9JA 3WXKA 4LF6K 5F1XA 4KB0A 5AQUA 2NZTA 4BDYA 1XC3A 5AQFA 4LSNA 1IBLK 3EKSA 3MX2A 4DTMA 1EWQA 1VRTA 3VMFB 2YHXA 5GINA 2PZSA 4O44A 5FPEA 5B8HA 2FF6A 4I7FA 2IVNA 3A2FA 3CCQN 4BC4A 3MN9A 4DF8A 3V1OA 1CXUA 1EKEA 1JLFA 3OVNA 4M3WA 5HOOA 1NWKA 2W41A 3KKRA 2NNWA 4A2BA 2OTJN 3KKSA 3G6EN 1IKXA 2YNHA 3DXKA 4FJ8A 3PUFA 2OPRA 1W9HA 4CF8A 1VSJA 1J54A 2WBNA 1EQYA 3PX4A 1VSHA 4IJNA 2WUSA 4CEAA 2UU9K 4BE2A 1KAXA 4RG8A 1LW0A 2JWKA 4N5SA 3PSIA 2OANA 5JMVA 3EYZA 2O8CB 4CJLA 4EP5A 1DKGD 1N33K 5H1SQ 4YFUA 4KTZA 4PKHA 4XH5A 4CK2A 2QK9A 1IV0A 1RDBA 3U9DA 1VSEA 2Z1JA 5HBMA 4BG8A 3OJSA 1LWCA 3NF6A 4ICLA 4N56A 4FJNA 5BN8A 4RCHA 4JS5A 5IWAK 1QS4A 3FZKA 2Q1NA 3SUOA 5BN9A 1OVYA 4CJVA 3THYA 3VQQA 1IBMK 4DSFA 3TU5A 3W0LA 1VK0A 3MWTA 4KKOA 3EKUA 3AAPA 3F9MA 3PO4A 4DUYK 2DTUA 1MDUB 3RRHA 3QEVA 3SV4A 5FPDA 3E9OA 3F9KA 3KTQA 1JLEA 3FFKB 2P9PA 3FLCO 3G10A 2BE2A 4BRCA 5LY3A 3C6TA 4DQQA 2HBKA 1DT9A 5K14A 3MECA 3MN6A 5BR8K 1NNEA 3LDOA 2E20A 3H3NO 3D7EO 3IKMA 3JAMO 3SJJA 4JKFA 4O8UA 3V9WA 4MFBA 3CCUN 3QEPA 3R9PA 3WXMB 3LM9A 3SV3A 2E5LK 3KHYA 4A61A 3OYFA 4V19S 2F8TA 1RT7A 3OYHA 1TK8A 3RTVA 4B1XB 1WLJA 1HQEA 3TARA 1UA0A 4IEEA 2ETJA 3T1YK 1SKRA 3NDKA 4JI0K 3SK3A 4C8NA 5C15A 2QKBA 4M63C 3NHGA 3BUZB 1ASVA 4JI4K 4DFMA 5JVHL 1XNRK 4CGHA 3B6OA 1VQMN 1LAVA 4B1WB 4XH4A 3PO5A 3CJCA 3H08A 3RSEB 3ZSOA 4BQLA 3OYCA 5BPLA 4JYAK 1N32K 4N41A 1NLVA 1Y97A 2VWBA 2P9LA 4IO8A 1R59O 4B1VA 1QZ5A 5C25A 3ITHA 5AR0A 2IVPA 4O5BA 1YJWN 1WUAA 1NK5A 3AO5A 4DTJA 4AILC 2D0AA 4DQIA 3HJFA 5C2DA 1X9WA 3A5MC 4AM6A 2QWQA 3CI5A 4A5BA 2P1JA 1DTTA 3IRXA 1N8RO 2ITMA 2A42A 5BRFA 4FW1A 1X9JA 4MLHA 3S41A 3TAGA 4E7IA 1T7PA 5BREA 1BHLA 4I6MA 4E1NA 3J7ZO 3H3OB 4FJXA 3LDSA 4JKHA 3SCXA 3M8QA 4XH1A 3D2EB 3CFRA 3TSPA 3ASMA 1IH7A 1ASWA 3NFAA 4DV4K 3DLRA 1HKBA 1Z05A 1SKSA 2QM1A 4YHHK 3M1FA 1B9DA 2A1RA 1G99A 2VQEK 2BANA 4QOZB 3NF7A 2KZZA 2PYJA 2OPQA 5C12A 4BREA 3MEEA 1C6VA 3FZLA 5FPNA 3MK6A 5HRRA 5BRHA 2VQFK 4DR3K 4LC9B 1KVAA 1KCFA 3KK1A 2O8EA 3LP3A 1SL2A 1GLAG 3BY5A 3DWLA 2D0CA 2NUBA 4RW7A 5GAEP 5AZIB 3T69A 4H5RA 3QIOA 4Z4HA 4EFHA 3AO3A 4A57A 2H3GX 1ZBFA 3DXMB 2W6LA 3H45C 3QFUA 3ULEB 1O1WA 3THWB 3GE1A 3EZWA 1JCEA 4AHRA 2A3ZA 4H0PA 3O3HA 2P9UA 4RW4A 3OYLA 2DPNA 2ZD1A 1TL3A 4DTXA 1FKPA 4FWMA 5ADXH 1FJGK 5JICA 3O80A 1A5VA 3PLAA 5CHIA 3EE9A 3T1AA 4CI6A 3ZSQA 3ZT1A 4FWQA 4Q0BA 1NGDA 3KK3A 3ZT3A 1RT3A 2A5XA 4O0JA 1K9MO 1VSIA 1VAZA 1SL1A 3R6MA 4EHUA 5FRNA 4IZ9A 3L2UA 4ELUA 1NJZA 4RW8A 2HHTA 3HSCA 2GBZA 4DUZK 4FYDA 3WNGA 1KAZA 4HCBA 3MAQA 5HL7L 3KLIA 3CQXA 1TUUA 2QEXN 3JXUA 3NF8A 4FL9A 4DTPA 5HRNA 2G8IA 4JKCA 2Q2RA 3AVMA 3DRSA 3CERA 1KFDA 3M3ZA 4LY7A 1HMVA 4NLBA 5KRTA 3CPWM 4FCYA 4JEPA 2WONA 4I2PA 1GLLO 4HCCA 2QKKA 2O8CA 2O8FB 5LJVA 3ZSRA 1IO2A 5GAGP 4KI6A 1FXXA 2ZJQL 4ILJA 5AQLA 3L3VA 4KTWA 1NJYA 1C1AA 4DTNA 3UKUB 4CHQA 3HYFA 3M6GA 1JKHA 4FLYA 1ZXOA 4IDKA 5AZJB 3MDQA 3PV8A 4JD2B 3AAQA 2NRHA 3UKRB 1BCMA 4M45A 3O3FA 3CXCM 1GLEG 4B08A 3I55N 4FJHA 1MU2A 3IUCA 1HYVA 1CZBA 1DEJA 3CJ9A 2E2NA 2W42A 4LFCK 1QZ6A 3T19A 4WQ5A 4J2BA 1OH6A 4IG0A 4DSJA 3SUQA 4M41A 2UUBK 4DQPA 5BPNA 4M3TA
chains in the Genus database with same CATH topology
1CZAN 4BC3A 2ZGZA 3QBWA 3O9RA 3Q7BA 4ILHA 1VQLN 3VEOA 5F0XA 3HM8A 1VQNN 4PHTX 2QXLA 4H5TA 5AQPA 3WXIA 1LOTB 3O08A 4XEIA 3FZMA 4B9QA 3O9QA 4BVOA 4BGBA 1U2VA 3CHWA 3CCSN 3H6EA 1YAGA 1YITN 3R8EA 4OPAA 1GLFO 1NBWA 2J4RA 3A5LC 4C1NI 2PAVA 3A8YA 4HWIA 5AQZA 1S72N 5BR9A 2E2OA 3CETA 3VTIA 4IJAA 2GELA 3N4QA 5AQQA 3A0IX 4JK7A 1BU6O 2Q0UA 4GV9A 4WFAL 4WF9L 3G71N 4L3QA 4EIAA 5LJWA 2QA4N 2E1YA 3VEWA 4CZMA 5F2RA 1O13A 3O6WA 3P4IA 2WFBA 4H0YB 2NRRA 3ENHA 5EX5A 3SBTA 4FVUA 1BOTO 3I56N 3ID8A 3CC2N 3NMUA 4H0OA 3G25A 3O9TA 3QBXA 3FZFA 4YDUA 2E88A 1T6CA 3SLCA 2YJEA 1SQKA 2FSJA 4YOUA 2YHYA 2P9UB 3WXLA 4NLCA 2HBLA 3K9JA 3GL1A 5M1FA 3B8AX 3WXKA 3KK7A 2QWOA 5F1XA 2QWPA 3SAGA 5AQUA 4CD3A 2NZTA 2HOEA 4C23A 3QB0A 5C0YA 4C1NK 3H1VX 4CD1A 4R79A 1XC3A 5AQFA 3AY9A 1KXPA 3WT0A 4BRIA 3CCJN 1ZC6A 4BRNA 3EKSA 3MX2A 3D2FB 4FWLA 4BR7A 3RSEA 3VMFB 5DM6L 4RWTA 2YHXA 3CJBA 3MCAB 5GINA 3HTVA 4MO5A 4ISFA 4GNIA 4WQ4A 2ASOA 4CZHA 3GOIA 5FPEA 4YOTA 4DB3A 2P9KA 5B8HA 2FF6A 1YXQA 2IVNA 1MWKA 3HZ6A 1NGAA 4CZGA 3CD6N 2ZF5O 5CR4A 3CCQN 3NVKA 4BC4A 1XQSC 3MN9A 3QFPA 1RFQA 1K8KA 5FPMA 3HRGA 3WXJA 1ESVA 1BDGA 5HOOA 1Q86O 1NWKA 1NJIO 2W41A 2NNWA 4YDUC 4A2BA 2OTJN 2P9SB 1SS6A 4MLEA 3G6EN 1GLDG 1BA0A 3DXKA 3FR0A 4K42A 2KLAA 2Q0RA 4OPHA 3ZYYX 3AGKA 1VQKN 1TUYA 3VGKA 3J8AA 2A40A 1HPMA 3BF1A 1K8KB 4CJ7A 3H1QA 2WBNA 1EQYA 3FGUA 3QICA 3OW2M 3VESA 4IJNA 2WUSA 5M1QA 2D4WA 3GG4A 1VQ4N 5MLCQ 2CGKA 3JS6A 3VEVA 1KAXA 3OBWA 3VPZA 3HOSA 2JWKA 1RDUA 1BWFO 1MWMA 4JNEA 3VF2A 4CBXA 2OANA 3DXKB 2VGMA 5JMVA 3LDQA 4G9ZA 2E2PA 3DLLL 1DKGD 3I33A 3CF5L 3EO3A 5H1SQ 1SZ2A 4BVPA 3SJHA 4JK9A 4PKHA 4PKIA 1W2BM 2NRVA 4XH5A 4A5AA 2GTDA 4FOIA 4CZKA 1VQPN 3U9DA 2GEMA 4CZIA 3CC7N 4NO7A 4BG8A 5JVGL 3CCMN 3VEZA 5BN8A 4WCEL 4RCHA 5AQTA 1LCUA 5M1NA 4RTFD 3WUHA 2NRXA 1YI2N 2Q31A 3RVCA 3VTHA 1S22A 3BEXA 1HKCA 2PFUA 3FZKA 3TTDA 2Q1NA 3E66A 5BN9A 4H5NA 4FWNA 3I8BA 4QS9A 1OVYA 5JLHA 2V7ZA 3TU5A 1GLCG 3C7NA 3W0LA 2HBMA 3C6AA 3MWTA 5AQYA 3UE5A 2FF3B 3EKUA 1VQON 1YVNA 5AQHA 4IOXA 2VYPA 2I7PA 3AAPA 3F9MA 5AQGA 4IOCL 4YOXA 4GVEA 2A41A 2HBJA 4JHDB 1MDUB 3O5BA 5AZIA 1NGJA 4ISEA 1TYQB 3KVGA 5FPDA 3E9OA 1NGFA 5CE3A 3FLCO 1HJOA 2P9PA 3FFKB 3SMSA 3VEXA 4BRCA 1NGIA 1Y64A 3DXMA 4M7XA 2FLOA 3VEYA 2HBKA 5LY3A 4WFNL 1YHQN 3KWGA 3OHRA 1IJJA 1S3XA 1DT9A 1P8ZA 4IO9L 2NLXA 3TSQA 3MN6A 1VQ8N 5KQDA 1U2VB 3P38A 5M1KA 1KQSM 3LDOA 2E20A 3H3NO 3D7EO 3AARA 3EN9A 3IKMA 3QDKA 4JKFA 4O8UA 1BUPA 2QWRA 2YJFA 3H46O 4H5WA 3CCUN 1VQ9N 1ATRA 3P39A 3R9PA 2YCHA 3WXMB 3LM9A 3C0BA 4MDAA 3O9UA 5E26A 3KHYA 1WOQA 4BG9A 1VQ7N 4A61A 4KH5A 3ZX2A 2JWLA 2BH1A 2QWMA 4GV6A 1V4SA 4B1XB 3Q7CA 1SAZA 4O5FA 4JKEA 4AM7A 3GBTA 4BR4A 5BRDA 2QW9A 4K43A 2F9TA 4IEEA 2WC9A 4A59A 4PL8A 1M1KO 3ZEUA 1GLBG 1YF5L 3SK3A 2E2QA 5GIOA 2E8AA 2RHKA 1Q82O 2A6AA 4GY2B 4U7BA 2FSNA 5C15A 4H5VA 4M63C 1K8AO 5E84A 1KD1O 1GLJO 3BUZB 3LDNA 3T7ZA 1JCGA 3VOVA 1V4TA 5AQWA 5JVHL 2CH6A 1U6ZA 2Q36A 2AP1A 1ATNA 1VQMN 4JKGA 4B1WB 4CZEA 4XH4A 3CJCA 3ZEUB 2FSKA 4PKGA 3RSEB 4H0TB 4BQLA 1YUWA 4CBUA 2Q97A 3UB5A 1HX1A 5BPLA 2P9IA 2NRZA 3LM2A 1YJNN 1Q81O 2P9KB 1NLVA 4HTLA 5M1OA 1JJ2M 1HKGA 2P9LA 2ASMA 2VWBA 1M90O 2GX9A 4IO8A 1R59O 3TTFA 4JK8A 1ILYA 2D0OA 4B1VA 1QQMA 1OKJA 1NMDA 1QZ5A 2YI1A 4JKGB 3LL3A 5AR0A 3WEEA 3CC4N 2IVOA 2AA4A 4BY9C 4K25A 2CH5A 2IVPA 5AQKA 1VQ5N 1YJWN 1WUAA 5KPZA 5C10A 3WQTA 2HF3A 4BRDA 3MMVA 4BC5A 3C65A 4FSVA 1ATSA 1Z6RA 4FWSA 4JAXA 4NB4A 5AQOA 5C2DA 3P31A 3A5MC 4AM6A 2QWQA 3CI5A 3UKUA 2KKZA 3G4SN 1C0GA 3D2EA 4A5BA 3GDQA 3CMEN 3MCPA 2D1KA 4FO0A 4B1ZA 2ITMA 1N8RO 5TKYA 2A42A 4BRHA 5BRFA 4MLHA 1X9JA 5AZJA 3L0QA 3MN7A 3S41A 4JKDA 3UKRA 3IFRA 5AQMA 5BREA 3E1YA 3O1BA 4I6MA 3J7ZO 3H3OB 4YOWA 3U9ZA 4BRLA 4JKHA 3CCVN 1HLUA 3PIOL 4XH1A 4BR2A 4U67L 3D2EB 3LDLA 3LDPA 2GWJA 4FOEA 4PL7A 2P9NA 3TSPA 2V52B 3AGRA 1Q7YO 1HKBA 1Z05A 4FWRA 2QM1A 4YOVA 3C6HA 3M1FA 3SAHA 1QVGM 1G99A 1E4FT 3HI0A 4I6MB 3KZBA 3DJCA 5AFUH 4ISGA 1X3NA 4K41A 4IDHA 4BROA 3EL2A 4CZLA 4Z94A 3SMPA 3R3LA 5C12A 4BREA 5JLFA 3FZLA 5FPNA 3MK6A 4WYBA 5AQIA 5BRHA 5GADP 3SBGA 4YORA 4LC9B 2F7TA 3O4WA 4B1UB 1D4XA 4JKBA 1VQ6N 4IWVA 1E4GT 3EE8A 4DQ8A 3C7NB 3SAFA 3ULEA 2ASPA 2EWSA 1NGHA 4BRMA 1T6DA 3CCLN 1GLAG 2VGNA 1BO5O 4IFEA 3CQYA 3FZHA 1T3VA 3DWLA 4BR0A 2RE2A 3F5TA 4BC2A 5GAEP 5AZIB 3T69A 4F9OA 2NRTA 4H5RA 1RDWX 2P9PB 4EFHA 4A57A 2H3GX 5GIPA 2E1ZA 3ID6A 2PBDA 2VCPA 3DXMB 4BRPA 4FWOA 3CCRN 3H45C 5C2FA 3QFUA 5AQXA 3ULEB 3IDHA 3OA9A 3O9SA 3O1WA 2FXUA 3MN5A 3GE1A 3EZWA 5AQJA 4E1JA 1YIJN 1JCEA 1EO1A 2QWLA 2A3ZA 4H0PA 1T44A 3VF6A 2P9UA 3VGMA 3W3DA 2DPNA 4DKWA 3BP8A 4WQ5C 3R1XA 1IG8A 4BR9A 3CPEA 2YHWA 4FWMA 5ADXH 3ATVA 3F2KA 5JICA 4IOAL 2UYTA 2F9WA 3O80A 5EOYA 3PIPL 4YOYA 5KPRA 3PLAA 2BUPA 3CJAA 3ZETA 5CHIA 2D0PA 3U8XA 3EE9A 4MDBA 3ZX0A 4WFBL 1K73O 4ILGB 4CI6A 3D2FA 3M5RA 4QS8A 1BA1A 5M1PA 5AQVA 4FWQA 4BRFA 4CBWA 5BPMA 4BR5A 4H03B 5EXWA 4B1YB 1NGDA 3CJ7A 5I9EB 4FWPA 1C0FA 4KBOA 3D6RA 2A5XA 3U4LA 4Y0WA 3HOTA 1K9MO 1VAZA 3VF4A 3VGLA 3ZX3A 4DCHA 2HSTA 3R6MA 3WQUA 4EHUA 5EVZA 3ZETB 3A5NC 2I7NA 3CIPA 4IZ9A 4JN4A 4KH4A 4EHTA 5AQSA 4CZJA 3CJ1A 5ELZA 5DM7L 3TSUA 3HSCA 2NRWA 4FPAA 4IEIA 5AFUA 2P9SA 1KAZA 1XUPO 1NGCA 3O8MA 3A5OC 3TPQA 1NGEA 5KQ8A 5HL7L 2CGLA 3NVMA 3CQXA 1BG3A 1TUUA 1HUXA 4KH6A 2QEXN 3JXUA 4FL9A 2HF4A 2Q2RA 4JKCA 1MA9B 2HMPA 3CERA 2P9IB 3IMXA 2ZWHA 3M3ZA 1DGKN 2ZJPL 1KAYA 4NLBA 3CPWM 2IIRA 4A2AA 1QQNA 4UY8O 2BTFA 1JCFA 2P9LB 4JEPA 3CMAN 2QTDA 2W40A 1GLLO 3N4PA 5AQRA 4MO4A 1NGGA 4FWKA 2V51B 3L6QA 2GUPA 4JKAA 3WEEB 5LJVA 5TKWA 5GAGP 3KWIA 4JD2A 3E9PA 4O8KA 5EY4A 2KHOA 3ENBA 2V7YA 2ZJQL 4ILJA 5AQLA 4J8FA 4CZFA 3MX5A 1KC8O 1NM1A 4AF1A 1RGIA 3UKUB 3MWPA 4WQ4C 4QS7A 4BRAA 1QVFM 3M6GA 1W97L 1QQOA 1ZXOA 5AZJB 1Q18A 3MDQA 1ZBSA 1H1VA 4JD2B 3TTCA 3AAQA 2NRHA 3ENOA 3HBTA 3QMLA 3UKRB 4EAHD 4BQZA 2YX6A 5ADXA 5GAHP 4M7YA 3VERA 2ZGYA 3CXCM 1GLEG 5KPTA 3L4QA 1YJ9N 3I55N 3IUCA 1X3MA 1QHAA 2GWKA 3DAWA 3E9LA 4GV3A 3VENA 1J6ZA 3CCEN 1DEJA 2QI2A 4DHYA 3K9KA 3CJ9A 2E2NA 2P9NB 2ZJRL 2CGJA 1QZ6A 4BRKA 4WQ5A 5AQNA 4BRGA 4IXCA 2QWNA 3VETA 4FPBA 1NGBA 4JHDA 4H0XB 4BGAA 3L4IA 4BRQA 3ATUA 3BF3A 4A62A 1TYQA 5BPNA 3FE1A 1P90A 4OO1J 3OBYA 4H0VB 2OTLN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R1X A;  3T69 A; 
#chains in the Genus database with same CATH topology
 2HHU A;  3KJV A;  4IG3 A;  1RDA A;  1D9F A;  2QXL A;  5AQP A;  4M3Z A;  1LOT B;  3VQ5 A;  1RT6 A;  4BGB A;  3CCS N;  2DFF A;  3K2P A;  3R8E A;  4X62 K;  4BE1 A;  1GLF O;  1NBW A;  3A5L C;  4C1N I;  2PAV A;  3A8Y A;  4XIU A;  4I9Q A;  2GEL A;  4CGI A;  1NJW A;  5J2N A;  3RMB A;  4CEC A;  1UWB A;  4K8Z A;  4EIA A;  4NYN A;  4FJ9 A;  1Q9Y A;  4FJ5 A;  4DSI A;  4DU4 A;  5F2R A;  1RBT A;  1O13 A;  3P4I A;  2Y1I A;  5EX5 A;  1C1C A;  4DV6 K;  3FZF A;  1HNZ K;  2A1S A;  3SLC A;  2FSJ A;  3WXL A;  2HBL A;  3GL1 A;  5M1F A;  3B8A X;  4JI1 K;  3KK7 A;  2ZQB A;  4DS4 A;  5C0Y A;  3OYN A;  3WT0 A;  3RMC A;  3CCJ N;  2BDP A;  4BRN A;  4CJ5 A;  3D2F B;  4FWL A;  4OKK A;  3RSE A;  5DM6 L;  3VN5 A;  3MCA B;  1GOB A;  4ISF A;  4GNI A;  2ASO A;  3GOI A;  1YXQ A;  4YNQ A;  3CD6 N;  2ZF5 O;  1RBU A;  2ITG A;  4FZX C;  3NVK A;  2I5J A;  5FPM A;  1K8K A;  1BDG A;  2F96 A;  4YDU C;  2P9S B;  1QSY A;  4FK4 A;  3TR8 A;  3FR0 A;  4K42 A;  2Q0R A;  3OS2 A;  3AGK A;  2A40 A;  4LF5 K;  3BF1 A;  4CJ7 A;  3FGU A;  4OLA A;  1JL2 A;  3GG4 A;  1VQ4 N;  3RR8 A;  1VSF A;  2CGK A;  3VEV A;  2E4L A;  4DG1 A;  3HOS A;  1MWM A;  3VF2 A;  4CBX A;  1SUQ A;  1VSM A;  4G9Z A;  2E2P A;  2VG7 A;  2YNG A;  3CF5 L;  3EO3 A;  4KHY A;  3SJH A;  1HJR A;  4PKI A;  4KV8 A;  2NRV A;  4CHY A;  4CVN E;  4AHC A;  4A5A A;  4KHU A;  4FOI A;  2GEM A;  3VEZ A;  2XY8 A;  1XNQ K;  3LP2 A;  5AQT A;  5M1N A;  4RTF D;  1YI2 N;  3BGR A;  2Q31 A;  3RVC A;  3TAM A;  3VTH A;  2OCE A;  3TTD A;  4BAC A;  1DTQ A;  1KVB A;  4FWN A;  4H5N A;  2D0B A;  4DR1 K;  4QS9 A;  5JLH A;  3S3O A;  3CQ8 A;  3QER A;  5AQY A;  2IGI A;  5CZ1 A;  3UE5 A;  3IS9 A;  2FF3 B;  1VQO N;  5AQH A;  3OYA A;  2VYP A;  2I7P A;  5AQG A;  4IOC L;  4M42 A;  4JHD B;  3O5B A;  5AZI A;  1NGJ A;  1ZYQ A;  1RT5 A;  4ISE A;  1TKD A;  5KRS A;  2HVH A;  3SMS A;  4HTU A;  1CZ9 A;  4DF4 A;  4LF8 K;  3DXM A;  2FLO A;  3VEY A;  1ZBI A;  3OHR A;  1IJJ A;  3U6F A;  1S3X A;  4IO9 L;  3THW A;  4E3S A;  2NLX A;  3OS1 A;  1JLC A;  1OH8 A;  1WN7 A;  4CFA A;  1U2V B;  4Z4E A;  1KQS M;  4DSK A;  5CYM A;  4AHT A;  1I39 A;  2DFH A;  3HVT A;  2XO7 A;  4H5W A;  3H46 O;  1JLA A;  2OZM A;  2HHH K;  4CEF A;  4W5Q A;  3HP6 A;  2X74 A;  4KH5 A;  1D8Y A;  1NMN A;  2JWL A;  1S1U A;  4BWM A;  4NXM K;  2YKN A;  1RBS A;  4O5F A;  3HP9 A;  1DLO A;  3GBT A;  4AM7 A;  4BR4 A;  2QW9 A;  4K43 A;  3LAL A;  3ZEU A;  4CJT A;  1YF5 L;  2F4V K;  3T1H K;  5GIO A;  1Q82 O;  3HPG A;  4GVM A;  4FJL A;  3HPH A;  1K8A O;  1KD1 O;  1GLJ O;  3U3Y A;  3T7Z A;  1JCG A;  4E7H A;  1UOC A;  3CM6 A;  5AQW A;  2G8F A;  2Q36 A;  3OYG A;  1ATN A;  4JKG A;  2QXF A;  1E3M A;  1OH7 A;  1YUW A;  4CBU A;  1HX1 A;  4H8K A;  2NRZ A;  4UQG A;  1NG9 A;  1XMO K;  1YJN N;  1Q81 O;  2P9K B;  2HB5 A;  3AVB A;  4HTL A;  4DR5 K;  2GX9 A;  4CGG A;  4JK8 A;  1QQM A;  1NMD A;  2YI1 A;  3QIN A;  3CC4 N;  4BY9 C;  2OZS A;  1SV5 A;  2HF3 A;  3HT3 A;  4FSV A;  4FWS A;  4B8A B;  3P31 A;  4ZTF A;  3UKU A;  2KKZ A;  2X78 A;  1C0G A;  3G4S N;  1RT2 A;  1U4B A;  3GDQ A;  2HHW A;  3MCP A;  5TKY A;  4B9V A;  5AZJ A;  3V9S A;  3L0Q A;  3MN7 A;  1WNS A;  4FLX A;  3UKR A;  3IFR A;  2EX3 A;  3O1B A;  3C6U A;  3U9Z A;  3ZSX A;  4CEZ A;  3C94 A;  2VG5 A;  4U67 L;  2HVI A;  3LDL A;  4Y1C A;  1Q7Y O;  4FM1 A;  4FXD A;  4J2E A;  3J80 O;  3THV A;  1E4F T;  3HI0 A;  1HNV A;  3S3M A;  3DJC A;  1X3N A;  1GOA A;  4K41 A;  4IDH A;  4BRO A;  2G8W A;  3HST B;  3R3L A;  5AQI A;  5C42 A;  1RTJ A;  4HUG A;  4IBN A;  2F7T A;  3O4W A;  4CJ4 A;  4JLH A;  4JKB A;  3KIO A;  1W7A A;  4DV2 K;  4DQ8 A;  1E4G T;  3SAF A;  4E0D A;  4CEB A;  2ASP A;  4FVM A;  4BRM A;  1T6D A;  2HMI A;  3CCL N;  3SZ2 A;  2VGN A;  1L5U A;  3FZH A;  4F9O A;  1VRU A;  5J2Q A;  5GIP A;  1JLB A;  3CCR N;  4FWO A;  5JS2 A;  2FBT A;  3J7A P;  3AO4 A;  3IDH A;  3OA9 A;  1S9E A;  4J2D A;  5HRS A;  3ZLJ A;  1I94 K;  4CJK A;  3W3D A;  3DLG A;  3TAP A;  2B6A A;  3BP8 A;  4WQ5 C;  3D45 A;  3R1X A;  3OYM A;  4IOA L;  4E19 A;  2UYT A;  3QEX A;  2F9W A;  5EOY A;  3PIP L;  1YTA A;  2KW4 A;  4MDB A;  4WFB L;  1K73 O;  4CE9 A;  3D2F A;  4YY3 K;  5M1P A;  5AQV A;  4AH9 A;  5BPM A;  2HW3 A;  4H03 B;  3I8D A;  3CJ7 A;  5I9E B;  4FWP A;  3D6R A;  1JLQ A;  3ZSY A;  4CW7 B;  3RMA A;  5HLF A;  3U4L A;  2RKI A;  4Y0W A;  3L2W A;  3VF4 A;  1C0U A;  3I0S A;  3VGL A;  3ZX3 A;  4DTS A;  3ZET B;  4EHT A;  3CIP A;  2I7N A;  3V6D A;  3LWM A;  3JYT A;  4KI4 A;  3FFI A;  4CZJ A;  4FLW A;  1NK9 A;  3TSU A;  4BE0 A;  5AFU A;  2P9S A;  1Q9X A;  4FJK A;  3VQP A;  2F8S A;  4EP4 A;  2CGL A;  3PX6 A;  1HNX K;  5I3U A;  2G8U A;  2UXD K;  1B9F A;  2HF4 A;  1S6P A;  4Z4G A;  3CYM A;  4OLB A;  3V9U A;  4FLZ A;  4GKJ K;  3QO9 A;  4DS5 A;  2G8V A;  2P9I B;  4R5P A;  4KHP K;  3IMX A;  2ZWH A;  1KAY A;  4A2A A;  4DLE A;  2W40 A;  1NGG A;  3L6Q A;  2GUP A;  5TKW A;  1T8E A;  2UUA K;  4HHT A;  4Z4F A;  3B6P A;  3TWH A;  4O8K A;  5AJ3 K;  2KHO A;  4CZF A;  5A2Q O;  2KZM A;  1RGI A;  1LWF A;  4KO0 A;  4QS7 A;  4E89 A;  3CFO A;  4QAG A;  1ZBS A;  4BDZ A;  4EAH D;  1RTI A;  5GAH P;  4I9L A;  3VER A;  2ZGY A;  1L3U A;  4K8X A;  3OYD A;  3L4Q A;  3K5M A;  4LF4 K;  4CK3 A;  4KTQ A;  1J6Z A;  3EEQ A;  3CCE N;  4DHY A;  2ZJR L;  2YNI A;  5HP1 A;  4BRG A;  2QWN A;  1J5E K;  4JHD A;  3BF3 A;  3MXJ A;  4OO1 J;  3OBY A;  1CZA N;  4BC3 A;  4DV5 K;  3DOL A;  3ALY A;  5CYQ A;  4FJJ A;  4B9Q A;  3OYK A;  1YT3 A;  4OGC A;  1U2V A;  3SQ0 A;  1YAG A;  4OPA A;  2HHX A;  3QET A;  4DR7 K;  3I0R A;  5J2M A;  4OVL A;  2E2O A;  2YKM A;  1BIU A;  3N4Q A;  5AQQ A;  2Q0U A;  5J2P A;  2OA8 A;  4BDP A;  5E41 A;  3P83 D;  4C8O A;  3TAE A;  3L2Q A;  3AVL A;  4CJS A;  4CZM A;  1X9M A;  2RF2 A;  3IAY A;  3O6W A;  4CK1 A;  1GOC A;  4H0Y B;  3ENH A;  3SBT A;  2IOC A;  1KFS A;  4W5O A;  3I56 N;  4CJR A;  3AO2 A;  4H0O A;  3O9T A;  4M3X A;  1T6C A;  2YJE A;  2YHY A;  4OX9 K;  2KQ2 A;  2B5J A;  2KTQ A;  1NJX A;  4CD3 A;  3AVG A;  2FBX A;  1I3A A;  4C23 A;  3AA2 A;  4DSE A;  1KLM A;  2DFE A;  2FC0 A;  3K5L A;  1S1W A;  4R79 A;  4LF9 K;  4CHZ A;  4CF2 A;  3VQ9 A;  4BR7 A;  4RWT A;  3LWL A;  1A5W A;  3HTV A;  4WQ4 A;  4CZH A;  3V9Z A;  4DB3 A;  3RR7 A;  2P9K A;  4CZG A;  1MWK A;  3HZ6 A;  1NGA A;  4DU3 A;  3KD1 E;  5CR4 A;  5DMR A;  4DSL A;  3WXJ A;  3CFP A;  2WTU A;  1ESV A;  1Q86 O;  4CJQ A;  1NJI O;  1SS6 A;  2RN2 A;  4MLE A;  1NOZ A;  1GLD G;  4IKF A;  2KLA A;  1TKZ A;  1TUY A;  3J8A A;  4E7L A;  1HPM A;  2O4G A;  2B4J A;  3H1Q A;  3QIC A;  3VES A;  2O8B B;  1SL0 A;  3VPZ A;  3SQ2 A;  2ATQ A;  1B92 A;  3OBW A;  5JS1 A;  4KHS A;  4KHQ A;  1RDU A;  3QLH A;  3DXK B;  2VGM A;  1QSL A;  3I33 A;  1SZ2 A;  4BVP A;  4JK9 A;  5KGW A;  1TK0 A;  2GTD A;  3TAN A;  1VQP N;  2X6N A;  4NCA A;  3LP1 A;  4B9T A;  3CC7 N;  4NO7 A;  1CXQ A;  3T3F A;  3AVH A;  2R7Y A;  4WCE L;  2HND A;  1LCU A;  3WUH A;  1QSS A;  3MXM A;  1BIS A;  5HRP A;  3BEX A;  1EXQ A;  2PFU A;  3DLK A;  3KLE A;  3I8B A;  2V7Z A;  1WSF A;  1GLC G;  3UIQ A;  1QQC A;  2HBM A;  1R0A A;  1YVN A;  4IOX A;  4YOX A;  4W5R A;  2A41 A;  2HBJ A;  2XY5 A;  4JV5 K;  4B3O A;  1FK9 A;  4NXN K;  4CIF A;  1TYQ B;  3KVG A;  1NGF A;  3VEX A;  1HJO A;  4M7X A;  1Y64 A;  1RT1 A;  2YHA A;  3C95 A;  3BZK A;  3EY1 A;  4F3O A;  1KSP A;  1KTQ A;  1LV5 A;  3THX B;  2G8K A;  1RTH A;  3HL8 A;  2O8D B;  4CCH A;  2DY4 A;  5KQD A;  1W0H A;  4G1Q A;  2P5G A;  3QIP A;  3EN9 A;  1BUP A;  1UA1 A;  3QES A;  2HNZ A;  1VQ9 N;  1ATR A;  1S6Q A;  3P39 A;  1WSH A;  2YCH A;  5E26 A;  4O4G A;  3AVN A;  3CM5 A;  3RWU A;  4KFB A;  3ZX2 A;  2BH1 A;  2QWM A;  1TV6 A;  4CJP A;  3PSF A;  3Q7C A;  1SAZ A;  2Z1G A;  3VA0 A;  4LF7 K;  5BRD A;  4CFC A;  2F9T A;  5CY4 A;  2WC9 A;  4ID5 A;  4A59 A;  1M1K O;  3LZJ A;  1GLB G;  1F21 A;  2E8A A;  2A6A A;  4U7B A;  3QEW A;  2FSN A;  4B3R K;  4H5V A;  4HUE A;  5E84 A;  1TKX A;  1U45 A;  3OS0 A;  3V1Q A;  3VOV A;  4CF0 A;  4JI6 K;  4NYF A;  1IKV A;  3O3G A;  4ID1 A;  3LAN A;  2AJQ A;  2Y1J A;  4CJE A;  2KFN A;  3K0S A;  3VQA A;  2P9I A;  3ZT0 A;  5CZ2 A;  4M3U A;  3LPU A;  1HR0 K;  5M1O A;  3NGI A;  4JI2 K;  1X9S A;  3TTF A;  1ILY A;  2D0O A;  4FJ7 A;  4FZY A;  1OKJ A;  1T05 A;  3L8B A;  4GKK K;  2AA4 A;  1WSI A;  5AQK A;  3L3U A;  5KPZ A;  2YNF A;  4CHO A;  5C10 A;  4CEO A;  3WQT A;  4BRD A;  4JI3 K;  3MMV A;  4NB4 A;  1Z6R A;  4Z0U A;  5FRO A;  2XY7 A;  3P1G A;  1WB9 A;  3D2E A;  2UXB K;  1U49 A;  3CME N;  3LZI A;  4B1Z A;  4BRH A;  3AVJ A;  4JKD A;  1TAU A;  5AQM A;  4YOW A;  3V81 A;  1VHX A;  4F2R A;  4DFK A;  4CJW A;  4KB1 A;  1HLU A;  4W5T A;  3PIO L;  4BR2 A;  1IKY A;  2GWJ A;  3NAE A;  3AGR A;  4FLU A;  4FWR A;  4YOV A;  1JXB A;  4NCG A;  3SAH A;  1QVG M;  3HK2 A;  4W5N A;  4I6M B;  3KZB A;  3EL2 A;  3SMP A;  4F8R A;  5GAD P;  3SBG A;  1EP4 A;  4YOR A;  2UUC K;  1D4X A;  3J7Y P;  4B9N A;  3EE8 A;  3C7N B;  3ULE A;  4PQU A;  1NGH A;  1REV A;  4FW2 A;  3CQY A;  1T3V A;  2WOM A;  1HPZ A;  4BR0 A;  3F5T A;  4BC2 A;  2NRT A;  1HRH A;  5EU7 A;  3VQ8 A;  4B9L A;  3ID6 A;  3V1R A;  2PBD A;  3SYZ A;  3P5J A;  2O8E B;  5C24 A;  3BZC A;  1WSJ A;  5KGX A;  3O9S A;  3QNO A;  1HYZ A;  3O1W A;  3L2R A;  2FXU A;  3MN5 A;  3DI6 A;  4EZ6 A;  2IDO A;  4DU1 A;  1T44 A;  4DFJ A;  1Z25 A;  1IG8 A;  4BR9 A;  1OH5 A;  2GUI A;  2YHW A;  3SNN A;  1IG9 A;  2Z1H A;  5KPR A;  3TAF A;  3CJA A;  2D0P A;  4H4M A;  4X64 K;  3KLH A;  4ILG B;  2FBY A;  4CHP A;  1ZBL A;  3VQE A;  3M5R A;  1BA1 A;  4BRF A;  3K5O A;  4GMJ B;  1C0F A;  1EWR A;  1X1P A;  1N6Q A;  4X65 K;  2HST A;  3IG1 A;  5EVZ A;  3A5N C;  3NGY A;  1TL1 A;  3ZT4 A;  5DM7 L;  4EZ9 A;  1XUP O;  1NGC A;  4AHV A;  3TPQ A;  5KQ8 A;  4LFA K;  3AO1 A;  2O8F A;  4CJ3 A;  3RMD A;  2OPS A;  4CEQ A;  2O8B A;  1ZBH A;  2HMP A;  2ZJP L;  1ITG A;  3NF9 A;  2IIR A;  1XHX A;  4UY8 O;  1JCF A;  3CMA N;  4JI5 K;  2QTD A;  1NK7 A;  2HHQ A;  3VQC A;  1BQM A;  4MO4 A;  4KHN A;  4Z4I A;  4FWK A;  2V51 B;  4JKA A;  3WEE B;  4KRE A;  4PY5 A;  1J9A A;  4JD2 A;  2E6L A;  3DMJ A;  3ENB A;  4Y1D A;  4J8F A;  1KC8 O;  5IT9 O;  3MEG A;  1BIZ A;  2XHB A;  3NCI A;  4WQ4 C;  1XMQ K;  1QVF M;  4ZTJ A;  4B9U A;  1W97 L;  1QQO A;  1RT4 A;  1S1X A;  1WBD A;  1Q18 A;  2FBV A;  2HNY A;  3ENO A;  4CJU A;  1BI4 B;  4BQZ A;  5ADX A;  1HQU A;  4E7J A;  1YJ9 N;  3SQ1 A;  1OVQ A;  1X3M A;  1QHA A;  3DAW A;  4ZHR A;  1FW6 A;  4KRF A;  3VEN A;  2KFZ A;  2QI2 A;  3F73 A;  3K9K A;  2P9N B;  2CGJ A;  3VET A;  3MXI A;  1NGB A;  1A5X A;  4BGA A;  1JLG A;  1TYQ A;  4OJR A;  3FE1 A;  4LFB K;  1SKW A;  1LAW A;  2OTL N;  1VSD A;  1IKW A;  3ISN C;  2ZGZ A;  3QBW A;  3O9R A;  4KHW A;  3ZCM A;  4ILH A;  1VQL N;  3VEO A;  3THX A;  3HM8 A;  2O8D A;  3WXI A;  4BVO A;  4KPY A;  4NCB A;  1WBB A;  3H6E A;  1YIT N;  4OKE A;  4DTR A;  4B3S K;  3AV9 A;  3S9H A;  4HWI A;  5AQZ A;  1S72 N;  5BR9 A;  3SI6 A;  4IJA A;  3NH1 A;  5SZT A;  4JK7 A;  1BU6 O;  1N34 K;  4GV9 A;  4WFA L;  2HHS A;  4FJG A;  4L3Q A;  4AQY K;  2QA4 N;  2E1Y A;  3VEW A;  2XY6 A;  4B9M A;  1LW2 A;  3LPT A;  4ELV A;  1G15 A;  1L3V A;  2NRR A;  1FKO A;  4CED A;  1BOT O;  3AVA A;  3NMU A;  1KRP A;  3G25 A;  3QBX A;  4YDU A;  4N47 A;  2E88 A;  4E1M A;  1SQK A;  3K57 A;  4K0K K;  4NLC A;  3SQ4 A;  4PUO A;  4CF1 A;  4FJI A;  2JGU A;  2QWO A;  2GV9 A;  2QWP A;  3SAG A;  3D0P A;  2HOE A;  3M8P A;  3QB0 A;  4C1N K;  1U47 A;  3H1V X;  1TVR A;  3AVC A;  3M8R A;  4LSL A;  4CD1 A;  2PY5 A;  3AY9 A;  1KXP A;  4BRI A;  5KTQ A;  1RDC A;  1ZC6 A;  3CJB A;  1NKE A;  4MO5 A;  1ZBU A;  4YOT A;  4FK0 A;  3DYA A;  1CLQ A;  1XQS C;  4FZZ A;  3QFP A;  1RFQ A;  3HRG A;  3JSM A;  5SWM A;  3SPY A;  3WNE A;  1RBV A;  1YTU A;  1XHZ A;  2ZE2 A;  4OKJ A;  1QTM A;  1BA0 A;  1RNH A;  4OPH A;  3ZYY X;  4OPK A;  1VQK N;  3VGK A;  4CES A;  3OYI A;  1K8K B;  3L2V A;  4FLT A;  3OW2 M;  1QE1 A;  5M1Q A;  2D4W A;  1S5J A;  3DLH A;  3HXM A;  5MLC Q;  3JS6 A;  1XI1 A;  3VQB A;  4DQS A;  1VSL A;  1BWF O;  4JNE A;  3EZ5 A;  3LDQ A;  3DLL L;  2Q3S A;  2PYL A;  4JS4 A;  4FK2 A;  3O4N A;  1W2B M;  3WNF A;  3TAB A;  3CG7 A;  4IFV A;  3DOK A;  4CZK A;  1C0M A;  4CZI A;  5LMN K;  3AA5 X;  5JVG L;  3CCM N;  1NK0 A;  4AHS A;  2NRX A;  1S22 A;  4F4K A;  1HKC A;  2UXC K;  3E66 A;  4DFP A;  4DQR A;  4C8K A;  3C7N A;  3C6A A;  3V4I A;  3G0Z A;  3K58 A;  4B8C A;  4O0I A;  3M8S A;  4GVE A;  4CHN A;  5CE3 A;  1NGI A;  4WFN L;  1YHQ N;  4DMN A;  3KWG A;  1P8Z A;  4DR2 K;  3TSQ A;  4PWD A;  1VQ8 N;  3BDP A;  4KAZ A;  3PY8 A;  4OGE A;  1BQN A;  1XWL A;  3P38 A;  1WAF A;  5M1K A;  1EET A;  3AAR A;  3SPZ A;  3QDK A;  2QWR A;  2YJF A;  3AVK A;  2D5R A;  1S9G A;  4L8R B;  4DR4 K;  2XRI A;  1BGX T;  4DTO A;  3C0B A;  4MDA A;  3O9U A;  3NH0 A;  4DR6 K;  1WOQ A;  4BG9 A;  1VQ7 N;  4FLV A;  4GV6 A;  4ELT A;  1V4S A;  2VWJ A;  4JRQ A;  5KI6 A;  3PX0 A;  1EX4 A;  4JKE A;  2OYQ A;  5DK5 A;  4CGD A;  4O55 A;  4PL8 A;  2E2Q A;  2RHK A;  3V9X A;  4GY2 B;  1C1B A;  5FDL A;  2IS3 A;  1TGO A;  1JXE A;  3LDN A;  5FLX O;  1NK8 A;  1ASU A;  1NOY A;  2YHB A;  1V4T A;  3AA3 A;  4QCL A;  2CH6 A;  1U6Z A;  2AP1 A;  4BWJ A;  4FM2 A;  4CZE A;  3ZEU B;  2FSK A;  4PKG A;  4H0T B;  3LP0 A;  2Q97 A;  3UB5 A;  3SUP A;  3ZT2 A;  3LM2 A;  3U3G A;  4JI7 K;  1N36 K;  1UAX A;  1JJ2 M;  1HKG A;  2ASM A;  1M90 O;  3KLF A;  1TK5 A;  4IFY A;  4JKG B;  3LL3 A;  3WEE A;  2IVO A;  4K25 A;  2CH5 A;  1VQ5 N;  5LMU K;  1L3S A;  3KLG A;  3OYJ A;  4CF9 A;  1VSK A;  4BC5 A;  3C65 A;  1ATS A;  4JAX A;  5AQO A;  4CFD A;  1NKC A;  1BL3 A;  2X6S A;  3AVI A;  2D1K A;  4FO0 A;  4CEE A;  3KK2 A;  4CJF A;  4MQ3 A;  4HUF A;  1BI4 A;  3E1Y A;  4DLG A;  1U04 A;  4M3R A;  4CIE A;  4BRL A;  5FRM A;  4FM0 A;  2P5O A;  3CCV N;  3LDP A;  3DRP A;  4FOE A;  4PL7 A;  3K59 A;  2P9N A;  2V52 B;  1RIL A;  3NBP A;  3C6H A;  1XC9 A;  2VG6 A;  2W6K A;  1D5A A;  4C8M A;  5AFU H;  4ISG A;  4CZL A;  4Z94 A;  5JLF A;  4WYB A;  3VQ6 A;  2RPI A;  3HO1 A;  3OY9 A;  1Q8I A;  2YV0 X;  4B1U B;  1VQ6 N;  3THY B;  1WAJ A;  4IWV A;  1J53 A;  1HNW K;  2EWS A;  5T7B A;  4IFE A;  1BO5 O;  2RE2 A;  4E7K A;  1NK4 A;  2O4I A;  1RDW X;  4I2Q A;  2P9P B;  3QNN A;  1J5O A;  2E1Z A;  2VCP A;  4BRP A;  4CFB A;  2G8H A;  5C2F A;  5AQX A;  1WSG A;  4C8L A;  1BCO A;  5AQJ A;  4E1J A;  1YIJ N;  1EO1 A;  3DLE A;  2QWL A;  1WSE A;  3VF6 A;  3VGM A;  3VQD A;  4Z4C A;  3TI0 A;  1C0T A;  4DKW A;  3NE6 A;  2JLE A;  1TKT A;  3CPE A;  3ATV A;  3F2K A;  3HVR A;  4YOY A;  3VQ4 A;  2BUP A;  3ZET A;  1HYS A;  3OTO K;  3U8X A;  3ZX0 A;  1JL1 A;  4QS8 A;  4CBW A;  4BR5 A;  5EXW A;  4B1Y B;  4CER A;  3QEI A;  4KBO A;  2EHG A;  1S1V A;  4DV7 K;  3TAQ A;  3HOT A;  4Q5V A;  4J2A A;  4DCH A;  3WQU A;  1RCH A;  2HHV A;  4JN4 A;  4KH4 A;  5AQS A;  3CJ1 A;  5ELZ A;  3HM9 A;  4DWI A;  2NRW A;  4LH4 A;  4FPA A;  4IEI A;  3O8M A;  1NKB A;  4DV3 K;  3A5O C;  1NGE A;  3NVM A;  3ZSV A;  1QHT A;  1BG3 A;  3AA4 A;  1HUX A;  3OYB A;  3OJU A;  4KH6 A;  2BGG A;  1TAQ A;  4FJM A;  1MA9 B;  2IC3 A;  3ULD A;  3SUN A;  1T03 A;  1NK6 A;  5HRO A;  3WNH A;  5I42 A;  4F2S A;  3ZSW A;  1DGK N;  2E6M A;  1LWE A;  4DV0 K;  1QQN A;  4H4O A;  2BTF A;  3DM2 A;  2P9L B;  4CGF A;  2LSN A;  3N4P A;  5AQR A;  1RDD A;  3KWI A;  3VQ7 A;  2Z1I A;  4N76 A;  3E9P A;  4JRP A;  5EY4 A;  4PA1 A;  4B3M K;  2V7Y A;  3O4Q A;  4DTU A;  3NGZ A;  3MX5 A;  4RW9 A;  4B3T K;  1NM1 A;  4AF1 A;  4M3Y A;  3ZSZ A;  4OPJ A;  4DV1 K;  3MWP A;  1Z26 A;  3DRR A;  4LD0 A;  1NU0 A;  4BRA A;  1N5Y A;  3K5N A;  4F3T A;  1K6Y A;  3RRG A;  3LAM A;  1H1V A;  3TTC A;  3HBT A;  3QML A;  4X66 K;  2YX6 A;  4M7Y A;  5KPT A;  4LH5 A;  5D3G A;  4AHU A;  2GWK A;  3E01 A;  3E9L A;  4GV3 A;  4TSX A;  1RBR A;  4BRK A;  5AQN A;  4IXC A;  4FPB A;  3LAK A;  1HNI A;  4H0X B;  3L4I A;  3NH2 A;  4BRQ A;  3ATU A;  1S1T A;  4A62 A;  3KD5 E;  1P90 A;  3S3N A;  4H0V B;  4GW6 A;  1KLN A;  3Q7B A;  2ZM6 K;  2IAJ A;  4RW6 A;  5F0X A;  1VQN N;  4PHT X;  1YVU A;  4H5T A;  3O08 A;  4XEI A;  1U48 A;  3FZM A;  3O9Q A;  3HPO A;  1RTD A;  3CHW A;  2VWK A;  4HVJ A;  4WE1 A;  2J4R A;  1KVC A;  5J1E A;  4CIG A;  1L3T A;  1IBK K;  3CET A;  3VTI A;  3VA3 A;  2OPP A;  3A0I X;  2P51 A;  4WF9 L;  3G71 N;  5LJW A;  5LL6 Z;  4CGJ A;  2WFB A;  3MED A;  3OYE A;  3J81 O;  4FVU A;  3AVF A;  3CC2 N;  3ID8 A;  4JI8 K;  3DLB A;  1D9D A;  4YOU A;  2P9U B;  4B9S A;  3K9J A;  3WXK A;  4LF6 K;  5F1X A;  4KB0 A;  5AQU A;  2NZT A;  4BDY A;  1XC3 A;  5AQF A;  4LSN A;  1IBL K;  3EKS A;  3MX2 A;  4DTM A;  1EWQ A;  1VRT A;  3VMF B;  2YHX A;  5GIN A;  2PZS A;  4O44 A;  5FPE A;  5B8H A;  2FF6 A;  4I7F A;  2IVN A;  3A2F A;  3CCQ N;  4BC4 A;  3MN9 A;  4DF8 A;  3V1O A;  1CXU A;  1EKE A;  1JLF A;  3OVN A;  4M3W A;  5HOO A;  1NWK A;  2W41 A;  3KKR A;  2NNW A;  4A2B A;  2OTJ N;  3KKS A;  3G6E N;  1IKX A;  2YNH A;  3DXK A;  4FJ8 A;  3PUF A;  2OPR A;  1W9H A;  4CF8 A;  1VSJ A;  1J54 A;  2WBN A;  1EQY A;  3PX4 A;  1VSH A;  4IJN A;  2WUS A;  4CEA A;  2UU9 K;  4BE2 A;  1KAX A;  4RG8 A;  1LW0 A;  2JWK A;  4N5S A;  3PSI A;  2OAN A;  5JMV A;  3EYZ A;  2O8C B;  4CJL A;  4EP5 A;  1DKG D;  1N33 K;  5H1S Q;  4YFU A;  4KTZ A;  4PKH A;  4XH5 A;  4CK2 A;  2QK9 A;  1IV0 A;  1RDB A;  3U9D A;  1VSE A;  2Z1J A;  5HBM A;  4BG8 A;  3OJS A;  1LWC A;  3NF6 A;  4ICL A;  4N56 A;  4FJN A;  5BN8 A;  4RCH A;  4JS5 A;  5IWA K;  1QS4 A;  3FZK A;  2Q1N A;  3SUO A;  5BN9 A;  1OVY A;  4CJV A;  3THY A;  3VQQ A;  1IBM K;  4DSF A;  3TU5 A;  3W0L A;  1VK0 A;  3MWT A;  4KKO A;  3EKU A;  3AAP A;  3F9M A;  3PO4 A;  4DUY K;  2DTU A;  1MDU B;  3RRH A;  3QEV A;  3SV4 A;  5FPD A;  3E9O A;  3F9K A;  3KTQ A;  1JLE A;  3FFK B;  2P9P A;  3FLC O;  3G10 A;  2BE2 A;  4BRC A;  5LY3 A;  3C6T A;  4DQQ A;  2HBK A;  1DT9 A;  5K14 A;  3MEC A;  3MN6 A;  5BR8 K;  1NNE A;  3LDO A;  2E20 A;  3H3N O;  3D7E O;  3IKM A;  3JAM O;  3SJJ A;  4JKF A;  4O8U A;  3V9W A;  4MFB A;  3CCU N;  3QEP A;  3R9P A;  3WXM B;  3LM9 A;  3SV3 A;  2E5L K;  3KHY A;  4A61 A;  3OYF A;  4V19 S;  2F8T A;  1RT7 A;  3OYH A;  1TK8 A;  3RTV A;  4B1X B;  1WLJ A;  1HQE A;  3TAR A;  1UA0 A;  4IEE A;  2ETJ A;  3T1Y K;  1SKR A;  3NDK A;  4JI0 K;  3SK3 A;  4C8N A;  5C15 A;  2QKB A;  4M63 C;  3NHG A;  3BUZ B;  1ASV A;  4JI4 K;  4DFM A;  5JVH L;  1XNR K;  4CGH A;  3B6O A;  1VQM N;  1LAV A;  4B1W B;  4XH4 A;  3PO5 A;  3CJC A;  3H08 A;  3RSE B;  3ZSO A;  4BQL A;  3OYC A;  5BPL A;  4JYA K;  1N32 K;  4N41 A;  1NLV A;  1Y97 A;  2VWB A;  2P9L A;  4IO8 A;  1R59 O;  4B1V A;  1QZ5 A;  5C25 A;  3ITH A;  5AR0 A;  2IVP A;  4O5B A;  1YJW N;  1WUA A;  1NK5 A;  3AO5 A;  4DTJ A;  4AIL C;  2D0A A;  4DQI A;  3HJF A;  5C2D A;  1X9W A;  3A5M C;  4AM6 A;  2QWQ A;  3CI5 A;  4A5B A;  2P1J A;  1DTT A;  3IRX A;  1N8R O;  2ITM A;  2A42 A;  5BRF A;  4FW1 A;  1X9J A;  4MLH A;  3S41 A;  3TAG A;  4E7I A;  1T7P A;  5BRE A;  1BHL A;  4I6M A;  4E1N A;  3J7Z O;  3H3O B;  4FJX A;  3LDS A;  4JKH A;  3SCX A;  3M8Q A;  4XH1 A;  3D2E B;  3CFR A;  3TSP A;  3ASM A;  1IH7 A;  1ASW A;  3NFA A;  4DV4 K;  3DLR A;  1HKB A;  1Z05 A;  1SKS A;  2QM1 A;  4YHH K;  3M1F A;  1B9D A;  2A1R A;  1G99 A;  2VQE K;  2BAN A;  4QOZ B;  3NF7 A;  2KZZ A;  2PYJ A;  2OPQ A;  5C12 A;  4BRE A;  3MEE A;  1C6V A;  3FZL A;  5FPN A;  3MK6 A;  5HRR A;  5BRH A;  2VQF K;  4DR3 K;  4LC9 B;  1KVA A;  1KCF A;  3KK1 A;  2O8E A;  3LP3 A;  1SL2 A;  1GLA G;  3BY5 A;  3DWL A;  2D0C A;  2NUB A;  4RW7 A;  5GAE P;  5AZI B;  3T69 A;  4H5R A;  3QIO A;  4Z4H A;  4EFH A;  3AO3 A;  4A57 A;  2H3G X;  1ZBF A;  3DXM B;  2W6L A;  3H45 C;  3QFU A;  3ULE B;  1O1W A;  3THW B;  3GE1 A;  3EZW A;  1JCE A;  4AHR A;  2A3Z A;  4H0P A;  3O3H A;  2P9U A;  4RW4 A;  3OYL A;  2DPN A;  2ZD1 A;  1TL3 A;  4DTX A;  1FKP A;  4FWM A;  5ADX H;  1FJG K;  5JIC A;  3O80 A;  1A5V A;  3PLA A;  5CHI A;  3EE9 A;  3T1A A;  4CI6 A;  3ZSQ A;  3ZT1 A;  4FWQ A;  4Q0B A;  1NGD A;  3KK3 A;  3ZT3 A;  1RT3 A;  2A5X A;  4O0J A;  1K9M O;  1VSI A;  1VAZ A;  1SL1 A;  3R6M A;  4EHU A;  5FRN A;  4IZ9 A;  3L2U A;  4ELU A;  1NJZ A;  4RW8 A;  2HHT A;  3HSC A;  2GBZ A;  4DUZ K;  4FYD A;  3WNG A;  1KAZ A;  4HCB A;  3MAQ A;  5HL7 L;  3KLI A;  3CQX A;  1TUU A;  2QEX N;  3JXU A;  3NF8 A;  4FL9 A;  4DTP A;  5HRN A;  2G8I A;  4JKC A;  2Q2R A;  3AVM A;  3DRS A;  3CER A;  1KFD A;  3M3Z A;  4LY7 A;  1HMV A;  4NLB A;  5KRT A;  3CPW M;  4FCY A;  4JEP A;  2WON A;  4I2P A;  1GLL O;  4HCC A;  2QKK A;  2O8C A;  2O8F B;  5LJV A;  3ZSR A;  1IO2 A;  5GAG P;  4KI6 A;  1FXX A;  2ZJQ L;  4ILJ A;  5AQL A;  3L3V A;  4KTW A;  1NJY A;  1C1A A;  4DTN A;  3UKU B;  4CHQ A;  3HYF A;  3M6G A;  1JKH A;  4FLY A;  1ZXO A;  4IDK A;  5AZJ B;  3MDQ A;  3PV8 A;  4JD2 B;  3AAQ A;  2NRH A;  3UKR B;  1BCM A;  4M45 A;  3O3F A;  3CXC M;  1GLE G;  4B08 A;  3I55 N;  4FJH A;  1MU2 A;  3IUC A;  1HYV A;  1CZB A;  1DEJ A;  3CJ9 A;  2E2N A;  2W42 A;  4LFC K;  1QZ6 A;  3T19 A;  4WQ5 A;  4J2B A;  1OH6 A;  4IG0 A;  4DSJ A;  3SUQ A;  4M41 A;  2UUB K;  4DQP A;  5BPN A;  4M3T A; 
#chains in the Genus database with same CATH homology
 1CZA N;  4BC3 A;  2ZGZ A;  3QBW A;  3O9R A;  3Q7B A;  4ILH A;  1VQL N;  3VEO A;  5F0X A;  3HM8 A;  1VQN N;  4PHT X;  2QXL A;  4H5T A;  5AQP A;  3WXI A;  1LOT B;  3O08 A;  4XEI A;  3FZM A;  4B9Q A;  3O9Q A;  4BVO A;  4BGB A;  1U2V A;  3CHW A;  3CCS N;  3H6E A;  1YAG A;  1YIT N;  3R8E A;  4OPA A;  1GLF O;  1NBW A;  2J4R A;  3A5L C;  4C1N I;  2PAV A;  3A8Y A;  4HWI A;  5AQZ A;  1S72 N;  5BR9 A;  2E2O A;  3CET A;  3VTI A;  4IJA A;  2GEL A;  3N4Q A;  5AQQ A;  3A0I X;  4JK7 A;  1BU6 O;  2Q0U A;  4GV9 A;  4WFA L;  4WF9 L;  3G71 N;  4L3Q A;  4EIA A;  5LJW A;  2QA4 N;  2E1Y A;  3VEW A;  4CZM A;  5F2R A;  1O13 A;  3O6W A;  3P4I A;  2WFB A;  4H0Y B;  2NRR A;  3ENH A;  5EX5 A;  3SBT A;  4FVU A;  1BOT O;  3I56 N;  3ID8 A;  3CC2 N;  3NMU A;  4H0O A;  3G25 A;  3O9T A;  3QBX A;  3FZF A;  4YDU A;  2E88 A;  1T6C A;  3SLC A;  2YJE A;  1SQK A;  2FSJ A;  4YOU A;  2YHY A;  2P9U B;  3WXL A;  4NLC A;  2HBL A;  3K9J A;  3GL1 A;  5M1F A;  3B8A X;  3WXK A;  3KK7 A;  2QWO A;  5F1X A;  2QWP A;  3SAG A;  5AQU A;  4CD3 A;  2NZT A;  2HOE A;  4C23 A;  3QB0 A;  5C0Y A;  4C1N K;  3H1V X;  4CD1 A;  4R79 A;  1XC3 A;  5AQF A;  3AY9 A;  1KXP A;  3WT0 A;  4BRI A;  3CCJ N;  1ZC6 A;  4BRN A;  3EKS A;  3MX2 A;  3D2F B;  4FWL A;  4BR7 A;  3RSE A;  3VMF B;  5DM6 L;  4RWT A;  2YHX A;  3CJB A;  3MCA B;  5GIN A;  3HTV A;  4MO5 A;  4ISF A;  4GNI A;  4WQ4 A;  2ASO A;  4CZH A;  3GOI A;  5FPE A;  4YOT A;  4DB3 A;  2P9K A;  5B8H A;  2FF6 A;  1YXQ A;  2IVN A;  1MWK A;  3HZ6 A;  1NGA A;  4CZG A;  3CD6 N;  2ZF5 O;  5CR4 A;  3CCQ N;  3NVK A;  4BC4 A;  1XQS C;  3MN9 A;  3QFP A;  1RFQ A;  1K8K A;  5FPM A;  3HRG A;  3WXJ A;  1ESV A;  1BDG A;  5HOO A;  1Q86 O;  1NWK A;  1NJI O;  2W41 A;  2NNW A;  4YDU C;  4A2B A;  2OTJ N;  2P9S B;  1SS6 A;  4MLE A;  3G6E N;  1GLD G;  1BA0 A;  3DXK A;  3FR0 A;  4K42 A;  2KLA A;  2Q0R A;  4OPH A;  3ZYY X;  3AGK A;  1VQK N;  1TUY A;  3VGK A;  3J8A A;  2A40 A;  1HPM A;  3BF1 A;  1K8K B;  4CJ7 A;  3H1Q A;  2WBN A;  1EQY A;  3FGU A;  3QIC A;  3OW2 M;  3VES A;  4IJN A;  2WUS A;  5M1Q A;  2D4W A;  3GG4 A;  1VQ4 N;  5MLC Q;  2CGK A;  3JS6 A;  3VEV A;  1KAX A;  3OBW A;  3VPZ A;  3HOS A;  2JWK A;  1RDU A;  1BWF O;  1MWM A;  4JNE A;  3VF2 A;  4CBX A;  2OAN A;  3DXK B;  2VGM A;  5JMV A;  3LDQ A;  4G9Z A;  2E2P A;  3DLL L;  1DKG D;  3I33 A;  3CF5 L;  3EO3 A;  5H1S Q;  1SZ2 A;  4BVP A;  3SJH A;  4JK9 A;  4PKH A;  4PKI A;  1W2B M;  2NRV A;  4XH5 A;  4A5A A;  2GTD A;  4FOI A;  4CZK A;  1VQP N;  3U9D A;  2GEM A;  4CZI A;  3CC7 N;  4NO7 A;  4BG8 A;  5JVG L;  3CCM N;  3VEZ A;  5BN8 A;  4WCE L;  4RCH A;  5AQT A;  1LCU A;  5M1N A;  4RTF D;  3WUH A;  2NRX A;  1YI2 N;  2Q31 A;  3RVC A;  3VTH A;  1S22 A;  3BEX A;  1HKC A;  2PFU A;  3FZK A;  3TTD A;  2Q1N A;  3E66 A;  5BN9 A;  4H5N A;  4FWN A;  3I8B A;  4QS9 A;  1OVY A;  5JLH A;  2V7Z A;  3TU5 A;  1GLC G;  3C7N A;  3W0L A;  2HBM A;  3C6A A;  3MWT A;  5AQY A;  3UE5 A;  2FF3 B;  3EKU A;  1VQO N;  1YVN A;  5AQH A;  4IOX A;  2VYP A;  2I7P A;  3AAP A;  3F9M A;  5AQG A;  4IOC L;  4YOX A;  4GVE A;  2A41 A;  2HBJ A;  4JHD B;  1MDU B;  3O5B A;  5AZI A;  1NGJ A;  4ISE A;  1TYQ B;  3KVG A;  5FPD A;  3E9O A;  1NGF A;  5CE3 A;  3FLC O;  1HJO A;  2P9P A;  3FFK B;  3SMS A;  3VEX A;  4BRC A;  1NGI A;  1Y64 A;  3DXM A;  4M7X A;  2FLO A;  3VEY A;  2HBK A;  5LY3 A;  4WFN L;  1YHQ N;  3KWG A;  3OHR A;  1IJJ A;  1S3X A;  1DT9 A;  1P8Z A;  4IO9 L;  2NLX A;  3TSQ A;  3MN6 A;  1VQ8 N;  5KQD A;  1U2V B;  3P38 A;  5M1K A;  1KQS M;  3LDO A;  2E20 A;  3H3N O;  3D7E O;  3AAR A;  3EN9 A;  3IKM A;  3QDK A;  4JKF A;  4O8U A;  1BUP A;  2QWR A;  2YJF A;  3H46 O;  4H5W A;  3CCU N;  1VQ9 N;  1ATR A;  3P39 A;  3R9P A;  2YCH A;  3WXM B;  3LM9 A;  3C0B A;  4MDA A;  3O9U A;  5E26 A;  3KHY A;  1WOQ A;  4BG9 A;  1VQ7 N;  4A61 A;  4KH5 A;  3ZX2 A;  2JWL A;  2BH1 A;  2QWM A;  4GV6 A;  1V4S A;  4B1X B;  3Q7C A;  1SAZ A;  4O5F A;  4JKE A;  4AM7 A;  3GBT A;  4BR4 A;  5BRD A;  2QW9 A;  4K43 A;  2F9T A;  4IEE A;  2WC9 A;  4A59 A;  4PL8 A;  1M1K O;  3ZEU A;  1GLB G;  1YF5 L;  3SK3 A;  2E2Q A;  5GIO A;  2E8A A;  2RHK A;  1Q82 O;  2A6A A;  4GY2 B;  4U7B A;  2FSN A;  5C15 A;  4H5V A;  4M63 C;  1K8A O;  5E84 A;  1KD1 O;  1GLJ O;  3BUZ B;  3LDN A;  3T7Z A;  1JCG A;  3VOV A;  1V4T A;  5AQW A;  5JVH L;  2CH6 A;  1U6Z A;  2Q36 A;  2AP1 A;  1ATN A;  1VQM N;  4JKG A;  4B1W B;  4CZE A;  4XH4 A;  3CJC A;  3ZEU B;  2FSK A;  4PKG A;  3RSE B;  4H0T B;  4BQL A;  1YUW A;  4CBU A;  2Q97 A;  3UB5 A;  1HX1 A;  5BPL A;  2P9I A;  2NRZ A;  3LM2 A;  1YJN N;  1Q81 O;  2P9K B;  1NLV A;  4HTL A;  5M1O A;  1JJ2 M;  1HKG A;  2P9L A;  2ASM A;  2VWB A;  1M90 O;  2GX9 A;  4IO8 A;  1R59 O;  3TTF A;  4JK8 A;  1ILY A;  2D0O A;  4B1V A;  1QQM A;  1OKJ A;  1NMD A;  1QZ5 A;  2YI1 A;  4JKG B;  3LL3 A;  5AR0 A;  3WEE A;  3CC4 N;  2IVO A;  2AA4 A;  4BY9 C;  4K25 A;  2CH5 A;  2IVP A;  5AQK A;  1VQ5 N;  1YJW N;  1WUA A;  5KPZ A;  5C10 A;  3WQT A;  2HF3 A;  4BRD A;  3MMV A;  4BC5 A;  3C65 A;  4FSV A;  1ATS A;  1Z6R A;  4FWS A;  4JAX A;  4NB4 A;  5AQO A;  5C2D A;  3P31 A;  3A5M C;  4AM6 A;  2QWQ A;  3CI5 A;  3UKU A;  2KKZ A;  3G4S N;  1C0G A;  3D2E A;  4A5B A;  3GDQ A;  3CME N;  3MCP A;  2D1K A;  4FO0 A;  4B1Z A;  2ITM A;  1N8R O;  5TKY A;  2A42 A;  4BRH A;  5BRF A;  4MLH A;  1X9J A;  5AZJ A;  3L0Q A;  3MN7 A;  3S41 A;  4JKD A;  3UKR A;  3IFR A;  5AQM A;  5BRE A;  3E1Y A;  3O1B A;  4I6M A;  3J7Z O;  3H3O B;  4YOW A;  3U9Z A;  4BRL A;  4JKH A;  3CCV N;  1HLU A;  3PIO L;  4XH1 A;  4BR2 A;  4U67 L;  3D2E B;  3LDL A;  3LDP A;  2GWJ A;  4FOE A;  4PL7 A;  2P9N A;  3TSP A;  2V52 B;  3AGR A;  1Q7Y O;  1HKB A;  1Z05 A;  4FWR A;  2QM1 A;  4YOV A;  3C6H A;  3M1F A;  3SAH A;  1QVG M;  1G99 A;  1E4F T;  3HI0 A;  4I6M B;  3KZB A;  3DJC A;  5AFU H;  4ISG A;  1X3N A;  4K41 A;  4IDH A;  4BRO A;  3EL2 A;  4CZL A;  4Z94 A;  3SMP A;  3R3L A;  5C12 A;  4BRE A;  5JLF A;  3FZL A;  5FPN A;  3MK6 A;  4WYB A;  5AQI A;  5BRH A;  5GAD P;  3SBG A;  4YOR A;  4LC9 B;  2F7T A;  3O4W A;  4B1U B;  1D4X A;  4JKB A;  1VQ6 N;  4IWV A;  1E4G T;  3EE8 A;  4DQ8 A;  3C7N B;  3SAF A;  3ULE A;  2ASP A;  2EWS A;  1NGH A;  4BRM A;  1T6D A;  3CCL N;  1GLA G;  2VGN A;  1BO5 O;  4IFE A;  3CQY A;  3FZH A;  1T3V A;  3DWL A;  4BR0 A;  2RE2 A;  3F5T A;  4BC2 A;  5GAE P;  5AZI B;  3T69 A;  4F9O A;  2NRT A;  4H5R A;  1RDW X;  2P9P B;  4EFH A;  4A57 A;  2H3G X;  5GIP A;  2E1Z A;  3ID6 A;  2PBD A;  2VCP A;  3DXM B;  4BRP A;  4FWO A;  3CCR N;  3H45 C;  5C2F A;  3QFU A;  5AQX A;  3ULE B;  3IDH A;  3OA9 A;  3O9S A;  3O1W A;  2FXU A;  3MN5 A;  3GE1 A;  3EZW A;  5AQJ A;  4E1J A;  1YIJ N;  1JCE A;  1EO1 A;  2QWL A;  2A3Z A;  4H0P A;  1T44 A;  3VF6 A;  2P9U A;  3VGM A;  3W3D A;  2DPN A;  4DKW A;  3BP8 A;  4WQ5 C;  3R1X A;  1IG8 A;  4BR9 A;  3CPE A;  2YHW A;  4FWM A;  5ADX H;  3ATV A;  3F2K A;  5JIC A;  4IOA L;  2UYT A;  2F9W A;  3O80 A;  5EOY A;  3PIP L;  4YOY A;  5KPR A;  3PLA A;  2BUP A;  3CJA A;  3ZET A;  5CHI A;  2D0P A;  3U8X A;  3EE9 A;  4MDB A;  3ZX0 A;  4WFB L;  1K73 O;  4ILG B;  4CI6 A;  3D2F A;  3M5R A;  4QS8 A;  1BA1 A;  5M1P A;  5AQV A;  4FWQ A;  4BRF A;  4CBW A;  5BPM A;  4BR5 A;  4H03 B;  5EXW A;  4B1Y B;  1NGD A;  3CJ7 A;  5I9E B;  4FWP A;  1C0F A;  4KBO A;  3D6R A;  2A5X A;  3U4L A;  4Y0W A;  3HOT A;  1K9M O;  1VAZ A;  3VF4 A;  3VGL A;  3ZX3 A;  4DCH A;  2HST A;  3R6M A;  3WQU A;  4EHU A;  5EVZ A;  3ZET B;  3A5N C;  2I7N A;  3CIP A;  4IZ9 A;  4JN4 A;  4KH4 A;  4EHT A;  5AQS A;  4CZJ A;  3CJ1 A;  5ELZ A;  5DM7 L;  3TSU A;  3HSC A;  2NRW A;  4FPA A;  4IEI A;  5AFU A;  2P9S A;  1KAZ A;  1XUP O;  1NGC A;  3O8M A;  3A5O C;  3TPQ A;  1NGE A;  5KQ8 A;  5HL7 L;  2CGL A;  3NVM A;  3CQX A;  1BG3 A;  1TUU A;  1HUX A;  4KH6 A;  2QEX N;  3JXU A;  4FL9 A;  2HF4 A;  2Q2R A;  4JKC A;  1MA9 B;  2HMP A;  3CER A;  2P9I B;  3IMX A;  2ZWH A;  3M3Z A;  1DGK N;  2ZJP L;  1KAY A;  4NLB A;  3CPW M;  2IIR A;  4A2A A;  1QQN A;  4UY8 O;  2BTF A;  1JCF A;  2P9L B;  4JEP A;  3CMA N;  2QTD A;  2W40 A;  1GLL O;  3N4P A;  5AQR A;  4MO4 A;  1NGG A;  4FWK A;  2V51 B;  3L6Q A;  2GUP A;  4JKA A;  3WEE B;  5LJV A;  5TKW A;  5GAG P;  3KWI A;  4JD2 A;  3E9P A;  4O8K A;  5EY4 A;  2KHO A;  3ENB A;  2V7Y A;  2ZJQ L;  4ILJ A;  5AQL A;  4J8F A;  4CZF A;  3MX5 A;  1KC8 O;  1NM1 A;  4AF1 A;  1RGI A;  3UKU B;  3MWP A;  4WQ4 C;  4QS7 A;  4BRA A;  1QVF M;  3M6G A;  1W97 L;  1QQO A;  1ZXO A;  5AZJ B;  1Q18 A;  3MDQ A;  1ZBS A;  1H1V A;  4JD2 B;  3TTC A;  3AAQ A;  2NRH A;  3ENO A;  3HBT A;  3QML A;  3UKR B;  4EAH D;  4BQZ A;  2YX6 A;  5ADX A;  5GAH P;  4M7Y A;  3VER A;  2ZGY A;  3CXC M;  1GLE G;  5KPT A;  3L4Q A;  1YJ9 N;  3I55 N;  3IUC A;  1X3M A;  1QHA A;  2GWK A;  3DAW A;  3E9L A;  4GV3 A;  3VEN A;  1J6Z A;  3CCE N;  1DEJ A;  2QI2 A;  4DHY A;  3K9K A;  3CJ9 A;  2E2N A;  2P9N B;  2ZJR L;  2CGJ A;  1QZ6 A;  4BRK A;  4WQ5 A;  5AQN A;  4BRG A;  4IXC A;  2QWN A;  3VET A;  4FPB A;  1NGB A;  4JHD A;  4H0X B;  4BGA A;  3L4I A;  4BRQ A;  3ATU A;  3BF3 A;  4A62 A;  1TYQ A;  5BPN A;  3FE1 A;  1P90 A;  4OO1 J;  3OBY A;  4H0V B;  2OTL N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...