3T6WA

Crystal structure of steccherinum ochraceum laccase obtained by multi-crystals composite data collection technique (10% dose)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
495
structure length
495
Chain Sequence
VQIGPVTDLHIVNADIVPDGFVRPAVNAGGTFPGPVIAGNVGDNFQIVTFNQLIECSMLVDTSIHWHGEFQKGTNWADGPAFITQCPIIVGNSFSYNFNVPGMAGTYWYHSHLTTQYCDGLRGPFVVYDPNDPDANLYDVDDDTTIITLADWYHVLAKEMGAGGAITADSTLIDGLGRTHVNVAAVPLSVITVEVGKRYRMRLVSISCDPNYDFSIDGHDMTIIETDGVDSQELTVDEIQIFAAQRYSFVLNANQPVGNYWIRANPNSGGEGFDGGINSAILRYDGATTADPVTVASTVHTKCLIETDLHPLSRNGVPGNPHQGGADCNLNLSLGFACGNFVINGVSFTPPTVPVLLQICSGANTAADLLPSGSVISLPSNSTIEIALPAGAAGGPHPFHLHGHDFAVSESASNSTSNYDDPIWRDVVSIGGVGDNVTIRFCTDNPGPWFLHCHIDWHLDAGFAIVFAEDIPNTASANPVPEAWSNLCPSYDSAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reaction intermediates and redox state changes in a blue laccase from Steccherinum ochraceum observed by crystallographic high/low X-ray dose experiments.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Laccase
total genus 136
structure length 495
sequence length 495
chains with identical sequence B, C
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6wA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6wA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6wA03
3X1EA 4ENZA 4DPCX 3FU8A 1M57B 1KCBA 2RACA 2IAAC 3GXUB 2OV0A 3FSVA 1NPJA 5D4HA 3FPXA 1KBVA 4YSCA 4GP8B 1X9RA 4KNTA 4PCYA 1SHXA 2XV3A 1GS7A 2PPFA 3ASNB 2DV6A 4A2EA 2YXWA 3KW7A 3OM3B 4GXFA 3N55A 3OD3A 5FC9A 1OOWA 2Q9OA 3FT0A 1NIEA 2H3XC 3NJHA 4W9ZA 4NAJA 3X1GA 2XXGA 1NDTA 2R7EA 2W8CA 2Y1AA 1MZYA 2DWSA 1A8ZA 1W8EA 1OE1A 2NRDA 2QT6A 2EINB 2VSMB 4GYBA 4FA7B 5I6MA 1GY2A 2ZXWB 1JVOA 4W1TA 4HCGA 4JHVA 2HX9A 4E9WA 2HLEB 3FYEB 1CYXA 2R7EB 1BXVA 1ET7A 3OQRA 4BDVB 4QLWA 1NIDA 1GY1A 3EH5B 3GDCA 1AG6A 4M4RB 3UAEA 1OCOB 5EHFA 1GSKA 2YQBA 1CC3A 1AACA 2XWZA 3GYRA 1DZ0A 2HZHA 3TASA 1KDIA 4AI7A 8PAZA 3HEIB 2YAHA 1TKWA 2VM4A 3AZUA 3SQRA 1E30A 2H47C 5F7AA 5I6OA 3WKPA 4G72B 1ASQA 1SF3A 1HFUA 2BZCA 3ABMB 4HHWA 3X1NA 4KO7A 4G70B 1HAUA 1FFTB 5I6PA 2ZONA 2FT7A 3PCYA 5D4IA 3QJQB 1JXFA 1J9QA 1JZEA 4QKTA 1JOIA 1E5YA 2FT8A 3T9WA 1NTDA 4NERA 1OE3A 1URIA 2BP8A 3WNIA 3G5WA 1OCCB 1PZBA 4E9VA 1J5CA 1NIBA 2W88A 4E9TA 3IBOA 4UAHA 2GI0A 2VW4A 4A66A 1EZLA 2YAOA 2OCCB 2AZUA 1YLBB 1WA1X 1QLEB 1ID2A 1N70A 1JVLA 2Y69B 2XV2A 3NP4A 2J56A 1IBZA 3JTBA 5PCYA 4KNSA 5I6NA 1ZPUA 1AZUA 4DP1X 2WSDA 2XV0A 4HALA 1CUOA 2IDFA 3ABGA 4A68A 4M3HA 1W6LA 3S8FB 5I6LA 1NINA 1AS6A 2XX0A 1AR1B 2XYBA 4AKOA 1ZDQA 5LDUA 1A65A 1W6WA 2BW5A 3S3BB 3PAVA 1IUZA 2XX1A 3EHBB 2PPAA 2QDWA 3T71A 1NWPA 3FQ1A 3OMNB 3UABA 4YSUA 3ZDWA 2GSMB 1B3IA 3T6VA 4DP9X 1PLBA 2YAMA 2QPEB 4YSTA 1SDDA 1XB6A 4DP4X 5TK2A 2LLNA 2P80D 5I5JA 4PAZA 1GS8A 2J55A 4X4KA 4L0PB 5A7EA 2PPCA 1JXDA 7PAZA 3MX0B 1ET5A 4HAKA 4BK5C 3CVCA 3NSCA 2EIMB 5ANHA 2BZ7A 1KGYE 4UF7C 1ZDSA 1OE2A 4G7QB 1AZBA 4BWWA 2HXAA 1PZAA 2IWKA 1CYWA 3QJVB 4BWUA 5B7FA 4YSDA 4E9RA 4YVNA 1WS7A 2ZOOA 1ILSA 4KO6A 1F56A 3AW5A 1WA0X 2PLTA 2AANA 1E5ZA 1ZIBA 2BW4A 3MBWB 1GS6X 5AKRA 4WTQA 4G7SB 2FQFA 3WIAA 1SDDB 2BO0A 3TBCA 1J5DA 1KV7A 2I7OA 1OCZB 1PMYA 1FWXA 3ZIYA 4Q8BA 1EHKB 3NSYA 3UAAA 4E9QA 3X1FA 2AZAA 1NIFA 3AG3B 3H4FA 4MFHA 4YSOA 3V9CA 3WNJA 4AZUA 6PCYA 5I5IA 2XVBA 1SFDA 2JFCA 1PAZA 3FYIB 1FA4A 2GC4C 1QNIA 2UX7A 2EIKB 1WAEA 2FQDA 1TEGA 3FU7B 1GW0A 1JERA 3QJTB 1AZRA 1SFHA 5B1JA 3IN2A 1TEFA 3QJRB 1KYAA 3FSAA 1J9RA 2FNWA 5AZUA 4WKXA 2VSKB 5B3SB 4N4YB 2GB2A 2FT6A 4YSRA 1OV8A 1R1CA 1MG2C 2XU9A 5F7BA 3X2QB 4BDVA 1SNRA 3UACA 2A3TA 3TU6A 2DY2A 3ABLB 4YSQA 1AIZA 2UXTA 2FQGA 3BQVA 4KO5A 4AX3A 2TSAA 2XXFA 1A4CA 3NJJA 3NJIA 3QQXA 4RH4A 3NP3A 2GBAA 4G71B 2PPEA 4AKQA 1KBWA 5PAZA 1CURA 4JHUA 3EH3B 1BQKA 3S8GB 3UGEA 4BXSV 4GY4A 3FU9A 3S3CB 3DKHA 4KNUA 2DYSB 2Q5BA 3ZX1A 4DP8X 4HHGA 4A2DA 1HAWA 3KW8A 2PCYA 2UXGA 4E9XA 2FWLB 3C75A 3X1BA 2J57A 2TSBA 1ZIAA 2CUAA 3ERXA 1AS8A 2BP8B 5D4JA 1J9TA 5B1AB 1PLAA 1PNCA 1WA2X 1MG3C 2HRGA 2YARA 4KOBA 4G7RB 1X9UA 2YAQA 2I7SA 3PAZA 3WI9A 2P80A 1BXAA 1JZJA 2CCWA 1UATA 2QDVA 2BWIA 4HIPA 3T6WA 4N8UA 4KOCA 1OF0A 3U25A 2DYRB 1L9OA 3QPKA 4KO9A 4NB7A 2GHZA 1RKRA 2AVFA 2WO2B 3T6ZA 1GYCA 2I85A 3NJLA 4DPBX 4BXVA 3V9EA 2VM3A 5TK4A 3ABKB 4P5SA 3OMAB 1BQRA 4EF3A 1ILUA 1NIAA 1PF3A 1TU2A 3NJNA 3NSDA 3EF4A 1KDJA 5I28A 3AG1B 1IBYA 4YSSA 1ASPA 2PCFA 2VN3A 2X87A 2CALA 3PXLA 3PLYA 4F2FA 1PZCA 1PY0A 1XB3A 9PCYA 4E9SA 2IH8A 3D12B 1XMEB 1ZV2A 1L9SA 5I5MA 4DP7X 1RZPA 4DPAX 1AAJA 3H56A 2PPDA 1IKOP 4A2HA 1WS8A 1VLXA 1NPNA 1AG0A 3HB3B 2WO3B 3NSFA 3TBBA 2BHFA 2VMJA 4P5RA 1L9TA 2IH9A 3IE9A 2PP7A 2UX6A 3FSZA 1GR7A 4BWTA 1NZRA 3QJSB 2OJ1A 3T6XA 3AG2B 4DP5X 4GP4B 1JXGA 4A2GA 2UXVA 3AY2A 4AKPA 4UANA 4YSPA 2VW7A 1A4BA 5B1BB 2GC7C 7PCYA 3SBPA 1KCWA 4GP5B 3CG8A 4YL4A 2FQEA 4F2EA 1XB8A 1BAWA 3FQ2A 2AFNA 1J9SA 1JZIA 5B7MA 1PCSA 4ZK8A 3CDZA 4A67A 1QHQA 1RCYA 2YAPA 2CJ3A 3RYMA 2CAKA 3DTUB 3CZUB 1V54B 1AOZA 1AS7A 2PP9A 2MTAA 4DP0X 1A3ZA 3FQYA 3OMIB 2EILB 3SBQA 1T5KA 4CSPA 5I6KA 3JT2A 3UADA 1BQ5A 2FJSA 3NJKA 2BP0A 1SHWA 2IDSA 2BWDA 2YAEA 3NJMA 1JZGA 5E9NA 3ZBMA 1JZFA 2IDQA 3AG4B 2IDTA 1V10A 3FU7A 2QPDB 1M56B 4DP6X 2BP0B 2X88A 5B1KA 2JXMA 1IC0A 1L9RA 1L9PA 1E65A 2IWFA 3N2JA 4HZ1A 4K9JA 2PP8A 3S3DB 1I53A 1BXUA 2CBPA 2E86A 3BVDB 5AFAA 1BYOA 2UXFA 2HX8A 3EH4B 3IEAA 2JKWA 1DYZA 1E67A 3WG7B 4A2FA 3CDZB 2IWEA 1ASOA 1SJMA 4TXVB 1BYPA 1NWOA 1M9WA 2YXVA 2FTAA 1SF5A 3TA4D 2GIMA 3NT0A 4Q89A 1L9QA 1BEXA 2HX7A 2XUWA 3FPYA 2DWTA 1AZNA 3NJGA 2ZWNA 6PAZA 3PAUA 3NYKA 1A4AA 1ETJA 3CVDA 4HCFA 1RZQA 3QJUB 1NICA 4JKNA 4DP2X 3WKQA 1ET8A 2B08A 1JZHA 2B3IA 2IDUA 3IN0A 4E9YA 4F7KA 1PLCA 4FAAB 4CSZA 2EIJB 5IY5B 2N0MA 5B1JC 1AZCA 1OCRB 1ADWA 3CVBA 5I26A 4YSEA 2XLLA 1MZZA 1N68A 2HRHA 1AANA 1AQ8A 4HCIA 3PPSA 2H5UA 2VW6A 5B7EA 2YAFA 4YSAA 2J5WA 4YVUA 1V55B 3L45A 1MDAA 3FS9A 3FSWA 1PNDA 3DIVA 2MRYA 3NJFA 3H4HA 3SBRA 3ASOB
chains in the Genus database with same CATH superfamily
2R0LH 3B37A 3MV01 5D1XB 4AWJC 1YECH 2AMUA 4K9EL 3ARPA 1CK0L 3MACL 5FYJL 5I1JH 2FO8A 1YEHL 1GOGA 1CFQB 2ZNXA 4J4PD 3IB4A 5TQ0L 1YYMH 4LL1A 4PJHF 1X4XA 1ZHLA 4TPRH 3KW7A 4OLZH 5IV2B 3OM3B 2B0SL 4BFOA 4GXFA 2F08A 3CHOA 3FT0A 5DD1L 2OFQA 3Q8FA 4PS4L 4J12A 4KKNA 5CJ5A 5D71L 4LSVH 4P99A 3WL9B 1DANU 4PS4H 3IU4L 5EZIH 1AFVH 4FFZA 1SHSA 3NA4A 4G1MA 1AQHA 3S37L 4Z3GA 2HX9A 2VL4A 4PFEA 2VR3A 3VXRD 1CYXA 5EFIA 3QRFM 4C56B 5K69A 5D72L 1GIGL 3MTXA 1QRKA 5MP6H 2ENJA 2PCPA 2A0LD 1F4XH 4G8GE 4DOHB 3BH4A 2OPCA 4DO5A 3TN0B 1OSZA 4IRSD 2WWOA 3Q6FA 3QDGE 5L7XH 4JHAL 4YHZL 3NIFF 1MHHA 3DX1A 4ZDHA 2R0LL 4FQXC 3I6GA 1YNLL 1MCLA 4F8NA 3MLPA 4JFOA 2H8PA 5LBSA 2XWZA 2DJMA 2VDQH 3QEHB 1S5HA 1MF2L 1O6TA 3JZYA 5I75B 2E7LA 3LMJL 1OTUC 1F5WA 3UH8A 4WK4B 1BVKA 3PDGA 1UZ8A 4OIBA 2I27N 1P7HL 1X44A 1UWGH 1IM9B 5JA8B 1KJVB 3U4BL 3ILPB 4FQJH 5F7MC 1JCKA 3J07A 1FP5A 2ZXAA 4YXKL 1V7NL 2WXNA 4L5FE 1FFQA 4OBSA 3UPCA 2ADJB 2XG5B 4PG2C 2JNZA 2X1QA 1EMTH 3HAEB 4HGWB 35C8L 3CV5A 2CJUL 3DPDA 4LASL 4NCC2 4MZ2A 1W0WB 4PIRF 2D7NA 3MNVB 5JPNB 3L2LA 3K6DA 3IMBA 4LLQB 4DCQB 4Y4FC 5FUOH 4H1LB 4HIIB 1MY5A 2VLME 4IKIA 4PJEA 2AK1H 2H26B 1BJ8A 2AZUA 5E99H 1DJYA 4JFFD 2XV2A 2H32H 4OD3L 1XO8A 5FK9B 3V4LA 3OXRA 3BO8B 1FORL 4Y5XC 2VDKH 4GUOA 3K6FA 1ONQB 1DVXA 1NQBA 1YEKH 2ZUSA 3AXLB 3CDGB 4Z7UE 1KPUA 5BOZG 2I60L 4PYHA 4X5RA 3SY6A 4ADGA 1B0GB 1RK0B 4GRMA 2VXTH 5ES4B 4GG6E 1IGYA 4Q6IC 4V1DD 5C08E 3VACA 3KBHE 3PAVA 5CEXB 4YHIA 1M42A 1U8IA 1SMDA 3L9YA 2QDWA 1NWPA 2GSIB 2FYVA 3ULVH 5IB2B 4OZIB 3ZDWA 2GSMB 4U1KB 4ZO7A 3WUWA 3DROB 4HK0B 1V3JA 3EG9A 5LNGA 1IBBA 1AMXA 4EXPX 2C1PB 3UMNA 3L7EB 3MREB 1R24B 4UOW1 4YHLH 5EO9B 3UJIL 5DJAA 3SOBL 1FRGL 4P2OA 2QV2A 3FUFA 1JXDA 5LXGL 3HNSL 1K72A 1O0VA 3MZGB 4GUCA 2NR6C 1LE5A 3VSVA 2EH7L 3QCTL 5I1GH 4O58H 4FF9A 2QV4A 5DSCA 1LQBC 2OJEA 2Z31A 1KXVA 3MJ9A 4G7QB 4WAFA 3PHOB 5AW4B 2C4FU 5C0CD 1ZGLM 1KWKA 4P2OD 1RULH 1E50A 2ZWKA 4YQXL 4KO6A 5TE6H 2XN2A 2Y1VA 3IJ8A 1E4XH 2BFVL 2BSSA 4UQ2B 5T1JA 3SDYH 3TNMA 1JDDA 4JFHE 2X4NA 4EBQL 1JUFB 1Q0XH 4ZMAT 3K71A 2W81C 3CE1A 2Z91B 5HI5C 3CC5A 4GQZA 3F7VB 3ATDA 1FO0A 2I7OA 3WAKA 1KCUL 5C7XH 1ZJBA 1EEUA 5EEUA 3IMRA 2O5XH 3VNYA 2X4NB 3RDTC 4PLNC 3NEEA 4JJOA 1FFNA 3BGAA 4JPIB 2DQUH 2EKSA 4XAWL 3TONA 3SKJH 2XZCH 2OCJA 1PAZA 3L3IA 4FHBD 3VI3A 3KWXA 4AQEB 3TO4C 2A6IB 2VN7A 3IXAA 3KHQA 4F58L 4GBXA 2P5EA 2QEJA 2ZKYA 5C07E 4JL2A 3GINA 1NBYA 1NC4D 5IB5B 1I9JH 2FL5A 1HI6A 5DYFA 2R23B 2YGOA 1TEFA 1U8PA 1LO0H 3F7VA 4HFWA 3CH1A 3WTXA 3GNMH 1JV2A 1E27A 4JZNB 2ATKB 3SDAB 2AJUL 1T1YA 1F4AA 5KS9B 2EVIA 4AYEC 4CJ0A 4FHKA 5M7QA 3L1GA 1BZ7A 1FL6A 1RERA 4U1SB 2VN5A 4ICWA 1O7DC 1TZHB 4X7TB 1QBLL 1E8ZA 1F0LA 1L4IA 4HXBH 1CDGA 4A7GF 3IGAA 4JKPH 2FQGA 5A2KH 4XCYB 5HP5A 2YC1A 5IB1B 2AC0A 5DS8A 4NUPA 4EN3D 1TSRA 1WEJH 3H42L 2HT4C 1E7VA 5IFJB 3SYPA 3BP6B 2FBOJ 2B7DT 1N0LA 2KZWA 5DUJA 3UBXB 1XEUA 1TYEB 3O45B 4D2NA 2IPUG 4PWHA 5LGYA 1FFPB 4JHUA 1P5VB 2GVYA 4MRCA 3S8GB 2NY2B 3FZUD 2ZX9A 1IJ9A 2B1AH 3WIHL 4ZTPH 4MCYA 2ARWA 1BG9A 1KN4L 1T1XB 4BK8A 1SOSA 3TO2A 4LBAA 1F00I 3LXUX 3GTVA 3EW3B 2C3XA 3GS7A 3QARA 5IW1A 1R17A 3O0RL 2C3HA 4ODTL 4OM1L 4E42A 2B3RA 5CP3H 1ZIAA 3IDYC 4JVPA 2CGRH 4FXGC 1J9TA 2VLRD 2WNKA 5ABAA 1TQCB 1WFOA 1R4XA 4JY5L 1B3JA 5EOQH 3F85A 3OR7A 1I31A 2WKOA 5DD0H 1J1XH 3A4EA 3W56A 2OTPA 3WI9A 4K8RL 2J5LC 3RGVA 1QO3B 4O4YH 3K72A 3TBTB 4HJ0C 4WI3A 1FI8C 4RMQA 5CNHA 3QIUD 4OJCA 5BQ7B 4KUCD 4ZFZA 5DWUL 1QEWB 3PUUA 3QIBC 4XBEH 3VXOA 1L9OA 3TPUA 1G6VK 1AQDA 5E9AA 4JW3A 3N0AA 2GHZA 2O72A 1PX3A 2HJKB 1NMAL 4OCWL 1H6EA 4EVNB 4M48H 3V9EA 1ESOA 4KDTC 4YHKL 1F6FB 5IJCC 1GGIL 2K70A 5D1ZB 4ONGL 1UM4L 1UKTA 4KBPA 3WO4C 1YHPA 4KTDL 4RAHA 5GGQL 1X7SA 3ZHFA 3EF4A 5E24E 1UVQB 3UZQB 4W9DC 3VXUB 2X10A 3PXLA 3D3VD 5GRUH 3PREA 4P06A 3EFFA 4UYPA 1RQ5A 3TZVA 3ZE2E 4NO3B 2H1XA 4DEUA 3UJJL 5D1ZD 2V7NB 4C83A 3G3LA 4GQ9L 1GHFL 2ZX6A 1KT2B 4QHPA 3UBHA 5AW5B 2O93L 2XRAL 1CGVA 5C0BA 4QOKB 2VSDA 3MGTB 2WIIB 4Y19E 4K3DH 5JPMA 5DO2C 4M5TA 3T2NH 2VDOL 5D5ME 3ZYJA 1OT2A 1U8PB 3M7FB 4MA8L 1QFHA 1FHGA 3Q06A 1QBLH 5DSCB 1JZ6A 3M1BB 1AGEA 3BE1H 3D30A 4UQCA 4FMFA 4PLKD 2H6PA 1WLHA 2Y5EA 4BJLA 2P48B 2ILLA 3H6JA 4OT1H 1CYGA 3DK2A 3LNGA 1N64L 3CZSA 3ULAB 3ALPA 2ZOUA 3WFBH 1BZDA 1MLCB 5AYUL 2BSEA 4GKSB 4LKXA 1HHHA 5IF0A 4D0DB 1JFQH 2FQEA 2NLJA 3ZMRA 4EI0A 1ZHNB 1A2YA 4J3VA 4MMZC 1N7MH 4EZMA 4OLVL 3W57A 1L0YA 3DVGB 5LBVA 3WEMA 5B7MA 1U2YA 1TJGH 2X9XA 2P8LA 3S5LB 3GJFA 1PG7W 1N5YH 3NACH 5DS2A 3EIFA 4WCYL 4L37A 1JPSL 4JCMA 2H0JA 3FRPB 1WWBX 3VDAA 4AL8H 4QDGA 1U8IB 1BBJB 2HVJA 4Z7QB 1PS3A 3VGAC 4MD0A 2ATAA 1NOFA 5EBWA 2ARJB 3CD4A 1B0GA 1OB1A 2ITDB 5I1IH 1AGBB 1BX2B 2WVVB 1KTLA 3ZYIA 1LWJA 1PG7L 1HZKA 4LLUB 1U8JA 3VWKD 5J12C 1I7UB 2IDQA 4TULH 4WTWA 3FU7A 4EN3B 4N2IA 3IXTA 2EC8A 2BCKA 2EIBA 3QO0B 3EBGA 1U8CA 2MCMA 5JHDE 5HGHA 5IVNA 4H1LA 2OMVA 3S3DB 1E90A 4F33B 1PIFA 3QWNA 2OR8A 2XQBH 1FZKB 4R26L 2J6EA 4IMKC 3Q6GL 3WOVA 3MRLB 4Y16D 1EBPA 3T5WA 2XQYK 4B53A 2WJ5A 3V6FB 3KL5A 4HIEB 5IZ7A 3WJLC 3R7RA 4PJDA 3TV8A 5EBLA 1KTDB 4LMQI 2DQDL 4Y5YB 3V5DB 2GIMA 1J9CT 3FT9A 1EHNA 3LH9A 4Z3JA 5KVFH 2ZAGA 5DJ0A 2ZWNA 2ADIA 2X4QB 2ICEC 1ETJA 3A23A 5E94B 1L6ZA 4Q52A 1BEYL 4AJWA 4NRZA 1SM3L 1MAKA 3EHBC 5CD3B 2EE0A 4WGKA 4Y2DD 1YDPB 3JTTA 1X5YA 2DMGA 4N0FB 3NIGB 5CBAB 2I26N 4I0PB 4M5SA 4OUUA 5IY5B 2N0MA 1MWAA 1ZSHA 2MCPH 1LTXA 1DBAL 3DUHA 3V0WL 4N2GA 1HINH 4NRXA 1VIWA 2CMRL 5IWLC 3VFWA 2D7OA 4PWEA 2ATKA 2E56A 5F2FA 4WNSA 2CBMA 3BP7B 1CQKA 5ECGA 4KAQL 4U0QB 4WI9A 4JK0D 1S3RA 3ARSA 4FP8H 1MDAA 3WLWC 1SJHB 1IM3A 4GEJA 3H9SE 1VERA 5IBLC 3QNYA 3S6CA 5AVYB 4I48A 4S1SH 5AAWC 3D9AH 4MNQB 1MFCL 4BFEA 1XBRA 3TT3H 5KUKA 3FU8A 3S35H 2GUYA 4X7CC 1F4WL 1HKLH 4KTEL 5IW6A 4ES9A 1JNLL 4GRWE 4PJGB 1GTFA 4R3SA 3PQYD 1WF5A 4OZGB 1X9RA 3TYGH 1KYUA 4IKLA 4E0RA 4OCRL 2BM3A 1WAAA 3QEHA 3G9VA 3CPLA 3QI9D 3RWCB 3VE0A 4K7PX 1LO3H 4LGSB 3ZT7A 3BI9X 5F0MB 3NESA 4PJ7E 3CFDA 4L4VD 3MYJB 1W8OA 2VYRE 1T3FB 1T2QH 3HI1A 3SKMB 2HVBA 4I3RL 1Q9OA 1GZHC 2IBGA 4MGXA 4XNBA 2LU4A 5J12B 4G8AC 1A8ZA 4XPHH 2QT6A 3LD8B 4PB0L 4L3CA 3NGBB 1G6RL 3G5ZB 3QNXA 4HS6B 4KRPB 3AY4C 4X4ZA 3CXHJ 1DJGA 1I1YA 4Y5VA 43CAA 4BCXA 3UTTE 1WEJL 1U9KA 4ZTEA 3GSUA 3FQTA 3BAIA 1INEH 4LCIL 4JFFB 5EV7A 3FN0H 4OIIL 4WFED 1IILE 3V8OA 4MCNA 3RG1C 1WFIA 5E2TH 2QQLL 4N8CL 4P2RB 5C0AB 2YD1A 1VZGA 4PWFA 5HJ3A 3HE6A 3UAEA 5C8JB 4KZEH 4ZJ9A 2FX7L 3TO4D 1RUKH 4N5EC 2DQEL 4D0CB 3EGXA 4PRDB 3VD4A 1Z9SB 3BPOB 1J5OH 3SO5A 3PGCA 1G9HA 4WNQB 4UB0L 2RD0A 5BW7C 2WBJC 4PJAA 4NQDD 4Z7OB 1JF5A 1MHCA 5L4FA 4NUGL 1NDGA 1RU9H 2R69L 1BZEA 2Y2YA 3QUHA 4LSTH 4RDQG 5HJBA 3W11D 2OI9C 4TOYL 4UBDC 3I2CL 4NXKA 4XMZA 5CSBA 4PJXB 3F05A 1WC7A 3QE5A 3VFSB 5C97A 5D4IA 4EQ3A 5KW9L 1QVOB 1JNLH 1O9WA 1VGKA 3QI9A 1G0YR 1KBGL 2JIXB 4WSKA 2VL5A 4K3EH 2DTMH 1URIA 5IP4A 1B4JL 2LAGB 1OCCB 1MFCH 3ARGC 2ZG1A 5FO8A 3D09A 5DVMA 2ESVB 3MV8D 4HJUA 5ICYB 4ZPTA 2K3TA 4JG5A 5K9JH 3MRQB 2YD0A 3FZUC 3L54A 5LKNA 2V2WB 4NNXB 4TQIA 3DUUA 1AXSA 2H0PA 1RULL 3IE4A 4P5TB 4PSRA 5FDWB 4PWJA 5A16A 4XVJH 1T4KA 2QSTA 3ABGA 3HHMA 4D8PA 5I1GL 1FNEB 3E3QC 1P5UA 4AW7A 1AR1B 3P2DA 3V7AG 2LABA 3C60B 1ZDQA 2EXWC 2NX5E 2CKNA 1CXLA 5KN5B 3OKLA 5J8OA 3BAYA 3GRWA 1AGEB 1IBGH 4OKVA 2AK4E 5BS0B 2PPAA 3T71A 3UGUA 3ZR5A 1RZIB 3DV6A 5FUZH 1HCFX 5I8OH 4ZOCA 3ULSB 1CFVL 2A74B 3E80A 2I24N 2NXYB 4KH2A 4KK5D 4H8WH 2Q20A 2BK8A 4YS4A 3FQ4A 4QHUA 2EXWD 4XNMA 2PNDA 2K8MA 1HCZA 2F8OA 3KPMB 1LMIA 1KC5H 4KROB 4G8GD 4OGXL 1QSFE 1GRWA 1RIVH 1BBDH 3RDJA 3QDGD 2F5BL 3UX9B 1L7IL 1YNKL 3EJYC 4XX1G 3TZVB 1EFQA 2AQ2A 4UM8B 2G5BB 3B7TA 3O6LL 2DBLL 1I7ZB 3P4MA 1RUPL 3J2PA 4LOUD 2DJSA 1SN2A 4PJ8A 2PYFB 1X5XA 2X05A 1F56A 3HRPA 3S36H 2PLTA 1C7TA 4N2AA 4PHXA 4PJ8C 3VJ6A 4E5XA 1JNJA 1RLBA 1B4JH 3LSOB 3TPKA 2R9HD 3FMGH 4LEBA 4RGNC 5GS1B 1P7BA 1SMOA 4L4JA 4O5LH 3W0WB 2RCSL 3EDEA 1NAKH 3F7PC 1EHKB 2E6PA 4WEEA 3VVWA 2NXYC 1CGYA 1AZVA 3KPSB 1P69B 2SEBA 1I1AC 1AQDB 2C4FT 4M7LT 2AZAA 3F7RA 5IBLD 3V9CA 3UBXA 3ARDA 4AL8L 1ES0A 2X38A 5D1XA 3QIWC 4ZUWA 7TAAA 2J1YA 3O6LH 2OMTA 5HI4D 2QKIB 5EBLB 3A21A 1MI5A 3MV7B 3QQNA 1SOXA 2OK0H 2CGZA 3QG7L 4PP2A 1Z5LA 2W91A 3GSRB 3IN2A 3MRLA 3T2OA 4GW4B 3SDDA 1XGRB 4OGXH 4I1RA 4H8VA 2KPNA 1Y1UA 2IADA 3MODH 3MDJA 1AY1L 4N4YB 4XO9A 1YNLH 3TH3T 4GBXD 5T1DH 3QDMA 4HKJA 1RZFH 1FZOA 4YSRA 3GMRA 1AO7A 1KIUA 2XU9A 3NIDB 3OKKB 4JKWA 3AB0B 3DOSB 2F18A 4NQSA 1OXYA 2EDKA 5J1AB 5CS7A 1A5FH 4V33A 3HPJB 2HTLC 3QEGH 4IEFB 3W81A 5FHAL 1HI6B 3O8XA 4HEPA 1DL7L 1KB9J 3SD2A 3HG1A 4L9LA 1I1YB 3NJIA 5FO9B 3HW7A 4OF8A 3BSZH 4TSAH 4XMLL 4DKFL 1MJ7L 5EUKB 4W9JC 3GO1H 1YMHB 3LKOB 3N85H 4OD2A 5C2UB 1N18A 1BQKA 2EUVA 3UJJH 5DFTA 5C0BD 1FBIL 5L4IA 1A8JH 4XCYA 5KSVB 4BHUA 5EOCH 5FS5A 1H15A 2WKOF 4DKTA 1HAWA 2UWEE 1LO3L 3DVNA 5IBTL 2DI9A 3TA3B 3K4AA 4BHUI 4K3HA 3CFKA 4IOIA 4QTHB 5MENB 3MFFA 4ZW8A 2QBWA 4IKNA 1YNTB 1UM4H 2IO5A 3OZ9H 4NKOA 1T66D 1HKLL 3UAJC 5D7JC 3HKZA 3SYAA 1MHEB 1KBBA 4EIGB 5F3BA 1D2OA 4HKXA 3V6BR 2QDVA 2BWIA 4HIPA 3DX9B 3WS6A 4BIKA 5JXEA 3B9KC 3DHPA 4Y16C 4JZJC 1OF0A 1ETA1 4N9OB 1EAPA 3DHJA 32C2B 4IGBC 3GIVA 4Z8FH 5AD0A 3EFDH 4TYUA 1A02N 4ABQA 1WBXB 1ORQB 1I7RA 5FGBC 1GMEA 4J8RA 5JHLH 2XVGA 4H5SA 5D6DA 3RVWD 3NJLA 4I0PA 1HL5A 3N9GL 3BMVA 1NFDB 4GW5A 5C07D 1NCTA 4G5AA 3NEOA 1OARH 3ZL1A 4EF3A 3B3IB 3QUXD 2GCYB 1HXYA 4XHQA 1NIAA 3T04D 3NCBB 4XCEB 4UILH 2QMJA 3NSDA 3TNMB 2F5AL 4NDMA 1INEL 2AERT 3HC3L 4TQEL 3MCKB 3GDBA 3BLPX 4HJGB 4MNGB 5KYXB 4NJ9H 5EOTB 3ROOB 1PLGH 4EUPB 2ZJSL 3U0WL 3WTSA 3NZ8A 5IQ7L 4JDVA 4QYOB 4X9GA 3V0GA 3CFJB 1L6PA 3QG7H 1UTDA 5C09E 1T2XA 3VRIB 2ZKWA 2ZUXA 2BHFA 4PUBH 3L7EA 1F90L 2PP7A 5H2BB 1B6UA 4BWTA 2D9CA 2VE6A 4UINH 3B34A 2GYSA 2XDHA 1OAQH 3HHSA 5TQ2L 3AG2B 3O4LA 4Z7NB 4YHNB 4AC4A 3BGMB 1B0RB 1IAII 1K5NA 4EN3A 3JSSA 4TQ8A 5CILL 2NW2A 3SPJA 2Z4QA 3BC9A 2Q2LA 4O5LL 5DO8A 4AENA 2XTJD 2CK0H 4OB5L 3U6RB 4TUUA 4YSPA 5MEOB 2RGSA 1IKFL 1EHLH 1QHOA 1HOCA 5ESVA 4A6YH 2GC7C 1HILB 2VH5L 1R33A 4C54A 2FZ3B 3VX1A 1LO0L 3UBXI 3U4EA 3ULUL 5HHPB 3VD5A 5C2BL 2I07B 4EJ1C 1BD2A 1EK3A 5IB1A 2J8UA 3N43F 3BX7C 5IEKB 3GEFA 4PJ5B 1S3KH 4GW1A 1CBVL 2NZ9D 3HHSB 4NZUL 4WFHD 1RH8A 4J6IA 4QF1B 3SKJL 4QY8A 1JPGA 1GXEA 2W07B 4KC3B 4TS6A 3QCUL 2Q10A 2P5ED 2ICCA 3FUKA 5IW3A 4HIHA 4GKSA 2YJQA 3MRKB 3FUMA 4MXVE 4Y19D 4L9LC 5JLZA 4G9FA 5EZPA 4M93B 4Z7VA 3QORB 3C6LB 4H0LC 3E1F1 1JZGA 1J1PL 1LO2L 1BEYH 1U91B 3FRUB 4WFEE 4CW1A 1NBYB 2J71A 3QUXC 3F83A 2NDGA 3I9IA 2DI8A 4XMKH 2PYED 3R0NA 3N41F 1UJTA 2XXCB 4XZ4A 1RZ8B 1SXCA 2DQDH 2GBVA 5DJ6B 3FOLB 3IFNH 2MSPA 3MLWL 2PP8A 5EPMA 5C0RH 4DNLA 1NANH 3BWUF 3ME0B 2EE9A 1JZ8A 1SY6L 2UXFA 3I84A 5TH2A 3T65B 3UYPB 3VD0A 4G2AA 4LPTA 4FG6D 4JHBA 1C7SA 4LCCA 2BNRE 4OBRA 3FN3A 5KVEH 4UV4H 5H4YA 4BSWB 5D1XC 1M4KA 4JKKA 3TA4D 4Q89A 2EP6A 4KI5F 1D5MB 1HQRA 3ARGD 4YDJB 3IMUA 4G6AC 3QWOA 4Z7UF 3FUNA 3R4RA 5KBKA 2IAMC 4H8PA 3VM5A 3MLZH 3QJUB 1DO5A 2CDEA 2P42B 2COVD 4J7RA 2B4CH 2R1WB 1BWWA 3SYQA 1JK9A 4AGLA 3NTCH 4JFHD 5JOFB 3PWPD 1JI1A 3VFMA 2FEDC 3E7JA 3Q2VA 4GG6F 1T89C 8CGTA 5H4ZA 4FXKA 1IEBB 1OCRB 4FERA 1YEKL 2YO3A 2BSSB 2Z7ZA 4JFVA 3S88L 3HFFA 1EUUA 4PWGA 1LK2A 1A1OA 3MBEB 1TVBA 4O2FA 4EI6B 4YSAA 5KVGL 4YE0A 3Q2CA 2LT9A 4ZFOB 1RFDH 1J5OL 2QFRA 3NJFA 1TT6A 3S35X 5DFWH 3UTZA 4AQOA 1IKFH 2JCCE 2VDMB 4ENZA 1M57B 5CGYD 15C8L 1KCBA 3C5JA 3IYLW 3QUYB 3TVMD 3HFMH 4AQZA 4ADJA 3WFEL 4EPSA 4HIHB 1YPZB 2Q7YB 2WUCL 2ZYRA 4IGBD 4N2BA 2XWBB 2VC2B 4PRHE 1AI1L 3QJZA 2XBTA 3S0PA 3MA9H 4PCYA 4BSVB 2BRRL 2XV3A 1USZA 5HDWA 4FLHA 4NKIH 4R83A 3EYUH 3HN3A 4MCYB 5T3ZH 4K5MA 4BRJA 1FAKT 3DOSA 3AQDA 1CLYL 3QSKB 4X5QA 2EIZA 2IALB 3ARQA 2GITB 1P6AB 3PYCA 5E1QA 2E7BA 4I9WE 3W2DL 3PABA 3Q5YA 3VI4A 1NMBL 2GUOA 2ZCKL 2NRDA 3KJ4C 4Q74A 1JVOA 1A9EB 2XY1A 1SBSL 2P49B 1LP9B 4KKCD 4O51A 1SLWA 2OMTB 3CIAA 4Y1AB 1FO0H 2E8YA 1AXTH 1BXVA 2WBJD 4UT9L 3VI4B 4X4YA 2ZP0T 1W91A 4N0YH 5E0FA 5HYFA 4UOW0 1Q4NX 4R7NB 4ETQB 1DR9A 2IALA 3GZPA 4IRSA 1CFMA 3B9EA 2TAAA 5FW8A 15C8H 2VCOA 1YUKB 3MRIB 4NZRL 1NLBL 5EHFA 1N4XH 2X1PA 4L8SA 3V5HA 3BZDA 3QH3B 3RPIA 3L6FA 2AI0H 4ODHH 5K59E 2DMBA 3ALXA 1A7RH 2AXJA 2DWEB 1NAMH 3MCG1 4H5SB 5BZZA 5MI0C 5B8CA 1NBVH 1EJ8A 3FQNB 1R3LA 3ARFC 5CJOH 1EAJA 4WEUD 5DUPL 5F6IB 1HFUA 3V7AE 1KGWA 2IVFC 1JPFB 4DGUA 2J6EH 1QG3A 2UWEF 2EIEA 4K94H 1CE1H 3GSQA 2Y7OA 4HBCL 1JXFA 4XMVA 4K9EH 1E8WA 3CZJA 1RJCA 3QC5X 3VCLB 1EHAA 2BIMA 1YECL 2NSXA 3ZPDA 3MUJA 3OR6A 4OJYA 3FULA 5CGYC 3VSUA 3ESNA 4M61A 2P8MA 1BZ7B 4OZ4B 3BHBB 3AQXA 3O4LE 4YHMH 3TFBA 2VW4A 3RTQA 2K9UA 1KN4H 1FYTB 3QDAA 1ZHKB 1QLEL 3L5XH 1FNGA 1XGUB 1D5IH 3O6MH 1AZUA 3KYKH 4H8UA 4OJDH 2IMNA 3N04A 3D3VE 2BVYA 3FW6A 1UACL 4WW2B 5E5MB 1QRNA 1MI5E 2DQCL 3LIZH 4JFYA 5T3ZE 2AXWA 1MVFA 3KPLB 2EDXA 4ICXA 3X12A 2B59B 1AXSB 1LDSA 1YMMB 3FU6A 3PWLB 4PJ7A 4RCAA 1GS8A 1CCZA 1VSCA 2X4SB 5BOJA 1G6RB 1OTTC 2XIIA 3FO2A 1PDKA 3K8KA 4F7CB 1JGVL 3UROR 1MQKH 2YHGA 1VZHA 2PO6A 1EQWA 2CXKA 4XP1L 4BK5C 3P3YA 3KLAA 4P2QE 5HHXL 1ZTXL 1KGYE 2QMKA 1E9QB 4XP9L 2EADA 1GGUA 1MJJB 4HS6A 5F9JA 3O6KH 4NO0D 3L13A 5B7FA 3M8OH 4YVNA 1Q9OB 3FC8A 1XF2B 1FIEA 1XF3B 4PJBE 5BS0D 3ULUH 5FO7B 4Z7WE 1OF2A 2DQIL 5E2WH 4A6YL 4XH2B 2EDMA 5H94B 3T4YA 1WAAF 1HEHC 1FDLH 1U95B 4AM0B 4DZ8B 3N1PC 2RIKA 5I1AA 2RAMA 3HVDA 4GNKB 4JEGB 4M93C 1MUJA 1TMQA 2PR9A 5KUMA 2ZOTA 1V8HA 1E4XL 2BFVH 5JW3L 5SWQB 2XN9E 4GBXC 1Z9OA 5E03A 1NIFA 2APXA 2A99A 1TETH 4ZUVB 3T2NL 1J05A 4HDIA 1AGCB 5CFAA 4AQ1C 3QEUB 2XRAH 3CIQA 1WAEA 2L7JA 3AROA 1ACXA 2CIIB 5AALA 5E9DB 2ZOWA 1AP2A 4FQ1L 2WTOA 1I7TB 1R3JB 5ICZB 5D5MF 5JR1H 3K46A 3BEVB 3FSAA 3N44B 4NEHB 4QAMB 5E8PA 4LSUH 3RGVC 1JD9A 3LRKA 3K5SA 1W2KT 3MJWA 1LM8V 2WQAA 5KZCD 1R1CA 3V0IA 4F1SA 5KTEH 1WGOA 1KCKA 1M6OA 1S78C 4N20A 1A4KA 2IFFL 3B2XA 5DEZA 4TUJA 3SQOL 2VLKE 1IE5A 3BQVA 5EFIB 1QFWH 2OYPA 2CHXA 2B9BA 3EXJA 5DEGB 3SDXF 4TTDC 5L2KA 2G9HA 3NP3A 4PREA 2IAMD 1FL5B 3TOPA 3DECA 3QHTC 2BVPB 5AVWB 2MOGA 3S97C 5BPPA 4HQQL 1GMIA 4FLRA 3EYFB 1L7TL 4Y5YA 3V5DA 2NQCA 1AGDB 1G7QA 3HTLX 1UM5H 4AVKA 1TJXA 3M88A 4NGHH 4M62H 5DEGA 1WH0A 5DZVA 3VG9B 3BKJL 1JF6A 1QA9B 4LCWB 1KCRH 2EC9T 1LEKA 3OJVC 5IB4B 3ZLQC 1JRHI 1XIWC 3LZFH 4AE1A 4Y2LA 1FIGH 3VH8B 3HG1D 1OQOA 3C75A 1S9WB 4WDIB 4OGAC 2COQA 5GSRB 2IQ9L 3JTSA 3LKNB 2P45B 3H9SD 2CHDA 5IUCA 1TVHB 2EDYA 2FDBP 4G7RB 4M02A 3FCBA 5ABZA 1LJMA 1WT5A 4TOYH 1T5XB 3F7YA 2W9LA 1IEAB 4PRPB 3PRZA 2X6UA 3MBXL 1DVUA 3KLHC 1DQLH 1H3WM 2DEXX 3BUBA 1ZANL 2J6WA 2VLRE 4CC4C 1BZQK 5BRZA 4RMSA 3ECUA 4MMXB 3VXNA 2IBBA 1UA3A 1GYCA 2H32A 3DOHA 3WY4A 4XT1C 4FOMA 4ALAC 1OAYH 5EEYA 5AAWA 4QRTA 3H42H 4Q4EA 1D7BA 1XH1A 3TT1H 4N6RA 3UZVA 4M7JL 5I1EL 2AQ3A 5GGVH 2FWOB 3SQBA 2IH1A 2YD2A 4XVUD 5FHAH 5T1MA 1FSKB 3MLUL 2WN3A 1Z2KA 1ASPA 1CQYA 2XWDA 1A6TB 1IEHA 1E4XI 2FX8L 1YG9A 4GQQA 3TCTA 4XGZB 2JTYA 3P54A 3GJEB 3F7YB 4AITA 2IPKB 3KYOB 4XWGL 1E28B 1A14L 3L1FA 2R29L 3QNXB 4G7YH 4QXTA 1XGZA 5BUPA 2V9UA 1UM5L 4PJ8D 4BK5A 3BKMH 3KHOA 2XTJC 3QZNA 4Y2DB 3ZMNA 1DVQA 2OK0L 4NBZB 5DJZB 2CBQA 1JJUA 4UNIA 5D6CB 3HI6L 4FABL 1IT9H 4ZAKD 4OLZL 4HOMA 1DUYB 5EN3A 5IR1A 4PRBA 4JREB 5CJQL 2CKBL 2K6WA 1LLAA 3VCLA 3KLKA 1UADC 1UOVA 4EE2A 5JOPD 1WYJA 3WKML 4TVPD 4LCWA 1JHTA 3KS0J 5F93C 4FXKC 2C9AA 2P7TA 1MCPH 3GHPA 4JFDB 4BZ2L 1R19A 4CA4A 1NCNA 2DQJH 3PL6B 3CFCH 4IYKA 4LSUL 1A4BA 4W4OC 2ZYSA 4J2QA 3VG9C 3PIQB 4WDIA 4WFFD 4NQCA 4XVSH 1JNNL 2EJ1A 1EJOL 5TE6L 1J0IA 2RR3A 2HKHH 2XG4B 1JZIA 2NMSA 2ROYA 3GQFA 4MSWA 3SGJC 2CA3A 1FNGB 4K5NA 4X0KA 1NFIB 2YAPA 4IRSC 2L04A 5J6GB 1QI3A 4XCCL 5AWNL 3IFPB 3US9A 4W6XB 3HG0A 1V54B 5J13B 5D7LE 2MTAA 4HIXH 3QUMA 1A3ZA 1CDIA 3MRRB 2Q7AA 2M83A 2EVJA 3LN4A 5IUSA 1G94A 1TZGL 2VMDA 4H26B 3UJIH 4UIMB 3MLYH 3P0GB 3CH8A 2W92A 12E8H 4W6WB 1UZGA 1II4E 1WG3A 4ZI8A 4X6CA 4XNUL 5HVHC 2EE2A 5GIRA 1NGWA 1BAFH 2Y7QB 4QUOA 3OPZH 3WKMH 2P24A 2W9DL 3RWDA 4YHPB 2UUDK 4XCFL 2AV7B 1YVLA 1B9KA 2DYPB 3ELQA 4QHLA 4FLSA 5AZEL 3RGVD 4HLZG 1CIDA 2JKWA 3CUPA 1IT9L 4PY8J 5J6GA 3HI6H 1TITA 4U1KA 1XGTB 2Y2WA 3D7PA 2APVA 2CNZA 2ZCLH 4QTFA 4ZXBA 1FZKA 3RZCA 1Y6KR 2IWEA 2HJKA 1B0IA 1P1ZA 1ZLEA 1BVLB 4RMVA 4OM0H 2PCXA 4ZSOB 3WFDL 2X1WL 3CLEH 5JHAA 4ZW3A 1MWOA 5I16B 1EO8H 4P23D 4BH7B 1A9VA 2Y6SC 3WSQH 5MEOA 3NYKA 3UC0H 4GKLA 1I1AA 3WNOA 4QOKD 4WWID 5EEWA 1X7QA 4NAQA 3S5LG 4X6DF 1CFSA 1LXMA 1SYSA 3ETTA 3VDBA 3MOBL 2C9UA 4LPYA 2ZQKA 1Q90A 1JZHA 4E41A 2K9FB 2XFXB 4ZPTB 5CEZD 1MPAH 4OI9A 1QBBA 3DHUA 1TEYA 5DC4B 4YJZL 3FU0A 3FO1A 4HXAH 2HRHA 3B2VL 4KVNH 4LHUB 3ESOA 3SKOB 3VXUD 2VLJE 1N5YL 2VW6A 4JO3L 5M95B 2YAFA 3QO0A 4DVRL 2J5WA 4KKLC 4YVUA 3T0AA 1HHIA 1U8QB 5E00B 3AABA 2BIPA 2OQJB 3WUWG 3DJSA 1DO6A 1ZWIB 5GS0D 1WO2A 3V0HA 1AYOA 4RGNE 2K6ZA 3RNQB 5T1LD 1V7ML 3L3HA 4NT6B 4PJEF 4TUOB 3GXPA 4ODSL 3PHQA 2CO6B 1QFUL 4YSCA 4IRZA 3HR5A 3BWZA 5EIIB 5B39G 1DSFH 1BF5A 3LQMA 1PVHA 3OSKA 4FZ8H 4PP1C 1KIRB 1DLHA 4NNPL 4P57A 4XNZB 1OL0A 1NBVL 2A4EA 3UTPE 4W9ZA 3X1GA 2XXGA 4APQD 5JDSA 1A7RL 4M5ZL 5J1TC 3BPOC 4JPKL 4JX0A 3L4ZA 2FSEB 1U3HC 3OAYH 2VSMB 2VLRB 2MCG1 1HH9B 3FQTB 2R1WA 5IIEB 4WV1A 1H3PL 2BNRD 4PYGA 2H7WA 2HLEB 2PR4H 2A6JA 4PRPE 1KJMB 5CJBA 4YBQD 4OCRH 3VW3H 2UZPA 5C0BE 1ET7A 4MQXD 3UTSE 1LDPH 3BSHA 3C6SA 3DO7B 4P57B 1U4EA 3AXIA 1NCOA 3HBGA 4JM2B 5KTEL 3EH5B 1KZQA 5D7SH 2HTKD 4RAUA 1XSKA 4IRJD 5DJ8A 4JPWH 3EG9B 2E6QA 1CD8A 4HEMA 5D93B 4JZOA 2WANA 1E5UI 5IHZB 1SHMA 2I9LB 4OD1L 5F7YC 1KDIA 1M7DB 3S34H 2WXLA 3T0EB 3UPRA 2C9QA 3CN0A 4PJGA 2K4WA 4KAQH 5TF1H 2LFEA 4JFQA 4UTCA 4CVWA 4ZFQA 4KX8A 3ETSA 1K4CA 3KVPA 1HOCB 4YBLC 5ESVB 1NAMA 1GGBL 1NM9A 4U1MA 5HHNA 1DQMH 2MTPA 3D18A 3OAYK 2BRRH 2GEEA 4R8WL 5T1KD 5I8EA 2DQFB 5EC1A 3CQFA 3L2MA 3P02A 4NFCA 4UQ9A 1E6JH 1INQB 5K9OA 2R8SH 2X7LA 2SODB 5KYYB 1Y1DA 1TPXB 3L3GB 3RILA 1YAZA 2YXMA 3T9WA 4DWHA 3E8VA 2NUPB 3DV4B 4DVBA 4HS8H 4EDWH 3NCMA 2W88A 3B1UA 4KU1A 2R4RH 2VQ4A 3TBWB 2ICWI 2DQIH 5E2WL 4POZD 4RRPA 1WIUA 4F93B 2FBRA 3IFOB 2GI0A 1EZLA 2YAOA 5EU4A 1NUNB 1RFDL 2A9BA 3SDDB 3NK3A 1TTGA 1D6VL 2VGLM 1J48A 5ICZA 4K55A 4KHXL 4RGMB 3EDJA 1TLKA 1ZPUA 4PG9A 5BZWA 2YBGA 1UJ3B 3UTOA 2FNBA 3VW3L 4OCYL 1W6LA 5DRNB 2HRPL 2NX5A 2DTSA 4MAZA 4Q7DA 5T5FL 2NTFB 4YAQB 4PTTB 1UQSA 2IGFL 2OZNA 3BAKA 2JKXA 4HJ0D 3F5WB 1HCYA 1CE6A 1XHHA 2VABB 3O3AB 3FT3B 2OXHB 3EHBB 3S4SA 4URKA 4KVCL 1PCXA 1T0MB 2XN9B 3KCPB 5T3XD 3NIFE 5C0EB 3BXNB 3QIWA 4L1BA 4KK9C 4TVUA 5F88B 5I1AB 4G6FD 1NFDA 4W9FC 1OOAA 1SDDA 5C0CB 2V0AA 3WE1A 3MRNA 4IBZA 4QHLB 2R0WL 2WAHA 3O2DA 2Q1EA 3KVDD 3MOAL 4UQEA 4LSPH 3PU7A 4KJPC 3GB7B 5HDBF 2YOAA 2H2SC 2X9YA 4Z7WB 2A9DA 4IBYA 1RXLA 4HGKC 4PJBB 3CFJA 1XCTB 3LPOA 3GSVB 1SN5A 5GJSH 1OE2A 2PXYB 2ARJQ 5L4JA 2FJFB 4WCYH 3GI8L 4JGUA 4AMXA 4EIZC 3BH8B 4KHXH 1XF1A 4YSDA 5JDSB 1ILSA 4P9MH 4P2QB 2OMXB 1CZ8H 4JFQB 4IJ3B 3B9KB 1CJYA 2GJ6E 2C7UB 2AQPA 2FAUA 4U49A 4P4RB 4L8CB 4HS8L 4EDWL 3DX3A 4L29B 3TBCA 2WYIA 4HV8A 4PN6A 4X6DA 2Z64C 3ZIYA 5HDRA 5GGRB 4Q8BA 3CXFA 3TP4A 4J8RB 1NCHA 1QFPA 4MJIE 5CR8A 4ZMYA 2DD8H 2QQNH 3SDCB 4PJCF 2W0FB 3WNJA 5E4OA 3L3HB 3FYIB 4UIKL 1JXKA 1BFOB 4DUWA 4WUUE 4C56A 5KBDA 4JFXA 1A3QA 3ETBF 5DUPH 1TEGA 1C12B 1VAHA 1I8AA 2XPZA 5FKPB 4Z77B 1XTMA 1A4JB 1S9XB 3UAJA 4ZMQA 5KEZA 1QWNA 3SOBH 4EUPH 5JLZB 2HN7A 1OGSA 4JFPA 3M46A 1NLBH 4DETA 4AIZB 2ZF8A 3APNA 3MFFB 1J8HD 1UFGA 3T1FB 3T3PB 4X7DC 4G43A 1MG2C 2W07A 3H9YA 2JKTM 3MRDB 2AJXL 4IMLA 5I18H 3P3TA 2H6OA 5HGAA 3SE8L 2DJ4A 2OXGB 4X6CF 5IVXB 2VM9A 2UXTA 1OP5H 2MPAH 3DJ9A 3G5VA 4QHNA 1C08A 1U91A 3KPRA 4MQ7A 4Q2ZA 3P9WB 2CLRA 3K74B 4EOWH 5T5FH 4Z1PA 4HKZB 2OW6A 3T2LA 5TFSH 5JO5A 3IF1A 5C0IB 3L1EA 4ODWB 2IGLA 2UZXB 4LE8A 4RGOH 1KYOJ 4O9HL 5DJAB 3EH3B 1Y07A 4Y4KB 4JB9H 4OD3H 1A3RH 3U0WH 3MLSL 3QCVH 4UOJA 4ALAH 1JK8B 3VXRB 3FO1B 4CVZB 5SWSA 1J7VR 3F5WA 5D1QB 2L7UA 3MNVA 5JPNA 3RVVD 2YARA 2ZAIA 3TWCH 1E4WH 2JQZA 3WHXA 5I15H 2Q76B 2BNQD 4JAMA 4U1NA 4Y1AE 5FB8A 2BXYA 2X41A 2WJ7A 1WP6A 1BLIA 4JUTA 4XNXH 1I1AB 1LP9E 1XGQB 5DRXB 4OJEH 3SPIA 3HB3C 4U1JB 1IX2A 3DTDA 2VMFA 4NQCE 3ILPA 1QWHA 4XODA 1BMZA 3QPKA 1C9SA 3EFOB 3HKFA 3QFJA 2BP3A 4A04A 2F6AA 3CHRA 2VDQL 2EH8H 1CICD 3OL2A 4QXWA 4QCIB 5D96B 2GEQA 3CFIC 1NSNL 2FGZA 3VE0B 1GZQA 4YDKH 2NY1D 1ILUA 3RX8A 1U3HD 4DT2A 1GYAA 2DEYX 5DLLA 1PF3A 3VFPA 4A39A 2VRKA 1TCMA 3GBDA 3ROOA 1KDJA 4M8RA 1ZT4B 3QS3A 1I8MA 5DD3L 1YPZE 2E9JA 2NTFA 4YAQA 1PZCA 4PJAE 3QPQC 1OW0A 3L9RB 5EOCL 2X1OA 4XZUA 1VA9A 3A6BL 1U8HA 4NGHL 1ZV9A 5EULV 3BP7A 4HJJL 4Q4IA 2V3DA 5I73C 3BVXA 3ZTJH 3V0JA 3T3MB 1DVFC 2ZOKA 3VRJA 3ZYZA 4S0HA 2VQUA 4PIBA 3HB3B 5HYJB 2Z31D 4X6BA 4A38A 1W72L 1L9TA 1XCWA 1SY6H 5TE7L 3RWIB 3VYNA 1GR7A 1I4FA 4TLTA 1Z7JA 3TJHC 5A2LH 2W9EH 2QQNL 3MV9E 3QWRD 5TD4A 3MJ8B 1GPOL 3U9UB 3MRCA 1GW6A 3ZRSA 4LEXH 2R83A 5CMAB 2CRZA 2BVQB 2GTZA 4B97A 1HH6B 4MXWH 3VWJB 1HH9A 2ADIB 5KVDL 2YN3A 4CADB 12E8L 4M7ZC 5F7EH 2P3YA 2FYYA 4KI5E 4C4UA 3IAGC 2DLIA 2HFTA 1E5BA 5F3HA 3WEXB 3CFTA 4HSQA 1ZAGA 1OM3H 1BAWA 4PVLA 3X3GH 2YSSA 4D9RE 2XWEA 3I9GL 2M1KA 1H15B 1U95A 4AM0A 4Z5RB 2F53D 5HBBA 2I25N 2FO4A 4WUKL 3MO1A 4QXVA 2AITA 3LNIA 3K71B 4NQUA 1WHPA 1KIUB 4J3UA 4YBQC 2ISDA 1KEML 4ZFGL 3FQYA 3CZGA 1MELA 4JFFA 1WE5A 2QZ5A 4HUXB 1H6TA 4PV8B 4JFTA 3MNDA 3DPBA 3VH8G 1KXQA 1DUZA 2DMKA 5JW4N 2W0LA 5K9KA 5E9NA 3W38A 5DQDH 4WTZG 1FGVL 1T1ZB 4WFHE 3MRBA 2B2XL 2C8NA 3TNNA 4ZZKA 2W38A 3KLAB 3OB8A 2VDLB 1IC1A 1KJ3L 1JTOA 2VZOA 1BYNA 4GB9A 5MEQB 1ETZA 1AHWC 5LVEA 1TTBA 3WTTA 1IGTB 1TU2B 1IC7L 2G5RA 2BSTB 3OAUL 1QZNA 3EH4B 3QYCA 1TFHA 2FLRT 5CIPB 3MRPB 3QXAB 2J8UF 2ZX7A 3DROA 4FABH 1INDH 1PJWA 2DRUA 3CDZB 5MI0B 4OSUH 3DBXB 4IGBA 1BBDL 4AW4A 4WWKB 1NWOA 4A7GA 3G5XB 1DVYA 3II2A 1MH5A 3NIDF 4OLXL 2OSWA 2ZX8A 2R1YB 2ZWLT 2BVTA 4WW2A 2Z8SA 1RUML 5EA0H 5FUOL 2AQRA 1LEIA 2BSED 1XD1A 5DRNA 5DZLA 2BVQA 3PQYE 1RK1A 2GTWA 1KJ2B 2O6DA 4J6RH 1NICA 3GSNH 3MV9B 2UY7B 5AVSB 1IBGL 1BPVA 3RAJL 4LCUA 4YEFA 3K6NA 3RTQB 1OGAE 3QDGA 3T4AA 2XVKA 4Z7NE 2G60H 4ZXBD 4LIQE 4AIEA 3RZCD 3WKYA 4XNYL 3FT2B 1EGJH 2KDYA 2W65A 1KN2H 5I2IA 4PGJA 4HCIA 1FL3B 4XPBL 5ITFA 1I9IH 3O3UN 3DXAB 1CF8H 5A43C 3RL1B 1WZLA 3K80A 1CN4A 5FYJD 2DMHA 4PMEA 4LQFL 3P9MB 5FYKE 5F7EL 1U58A 3BJ91 5LNEA 4MXWL 3WDIA 5D7SL 3UZQA 5C0NC 1MFMA 4MNGE 5GS0L 4MJ5B 1D9KB 3O2DL 4NDMB 3KPMA 3RX5A 4KZ0A 3FB5B 4OZGF 3E1ZA 1NOAA 2W9EL 1D5RA 3FT4A 4A7TA 5FDYA 5GISL 5LO7A 5EMYA 1KGCE 4MDIA 1C5CH 2YXWA 4ZYKA 1XF4B 2J1XA 5SWZE 3IDNA 2D7PA 3FB5A 2OP4H 4NQCB 3Q6FB 4NAJA 2LOEA 1S8DA 4K4KA 4LSVL 3U2JA 3CSBA 4HWZB 1M05A 5DRWB 1SJEA 3F58L 4G7YL 3R4DA 1EEZA 3GLAA 4UQAA 4XWGH 1DVTA 1N4XL 3DX9A 4XE5B 3G04A 3M1OA 5KYNA 3B1TA 5MERA 3ARDC 4FQXD 1MCQA 4NIKB 4QYAA 2FX8H 1DJXA 3NCJL 4GMSL 4LOFA 1YYML 4WIQA 3U83A 1ZV5A 3BAJA 2DQGL 4IDJL 1OTUD 1QLFA 3HPLB 3IJ9A 4N24A 4JY6B 4YZFE 5DD5H 5GJTL 1KF9B 2V33A 1YY8A 4B27A 1JTTA 1YNTF 3QRGL 4FS0A 4ONFL 5FA3A 1JZ5A 1EIBA 1AKJD 1GSKA 4MA7H 4NWUH 4ZX5A 3GBMH 4KGJA 5EEXA 4P4KB 3EJZC 4O00A 4HPOH 3O9WC 5DQ9A 4HWEL 2Z93B 1PGRB 4XMPH 2FECL 4JO1L 1CF8L 2MHAB 3OKYA 5I6OA 5JMOC 1BZ9A 4IOFD 2OMYB 1R0AL 1MJUH 3EYQD 3ABMB 2H6PB 2HAZA 1N26A 2A83B 2XTJE 3ARBD 3FRPG 4G70B 5FXCH 4BRVA 5CCKH 1FQ9C 2Z93A 3MQIA 3GI9H 4U7KA 5CUSH 2YMOA 1NCUA 2QADD 3KM2A 1KV3A 3GSNL 4J3XA 1F4WH 5CZRA 3T3PF 1NTDA 2H41A 1Q0EA 1MRDH 5C0AA 4L4VA 1RZ7L 4AC2A 1S9KC 5TDNA 2FLMA 3VFMB 5F8QC 4F24A 1GH7A 1QUPA 3GJFB 2R23A 3BT2L 5BRZD 3KBPA 1AQKL 5BRQA 1XFPA 1OSPH 2UY6B 4WUUB 4JO5A 4B9JA 1WWCA 1FNLA 3WTVA 4XX5A 4WU7A 4XNZC 3CHPA 4M3HA 1EEZB 1KTKE 4UTBH 4EZKA 4JO8A 4PJCE 5F89A 1IUZA 4LF3B 4X7EC 3RHWK 4XPFH 2IFFH 5HPMA 2WYZA 2ZXBA 3MJ8A 1IKNA 4L29A 1B3IA 3HOGA 2XZQL 4TF4A 5IB4A 2BCMA 2GJ6B 3IDIA 1A7NL 2LLNA 3F6JA 2J55A 1HSAB 2PUQT 1GYWA 4L1SA 4M6OH 1E3XA 1PD6A 4ZO9A 5A7EA 2JJUA 3V6OE 4MB5A 4NP4L 3AQZA 4WNJA 2ERJC 4FTVA 5D8JH 1OCWH 1T6WA 4TNGA 1U8HB 5ANHA 3LY6A 4AEFA 2E74C 1U8LA 3ARZA 5F7DB 1NLDH 3PAYA 1KENH 3VFTB 2R51A 1IGFH 3CZFA 3L95B 1G9MH 4PJBA 4G5ZH 5J4MA 2GUOB 4FXGA 2QHRH 1R5IB 1EDHA 2HLAA 3GMNB 4LLVA 3RDTD 3B4NA 3P4LA 2E6JA 1O5PA 4M00A 3U46B 1BVNT 1D9KC 3KBFA 2ICEB 3RZCC 5L2JB 3LQZA 3VRJB 1PZ5A 2FQFA 3ZTJG 1MCNA 3EJYD 4JFED 4Y16A 2CJSA 3EJTA 3HBPA 4G80A 4KFZC 5EORL 3RPBA 3NRPA 1KV7A 4BV1A 2QADC 5I1IL 1Q1PA 3KCWA 5KW9H 3T0VA 3DNKA 5BS0E 1OAZH 3B6SB 2I5YH 1XCQA 3AG3B 4A2LA 2G3XA 2MPVA 3VTTA 3EYFA 2CKBH 1Z3GH 4HCRA 5AB9A 1SN0A 2NX5B 3NACL 5EU6D 4F15B 5JQ6L 1ZTXH 2V8LA 2VXQL 1XTLA 2YC1B 1HSBA 1NGPL 1RV6X 3ARED 1KB5L 1Q9KB 2X3BA 2D31B 3CCHA 4LZKA 5CLXA 2WLKA 1DLFH 4DKDC 4KI1A 2V2WA 4NNXA 5FW6A 3W5MA 5FGCE 25C8L 3LH2H 5DQJB 5B3SB 4P59H 3KLSA 4HMEA 4EN3C 5GZOD 2VDML 5BOPA 2HFEA 4OR1A 4TQHA 4NC0B 5D1QA 1P4IH 5FO7A 1GGCL 2ESVE 5LXVA 5KBNC 3WE6A 3FXIC 3S4SG 2IEPA 3LQAL 3O11A 4EI5A 2ADGB 1CF1A 2VZSA 4PJXF 3L3OA 1U42A 3JUYA 1HC1A 4N1CA 5JW4M 1V27A 3RWEB 2IQAA 3BDYH 2QELA 3ARDD 4QNPE 1LNUB 3A4AA 3GMOB 1P9MA 4PJXE 4UT6A 5MEPA 1EV2E 3HR6A 1BF2A 1QBAA 2AXGB 2FUQA 3MVSA 4PRIB 4S2SB 1QD0A 4DW2L 4MD0B 2EKJA 1UWEH 4ISVA 5CZVL 1MREL 3BPNC 1MIMH 3K1KC 2BP5M 3EBAA 5C0FA 4PJHA 5F9AC 3VQMA 4JG9A 4TL5A 3G5VB 4MTMA 3TJPA 1CLYH 1UCTA 4Z3FA 1KTRL 2X4TA 5FOBA 3V52H 4HHGA 4NJ9L 4XNXL 4POZC 4N22A 4NN7B 5HJGA 2PCYA 1X4YA 4U0RB 5DHVB 2OTWB 1UG9A 3UIZA 3TIEA 1TTRA 4P2RA 1RVFL 5D4JA 2UZXA 5TPWH 1ITCA 2DM4A 3QDME 3D08A 4ONGH 3L2NA 4D3CH 3AB0C 1F3DJ 3DRTA 3QZMA 4BA8A 1B2YA 1KOAA 4EQ2A 5HYSB 4TN9A 5I6XB 5KSBA 2J6EL 3PQYA 1OAXH 5AUMA 3PWNA 4P46C 2OMZA 1SXSA 2X0WA 1BLNA 1D6EA 5JIHA 3RVUD 4Z8FL 4IMLB 4BFNA 4HWBL 3BHBA 1TQBB 3TFKC 1C5BL 2GBUA 4KVPA 1V3MA 3HZVA 1MJ8L 2AI0L 4ODHL 4N9GA 2W1NA 1H3UA 2CRYA 1ZHLB 5BJTA 2I9TB 3PWLA 4PJ7B 4W6YB 3IK2A 3A6CH 4GIOA 2J8UB 3WO4B 2VXSL 3CWGA 4JJ5A 4DESA 3HRZC 4OZGE 4PGEA 1AXTL 4H0IA 2EXTA 4RGNB 5F7UA 2VRQA 4G1EA 2VAAB 1NEZA 4F2FA 1XDTT 3K91A 3TBTA 5BUGA 5B3JF 5IJBC 3IVKA 4FTDA 5FV1L 1NMBH 4DP7X 4JPKH 4UAOC 2B15A 2D2OA 4Q6IB 3CQPA 3CFEB 4UV4L 4A2HA 4DF9A 1DBKH 1EPFA 2GK2A 1AG0A 4ZUUA 1TZIB 3AJ7A 5EF2A 2NXZD 1IFHH 4IBTA 4QXUL 3VO0A 3I9AA 1I3UA 2ZOKB 3GHBH 5E8PB 3MLWH 3C8KA 2DWDA 3BAEL 3WN5B 2AJSH 4UTAL 5IEKA 4IOFC 4XMWA 2XG5A 1CDYA 3C9NB 4GP4B 3B7YA 4P5KB 3CXDH 3ARBC 2UXVA 4YHOH 4J4PC 2QGBA 3K2UH 5CLZA 3U4EB 3S5YA 3ZK0A 3MRJB 3VA2C 5B38G 3OR7B 3KDMA 2RFXA 1I8IB 3T3MF 4NUJB 5JYLA 3V0DA 3BPCB 3V95A 3S7GA 4NM8H 1NCCL 2YMTA 3BZFA 4L4TE 4AYID 3FFCD 2ZSWA 3ZVVA 5ISZB 3KH4A 2YLHA 2B8OT 3AQYA 3EO0B 1RLWA 2N7BA 3GGWA 2RHEA 4PS7A 1QTSA 2CJ3A 2E4FA 1JPSH 4KTGA 5C0EA 3N1QC 4ZDHB 3QIUC 4N5ED 3OJDB 1H6UA 1B88A 5HHXH 4F33A 4XP1H 1D5BA 2OX5A 1B9ZA 3H54A 3NTCL 3C6EA 2JTDA 4X4YB 1DQDH 3K6SB 4LSPL 3U0PA 2X7LB 3PV6A 3JWNG 3LNEA 3UYOD 4OT1L 1V5JA 3BQUD 1JHKH 4RWYL 5DA4A 1NC4A 4A63A 3GRBA 4F92B 4UIMA 1CVSC 1MFDH 2VTFA 1PTZA 3AREC 3PDOA 1EBAA 2G4EA 4FX5A 1RZJH 1KTLB 3CLEL 5D7LB 3N2JA 5HHVH 1DQJA 4KKPA 3NZHL 1KULA 3AREA 4O02A 5D7JD 2JH2A 3EOBB 4JM0A 1M2OA 5AAPA 5LGJA 3GS0A 3WNNA 4KK5C 1LWHA 2R69A 4IDLA 1JV2B 2A74A 2CM6A 2XBDA 3IJHA 1IC5H 3KPQA 4FFWC 2YQ2A 2R56L 3ULUE 1A7OH 1RIVL 4TM9A 4HMDA 4N85A 2ZAHA 4LCCC 1HQ4B 2H3KA 2JCCF 4XCFH 1FVDA 5IQ7H 2AEPH 2CBTA 1N0XL 5BV7L 3BH9B 1A7NH 3U9PL 5C0IA 3MRGB 1XZ0A 5FFLA 1V3KA 2BIIA 2JSFA 1HWWA 1IM3D 3FFCB 2WZ5A 3IDGB 1KSRA 1OVZA 1AOHA 4R0LC 4NJAH 4ZFOA 3HAEH 2NY0B 4GINA 3JZ7A 5CP3A 4CILA 2FSEA 1W9XA 1WK0A 1WTLA 4NQEB 3OHXA 4JRYB 4GO6B 1U93B 2OMUB 3T8VA 3WTYA 5LCVL 2X4PB 3EOBA 2CG9X 4ERSL 1CXEA 1M1SA 4P5MB 3CVBA 4AVHA 3UCRA 3CTTA 2HYMA 2JB5H 4YFDB 2J12B 3UO1H 1N68A 2OMXA 3RWJA 1BP3B 1DDTA 4G6AD 4W4OA 5AKSA 4HFUH 1QVOA 1IJNA 4YE4L 4Z9KB 4ORGA 5CGTA 3L45A 2P8PB 1MCEA 1HHGB 4Y2OB 4WRLA 3QYNA 2PYEA 4TNWF 1A6TA 2ITFA 4FQIH 1ES0B 2NUTA 2VJ8A 1H3VA 1JFHA 1DJSA 4JN1L 2NCMA 4KV5E 3VQ2C 35C8H 3DARA 4GG8B 4IJ3C 5LNDA 4WY7L 1KLUB 4RWHA 3H7LA 4ANWA 1NCJA 2D0FA 1HL9A 1F2XK 1CICA 4EI5B 1ZGLP 3BYTA 4AXWB 2X5PA 3QUGA 4LDLB 5L6YH 2H3XC 5DK3A 5TJWK 4ETQA 3F2LA 5J11B 5ESAB 5DFVD 4E41B 1YA5A 1BVZA 3J8F7 3CQQA 1UD3A 3U6RA 5KG9B 2ZXWB 4JQXA 1BZ8A 3K81A 3BKYH 5HHOA 4WW1A 1ZVYA 3HMXH 1X7TA 1THCA 2UZIH 3AMLA 3MV11 2Q76A 3QG6B 4GUPB 2VDOB 4GSDL 5JORB 4DK6A 3OQRA 1IFRA 2NPLX 4GSXA 4JPQA 3TTSA 3U1SH 2OA9A 1FCCA 4M6NH 5CINL 5AVRB 3TBWA 4ODSH 4MAYA 3UDWC 5I1EH 3REVA 2WKGA 1OARL 1CLZH 2WBKA 5T1DL 4QNPF 4KKAD 4KTYA 4PJBF 1G6RH 3Q43A 1G7JB 4XC1L 4XHJC 1YEGH 4GW1B 1JRHH 3R7QA 1WFTA 5D71H 4WJKB 3ZKSD 2XPGA 1KYFA 3S4SB 5CEZH 2NY3D 3HG4A 4FFZH 4Q0XH 3V0AC 5HGBA 3O45A 1W0VB 4F58H 4YBHA 4JMXA 3IJSB 4BQCA 4LP4A 4DUVA 2AJVL 4RETB 4DUXA 4CU6A 2F7OA 2P44B 4JPVL 1KBPA 4M1CC 3V5KB 5CWSA 3WLWD 1OHQA 4OQ1A 2EDEA 1AHKA 3K7UA 4W93A 1QFWI 5GS0H 2AS5M 1MLBB 3FB6B 4QTIL 5BCAA 1BFTA 1NC2A 4MHHG 1L0XA 1BQHG 3QUXA 4BELD 2X89D 1PZBA 2GKIA 1A6UH 5K33A 1BVNP 1DHKA 4LSQH 1IAIH 4QHUB 4UT6L 4FQHA 1JZDC 4M1CD 4RESB 3MI6A 4Y1TA 3DYOA 4H20L 2OCCB 2IWGA 5E9DE 4YE4H 1GGTA 1DJHA 4IK6A 1VACA 4F9LA 5FLUA 3VGAB 3VFTA 5I6NA 4JKLA 5CSZB 5I1CH 4GXUN 3V4PA 3Q8BA 3GXNA 2YD6A 2WSDA 2O61B 3QGVA 5IMMB 1DN2A 4ACTA 1MW2A 1E9PA 2Q86A 3PIQA 4O58L 4FQPA 3G6JA 1AS6A 4OTXH 4Y7OC 2ZNWA 4R6UA 4X0NA 3FH8A 5EN2B 3CFUA 4FN0A 5AZEH 4ANXA 4CN1A 2QGDA 1W6WA 4XNQA 4BFIA 2BW5A 2VR6A 3AM8C 4E68A 1ADQH 2NQDA 3FNKA 5IM7A 3BFOA 5A16B 3QB7C 2YD9A 2W9DH 2EYSB 4OF7A 3IS1X 3B8SA 3UABA 3LNDA 3B9AA 4HV8B 1SJVA 4ONHB 2KYIA 3OWRA 4OCXL 4KMTL 2P80D 3QISA 3GUFA 3O6FC 3MLYL 4OCNC 4AJ0A 5F89B 2ZP9A 2QLVB 2ZXQA 3CX5J 2Y36L 3H2WA 2V2XB 3MBEC 4HAKA 3RB5A 1U0QA 2I60H 5DJDA 3WMQA 3FUIA 5EIIG 4AT6B 1CYWA 1LE5B 1BZOA 3RDTB 3SBWA 2VLRA 3B7RL 3SJVE 1XSIA 2P5PA 3ML8A 3T09A 1D5BB 1E5ZA 4CUCA 3KXFB 4B96A 2BW4A 1UZ6E 2FATL 4GI9A 4URTB 4Y5VC 1MRDL 4BGLA 3O6FB 3SGEI 5AQ0A 3BCFA 2XA3A 3EJPA 4WKZA 5EF0A 5DK0A 4CMMB 1MI5B 5IJKC 3GUTA 3ZYOA 1CDUA 4GRLA 1KIQA 4IIQA 1MLCA 5IF0B 5KJRH 2BOCB 1H5BB 3MHZA 4QRRD 2IPTH 4LARH 1SFDA 2VC2H 5LN4A 5TGBA 1BZ9B 2ZUYA 1DN0A 4M43H 2R69H 4LSTL 1F11A 3MRJA 2LLGA 3QNYB 1UENA 3X3GL 1KB5B 4Z7UB 5E56A 1WZ1H 2H0EA 1QASA 3NOIA 5ECJE 1H19A 3O4LB 4LRNH 3LMJH 3HPJA 3PHSA 2XWCA 1HZLA 2FNWA 3LXBA 4LCVA 2ZJSH 1A14H 1UT1A 3AACA 4LHUA 3RFRA 3WFBL 1E43A 1ZY9A 3QNFA 3CFDB 2VO5A 2EUWA 4FFTA 2VITA 4ZNEE 3KWWB 5JOEA 2X09A 2Z0UA 3APCA 4X6FA 1BIIA 1XGRA 4LNRA 1M2VA 5DHEA 4DTGL 3ZY7A 3N40F 4Y7MA 1HESA 5DWPA 1LEKB 4NFBA 1JD7A 1KELL 2XQYG 3NJJA 2PWHA 4HLJA 2K4AA 2X4QA 2PPEA 2IFGA 4U1MB 3TBSB 3MJ9H 4BH7A 2HH0H 2XCMC 1R3LB 2E9GA 1T22A 3UMTA 1ND0A 5KOMC 1FG2B 4ZUTA 2M26A 2E3VA 4PS3A 3RUGF 4IRJA 4JG1L 2D7TH 4U1HB 3KPNB 1M2VB 4KJQD 3DO4A 3LHPH 2AJ3A 2Q3AA 3L4UA 2QLYA 5T5FA 4UM9D 4ZMPA 1AC6A 5E2UL 1I7RB 2CUAA 3OTTA 3QZPA 4AJYV 1J88A 1FZMB 1ZE3H 3RWDB 3QDJB 4Y1AA 2EEDA 1BJ1J 1JGDA 4O02L 5B3NA 5EOCJ 4QR7A 5JPMC 3H9HB 3L7FB 2JMRA 3OKOB 3V5KA 3ASWA 4C56E 3P77A 3MUGB 3TVMC 3C5ZD 2GTQA 1MJ8H 4LPVA 4HIJA 4K2UL 4N8UA 5CLWA 5C3TA 5GGUB 3P3SA 2CK2A 1K8DA 3D85D 4QT5B 3FCSA 4ATTA 1XV8A 1DBJH 3CFKB 4IOIB 4QTHA 3D51A 2AVFA 4U2ZA 2NY4B 5JXAL 4FQXB 4U6XB 2KI6A 1BMWA 3MJ9L 3BRDA 5JOPE 1UC6A 3A0OA 1KTJA 3CPUA 4OFYA 4WHYH 2X40A 2APWA 4X5XB 5EIIA 3QXAA 4L1TA 2AQ1A 4N8VB 2ZT9C 2WZ0A 1OB0A 3FU5A 4YC2C 1TU2A 5I17B 1RK1B 1WD9A 3D50A 5F0JB 1IAIM 1FV1A 4R90L 3AG1B 1G0DA 1SM3H 5AG8A 4ZFFB 4XP5H 1G4MA 4KHTL 3ROLB 4K3GA 3PF2A 2ZTBA 4KMQA 5LCVA 1KY6A 4IS6A 1LNUA 4Y2OA 5EEZA 2IAND 5D1XE 3QUMH 3SCMA 3DX8A 3QEQA 3D12B 1T4KB 3FAWA 4WWKA 3VAEA 4IBWA 4CSSA 1MVUA 3HNVL 2DM2A 1D9KD 4KITB 3D2UA 3FB8A 3EGXB 4LRNL 1TVBB 4O2FB 4EI6A 1EZSA 1EGJA 2B14A 1WZ1L 4X4ME 1JL8A 4UU9A 1NPNA 3NSFA 3S3PA 4P5RA 3P3RA 4P8QA 4AEIL 4DFHA 5GS2H 4YWGL 4GMTL 2WWNA 4LARL 4QHMA 3ZDYB 3T6XA 3R18A 2EE6A 2E46A 4DIXA 1T21A 5E6ID 3BN3B 2VXUL 4N2EA 4OFDA 3WY3A 5JW5B 3D2TA 1CI5A 5F3HB 3Q8AA 3BRFA 3JV5A 4FQ2H 3UJTL 2OL3B 1CTNA 3B2PA 1BQHB 1JPTL 1S9YB 3P11H 5ITBL 5JIQA 4GP5B 1J0HA 2CPUA 4FP8L 5CBEA 3IDNB 5JQHC 2Y1ZA 2KZKA 4WJ5B 4PRDA 4U7MA 1VACB 3CC5B 1VDGA 4TLSA 1HINL 2CAKA 4LCCB 4AYBA 3DDGA 3OF6A 4Y5XB 3PE9A 4F2ME 2YSSB 3UTQB 5LCVH 1OAZL 2ZUQB 1L7IH 1UD5A 1XSJA 3VFUA 1OM3L 2OULB 4LLWA 3KMDA 1K8DB 3SBQA 3ZOAA 4AQAB 5I6KA 2DN7A 1NUFA 3RY4A 1A6WH 4OF0A 2CUIA 5IMMA 1KNOA 1HTYA 1JS4A 2V9TA 4WHTA 1XIWB 5AW1B 1CD1A 4G8EB 4DP6X 4S10A 3U0PB 4U31A 3OQ3B 3K2KA 4G9FB 4LVNC 1AGFA 2WMPA 4UQ3A 2P43B 1LK3H 3HUJE 3PWVA 3QPXH 4YQXH 3SKMA 4LFHD 2OX5B 2AQTA 3W39A 5IMKB 3TLRA 2A38A 5IROD 4K3DL 4LFHG 3ZQXA 5J9PB 1BW8A 3ZKMD 5AOZA 4J4PA 4PJ5E 1E67A 2HUEA 3CU1A 4TLKA 3T0WA 3NA9H 5F88A 1LHZA 1R3JA 3VXME 5E08L 1KEGL 4K7PH 2LLLA 5I75C 4R7NA 2QPUA 1VEMA 1Y18B 5H35B 3QYMA 3ARRA 1UT2A 5E70A 3B7SA 2APSA 3NJGA 3V6ZA 5GHWH 1A4AA 2Z4QB 1U92B 4XXWC 3GUTB 1KCSL 4K3EL 1S7VA 2WLMA 3D0LB 1TPXC 5EBMA 4LL4A 3WY2A 1BHGA 3LXCA 4HP5A 5FYLD 4AVIA 3QCUH 1U8OA 1WITA 4TNVK 2DW5A 1SUJA 3OKNA 2XKSA 4G7VL 1KIPA 4WI4A 5A2BA 3JYCA 1OP5K 3E9TA 3MZTA 4P3WA 3M17B 2ZXGA 1D7DA 5LLIC 3T0EC 4WW1B 3DIVA 1JPTH 2CIIA 5ITBH 1N8ZB 4O4YL 4P04A 2VJXA 3ASOB 4YL9A 2WVUA 1XT5A 4WWKC 5I15L 4HH9A 4HUKB 3FF7A 2RFXB 4YHOL 1RY7B 2AGJH 5B8CC 2JQAA 3FSVA 3TCLB 5TPWL 2WO4A 4KZDL 1KBVA 2L0DA 3CXHK 3RIFK 4YXHH 4JRLA 1SHXA 4P4KA 5AVQB 3ASNB 3MBEA 4YWGH 2Z91A 1TQBC 3IETB 3S5LA 4NUMA 3CJJA 1SBSH 3V52L 3MLSH 4DZBA 2DIBA 4AIOA 4LOUC 5FC9A 4CN4A 3B2UD 1NCWH 4JFYB 1IFGA 3CDYA 5AKVA 5IMKA 5IFHL 2LU7A 1XF3A 3C5JB 2Y1AA 4O9HH 2R1XA 1FNHA 1NCWL 2OS7A 4GYBA 2PTUA 3HG3A 4AH2A 1VKXA 3TJEL 2DB8A 3WTWA 3UTZB 3DTXA 5CMAA 3WFCL 3S8WA 1E9OA 1S9VA 5I19L 3IJYB 4NKIL 1K4DA 3VXQA 3DPBB 3MLXH 3HC3H 1BECA 1EA9C 2YXFA 1I4FB 2Y7MA 2AXFB 5D72H 1I3GL 5MENA 1NIDA 1EH9A 1MNUL 1O6SA 1QWUA 2OZ4L 2UWEB 2YSTA 4YXLL 3BZ5A 1GGCH 3OC8A 4ODBD 3SGDI 3HFML 2DBJA 2FJGA 5AL0A 2BNQB 2V4LA 4PLJD 4YHKH 3N1MC 4X6DB 3F12B 5JXED 4NI6A 2XT1B 2OYLA 3SODB 3FT4B 3FQXA 1XSOA 5TDOB 25C8H 4LVEA 1DBBL 2W0KA 3HEIB 1P2CB 3M6DA 4LSDA 4F20A 1C12A 3F84A 4NHUA 2UWEA 1RHHA 1FG9C 2X0UA 4RFNB 2R0KL 4R4BB 4HFUL 4B60A 4G72B 1L6XA 4LIQL 3QJHA 3G6DL 2BZCA 2OL3A 3GMOA 1RHFA 4OUOA 3AGWA 2MCPL 3HE7B 2FJFA 2VR7A 4MQSB 4A37A 4PVNA 2BS71 1ZE3C 4JDTH 2ZONA 2ALWA 5IWLA 1JZEA 4TSCH 3O2DH 4FJZA 1YY9D 2O6EA 1ZHKA 4Z0BL 1PG7X 4ZO6A 5I66A 4WW2F 4POYA 2VJ0A 3WNIA 5E4EC 2OKMA 4AV0A 3JVGC 4M5YL 1K3ZA 1JI2A 3MV8A 5SWZA 4WI8A 4A66A 3WTUA 4AMKH 2BZDA 3N50A 1QLEB 3MV7E 3GXIA 4KY1L 4KXCA 4GUPA 1TQSA 3MNMA 3BXNA 1MVUB 3ZUCA 2WTRB 2YEZB 3GI8H 5DJ2B 2YD3A 3TX4A 4UZGA 4ISVB 2IDFA 1IC5L 4IS6B 2CCVA 2OR9L 4U1GB 3EBHA 2HFGL 1SJXA 4FNLH 2XYBA 1NC2D 3KPSE 1MCBA 5E6RB 3PFUA 3CDGA 3G5XA 3QFJD 2YEZA 4L05A 5HHVL 2FEEI 1NCDL 3IMTA 5BRZE 2JI1A 1OTSC 1TZ8A 2JJWA 4G80B 2QPEB 2ZSWB 4TULL 4YHYB 1BD2B 2EVFA 5JZ7D 1V3LA 3PJSB 4FULA 4YK4B 4ZUUB 2YPLA 2FECI 3N5AA 4GKZB 3HZMB 5HD8C 1XR8A 1ET5A 4JLRB 4NX0A 4Q58C 3OAWA 1N3NA 2CIKA 5FCSH 2WSPA 3BVWA 4BINA 4M43L 1X6LA 2GHWB 4M8QA 1LE9A 4LLUA 2EDHA 1CGSL 1NCAH 1IQWH 4LVNB 5E5RB 2AANA 3TYFB 2R2EB 3U36B 1G6RA 4NKMB 3F6LA 5BMFL 1Q94A 4HYTB 2WINB 3P4OA 5I66B 3OLIA 1NFIA 3NN8A 1Q0XL 1I8UA 2AK4B 4JMNA 3VU2A 1OCZB 4PBVC 1EZUA 2NW3B 5CFHA 5EC1B 3RUGA 5LAXA 2VIRA 3D33A 1ROCA 1OAQL 5TQ2H 5KN5A 4BUHA 4AYGA 3X1FA 1BQHA 2WXJA 4X4XB 1OHZA 2FH6A 4OFYD 3QUYA 1EDQA 1IGFL 1MXDA 4MAUL 3VXSD 2X2IA 1FA4A 2GJJA 1IFHL 3C5ZB 2V3EA 3GLEA 4NM4L 4JJ5B 4JFEE 5E8NA 2P46B 1RZKL 4H13C 1HXYB 1HL4A 4N2OA 1SEBB 3BKCL 1KYAA 3P4NA 1QKZL 1J9RA 4XVUC 4X7TA 4B50A 2FGWH 5HVGB 5TH2B 4WO4D 1OAJA 3B9KA 5F7BA 5J6HA 4PGBB 1DQJB 1ZS2A 5SWZD 3UACA 5AVUB 4YLCA 1A66A 2WCGA 4U4BA 1YEEH 2DKUA 2F5AH 3D2UB 2XI9A 2WQWA 3FB8B 3S36X 2WTPA 4G6ML 5BZXA 2JI2A 2WWMD 4PRAB 3ZZ1A 4G11A 1RJYB 3PHQB 2Q8AH 1UXWB 3FCTB 2WLYA 2OLDA 4YDJA 3ULVE 3JWOH 4FC3E 3QR1A 2R1XB 4QAWA 5FA4B 2A9AA 1NMAH 2EKSB 1G9NC 5ETUA 4QRRE 4KRPC 5ERWB 3BEWB 1N67A 2MHAA 1CDBA 2OJZH 3EJRA 4WU7B 3RFZA 1GAFL 4JM4H 3VI3E 4JUSA 3LV3A 4HWNA 3IS0X 4YOKA 4W9HC 4WTZA 3MTRA 3D25B 3Q7JA 3FQRB 3WUWB 3C5ZC 3GGWB 1IAIL 3A3YB 4IBVA 4PJHB 4GIAA 3UYPA 3TBVB 4NKMA 4E9XA 3F7QA 3SJVD 1J1XL 4JFFE 2HFEB 1IGIL 2ZUUA 1M7XA 1F86A 1ID5I 4L2LA 5ADOH 4S1DC 1NA8A 1CLCA 4KK9D 1V7MH 4GJTB 3W3BA 2R29A 1EZVX 4MS8D 4JR9H 2JVUA 1A1NB 3GXMA 4L3CB 2EDRA 3L4TA 3K6SA 2B20A 4N90E 1ZLUH 2ZICA 5CU5A 3TTYA 3MJ7B 2WLHA 3NSJA 5CEZL 2HB0A 2KDGA 4UZSA 3X3FL 1VHPA 2BS9A 2GITA 3FSOA<