3T6WA

Crystal structure of steccherinum ochraceum laccase obtained by multi-crystals composite data collection technique (10% dose)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
495
structure length
495
Chain Sequence
VQIGPVTDLHIVNADIVPDGFVRPAVNAGGTFPGPVIAGNVGDNFQIVTFNQLIECSMLVDTSIHWHGEFQKGTNWADGPAFITQCPIIVGNSFSYNFNVPGMAGTYWYHSHLTTQYCDGLRGPFVVYDPNDPDANLYDVDDDTTIITLADWYHVLAKEMGAGGAITADSTLIDGLGRTHVNVAAVPLSVITVEVGKRYRMRLVSISCDPNYDFSIDGHDMTIIETDGVDSQELTVDEIQIFAAQRYSFVLNANQPVGNYWIRANPNSGGEGFDGGINSAILRYDGATTADPVTVASTVHTKCLIETDLHPLSRNGVPGNPHQGGADCNLNLSLGFACGNFVINGVSFTPPTVPVLLQICSGANTAADLLPSGSVISLPSNSTIEIALPAGAAGGPHPFHLHGHDFAVSESASNSTSNYDDPIWRDVVSIGGVGDNVTIRFCTDNPGPWFLHCHIDWHLDAGFAIVFAEDIPNTASANPVPEAWSNLCPSYDSAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase
publication title Reaction intermediates and redox state changes in a blue laccase from Steccherinum ochraceum observed by crystallographic high/low X-ray dose experiments.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 136
structure length 495
sequence length 495
chains with identical sequence B, C
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6wA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6wA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6wA03
2P80D 3FYEB 4YSDA 3FQ2A 1E5YA 4GP4B 1JZFA 3N55A 3X1NA 3FPXA 2FQEA 2XX0A 1CC3A 5A7EA 3UADA 2FT7A 2X87A 3L45A 1AG0A 3EH5B 2WO2B 1T5KA 2GIMA 3IEAA 2HX7A 2XXFA 3OM3B 1KYAA 4KOCA 4E9RA 2IDUA 5TK4A 1AQ8A 3G5WA 4TXVB 4BK5C 1E65A 2UX7A 4UF7C 1GS6X 1WA0X 1PZBA 1J9RA 3AG1B 1X9RA 2N0MA 3KW7A 2OJ1A 1XB8A 3FU7A 4YVNA 1KV7A 3C75A 1PNCA 3X1EA 1AACA 4WKXA 1PZCA 3ABKB 4G7QB 1ET8A 2DYSB 4BDVB 1I53A 2MRYA 1IKOP 1IBYA 1XMEB 1AS6A 2LLNA 2H47C 4KO7A 1N68A 2GHZA 1BAWA 2BWIA 2IH8A 4A2HA 5I6NA 2DY2A 3NJFA 1J5DA 1NINA 4DPAX 1ETJA 2XV0A 2P80A 3UAEA 1W8EA 2IDFA 2YAMA 5B7FA 1IBZA 3TU6A 2CAKA 3NT0A 1OCRB 1CUOA 3JT2A 3OMAB 4KO5A 1NWPA 3NJNA 1A4AA 2QPDB 1L9QA 5D4HA 1FA4A 2FQDA 4M3HA 1KDIA 2YAOA 1JXDA 2QT6A 3NJHA 3QJTB 1AZBA 3NJLA 2CUAA 1ZDSA 5ANHA 4E9YA 2Y1AA 4YSQA 3IBOA 2VW6A 3NSYA 1YLBB 2DWTA 4E9TA 1J9TA 4K9JA 1A4BA 1BXVA 4HHGA 3SBPA 1RKRA 1SF5A 2VN3A 5TK2A 3ZX1A 1L9OA 4AX3A 3PAUA 3FU8A 1AZUA 3CVDA 3FU7B 1PY0A 3PXLA 2PPFA 2PPDA 1TKWA 1E5ZA 4GP5B 2FQGA 3WIAA 1MZZA 2EILB 4DP6X 4YSPA 4W1TA 3T6XA 3NYKA 1OCCB 3WKPA 1BQRA 2IAAC 4A2FA 5I6OA 5B1JC 3TBCA 9PCYA 2BW5A 4CSPA 2GB2A 4YL4A 1PLAA 5B1JA 3KW8A 1SF3A 4N8UA 1ID2A 3DTUB 1ZIBA 1BXAA 4A68A 2PLTA 2EIJB 3QJQB 1TEGA 4L0PB 1BYPA 1M9WA 3ABMB 2CBPA 1AG6A 3HB3B 2YXWA 3CVBA 1WA2X 2PP9A 4BXVA 2UX6A 1BYOA 2GC7C 1JZGA 4PAZA 5B7EA 1KCWA 4E9XA 4QLWA 1HAUA 3PPSA 2UXTA 3UGEA 4P5SA 3ASNB 2VM3A 4GP8B 3V9EA 3FSZA 2XYBA 1KDJA 3ZBMA 3HEIB 1MZYA 2BP8A 2J55A 1A8ZA 4NERA 3UACA 1PCSA 3IN0A 4BWWA 3ABGA 3H4HA 3FU9A 3RYMA 4E9QA 1AR1B 4YSRA 2IWFA 1CYWA 3QJSB 2W8CA 1FFTB 4KNUA 5AZUA 2MTAA 1FWXA 2VW7A 2QDWA 3NJIA 3X1BA 4AKOA 4Q8BA 1JOIA 1QNIA 2XUWA 3QQXA 3SBRA 1SDDB 5I28A 3PCYA 1GW0A 3ZDWA 2PCFA 2FTAA 2H5UA 2DV6A 3WI9A 1PZAA 1OOWA 4F2EA 4A2DA 1NPJA 3H56A 1KGYE 3IN2A 1RZQA 2XV3A 3ASOB 2BP0A 3DIVA 1TU2A 3ABLB 3CDZA 3T6ZA 2J56A 4YSSA 2IH9A 3NSCA 3FT0A 4X4KA 4A2GA 3OQRA 3FPYA 2BZCA 4YSUA 2VW4A 4RH4A 3V9CA 2TSBA 3FYIB 4HZ1A 1PNDA 2FT8A 5B1KA 2GC4C 1RCYA 1ILUA 2B08A 2R7EA 5F7BA 4PCYA 1EZLA 1A65A 1J5CA 3AG3B 3NP3A 3NJKA 2I85A 3D12B 2BZ7A 4YSTA 2EIMB 3FS9A 1M56B 1ASQA 1AZCA 6PAZA 2W88A 2BP8B 2NRDA 2FQFA 5E9NA 1JZIA 2PCYA 2AZAA 2Q9OA 3X2QB 4YVUA 1DZ0A 1AZRA 2VM4A 3TA4D 1WS7A 1NIEA 2PPCA 4JKNA 1OE2A 1KBWA 1GY1A 2J57A 3NSFA 1NIAA 1OE3A 1AAJA 5I5MA 1QLEB 1A3ZA 4AKPA 7PCYA 4MFHA 1SFHA 3EH3B 1L9PA 2YAFA 5I6LA 1GY2A 4KNTA 4FA7B 2BHFA 1OCZB 3T6WA 4KOBA 1J9QA 3QJUB 3CG8A 3GDCA 5B1BB 1ZV2A 5B7MA 1NIDA 2FJSA 3SBQA 1MG2C 4DP7X 2EINB 4NB7A 3U25A 3UABA 3WKQA 4AI7A 4DP9X 4BWUA 2JFCA 1BQKA 3OMIB 1NICA 4HALA 1NZRA 3MBWB 4YSCA 2ZOOA 3IE9A 5I6KA 1DYZA 6PCYA 3GYRA 3AZUA 4W9ZA 2DYRB 5AFAA 2XV2A 2CCWA 5PCYA 1BXUA 4GYBA 3OD3A 4A2EA 3NJJA 3S8FB 1KCBA 2DWSA 2ZONA 3T71A 1ZIAA 4KO6A 1OF0A 4DP0X 1EHKB 2CALA 3X1GA 4G7RB 1M57B 2HXAA 2VMJA 1AIZA 2YAHA 4KNSA 1CURA 2Q5BA 1AS7A 4F2FA 3PAZA 3SQRA 2YARA 3WG7B 3FQ1A 4EF3A 2PPAA 1PMYA 3BQVA 2AFNA 1SHXA 3X1FA 4AKQA 2YXVA 4G70B 4ZK8A 4E9SA 1BEXA 2QDVA 1A4CA 3ZIYA 1ASPA 2GSMB 3PLYA 2IDSA 2BO0A 2JKWA 2Y69B 4E9WA 3S8GB 1KBVA 3EF4A 5I26A 4HCIA 3T9WA 4DP8X 2B3IA 4QKTA 2HRGA 2YAPA 1L9TA 1AZNA 7PAZA 1ET5A 2PP7A 1E30A 2PPEA 1JXGA 2JXMA 2AZUA 4JHUA 4HIPA 4DP2X 3AG4B 3AG2B 2GBAA 4HCFA 2VSMB 3EHBB 2IWEA 4WTQA 3CZUB 3CVCA 1NDTA 2H3XC 3OMNB 4DP5X 5I6MA 1AOZA 4Q89A 1ADWA 4UANA 4F7KA 1XB3A 2XWZA 4YSEA 1HFUA 1NPNA 3H4FA 1OCOB 4A67A 1ZPUA 2UXGA 4G71B 1MDAA 2UXFA 2XX1A 1PLCA 2FWLB 1CYXA 1GS8A 3FSVA 4NAJA 3DKHA 3FSAA 2HX8A 1BQ5A 4FAAB 2UXVA 1B3IA 1WA1X 4KO9A 2E86A 1W6LA 2IWKA 1PF3A 1XB6A 3NP4A 4G72B 1WS8A 3S3DB 3WNJA 1HAWA 1V10A 2PP8A 4BWTA 5LDUA 4BXSV 4GXFA 5FC9A 2YAEA 1ILSA 2TSAA 1GSKA 2HRHA 2I7SA 4DPCX 3QJVB 3T6VA 1N70A 3FQYA 2YAQA 1QHQA 2XVBA 1NTDA 5I5JA 1AANA 5AKRA 5EHFA 2QPEB 4CSZA 1SJMA 1ET7A 3ERXA 2A3TA 3S3CB 1OV8A 1URIA 2BP0B 1JVLA 2BWDA 3QJRB 5I6PA 2AANA 2X88A 3CDZB 4UAHA 1JZJA 4AZUA 1SFDA 3TBBA 4HHWA 4DP1X 1GR7A 3NJMA 1NIFA 2HX9A 4G7SB 1AS8A 4JHVA 3JTBA 2VSKB 1JZEA 2R7EB 1ZDQA 4A66A 1MG3C 5I5IA 2GI0A 1E67A 2FNWA 2WSDA 3NSDA 4N4YB 2XXGA 1NIBA 1NWOA 3AY2A 2RACA 1OE1A 4P5RA 1J9SA 2XU9A 5D4IA 4ENZA 3NJGA 2YQBA 1L9SA 1SNRA 1JERA 1SHWA 3N2JA 2OV0A 3WNIA 1UATA 1SDDA 2XLLA 2I7OA 2ZXWB 1X9UA 4E9VA 1L9RA 2WO3B 3MX0B 4M4RB 3UAAA 1JZHA 4YSAA 3AW5A 4GY4A 3S3BB 3GXUB 2IDQA 2AVFA 8PAZA 1RZPA 2OCCB 5IY5B 1F56A 2CJ3A 3EH4B 5F7AA 1VLXA 3TASA 5D4JA 1GS7A 4YSOA 1W6WA 4DP4X 4BDVA 2J5WA 1JVOA 2ZWNA 1R1CA 4HCGA 1TEFA 3FSWA 1IC0A 1GYCA 1WAEA 1V55B 1PLBA 3PAVA 1PAZA 2EIKB 3QPKA 5B3SB 1ASOA 5PAZA 1IUZA 3BVDB 5B1AB 2FT6A 1JXFA 2BW4A 4DPBX 2HLEB 1V54B 2HZHA 2IDTA 4HAKA
chains in the Genus database with same CATH superfamily
2AXHA 2WIMA 1NDGB 1E4XI 5GZOC 5DK2A 3DX6A 3T8VA 1MFBH 5DJDA 2YZ1A 1ZAGA 2J8HA 1G9HA 3ARSA 1OAUL 1W80A 3QWRA 4W9LC 4Z7OE 3VO0A 1NJ9A 1M1SA 4FFZH 4G9FB 4KOCA 4OSUL 2W91A 3U2IA 4MCYA 3BH9B 2XTSA 3SSGA 1CF1A 3L08A 3LDBB 1WAAA 4UT9A 2UX7A 1WIPA 2P8LB 4XTRD 4TUJA 4YZFF 1RH8A 3ULUE 2DQIL 2O4EA 3VXSB 1K8IA 2WY3B 4YHPB 1HHGB 2WWKT 5IWLA 1HILB 4IGBB 4XNXH 1QOKA 5FXCH 2EP6A 4C57C 1YEHL 2IPUK 5E9DA 1XMEB 2BVYA 4V1DB 3W1ZA 3GHPA 5DLLA 3WLBB 1AY1H 3TVMB 3O3AB 5I24A 2QQNH 1MRFL 3STLB 3FQRB 4M3KB 3K81A 4GBXC 2YAMA 3INUH 4QNPE 5IB2A 1ZS2A 3AQYA 3D0VA 4H8WL 1TYRA 4PJAF 5F7DA 3QDGD 4Y19E 2HJKB 1NEZG 3U79A 3V0JA 2BZDA 3EH1A 3EO9H 4WI6A 5FWQA 5ALCL 4XPBH 3G5XA 2VQ1A 2NSXA 1SEBB 3P73B 4JFYA 5ANHA 2NPLX 3P77A 4NKOA 2VH5L 5DA4A 1DQVA 5J8OA 1X9LA 3K46A 4ETQB 1YLBB 4X4XB 4EXKA 2ATAA 1V8HA 3MRCB 4FULA 3PWNB 3E2HB 3GBMH 3PWVB 3F65A 2JELH 1HOEA 2APXA 1UWEH 5SX5K 3W56A 3WXVL 3AQXA 2MNWA 5D96C 3CUPB 2APFA 4AX3A 5IW1A 3NESA 1F8TL 4R4FL 3HI1A 4L0YA 1TKWA 1UVQB 2CWRA 3B6SA 2Y3AA 2ZSVA 4BRJA 2JE8A 1I7UA 1V27A 3HAEG 3KJ6H 4Z7VB 3ULVC 5AW4B 3IDNB 3V0WL 2OJZH 2EVIA 3EXLA 1UXSA 4W1TA 1SYVA 4NZUL 1WE5A 4XP4H 1UADC 4ISVA 1Q1JL 4U1KA 1T4WA 1UWGL 2ARJQ 3LIZL 2AJVH 4P5TD 4CSPA 2R1XA 4AJVA 5F3HB 2BVUA 1AC6A 2VDLH 2ZG3A 4YUEH 4GSUA 4N8UA 1NCUA 3AADB 1CU4H 1QVOB 1N4XL 5FO8A 1QG3A 3HS0B 3ZHDA 3RFZC 1JP5A 4JFFD 2E7HA 4GSRA 4XN5A 4XI5C 3PGCA 1JS4A 2K4AA 5AYTA 5HGHB 4UM9B 3FTWA 5ITFA 3ECUA 3CGTA 4PGCA 3ZE1E 1E9PA 4ZBJA 5CF3A 1E7VA 3BT2L 3ESNA 4PS4L 1L9NA 1J87A 3EJUA 3FTXA 3EYSH 4NERA 1YCSA 5ISZE 3FO9B 4AQOA 1I8MA 1KJ2H 5JW4N 2H6UA 1WF5A 3DX8A 3N6YA 3MV7A 4PJBE 1IGFL 4RDQG 5DHVA 3TJEH 4FZ8H 2BNRD 3RZWA 5E2WL 4ZX6A 1RUPL 1QLFA 4JQIA 2GEEA 3U1PA 2ZCKH 4OJCA 3FCTB 4GMSH 1KCKA 2Y06L 1ETA1 5IF0B 5J57B 4NO5B 4GINA 1PTZA 4L1BA 2DV6A 3MNZB 1OOWA 4GG8A 5D4QA 3WGVB 1D3CA 2E27L 4MA3A 5CN2A 1C9SA 1PD0A 4OCXH 4YSSA 5C08E 2D3NA 3AXHA 4IOFD 2BH0A 3FN3A 4JCMA 5AB2A 4DEUA 3QUYC 4HIJB 5HXMA 2AEIT 2AXGB 2BZCA 2VW4A 2WKGA 4KX9A 4TS6A 5BZWA 3TO2A 1OP9A 1XH2A 3Q2VA 1PSKL 2A73B 4W93A 1QEWA 4Y2NA 4QXGH 5I71C 4HJSA 1QWUA 1HU8A 2Z92A 1DQMH 1Y07A 3IF1B 2IBZY 4S10A 2DQUL 1M1XB 3HN3A 1HSBB 3LHPL 2OSLB 2XWXA 2W94A 3SJVE 2C9PA 4JFDA 2FQFA 4IW4C 1UB6A 5DMKA 3KDPB 5GZNC 2MNUA 5FAAA 3PDGA 1DN2A 5EOQL 4U3SA 4K71B 1JI1A 5D7EA 4YDZA 1FYTB 4ZQKB 4G42B 4MMYA 4OLWH 5J6GB 3FT1A 3QPXL 1PW3A 4JFHE 4AKPA 1NAMH 1EEZB 2IQ9L 2R56H 5C07D 1F4YH 2EO7A 3TH4T 1WAAE 2YAFA 5IV2B 1RHHA 2Q8BL 4JFXB 5J12C 2ZXEB 2J43A 4H5SB 2LU3A 4JK0D 3K1DA 1RK1B 4Q56A 5HHOE 4AYFA 3MV9B 4XVJH 3WTWA 1U3HD 1U3NA 4J1UB 2DDQL 1J9QA 1HXYB 3DX7B 1U2YA 2VL4A 3L7FA 4A7VA 1LQSR 1U4EA 4UM8A 3U25A 3DGCR 5B39G 4KHTL 3VACA 1HDMB 1U8HB 4K3HA 4W9JC 2FATH 3LV3A 3MBWB 4TN9A 1MF2L 3U6XA 5T5NG 1MCOL 2DOCA 3KPSD 1ZT1A 3ROLA 4WUUB 1KJMA 3FOMA 1VFOA 2AEOA 2AQPA 3U46B 5EFIA 2WVVB 2XQ0A 4IJ3C 5B1CA 5TE7L 3SPCA 4WFFD 2QLVB 5F7WC 1JHTB 3MACH 3EDEA 1OTSC 1N0LA 5JZ7C 1BXUA 3N1MC 1O6TA 4H25B 4NQSA 4LPWA 2JTDA 1NGZA 1SPDA 1S5IL 3MRIA 3FHEA 2PTTA 3MNVA 3RBSA 4FG6C 5AB9A 3NPSC 2KDGA 4R97B 5IFJB 1F6AB 2VO5A 4EN3D 1ZLUH 4JZNA 4UV4H 1AIZA 2R0LL 3SDCD 1PU0A 3CFEA 1I1AA 5I0VA 4DK3A 1GZHC 2J8UE 4B3VA 4Z77B 4HXAH 5FKAA 3AGVA 1U21A 2P45B 4XVOA 5JNYB 2DM4A 2KUTA 4EQ3A 5ADPL 3L1OL 4HMEA 4DCQB 1SLUA 1YEKL 2CHZA 2KBGA 4G1MA 5GSRB 5KJ4A 5JUEH 3R4DA 4N90E 3IVKA 1RIHL 1WFJA 3EYVB 3L4XA 1ZSDB 4W9CC 2ZUXA 1XCQB 1G6RL 4Z95L 2QVKA 3I75B 3QUMB 4Y2LA 3L4WA 4LKCA 1ZK5A 2G9HA 1KB9K 1JZ5A 5C0FB 1AKJD 4B9JA 2H9GA 2UYLB 2YAPA 2BOCA 1E30A 3GRWA 4WI5A 1R19A 5EO9B 1KG0B 2VDPB 2X2IA 3MUY1 2ORBH 1PFCA 3T3ME 1BXXA 3U6RA 3U0PA 3VFSB 1EGJL 4I13B 4DJMA 1HHIB 3FONA 1U8CA 2L7JA 5DZJA 4OQTL 4CVZB 5DJZB 4C59B 3HMXL 4Q97A 3O3EA 3CZUB 2A1WH 5EBLB 3WNNA 2N1KA 3FBQA 4N2DA 3OMNB 3RDJA 5DO8A 1KBGH 3ATDA 3VH8G 1FBIL 3DETD 3CFMA 1LL1A 4H4NA 4HOMA 5L2JA 1CG9A 2FL5A 4H20H 5HDBE 1B9KA 1YQVH 2DWEA 5GRVL 3TH3T 5CUSL 1P0SE 5IVXA 5ITBH 1VESA 3DX9A 5DS8A 1OTUD 3LKPA 3SQOL 3ZKXB 3L4YA 2B1HL 1FL3B 1DEDA 1QBMH 2X2YA 4LHUA 4CU6A 3BWUC 2ATKA 3L3JA 1KTBA 3FTUA 5DT1H 3UJJL 3Q1EA 2OMZB 5KVGE 2E8ZA 5T3ZL 4OIIH 2X6AA 2XKNB 4UT6L 5EZIL 4J8RA 5F3BB 5F1KC 4R84A 3NAAH 1KCRH 2ZZUT 4H8HA 1AR1D 1OHZA 1VEMA 2MIZA 3MLWH 3A4AA 1ZLWK 5G4OA 2X41A 3SKUD 2OW7A 4BXSV 4Z0XB 2R9HC 2AV7A 1FZKB 4E41B 5L4JA 1GSKA 2PYEA 2QKIB 1GIGL 3MBEA 3O9WB 4MAZA 3IPBA 4JM4L 4OCWL 5CN3A 3FUHA 4DETA 2MJWA 2YHGA 2X4UB 2A3TA 2Y5TB 1URIA 3OKKA 2BP0B 1YMHA 1DVFA 2NXZD 35C8L 2P49B 4NC1E 1JDDA 1RVFL 2AANA 4HULB 2Q3XA 3QQ4B 4P3DB 2IOIA 1UXMA 3MRQB 1VFAB 3BW9B 1IM3D 5FYKH 5CCGE 2QHRH 3OF6A 1GZPA 1FGVH 2VLJA 2ERJC 2Z7YA 3C6LA 3O4OC 1Y0LA 3BPCB 4ZW8A 1AGBA 4KKLD 3WS3B 1OF2B 2VUOA 4NRYB 3ZXAC 2GPZA 4LDOB 3HOGA 3O2DA 4FG4A 2YKKA 4FQPA 1NLBL 4CBPA 5KVDH 4JG1H 4ORGA 3OZ9H 4PY7A 3S37L 4ZDHB 4X4ZA 3NSDA 5GS0L 1BA9A 2BHYA 2R0KH 5IOPA 1WBYB 3LMJL 4YHZH 3T1FA 2Z8RA 1OE1A 3ZDZE 1WWAX 4F5CA 3AWFA 3FUIA 3TNMB 3WFZA 3IAPA 4PJ9C 1P84K 1ZHKA 4UCFA 1TJXA 5D4IA 1EHAA 4N87A 1AJ7L 5BV7L 3AUWB 1DTUA 3N2JA 4MD4A 3SGJC 3F85A 1OPGH 1IKFL 4KMTL 3WIHA 3TEWA 4E9VA 4UOW1 5GZOD 1FSKB 1RHFA 5TE6H 3DC0A 3L9RB 1TJIH 1QQDA 4PJGB 5A16B 3BP4A 3KYNA 5LVEA 4ZSOB 1KJ3H 4GT0A 4FQIL 2ITCB 5CP7A 5AD0B 1B0WA 3CZSA 1GPOH 4NN6B 5C0GB 3BGFB 1SLXA 4OGQC 4WJG3 2ENSA 1JGEB 1INQA 2B5IB 3GSRB 1FJ1B 1EJFA 1NEPA 4XBPB 4IU3B 4Y2OB 3IDIB 5A2CA 4IRZA 3VFUA 1HXMB 3EBGA 3KLSA 1U8IB 3GHEL 2J5WA 1S7UA 3DOSA 2VXUL 3NA9L 3VXQB 4AQAB 2V2TB 2VC2B 5IW3A 3ZHLA 1PLBA 1EEQA 3BZ4B 3PAVA 5AG9A 3QS3A 4W4OA 4K5NA 4HS8H 4YS4A 4WEUD 2JJSC 2IPKB 2VTFA 4KK8D 4Y5VC 5B38B 3N85H 5DRNB 3TNNB 3NIFF 3QDJD 3PNRB 3C09C 5EU6A 3I9AA 5D55A 1QSFD 1JZFA 3MJ7A 4S1DC 4Z18A 5I66A 1XF2B 5GRUH 2WYZA 1A7BA 5HHXH 1MJ8L 2DWYA 4HK3N 4Z7QE 2DBJA 4JM2C 1MOEA 4E9RA 1T21A 4L4TB 4ZPTA 2ZKYA 4FG0A 3EYFA 2CDGA 1AQ8A 5EF1A 1ZT4B 4L4JA 4RAVA 3SBWA 4XOBA 5T3ZD 2C3VB 3V7AE 3MFFB 4EIBA 3E1F1 2I25N 1KZYA 3KW7A 3CSFA 3FB8B 1AHWB 4LLUA 1RZ8B 1LYQA 2WB1A 2YD1A 3MLRH 3PJSB 4UTAH 5I17B 1A1NA 1LILA 1AACA 3JWDC 4GRMA 4JR9H 5D7KD 3ECBB 4Y0GA 3GLZA 4I0CC 4JFPB 3IDGA 4XO9A 3ZL4H 1CDGA 1XD0A 2DYSB 4AENB 2Z31C 3D85B 2WZ0A 3SDXF 1F4XH 4LP5A 1I8LC 1N68A 4CU7A 5CNHA 4Y4KC 5IESH 3PQYD 4RISL 4F9PA 5C6TL 1WUNT 1DJIA 5GGRA 3EFOB 2MCPL 1M4KA 5C09B 4AMKL 1MWOA 1EDQA 4LRNL 1W8EA 5L6YL 3TU6A 3EW3B 4PV9A 3WUWA 4JNXA 4QF1A 4JRLA 1QUNA 3FFCA 3OKDA 4X6FB 3JT2A 2DIAA 4JG0H 3G04B 5JOFB 1C5CL 1YMMA 3AT9A 2V3DA 1N8ZB 1C12A 4LCCB 3VU2A 2FJGB 1BEYL 3MMEA 1JXDA 3ZL2A 3BSZA 3F7QA 3QUZC 3S3JA 1K2DB 2CKBA 4KMQA 1HH9A 2EYSA 4DK6A 4UI2A 4YSQA 4CADA 1BM3H 4XB8A 3T0EC 4RGNB 2DWTA 4XI5D 4E9TA 4MZIA 1C08B 1DJSA 2OMTB 3BWUF 4R7VA 1SF5A 1INEH 4ONOA 5F21B 4OT1H 3ILPB 1OARL 4P2OA 2W9EH 4XMLH 4ZW7A 4PJHA 1KCVL 4FA8A 3BE1L 4OZIB 1X7QA 2PYEE 5C0AB 3V0GA 4BQ8A 2DLGA 4AE0A 3SZKC 4WQOA 1X44A 1P7HL 4S0HA 2CK2A 3E1ZA 4KGLA 4G8GD 12E8L 3QI9B 4UNVA 2IAAC 2OSXA 4A2FA 3F7VA 4R8WL 4F8TA 7FABL 4M5YH 2BJML 2RA1A 3Q2LA 1GGBL 2YC1B 2G75B 3MODH 2WLLB 4Z7UE 1XD1A 4XN4A 1UD8A 2VLJE 5SX4I 2AXWA 1TUPA 2FSEA 4NFCA 3AQZA 4KZEL 3DPBB 3Q8FA 5FGSA 3BRDA 3V4PA 3BISA 5B7EA 3RWIA 4HUUA 2GJZA 3QUYD 4YN3A 1ECYA 1NGPL 4L37B 5GXBB 3FSZA 3UO1L 4MCZA 2AJUH 2X3CA 5DLMH 2P24B 3GJFB 4DGWC 1RXLA 1BZ7B 1ND0A 1MZYA 1AI1H 2OP4L 2H32H 3GMNA 4AC4A 4FS0A 4QTHA 4R0LA 4TYUA 1IGTA 3K6NA 1H0DA 2OZ4H 2AQTA 5BVPL 3HNTL 3P9MA 3RIFF 3VD4A 1CFNB 1G9MH 3HAEB 5FEBA 1YHPA 4PJDF 2E9IA 3S35L 4KUZH 3X1BA 1BECA 3QXUA 2BPBA 4X6CB 3VI4A 2E6JA 1FFOB 4AYMC 3U4EB 4Z7IA 5JIPA 1QNIA 4YXLL 1BVLB 1S7SB 1NCBH 1CTMA 1QNZL 4XOCA 3WEBA 2WZPD 5K9OA 1JI2A 1NMCC 3FF8A 4N9GA 1AQHA 1FV1A 3CNKA 1XSIA 1IBFA 4ELMB 3NPZB 4PY8I 3H56A 4XO4A 5L2KA 4NBZB 3NABH 3F83A 2P8MA 3KS0J 5E95B 5TDNB 3FTGB 1F00I 3BVVA 4X4YA 1DQDL 3GSNA 1D7DA 4PG2A 1QI5A 2WLIB 3H9SB 1S7TB 1CGXA 5IROC 1EZVY 5KN5A 2EDJA 3B37A 3QORB 1QPXA 2XFGB 2BK8A 2AJ3B 3NEOA 1ES0B 2E8YA 1N6VA 3HN8A 3HUJA 5LG6A 4WFGD 2CRZA 4LVNC 1P6WA 4ENEC 3BWAA 1YA5A 1H3UA 2VWEE 1JZ3A 1OZTG 1WFOA 5IQ7H 5KZCB 4YDLC 4JO2H 2XZCL 1J5CA 3AG3B 3B7SA 2FIRT 1I7TB 4QRUB 3C5SB 3ZHFA 1FFQA 4JHZA 1SOQA 3WFHB 2I9LA 4K3DL 5CU9A 4RGMC 2GQHA 5EU6E 5E9NA 4XP5L 2VR9A 3DUUA 2GJJA 3UP6A 3F7RA 5D7SH 3LKOA 3HG1D 1AZRA 2BFVL 2CGYA 1K3ZA 4KPHH 4HS6B 1WZAA 4J3UA 4QRRA 5JZ7D 1GSMA 4NCC2 4DW2H 2IBZX 3AREA 4FABH 1YDPB 3S36H 3ULUH 2DYPB 4Y4FD 3QIBD 4YLQT 3LQAH 4IU2B 2AQSA 4FXKB 3RWEA 1ZLVK 1XF4A 1TQCB 2Y4SA 2R4SH 3F00A 2JCCF 2ZF8A 3SQBB 5D7LD 3CSGA 1KY6A 4GAFB 3GDCA 4DF9A 1UOWA 1TU2B 3V0IA 4X7FC 2EINB 5BRZA 4G6MH 1MUJB 2V17H 4MNHB 4NO0A 1GC1C 1H8OA 1LXMA 2F08A 4BINA 3LKNA 2X0VA 4FADA 2CXKA 4XCEA 3MKGA 1VSCA 4PRDA 2OL3B 1NZRA 5BS0B 1N59B 1A4JB 2VZ3A 4LL9A 1PG7X 2QJDA 3WJMA 5E5UB 4N0UA 1CS6A 5I1AB 4JMNA 1KELL 3GYRA 2L8AA 5IGXH 3QEQB 3H42L 4PJIF 1T7WA 1FAIH 3OJDA 5FGBA 1YMME 1JF6A 4A2EA 1JJUA 4FHBD 5C0DA 1OAJA 1BLNB 1TZIB 2A9MH 4PJXF 3BJ91 2CZNA 2DWSA 3NRFA 4LPXA 5IB5B 3DYOA 5C86A 1QASA 3QYCA 1YYMH 1KIUA 3RPBA 4OU3A 4G9FA 4U49A 4B9YA 1M57B 5CJOH 4I0PD 2GIYA 4PRHE 1ZT7B 4QR7A 2E7DA 4P06A 5KBKA 2P8LA 1EIBA 1KN4L 4MJJA 4KX7A 1GOGA 5I16B 3VXSA 3FRPA 2AFNA 1UWEL 1DSFH 3DOHA 3IMRA 3VA2C 4YHPA 1HHGA 5EO0A 4F8OA 1HILA 4IGBA 3NFSH 3HN5A 4A04A 2A2QT 5B39B 1N6QL 2AAVA 1TO4A 1WHPA 4XVUC 3REVB 4K94C 4V1DA 3T9WA 4N8VB 3TVMA 3C8KB 1KT2A 2IH3A 1IGYB 3GO1H 3STLA 3CHSA 3JWDL 4EBQL 4DP2X 1NH6A 3W9EB 1KIQB 4OM0H 2R9HD 5JR1H 1KZQA 3NDZE 3G6DH 3QHZL 3N44F 2H2PD 4IS6B 3HBQA 4PFEA 5L4FA 2J73A 4X7SH 5C9JB 4IOSD 1U6AH 1FDLH 5LHDA 4GG6F 1F58L 3CXHK 4W6WB 4ONFH 4JBSA 2Y25A 3DHUA 3P30L 4MJID 1DJXA 3VRLE 1BREA 1SEBA 4L05A 5F7HA 1Z1WA 5KS9A 1R33A 1OT1A 1UURA 2C8NA 2AJYH 1C8PA 4KTEH 2C9UA 1RSFA 4LSSH 4X4XA 4YC2C 2G60L 4OZFH 4QRPA 2JKSA 2NY1C 1MY5A 3MRCA 3PWVA 3PWNA 1JNNL 4JDTL 4FAAB 3CUPA 1Z9OA 2OXHB 3WGUB 3MZGB 3ZUCA 3WY3A 5GQBA 1IEHA 4ZX5A 3OKLB 4OZGE 1NM9A 5CS7A 4G3YL 1GYAA 3J27A 1QP1A 4Z7VA 2X1OA 3IDNA 1KYUA 1YPZF 3BKJL 3WFEL 3K6DA 3CHXA 4FRWA 3QZBA 3S96B 3VXOB 5L2KE 4J3SA 4P5TB 1GYVA 1O7DE 4XCFH 4K7PY 5F3HA 3EUDA 1AANA 5EHFA 4GB9A 5CEZD 1QVOA 1SJMA 2WBXA 3LPPA 2BMKB 1OM9A 1J10A 2JKLA 3S3CB 4B9KC 1E27B 1TQTA 1J1XL 4WW2A 2XI9A 3VRIB 3VH8B 4AEIL 1M71B 1NBQA 4L8SC 4UAHA 1S7XA 2J1XA 1R46A 1Q0YL 3QAZB 4CNIB 1JZJA 2WYTA 1VACB 4S1SL 3PGDB 5EUOB 5FO9B 4UM9A 3OSKA 4Z8FL 4O51B 4PCSA 1P9MA 4U1MA 1NIFA 4G7SB 1AS8A 4PRPE 5G4NA 5JHMA 3P69A 4ZTOL 2AJXL 3WKMH 1KTKE 3WDIA 3IKKA 1GGCL 2DMKA 3WELA 2XTLA 3IMSA 4KDTA 3B1TA 4X83A 2CMRL 4P46B 2GJ6D 5T1MB 4HZLB 4NZDA 3KLKA 4MXWL 1JCKA 4GKOA 2EC8A 3O6LL 3QG6B 4UT9H 4XB7A 3SE6A 1AXSA 3T2QA 3A6CH 2BNRB 3QDHA 4BE6A 1SMAA 3P2DA 3ZKMC 5K1VA 2ZWLT 4OCRL 3PS6A 1KYFA 3FCTA 1RIUH 2I7OA 2IALA 5IF0A 1I31A 3IS1X 5TQ2L 4NO5A 1HJCA 5DUMH 3VWJD 5LNGA 1R17A 4S1DD 2ZOWA 1NAML 2QELA 3MNZA 1DJHA 5GJSH 4Z7NF 4F37K 4P2RD 1G94A 4ZS7L 2OK0H 5DUPH 4M48L 3ZN6A 3SDAC 4D0DB 4G8EA 4M5TA 4S0SD 3GXUB 2AXFA 8PAZA 2G0LA 3HVNA 4N9OB 5D2NB 3CFIC 1S5HB 2AXGA 2N7SA 2O72A 1NFAA 3VTAA 3VXRA 1L6ZA 1RZJL 5AKVA 2OULB 1MHHB 1SXCA 4G7YL 4N0UE 4QD2E 3TIEB 5TFSL 1JVOA 4JPWH 2LLGA 5I8CA 4PWGA 1UFGA 1G5GA 4ANVA 3MLZL 1M1XA 3CVHH 4WIQA 4KTGA 2OSLA 4Q6YA 3P9LA 5EU7C 1ZLSH 1PBYA 2Z31D 2BVPA 4AYSA 1WIUA 3MR9B 1J8SA 1U2HA 1V54B 4Y4KD 1E6OL 2IDTA 4O9HL 2X40A 4Q9RL 1W72L 5DHMC 1C16B 1WYJA 4ZQKA 3BPLC 5J6GA 2VZTA 4OUOA 4NGHH 5DMGC 4G9FE 2Y1YA 5I74C 5ILTL 4HJTA 4F57H 2XX0A 1EEZA 1MIMH 3P40A 2CA4A 4RNRA 3V6ZB 4OKVB 4M6NL 2QQLL 4HLJA 2WVUA 1LO3L 2QSTA 5KYYB 2JKXA 4JFXA 1QTPA 3MLPA 3RL1B 3VXSE 3QUZD 4QXWA 4J1UA 5CJQL 2CR3A 2VABA 2JF1A 3DX7A 4UF7C 4MXVE 4JFOB 1WWCA 1Z7JA 4NN7C 2PABA 4OCYH 2MPAH 3VFGH 1P5UC 1MCSA 3FU7A 1RPQA 2VXQL 1FAKT 4V1DE 2IGFH 5SV3A 2EDXA 3L1EA 3C75A 1UM4H 3X1EA 1HDMA 1U8HA 4XCNB 2VZSA 3MBWA 3QUXB 2VIRB 4G7QB 1T6WA 4RDBA 2AJSL 4M56A 1MCHA 3U0WL 4MBRA 3KPSB 5I1EH 2E9JA 5KUMA 1GA2A 3U46A 1F86A 3GMLB 4HAFA 2BSCA 4X7TB 1MFCH 4M7LT 3NJFA 5G55A 4XPFL 4L1DA 1LK3H 2FD6L 4RETB 1XV8A 2OCJA 1A7QH 3KPOB 3FMGL 3ZTCC 1T04B 4MA1B 3RWFB 4PHZA 3FCBA 3M88A 5DQ9B 2O61B 4PJAB 4XMPH 2Q7NA 2HLAB 1BV8A 5FGCB 3GXTA 4P9MH 4U1JB 3V52L 3HNSH 4MTMA 3ESOA 4IMLA 5CN1A 4GKLA 5KVGH 5KJRL 3ARGC 1WCBA 1H8LA 5TGBB 3SDCB 4KVCH 4JQIH 1CZ8L 2Y1AA 2ZKXA 1T1ZA 4Z77A 3BH8B 1ADQA 1G7QB 2WANA 4ZJ9A 5JNYA 1QMUA 1V7ML 1OSPH 2CJUH 1NGXB 3I84A 4DCQA 3IBEA 3JSSA 5GSRA 4X2UA 3QXAA 3EYVA 5ETUA 1FZOA 1ZSDA 4Z7VE 3ZX1A 2XQBL 1XCQA 3OV6A 3QUMA 2J1YA 2X12A 3WIIH 2EDFA 3HC4L 4N2CA 3UBXB 4KKNA 3BC9A 15C8L 5KSBA 3QW9A 4BGLA 5ABZA 4P57B 3C60B 2EE6A 4FYSA 4N6RB 2X6UA 5EO9A 1K9TA 1KLGB 3ZQ9A 4CVWA 3M6DA 4GW1B 1JNHB 3VFSA 5GS1A 1WEJL 2KERA 5H2BB 4LQFH 4K5PA 4IJTA 2VOTA 4CVZA 4XH2B 5DJZA 4EKXA 3EUUA 1SM3L 5EBLA 5BZZA 3MN8A 2PLTA 3BD5A 4HIXL 3AU1A 3PDOA 1FVCB 1BM7A 4MA8H 4JEGB 1CXEA 1LWRA 1BZOA 3GRBA 3PWLB 4ATWA 1P7BA 2RCSH 4L5FE 3UIYA 4PLJD 2IDCA 4UUJB 5D8JH 2QHRL 3ZDXF 4NLHA 4LSRL 3PNWA 1QPPA 4F7MB 1AXTH 4UBDC 1FL3A 5HI4C 5HDQL 5CLTA 4YFLI 3B2VH 2PWEA 5E6ZA 1E6JH 3K7UA 4FLRA 5JIMA 4EO5A 1IL1B 3QULA 5DO2D 1PX4A 2OMZA 4ODWB 4ENED 7TAAA 2XN0A 2COVD 1OP5K 5F3BA 1D7CA 4NNPL 3UACA 4ZMPA 3HJ0A 2NY2C 1ONQB 4PWIA 1AR1B 4WAFA 1EJ6A 1MQ8A 5DZPA 3A21A 3L2NA 4QXTA 4QIRA 1ULVA 4K15A 2F9BT 5LCVL 3A23A 4KI1A 4Z0XA 4UQ9A 1PCXA 3RZCC 1FZKA 3HKFA 3NJIA 3H7LA 4NHUB 4E41A 4HOXA 1CFVL 5J9PB 2QKIA 5D7HA 5HY9B 2VISB 5JPMB 3ZZ1A 2EACA 5ICZB 4LVOB 3BVNB 2FTAA 2QVMA 5F7LB 3EOYG 1NPJA 3GB7B 1DL7H 1HZHL 4GO8A 1JNLL 3QFJD 2BP0A 3CPLB 4DK5A 2BSTB 1Q9WB 3T6ZA 1X5HA 4L8CB 3MGOB 4YDNA 4P3DA 3MRQA 3BW9A 1IM3B 3MPCA 4B60A 3VFPB 4GAGH 3AWEA 4Z3TA 3B34A 1A6UL 3SPHA 5IOKA 3WS3A 2NX5D 3VM5A 3W0WA 3DI2B 4NRYA 4ZFGH 3EDJA 4X98B 2O5ZH 1YEIL 2FT8A 1GMIA 5T8IA 1VGEH 3NZSA 4H88L 2I5YH 1TTBA 4KV5F 4UQIM 5SV4A 4ZDHA 1OGSA 2LHAA 3CLEL 2XJKA 2R2BB 4MRCA 4OD1L 3SKOB 4RAHA 1FYTE 3NRPA 1AZVA 3O8XD 4GMTH 1SY6H 4HS8L 1E4KC 5GHWL 3KNBB 3TNMA 4QHKI 3CFNA 4PN6A 4QMEA 4XODA 3C8DA 2ZKWA 4AIOA 2HFEB 3VCLA 4E68A 4KVNL 2V2XB 4J8QA 1G7LB 3MV9E 2RFXB 4GSDL 5A16A 2GSIB 3GXIA 4AGNA 2XPGA 2ITCA 5DGQA 5AD0A 4KZ0A 5C0GA 2QVTA 1JGEA 3GRWH 3KPTA 3N43F 1UYWH 5FUCC 3GSRA 4L23A 3T6WA 1FJ1A 4GKSB 4FF9A 1NCCH 3PWJB 4NP9A 4UB0H 4Y2OA 4I18C 4YDVB 1AD0A 4R7NB 5B1BB 2KPWA 4AGOA 4EOWH 3KL0A 1G6RB 2YWZA 2WSKA 3WIFA 5C8JB 3MSPA 4WUUE 3WJJA 3BVXA 5HHVL 1QR4A 1CL7H 4OBRA 4XNYH 2C34A 4JR9L 5ICXB 3BIBX 4LVHC 4AEEA 3QHFH 3ZL4L 2FWOB 3C2AH 1E4XH 1VFBB 3BZ4A 4ZD3L 5I6KA 1G84A 4LCIH 3B9KB 1F4XL 2EH8H 4XVUD 3AFLA 5E8DL 2IPUG 4YHIA 2CD0A 2IPKA 1CD1B 4FNLL 2Z93A 4W9ZA 1N7ML 5B38A 3TNNA 5DRNA 3RX7A 3CBKB 3QDJB 5DHEA 2HTLC 4OI7A 2K9UA 1QSFB 3WD5L 1LD9B 3V4VL 4FFYL 1XF2A 1AGFA 1M05B 1T1XB 2DQEL 1K8DB 5FS5A 2JLPA 5JPNB 3PXJA 3BZDA 1SLWA 2XA3A 4L4TA 3SCMA 3B8SA 2ADGB 1FVEB 5FUOH 3PABB 1ZT4A 3CXDL 4YIQB 4EI0A 2C3VA 3G5YB 1GGIH 3UEZA 3MFFA 5EULV 1CI3M 4JKKA 5HGAB 1SHXA 1AHWA 4WY7H 3TEZA 3UO8B 2YXVA 3CDGB 5I17A 1U92B 5AOZA 2QQKL 2DQGL 5DD3L 4ZW3A 3ECBA 2VDQL 1B3JA 5J3HC 3PLYA 1NM4A 4JFQA 1TQVA 1LEIB 5FHBH 1R24B 3D85A 5LB1A 4KROD 1JXJA 3PAYA 3ABZA 1XBRA 5TF1H 3PQYB 2AV1B 1GMEA 3EFOA 1F11B 4JCLA 3C5ZD 5C09A 2YKLL 3O2DH 2GT9B 4JY6B 2QR0B 5G2NA 5KSUB 3KM2A 4QRFA 5KVEL 4PRID 3G04A 5JOFA 2BLFA 4TLKA 4F9LA 3OVUB 4LCCA 1UZGA 3VG9C 5C0BB 2CK0H 3D3VD 4UANA 2GTZB 1K2DA 4NDMB 4D9LH 4P2AA 4LB8A 5ALBL 1USQA 3IMUA 4YXKH 5I1GL 4YEEA 5E6UB 3WIHH 4N5ED 4N20A 5CWSB 3NACL 3NCMA 3MRGB 2VZOA 2MMXA 3BUIA 3PL6A 3FSAA 1HH6B 4K23H 4R4BB 4NXSA 5I1CH 1NCIA 4JVPA 3QEHB 1XH3B 4B9GA 3WFCH 3DMMA 3ILPA 1MFUA 1UJ3B 1XCWA 2HKFH 1DQIA 1JD9A 4R7DB 5BV7B 3IM1A 4E41E 2LABA 2VCOA 4JAMB 2NZ9C 4G72B 5C0AA 4YXHL 5DRXB 2YFOA 1G9ML 4BWTA 4DEWA 3GSXB 1NCDL 4G8GB 2YAEA 4QYOB 1TCMA 4TQEL 2VR7A 3ZKMD 1DQLH 3F58L 3MX0A 4BZ1A 4TTGA 2C9AA 4OF3A 3MOQA 2WLLA 1B6UA 5IG7A 4CSZA 1NQBA 4WFHD 3ZGHA 1TMQA 1IBDA 3IGUA 2WKLA 4FTVB 1NEZA 4IHOB 3SOBL 5KOMC 3QJRB 4LMQE 3DPBA 4L1HA 1OTTD 2G4GA 3SDAD 2K8MA 2A9AA 1M3JA 2M83A 4N28A 3F7PC 4K7PX 5F9DC 4DGYH 3LNEA 4L37A 1LK2B 1JPFB 4YHMH 2AK4D 4MS8C 2OSWA 1IT9H 1FL5B 2JH2A 2P24A 3JUZA 2XN2A 5KVFE 1BZ7A 3MV01 5ES4B 1MH5B 4WV1B 4XPAL 5IFHH 2FECI 1D9KB 2CHWA 3E9TA 1E67A 3FTZA 5DMJB 4ABUA 5F7MC 4HIQA 4JO1L 5KG9A 2NDGA 2H1LM 3DA0A 5MEPB 1IJ9A 4H2AA 1KBBA 5J6HB 1CFNA 3UXFA 3HAEA 5DMIH 1C5DB 4KQ0A 1BQSA 1ZS8B 4PJGE 2IPTL 4ODTL 4ZSOE 1FFOA 3U4EA 1DVUA 4Y9FA 4FD0A 1S7SA 2XLLA 4QHNB 1OAXL 4KXAA 1S4IA 4PQXA 5F3FA 5I75C 4ELMA 2BDNL 5CO1A 4Y2DA 4GRLA 3UTOA 1MJ7L 5TDNA 4HIEB 3FTGA 4MKTA 2D3LA 3D4YA 1KJVA 3F3HA 5JIKA 2D2OA 3H9SA 1S7TA 4W6XB 4AYID 4D9RD 2GSGB 5J56B 3TBYB 3LEXB 5F9JB 2F19L 1MCBA 1F4HA 2W1NA 5AVSB 3A67H 5AQ0A 3KXFD 5D4JA 4I88A 3QYNA 8CGTA 3OPZL 3MRBB 4QGTA 1U0QA 9CGTA 1HYSC 1TR7A 3QDMD 4LRIA 3FT2B 2BSBA 2J72A 1PX3A 3BSZH 3D52A 1I7TA 3C5SA 3RDTC 3S98A 3OGCA 4KX8A 2CKBH 2YPVL 2XQYK 5D1ZB 4GUPB 3LH2H 2YMXL 4IKJA 5I1LB 3ZKSD 5AW6B 3TZVC 2FHCA 4L9DA 1GGTA 2P80D 2X9XA 4YWGL 4HS6A 5BO0D 3NIFB 1S6NA 3H54A 2DQTH 3GIZL 2E9GA 1UT9A 3U7YL 4CC4C 1YDPA 4L4TE 4NQED 5EMYA 1G7MB 1BAFL 4Y4FB 3UADA 2FT7A 3QIBB 1S9XA 4IU2A 4XMUA 1YYML 1FGNH 4FXKA 1EXGA 2HX7A 1BJ1J 5DJ2B 1XXDC 1M2VA 3UTSA 2G2RB 5CJOL 2YPLD 2F53D 3SQBA 3PJLA 5CLYA 1IGMH 1J5OL 5FR3A 5CINH 4F8PA 4WKZB 2E47A 1MUJA 1X9RA 4JY5H 3AAZA 4MNHA 1F0LA 3MUGB 4MJ4A 1MFNA 5DUBB 2A7BA 2XZQH 2C4XA 4LIQE 4HPYL 5CR1A 2OL3A 1GOHA 4NM8H 4PM1A 5BS0A 4J5VA 3IPFA 4L4VD 1A4JA 4D8OA 2NCEA 5C09E 1MI5D 5I1AA 3I6LE 1WFMA 4OGAD 4L3CB 1MWAL 1HI6A 3SDXB 2AEPH 1A7NL 2B2XH 2O6EA 5LBSL 5E1QA 2Y9RT 4ZPVA 4OJEH 4YBLC 5C0EA 1CDJA 2NY0C 4BCYA 1ORQA 1KN2H 1BLNA 1TZIA 1U9KA 3ESVF 4S1RH 4AEHH 4TUOA 1Q1PA 4Q4EA 2YGOA 1CUOA 3VVVA 4D3CL 3OR6B 5IB5A 1BF2A 3OMAB 4KO5A 1NWPA 5E1IA 3HG5A 5I0YA 1KXVC 1LMIA 4RGNE 2D8KA 3MFGB 3FUKA 1PKQA 3ZZSA 1E4JA 3A6BL 2EXYD 1V3JA 4I0PB 5GGUA 1L6PA 2FE0A 1BGXL 1SMOA 1AVAA 5HSFA 1TLMA 1CFQA 1W15A 1ZT7A 2GIXA 3PPEA 4HXBH 1A6TB 1FLRH 4LSSL 5ID1B 5DUJA 1RJLA 5I16A 2AQRA 1O6SA 4AQ1A 1OCWL 4UINL 4HHGA 4UBDD 4OZIE 5C0AE 2WXPA 4UU9B 3INOA 4KJWC 5B39A 2NY3C 4LSUL 4XPTL 5HYQB 3I50L 3L9BA 3REVA 1PY0A 2I9TB 3CFKB 1HNFA 4M6OL 3N1QC 5HHMD 1SBSH 3N1FC 1WIOA 3C8KA 1D5XA 2WBJB 4LNRB 3VW3H 2WXKA 1IGYA 3V5HB 4NQUA 1J05A 3W9EA 2FJFB 1BQRA 5LN4A 5B8CC 2ZJSH 5CILH 5IJCC 2XVLA 2EKSB 3RI5K 2GEQA 1BQLL 3APDA 1I9RH 3QDGA 5EOTB 4A55A 4UMSA 3MREB 3BPNC 5T1DL 3KYOB 5C9JA 1DBJL 4LLMB 5IMOB 4WI7A 1OM3H 4AZ8A 3RIKA 2XKUA 5J13B 1F1GA 1FNSH 3EJZD 2PP9A 2J25A 5DQDH 1J8HD 5A6LA 5D1QC 3K71B 2DKSA 4LSQL 1IAII 4NSKA 4W9FC 1WJ3A 4B27A 2X9YA 3BJLA 2CXGA 4N25A 3STZA 2OXHA 2CCVA 3OAZH 4RZKA 4FGMA 4V2CB 2HKAA 1WG3A 1EV2E 3QCVL 3TT3H 5C3LD 2CO7A 3FU9A 3H4HA 3OKLA 4X6CE 2BINA 4NKIH 3P3YA 1Q0XL 2B4CC 3RVUC 3L3OC 4UAOB 4I3SL 3EZJB 1J1PH 3BP5B 3ZO9A 3DO7B 3SDYH 1MVYA 4ELME 4PJDB 3QXWA 3S96A 3VXMD 3VXOA 4P5TA 4R5XA 3QZOA 3PWUA 3WN5C 1M7DB 5DUML 3H9SE 2H5UA 2W0KA 3UGUA 3WI9A 1QHOA 1FIEA 3G6AB 1KGYE 1Z32X 2FYYB 1E27A 4WJ5A 1I9EA 1IC5L 1XSOA 3L7EA 1JHKL 2E5EA 2OR9L 3VH8A 3VRIA 1M71A 2K7QA 4JFFA 1CT8A 4CNIA 6FABH 1TIUA 5JXAH 4KKBC 4HJEA 1VACA 3OQRA 4GH7B 1H6TA 2BIIA 1ORSB 3KEHA 3DDFA 4I2XB 4O51A 1YRKA 4LASL 2K1MA 4Y9EA 5HYIA 1RCYA 1PIGA 4ESKA 5ACMA 3F7KA 4UTBA 1A65A 1F6FB 1J8RA 4GEIA 5DJ8B 3HS9A 1CQYA 2XWEA 2AGJL 5T1MA 2GJ6B 2EIMB 4HZLA 4KJPC 2QFPA 3BZFB 3NCXA 1ZLSL 3TA3C 1UZ8B 3QG6A 6PAZA 4TSCH 3BDXA 4YL9A 2PCYA 2BNRA 1IRAY 2QMJA 4G1EB 1I3GH 1S7VB 2HAZA 3B7YA 4Y5VB 3BX7C 1FYHB 1S9KC 4TQPA 2CRMA 5DD6B 1ZEAH 5AW0B 4MDIA 4BH8A 3HLKA 2HTLD 3VWJB 4TM9A 1JPST 2ZOKA 3LEVL 1GCFA 2APWA 4KRPC 3LQZA 3GXFA 4MFHA 4EIGB 1T3FB 4P2RB 1XGUA 1CFTB 3QCTH 4HVBA 4F37F 4GAAA 4BBWA 4D0DA 5JOPD 2WYHA 4NFBA 2BSSB 3RE0A 4Z6AT 2FX7L 2JCCB 1S5HA 3DURA 1HXKA 2XV6B 4K4KA 5BS0E 3U48A 2DIBA 3UABA 2E4TA 3U83A 3KLHC 3TIEA 3LNDA 2ZUQC 4L2YA 4K7PH 1WRFA 3LS5H 4WU7A 3QEQE 1K6QH 3KGTA 5D93B 2V8LA 1SZNA 3D1MC 4DZ8B 4DGVH 4NWTL 2VQ4A 4AGPA 5J3HD 2YEZA 4RX4D 4XNMB 4Q9CA 2APBA 3MRKB 4TOYH 1IE4A 4XXCC 1XIWD 2A99A 3MR9A 1RUQH 3CZJA 2I27N 1O7VA 4OZHA 3CK0H 4KKRA 5F9WB 3V55A 4BUHA 3KLDA 4PJIB 5JIDA 1ZHBB 2Q1EA 4RBPK 1B4JL 2Y23A 3IDYC 3CE1A 1MXGA 4M7KL 4LT7A 4F1SA 4JGJA 4HP5A 3RJQB 3FB5B 5FM4A 3DRQB 5HVGB 5C07A 3V6ZA 4NHCH 3UPCA 2I60H 5KYYA 5MI0B 2CLVB 3VU1A 1ZTXE 1NUDA 1ODUA 1HSAB 1FLTX 3QUZB 1P6AB 1OALA 5JW3L 1T0NA 1K5NB 4YDIH 2Y36H 3CFCH 2D03L 5GJTL 1OSPL 3V5KB 5K59E 4FQ2L 4EVNB 4AKQA 4KQ4H 2X9ZA 3HZKB 2WLMA 4XCNA 4D9QE 5E99L 2RIKA 2VIRA 3MOAH 4O58L 1U8MA 5E1GA 2JJTA 3L6FB 3KPSA 3LIZA 3NSXA 3FTYA 5FDYA 4ZUWB 4OM1H 2JQMA 1ERNA 2NZ9D 3GMLA 3CU7A 4AG4L 2JIXD 5C70A 3QC6X 5HPMB 5BCAA 4WENB 5I0ZA 3FUDA 4HIPA 1LE5B 1UQSA 4L5FH 2APSA 2FB4L 5JHDB 1WK0A 3RX8A 2UZIL 1T04A 3RWFA 5DQ9A 4LQFL 2O61A 4OLVL 4AIZB 3GIVB 1CLOL 3N44B 5GS2H 3WS6A 2Y07L 4AXWB 2OM5A 1AQKL 4GG6B 2QSCH 4EN3A 5TGBA 3SDCA 3V95A 2A74B 4N0FA 2E3VA 1AGCA 1CICC 1OCOB 1A0QL 1ZLDA 3LPOA 2A9NL 1KEGH 3BH8A 2GKIA 3AC0A 1G7QA 3NCCB 2ZWZA 5LNDA 2ZIDA 1NGXA 3P0VL 4GEJA 3CSPA 5DRWB 4RSYA 25C8L 3F8UB 3VXPA 4ODVL 5D71H 1NCTA 2LE9A 1WA1X 3E8UL 3QISA 4R6UA 2WTOA 1MW1A 1FL6B 2OS7A 4HDIB 4P0DA 3WSQL 5FWRA 1A6AB 1AKJA 2DLIA 4WF7A 1WS8A 3UC2A 5L0QB 2NXYC 3RTQD 4UQBA 4P57A 1LJMA 4N6RA 1NAMB 1SJXA 3T2PA 1YPZB 3SPVA 5SX4H 3VD2A 4OTXH 4GW1A 4IRJC 4KTYA 1JNHA 3ALXA 2DQHH 5H2BA 3JVGC 4HS3A 3E8VA 4IBWA 4XH2A 4LL4A 1LO0H 2AAAA 2Z65C 3EFDL 5EUOE 1AGEA 1FVCA 5T1JA 4JZOA 1KENL 1RZGA 1RPKA 4Y5XB 4M1GH 5F9OH 5I6PA 3PWLA 3I9PA 1UEMA 2J4WH 3C08L 1AFVL 1XTMA 1P1ZB 3K6SA 2X0WA 2IOOA 4EMZA 1AC0A 1I4FB 1FN4B 5T33H 3L95A 2K45A 4NI3A 1LDPL 3LXBA 4F7MA 4BFIB 4O2CB 5IVXF 5F7EH 4ZFGL 3JV6A 4PJ8C 1VGEL 2NNCA 1UA7A 1WO2A 4LCUB 2ICES 2M26A 4ODWA 5C0ND 4IRSB 4F2MB 3MCKB 3PP3K 1JZDC 2BNRE 3MJ6A 1HYSD 1W72B 4ODSH 1ONQA 5ID0B 4P07A 4GO9A 2KYIA 4P59L 4GQPH 1UZ6E 4GMTL 4FC3E 3M86A 2B7DT 2HFTA 2VDRL 4U0RC 2EVJA 1AIFB 4P5RA 1NBYA 4NHUA 1GXEA 2XVGA 4I1PA 1RI8A 4HUKB 3V10A 1JERA 5JPMA 2C4FU 2VISA 2R1WA 1UATA 5ICZA 1F4AA 1ZXKA 3BVNA 3W39B 2GCYB 5DTFB 1P5VA 4HJ0C 5D2NE 3SPJA 4PLKC 2HFGH 1I3RA 1TVBB 2FZ3B 3GGWA 4Z7NB 1FP5A 3CPLA 3NCBB 3MCG1 3NTCH 5EBWA 2XKSA 3MO1A 2FUQA 3MV11 2VXSL 1IM3A 1DVZA 5ABDE 1OAKH 4PJEB 5F7AA 2ICEC 2NX5B 2ESVD 5E5MB 4GAYA 3UIZA 2PN5A 2IAND 4DWHA 3ARFD 1UACL 4HH9A 4LP4A 5AWNH 2XCMC 4HJGB 4YK4B 1EO7A 3UDWC 2XVKA 1FC1A 5MP6H 1TZGL 3RL2B 2OYPA 3QCUH 5J1SC 5LBGA 1H5BC 3KPQB 2XWTB 1HINL 3QPKA 4YOKA 4OFDA 4LCIL 2CO4A 4XBGA 3O8XB 4G8IA 1IUZA 4LLAA 2WK2A 2X5PA 3QZPA 4FE9A 5TF0A 4HW6A 1JCVA 1G6VK 2HLEB 3F64A 2DMHA 3X3GH 4L1LA 5FUZL 3V7MA 4G5AA 3FYEB 5L9DH 4X4ME 4K8RH 2HFEA 1HHJA 2NY0D 4GP4B 2V2XA 4QXUH 4M6ML 5GZOA 1L7TH 2M1KA 5FYLL 2BY3A 3QUMH 2RFXA 2DI9A 1LE9B 2GSIA 5FDWA 4LNVA 3N9GL 3W2DL 2VKWA 1T5KA 3OB0K 1KIPB 5GRXG 3VA6A 1KYAA 4PCKA 2WM0A 3UBHA 4YZFE 5IQ9B 2VDPH 3GZOA 4GKSA 3CFQA 3PWJA 4WWNA 1UT1A 2OW6A 4YDVA 4R7NA 4BK5C 1REIA 4FFWC 1G6RA 1TVDA 4GFXA 4Q6IC 5DJYB 3RWHA 5FK9B 4WY7L 2V9UA 3KPSE 2FCBA 2A6IA 4HWNA 1WT5C 4JLRB 1EHNA 3U30C 4DKDC 3W81A 3LH8A 3MLVH 1PZCA 2FWOA 4LGRB 4N0CC 3KR3H 4P4KC 1VFBA 1CE6B 2FR4B 5IJVB 2MRYA 4W68A 4IQHA 4M00A 2HTKC 1U42A 4OQTA 2DW5A 3FT9A 5TF1L 3UJIL 1GTFA 3HMXA 4PJAE 3OWEA 4XMKL 1DBBH 3VXQA 1BSIA 4XWGL 5FGCE 5G5DA 3PXHA 3QDJA 2W0PA 3HHMA 1QSFA 3ZTNH 1YJDH 2R51A 3II3A 3SGEI 4XCCL 2OYMA 5AVVB 2V5TA 1M05A 4G6KL 1T1XA 5F6HI 4ZMVA 2LVEA 1K8DA 3ALPA 1FA4A 5CGYC 4X6EB 3PFUA 2FQDA 3HHRB 5D5MF 4I85A 3T04D 4GUCA 1J88A 4NPYB 1G0XA 3KEDA 3UEQA 1GYWA 3RWJB 3VFTB 1CF8H 4Z9KB 1CCZA 2ADGA 1FVEA 3FTVA 3ZMRA 2ZXQA 4YIQA 5E94B 3C6EA 4YXKL 4WLCA 4GSXA 4OFQA 1XGYL 3G5YA 4UT6A 4A39A 1P4LB 1D7BA 1RURH 4XWOD 4WVRA 4YDKL 3WNKA 2ZXAA 4JN2B 1JGUL 4YC2B 3G5VA 5D1QD 5HGAA 3ASWA 2CDFB 3ZZLA 4IBUA 1E90A 4BM7A 1MFDH 1U92A 1RKRA 1YNLH 3ZDYF 2P46B 5ACLA 5KSVB 3L5XH 2R29L 3ELQA 1JWUA 5T3XH 2PPFA 4DGIH 4KROB 3B7TA 2FQGA 3UTPD 3PQYA 5C9KA 2OTUB 3F84A 2AV1A 1PG7W 4IRZL 3KYMB 5EOCH 3C5ZB 3UTSB 4DHLA 3R1GL 2BX5A 3QO1A 1T0PB 5BO1L 1DQLL 1F2QA 1VZHA 4MB4A 5D1XD 1F2XK 5KSUA 1H8SA 3HIZA 4GAJL 4NZTL 4AUYA 1PLAA 4JGNA 4J3BA 1SF3A 4PRIB 1ODAA 4Y4HC 4BKLB 1KGXA 1QFWL 5KVFH 4XGZA 3D3VB 3FSOA 2VUKA 4NDMA 1AD9B 1CXIA 3D08A 2UX6A 4KK6C 1AOHA 2H0FA 2W65B 4KKBD 5AZ2L 5E4OA 2R0WH 4P5SA 2OBGA 3MRGA 2P44B 3ARBD 4JJOA 5D6CA 4AGQA 2YSSB 4R4BA 4IHBA 1HH6A 3QEHA 4Z0BL 3HEIB 4FJYA 2GJRA 2BP8A 3KVQA 1SXBA 4LEEA 4PB9H 4OCSH 3RWDA 1H19A 2AXJA 4JAMA 5JHLL 4KJPD 3QR1A 3VGHA 1AQDB 3TA3D 2MTAA 4PJHF 4AQEB 2HKHL 4XAWH 3WO3B 1QFOA 4G8GA 4LCWD 4QYOA 4AYGA 5HVHC 1P2CB 2VC2H 3KGUA 2H6PB 3I3DA 3MJ8A 1OXYA 3PCYA 4HLEA 2EE2A 1UCTA 2CGRL 1HL5A 4O02A 3IK2A 4F92B 4IHOA 4KRPD 3VX0A 4BFNA 2C4FT 3MLUH 1EXUA 2FO1A 3OSVA 2XYCA 2CUIA 2FRGP 3NSCA 1FPTH 1XGQB 2ZYRA 3FPYA 1UD6A 4LK4A 1BFVH 1A2YA 3BCDA 5AL8A 3QUYA 3SDDD 1LK2A 3HRPA 1DP0A 1HCFX 2V4LA 4XR8C 2AK4B 1JYXA 4B5EA 4CN6A 1JZ2A 3KLHD 3KVDD 2MQ0A 3EYOA 1KXQA 1ILUA 2B08A 3H3PL 4WV1A 4QGYA 5E2VH 1M42A 1BHGA 1LM8V 1QUPA 1JE6A 1ML0A 3GUFA 3V0VA 4P49A 4F7CA 4CMMB 5I15L 4I8DA 1T0OA 4KVPA 3LH2L 3V4VB 2UZYA 5J6HA 5CZKA 3KCPA 2WUCH 4K73A 4QEGA 1ZS8A 3QJHB 5E8PB 1E43A 1IKNC 3NIDF 4QHNA 3IFLH 3TBSA 2WZPA 3NSFA 2QL1A 4HPHA 3VI4F 1P7KA 1H9DA 1L9PA 1WBZB 3CC1A 1CK0H 3P0YL 4HIEA 4PWFA 4KNTA 2XHNA 4LIQH 1UD4A 2R69H 1IAKB 2F7PA 1QATA 4G2AA 4MYWB 5F89B 1QHPA 32C2B 4MB5A 2GSGA 3N43B 2GI7A 4J28A 3LEXA 2E56A 4UZSA 4R26L 1R3LA 1QFPA 1U8OB 2VDQB 5DVLA 3WUZA 4LHQB 1OY3B 2BSDA 3KXFB 5KANG 1PS3A 2G5RA 3FCSB 3MRBA 5SWQA 5CD3A 2FHFA 2VERA 1R3KB 3QDMB 3HUJF 2XY1A 3FT2A 1BG9A 4NM8L 5E9AA 3UROR 4YSCA 2COQA 1CGSH 4OLZL 1OGTA 5KSAD 2DF3A 3V4PL 3QDJE 2F5BH 1WZ1H 4GUPA 1QSFE 3DO3A 2DH2A 3IMBA 1Z66A 1VJSA 3AZUA 4MVBD 2WXIA 1EO8L 3HG1A 2IAMD 1B4RA 3MGTA 2NZ1A 3KL5A 4MMZC 4FQXC 1JV5B 2BNQB 5LAXB 1N19A 5C0RH 4NQEB 3BFWA 4R90L 3X14B 1G7MA 2C9XA 3EJYC 3QIBA 4Y4FA 3TYGH 1JGDB 2QPSA 3WFDH 4J23A 5T3ZE 1DANU 3HRZC 2HUEA 4B3EA 5DJ2A 1JGLH 3WNMA 3L1GA 3MLSL 2YPLB 1CFMA 4MWFB 2F53B 1QBAA 2IBBA 5D7LA 1IFRA 3WE6A 2Q5BA 5D7KE 1CICD 4BZ1H 3KGRA 3ZLQC 4WKZA 1PX8A 4ANXA 2NY5H 4HGKC 1XR8A 2FSDA 2PPAA 3BQVA 3MUGA 4A2LA 5EIIG 2WXMA 2QTEA 3VWKC 4KKPA 2WCGA 5DUBA 5C6PB 4Q9QH 3UAJC 2VRAA 3ZQWA 2E46A 3Q6GL 5L8KB 4OGYL 5IQOA 3PQYE 5FA3B 4L4VB 4ZXBC 3QZMA 2NNFA 1RP9A 2BO0A 3GSNL 1YEFH 3D2UD 3JWOL 4PGBB 1MI5B 4AGLA 4LCVA 1BLIA 2LT9A 4FL4C 5I26A 4DP8X 2AMUA 3HI6H 4X80L 3RWCB 4PGEB 1ET5A 3RU8H 3FUEA 2ADJA 5KVMC 1MAML 3A4EA 3O45B 3DBSA 2J6EL 3LN9A 4HFUH 1A6ZA 1IGIL 2BIHA 3AG4B 2EDYA 1P69B 1IGCH 1NLDL 5DF0A 3V6FA 3W9DA 3JTSA 4OF5A 5IBUG 3GJFH 5C0BE 3MV8D 4ZMTA 2YK1L 4AEFA 2XTJB 2Y2TA 3OR6A 1LNUB 1W0VB 2IWEA 1U58B 1ZD6A 1UM5L 2R1YB 4NZRL 5D2LF 3A47A 4F33B 5F0PB 4XX1E 1CDHA 3V4UL 2BP3A 1SQMA 4AL8C 3HAEH 1T20B 4I0PA 3ILQD 1HWWA 4S0TD 4ES8A 1INDH 1UWXK 3H4FA 5DQDL 1A6TA 1ZPUA 4JJ5B 2B1OA 5ID1A 4PYGA 5MHSD 5I76B 1A7PH 1DFBH 4YQXL 1CYXA 1CBVL 5FECB 3PUUA 5D70H 2E74C 2HX8A 4P3CH 1KGUA 4PJ8D 2BVQA 3FO0H 3FL7A 1BWMA 2H6OA 5L8LB 5H37G 5HYQA 2E86A 1W6LA 3GBNH 3KPLB 2J88L 4G8GE 2I9TA 1KPUB 5HHMB 4IBTA 3SE9H 5EZPA 4LNRA 3TPUA 4BK4A 2IG2H 4RWYH 2H41A 3V5HA 2WBKA 3UCQA 4WFED 5BZDB 2FJFA 3RA7L 3S5LB 3RTLA 4EDWH 4FTVE 4Q14A 1PZ2A 1OGAD 4N2OA 4NOFA 2EKSA 1N5YL 5IHUH 2IBGA 4CBZA 2XVBA 1CMOA 4O4YL 4MCMA 5EOTA 3DIFB 1IEAB 4IOSA 1FE8H 4LLMA 4NP4H 2ZG1A 4I9WD 5IMOA 3RI5F 4CMHB 3MU3A 4HJ0D 2GBVA 1T89A 4PLKD 4MJIA 2X88A 4U3XA 2EDEA 2J44A 2VLLB 5F1IB 4UYQA 3KBHE 3LD8B 5EEYA 1BQHG 1J8HB 1KXQE 4OJFL 5C0CD 3I6KB 5KS9F 1IQDB 2MSPA 3LRGA 2H0JA 3FCGA 3EYUH 1YNTA 4JHVA 1BX2B 4OI9A 3RNKA 3VB8A 2Q76B 5DZ9A 5LGJB 2KLTA 4JHWL 4YR6B 2XICA 2BXYA 2FNWA 4P48A 2P43B 5BQDA 5E2UH 2K6ZA 3BP5A 3DO7A 4D0BB 3Q6FB 3QFDB 1W0WB 1XGPA 1ZKAA 2D31B 4PJDA 5LAPA 3VXMB 5IFAH 5K9JH 2D7OA 3QXTA 2OQJB 1GGUA 4H1LG 2OL3H 4ONHB 3SGJA 2OMBA 2ZUTA 5CJ5A 1GRWA 4OD3L 2HH0H 3CAFA 3QG7H 4C83B 2XRAL 3G6AA 3B5GA 2FYYA 5IBTH 1BVOA 5ICYB 4JHBA 4OAWB 3OMZA 5HYJD 3D87B 1LTXA 4WFGE 1TLKA 3FJTA 2IDQA 2YQGA 1MHEB 5DCCA 5F2FA 2D3JA 5DS1A 3SN6N 2CJ3A 1ORSA 4PR5B 4I2XA 3QGVA 1QFUL 2H1XA 4PJ7A 1RZKH 3HS8A 2IFFL 1IC4H 3OHXB 4U1SB 4U1GB 4U2ZA 5IHLB 5JXEC 3ULUC 1W6WA 3LQAC 1MWAB 1FH2A 2WOBA 1NCHA 2F1EA 3NK4A 2EUVA 1NFKA 3K2MC 3FSWA 6TAAA 2WPGA 1GYCA 5KTEL 2GJ6A 1WH0A 4KHXL 4NQQA 4TOYL 2GVYA 1VKXA 5AAPA 3NIFE 4QYAA 4R9HA 2ENYA 4G1EA 1QWNA 4YGVB 1S7VA 4J3TA 1Q9OB 3VFMB 4Y5VA 1A7OL 4A7QA 3D7PA 4DN3H 3VQLA 5KWYC 2FEDC 2W60B 1ANUA 4JPKH 2CU9A 3GMPA 1JF5A 3OHMB 1X7TA 3VWJA 1NPUA 4NI6A 2O6PA 3MUHL 4NHCL 2OZNA 3HFML 4P2RA 3QQDA 4W4NA 5CGYD 1SXAA 4LSPH 1S9VB 2WNKA 3EJQA 5DVMA 3V8CA 1I82A 3OLDA 4TPRL 5EA0H 2BSSA 3O6MH 4YDJA 5J6SA 4N8PA 2ZXDA 1NFDA 2DD8H 2X9WA 4PH8A 4PVMA 2LTQB 4HWZB 2K3TA 1OD7A 5CGBA 3MRNB 4HQQH 5I1IL 3I6GB 3KM1A 3ML8A 4X7CC 3TBVA 5HHQB 4HCRL 1D6VH 3EH2A 3TN0B 2OJ1A 1HKLH 3WTSA 3H9HB 4WNSA 1MCPL 4KTDL 3SDXE 3ES6A 2B8OT 1MIEH 2CJSA 1XF3B 4M29A 4O00A 4JFED 4DZ8A 1JTPA 4XNMA 3KWUA 3O6FB 3BP6B 3U2JA 3MRKA 2Z31A 2LU5A 5EBMA 1XIWB 1QSED 3VMNA 2XOTA 3GI8L 5KW9L 4A2HA 2DQDL 3G7TA 3APFA 4PJIA 4Y4KA 5BMFL 1ZHBA 3MJ9H 2FLMA 3AXLB 2HT4C 3UAEA 2NT1A 3HZMB 3IDMB 3VYPA 5AL0A 3NT0A 3JQOB 1LO5A 5AVWB 2FBRA 4PJXA 3HB3C 3FB5A 3RY6C 1A6VL 3DRQA 3I74A 4G6JL 4EZKA 4HWEL 5D4HA 2BY0A 2YA1A 4W9IC 5FF6A 1CLZH 3GDBA 3WFBL 3QJTB 3ZYOA 4A7SA 4WNQA 4PV1C 1HSAA 3Q8AA 2NR6C 1MFEH 3QUZA 1NOAA 3MGAA 5JHAA 3IBOA 4HIIB 1NJ9B 4UDTA 3B56A 2CNYA 3RGVC 1UD5A 5CHNB 2B16A 4EVNA 5A6MA 1TNMA 2IMMA 3HZKA 2PMZA 3LPGA 4OLYL 1T66D 4K7FA 2D4DA 4TUJB 1R75A 2AQ2A 2WWOA 3LS4L 4KKCC 3L6FA 4Q0XH 2CR0A 4TULL 3HPLA 3O41B 1R5VA 4ZUWA 1RUML 3CH8A 3VFVB 3T2LA 5HPMA 2BSED 2JIXB 5AVQB 1QYGH 4KK5C 5E9DB 3T6XA 1LE5A 1PZ5A 1EMTH 4X8XA 2DQHL 2YFNA 1CE1L 3S7GA 2JKTM 2DQJL 2WUBL 3NCYS 4JQVA 1BAGA 4AXWA 2EIJB 1BD2D 4E5XG 4L0PB 1Z3RA 2DQFA 2WQSA 3EG9B 3VFRB 1YVLA 2QQQA 1AG6A 2KL6A 2A74A 2NW3A 1E9OA 1KWKA 3W3BA 1OAUH 3BWSA 3GZPA 3WAKA 2Z35A 2WXLA 3ZT7A 3U7WL 4ZYKB 4OSUH 2VQ1B 3JV5A 3D4ZA 4JFYB 1E7UA 3P77B 1M7XA 4AL8L 4Y9CA 4BFJA 3KWWA 3ARTA 2DQIH 5B4MC 2LVCA 4P04A 1FL6A 1MNUL 3O6KH 5KYXB 1IZJA 4HDIA 4PJDE 3SE4C 3W5NA 3RTQB 5CBEA 3OAYK 3TWCL 4LXFA 3HI1B 1YPZA 4JQXC 1HZLA 1YEHH 5KSBF 5SWSB 4GS7C 4M43H 2ZSVB 3KPPA 1I7UB 4MNQD 2PETA 5I5RA 3L4ZA 3SBRA 1MRFH 3VXUD 1SYVB 5GISH 1HK6A 4OFKA 4ISVB 1J18A 2VSCA 3F12B 3Q05A 5EUKB 2HFGL 3HW7A 5AKTA 2R1XB 4H8WH 4Y5XA 1XAKA 4I2XE 3IETB 4EZJA 5J4MA 1R9FA 3G08A 4L3ED 3ZE2F 4APQD 1L0YA 4KNQA 1DCLA 5FO8B 1FN4A 4KK9C 3D25A 5ALCH 1VGKA 5JYMA 1LP9A 2K6WA 3V9CA 4O2CA 4BFIA 5EEZA 3K74B 5K5YA 2GJ6E 4FOMA 4Y7OC 2VH5H 1HZKA 3D0LB 4LSTL 3ZE0F 4F2MA 3MCKA 2J1KA 2QFRA 4PGCB 5FW8A 2YD2A 2P28B 4HISA 3GHBL 5ID0A 5F6IB 3WXVH 3GBEA 4CC0A 3VQ2C 1ADQL 2XQYG 4RGOL 4R4FH 1AIFA 1PD6A 2UY7A 1DZ0A 4UIMB 3MNWA 4P2RE 3DX8B 3MV7B 5DHVB 2K9FB 4N1HB 3V0WH 2O6FA 4FQXD 1L7TL 2GCYA 4Y7MA 1DLFL 1QLFB 4YHYC 2AK1L 1Q1JH 5FYJL 4ODHH 1UWGH 3LIZH 1JNJA 2JCCE 3EJYD 1TVBA 1JHLL 3QFJA 4XPHL 3WDJA 5T1LD 3D4CA 1GH7A 3SE8L 4NCDA 3ENEA 2VXQA 2BHFA 4FLQA 4O5LL 4XN7A 5FOBB 4GG8B 3CX2A 4MA3B 4U1HA 1N4XH 1S78C 3S3SA 1L5GA 3BN9D 1ZV2A 3EIFA 3PWPD 4X99B 1QW8A 2NX5A 4G6AD 4WEMB 4DP9X 1CLCA 3RBGA 1WFUA 3ARFB 3KJ4C 1HT6A 1CD0A 4HJGA 4P5MB 3UZEA 3UAJD 1GKOA 1IGJB 4FHJA 3KPQA 1N64H 3IE9A 4PJIE 2X4OB 4BZYA 2XWTA 3BT2H 4ZXBD 4LDLB 4PS4H 4F58L 5LXGL 3ARDC 3O8XA 4WEBH 1E5BA 5AVXB 2LLLA 5BOJA 4FNRA 3FKUS 1D2OA 3EF7A 5IBLC 3FQTB 3IWUA 5EOCJ 4FFTA 4PBXA 2CCWA 4NIYE 4YBLB 5PCYA 1BDYA 4JFDB 1IGFH 3B2UD 1UB6B 3UOAB 2YRPA 4M93B 1H15B 5E2WH 1RUPH 1LE9A 1JFHA 3BESR 2KMWA 3VGAC 2NDFA 4MMYB 2Y06H 2CALA 3IJ9A 5CEYB 2W81C 4PD4J 2CKNA 4AE1A 2F54D 2E27H 3ZMNA 3SO3C 2PUQT 2JB6B 5DJYA 3SQRA 4XNUL 2NCMA 4AYFB 2WLNA 1P1VA 4IK6A 3L7FB 4JLRA 1KBPA 4TVUA 5I1DB 4NN5C 1B0RB 2FR4A 1YC7A 5IJVA 4E9WA 5JHDE 2OMUB 4G59C 2VDML 1EJOL 5JA9A 3MLYL 3LV3B 4BSJA 3ZKQD 2DQUH 2Q8AH 1EA9C 4Y16C 3ZKNC 1UD3A 2X4RB 4JHUA 3ROLB 3FOMB 4ZS6D 1TQWA 2GBAA 4WSGA 1GAFL 2ZYSA 2A4ZA 4GG6E 3LRLA 1YUHB 4WI0A 5EOQH 3FQXB 1CIDA 1CR9L 1N0LB 2ICWJ 2YD0A 4NQSB 4X6EA 4U3CA 4Z3IA 4JL1A 3QPXH 3RWJA 3MRIB 3VFTA 1EH9A 5LKNA 1I1FA 3KG5A 1ICTA 3WTUA 2Y7NA 2IQ9H 4PJ6A 1OW0A 5E94A 2Q8BH 3W5MA 4P5KB 3HG4A 2ATPA 4I4WB 1YO4A 1P4LA 5F8RC 2UXFA 4W9GC 2JI1A 3F04A 4W81A 2P5ED 1GL4B 1PLCA 2RTTA 4JZNB 1MEXL 1Z0NA 3BH4A 4NAJA 1JWMA 1Z9LA 2Z0BA 1I1AB 2DDQH 5J89A 2NLJB 5EIIB 5EZOL 5LCVA 5FKAB 2QMKA 4HOWA 2NNRA 2VDRB 4XP1L 4ALAL 4BQ9A 1QWHA 2E9BA 2PXYC 2Q10A 1IVLA 1X6NA 1J0JA 1YPZE 4ADGA 4G1MB 3LCYA 5EC1A 4OCSL 4FJZA 2WGNB 3IE4A 2SODB 4KHTH 3LN5B 2DMGA 1MCQA 3KCWA 3S3DB 4F27A 1HN1A 1MF2H 2OTUA 3L3OB 3ISWA 3P4NB 4XAWL 1BBDL 1SUHA 3KYMA 5FYJD 2Z7WA 1MCOH 1J0IA 2G9HB 3C5ZA 3Q7JA 3TBWB 1X5XA 5JQIB 5TH2B 4LDCA 1R3HA 3PP4L 1JN6B 5D1XB 3T6VA 1N70A 4M4RA 4PJ5D 5ADOL 1BVNP 4HGMA 4RWHA 5IBUB 5CZXD 5TE7H 4OR1A 2Z8SA 1COBA 4PRIA 5AYUL 5I5JA 3UBFA 4J3OF 3WN5B 4BKLA 4BFKA 3U6RB 1M53A 3E6HB 3ERXA 2YA0A 3UBGA 1S5IH 5GRYA 4CILA 3D3VA 2MHAB 4PRAB 3MLUL 4BK8A 3FN9A 4JL2A 2WJ5A 2NSMA 2W65A 2DI7A 4F2ME 1H6UA 1YEJL 1VEOA 3ARBB 1TPXC 2R0LH 2YSSA 4UT7L 5IVXB 3DX9B 5JXED 3TFKC 3IRPX 4QRBA 3SGKC 2QBWA 3G3LA 2GI0A 5ADPH 3L1OH 5AOIA 1RLWA 1A66A 1YEKH 2DJ4A 2QHLA 2ATKB 1RIHH 2QGBA 2VN6A 4B96A 4AQEA 1G6RH 2D4FA 4J8RB 3BAXA 3L4VA 4Z95H 3VM7A 3BAYA 3VDBA 3Q8BA 2IXQB 2CBQA 2JKIS 3AY4C 4LCWB 1L9SA 4Z7NE 3L2MA 4MJ6B 1P2CA 5FYJU 3LZQA 2H6PA 1XF5B 2FEDD 4GIOA 5EG6C 4YZWA 3MYZA 3RB5A 3WNOA 3T77B 3P3UA 1EGJH 3MBEB 1CK0L 3LEYH 4PJEE 5A2AA 2X4QA 2KLRA 4OQTH 2NX5E 4X0NA 2KLSA 4LF3B 5DJ6B 1IM9D 1FI8C 3HMXH 1RUAL 3BKCH 4N8CL 1HOCA 1I7ZB 3SDAA 3L17A 4A7UA 2OCCB 1NMAL 4OUUB 1UCBL 3SDDB 1S7WB 4Z3FA 5HD8C 1DVFB 1BQHB 2IJ0C 2PYFB 5LBVA 2AK4A 5CUSH 3QNZA 4XC3L 1K85A 3HPJA 1GZQB 1QR1A 3NCFB 3KHOA 1S9WA 1GZPB 2Q3ZA 2ZUQB 3C6LB 3GZQA 3L13A 1CDBA 1Y0LB 2J2ZA 3SQOH 1YSOA 2B1HH 2NTSP 4PWJA 1CGWA 3ECWA 3MBXL 5IB4B 2V5YA 3UJJH 1ASOA 4ORGB 4FFYA 5T3ZH 4UT6H 5EZIH 3IAGC 5SWZD 1T83C 1ZE3C 3QJHA 5E8PA 4WDIB 4K5LA 1A9VA 1I8KB 4KRLB 1E2VA 2HRPH 4H1LB 4UV7L 1ACYL 4N2KA 3HB3D 4E42A 3OC8A 3FO1B 4Q6KA 3BQUD 1GIGH 3QZNA 2UZXB 4PBWD 3OM3B 4JM4H 4OCWH 4LSVL 4HWBA 5F89A 5HDBF 32C2A 1QQDB 2X6MA 3OKEB 4FKEA 4I77L 4ACTA 3S4SG 2NR6D 3CTTA 4TXVB 3NJXA 3HG3A 3OKMA 4B7IA 1U8OA 5FO2A 4BZ1L 35C8H 4F3FB 3ZR6A 3WU1A 1BMZA 1RVFH 2OA9A 2VMDA 3KXFA 3RGVD 4FZEL 4KY2A 2WAHA 1WV7T 2YR3A 2W9DL 1GJUA 1R3KA 3QDMA 4YPGB 4NOBA 3ZYIA 5IUSA 5AG8A 2ZNWA 4E9LA 3AS0A 5CMAB 2W9LA 2JB5L 1FIGL 3D18B 3QEGL 1A47A 4BSVA 5KSAB 1NLBH 2EIBA 4OVUA 4PVLA 3I3BA 3S37H 4KO7A 2IH8A 2W59A 3U9UA 4FERA 4XVTH 3K0WA 2IAMB 1ETJA 2XV0A 2P80A 3OKYA 4PS8A 3SPIA 4KRMB 1JV5A 4RDQF 5LAXA 3MVSA 1VFUA 1HHKA 4NQEA 4HMDA 3EHBD 1AJ7H 4MB3A 5BV7H 4FCAA 5I6XB 1JGDA 3EKCA 4KMTH 1IKFH 5I66B 2ED9A 1T1YB 4X6BA 3US9A 3NJHA 5D5MB 2VERN 2WBWB 2VT0A 4U7MA 2I07A 2YPLA 4I0KA 4MWFA 2ZWYA 2F53A 3CCHB 4PMFA 3JZ7A 2SEBA 4FQIH 5C08D 2ZAGA 4N0RA 4BUQA 2ITFA 2WAQA 1T21B 2YUZA 1BXVA 3EYFB 3R7RA 1FF5A 4GXVL 3ULAB 4RAVB 4O02H 3FO0L 4QWWC 2NUPB 1L9OA 4L4VA 3ZDYB 3D0AA 3UTSE 3D2UB 4PGBA 1MI5A 2A6KA 3GHEH 5B4MD 4Z3JA 1W2KT 2VXUH 3O11B 3BKML 3NA9H 3RWCA 4GRMB 2WNWA 2Y2WA 4EI5C 2EILB 1HIML 3O45A 2YA2A 3SJVD 3K8MA 3VQMA 4PRIE 2X4TA 4JKWA 1KTDB 5I6OA 3MV8B 2CHNA 5B1JC 4PSPA 1Y6NR 4WTZG 1VDGA 3D3VE 4RRPG 3WY4A 3QWRD 1LNUA 5GGRB 1U58A 1KC5L 2FH6A 4F33A 1WWWX 4JE4B 4NP4L 1HEZB 1DQTA 4PV9B 4WI3A 3WUWB 3Q9PA 5J1TC 1TEGA 3TH2T 3FFCB 3OKDB 3BAWA 1T20A 5JQ6L 1B0GA 5CGMA 1Q90A 1MJ8H 2TRHA 1C12B 3DVNA 3L3GB 3W11C 5HHOD 4BXVA 3DGGA 2QADC 1KCWA 3MMEB 4E9XA 3GLDA 1A22B 4IMKA 3PPSA 4UQDA 5I76A 3S88H 3ASNB 1FORL 2EYSB 3GKZA 2F61A 2PWGA 3OB8A 4AW4A 5FECA 1BZ9B 5I30L 5GGTA 3V0EA 4QHKJ 2P3YA 4TNEA 1X6LA 4PJ8B 4XP6L 4CADB 1NAKL 3AMLA 2VO8A 1OSZB 3SKNB 4LU5L 5F88B 5GIRB 3KPLA 1A8ZA 3FHAA 3VD9A 4BWWA 1OEZW 2CDEB 4E9QA 1KPUA 4OCNC 1MDTA 3OXRB 4OB5L 4PRNB 1FFTB 2YUWA 3QQ3A 1EEYB 1JG9A 3RGBA 3QUKA 4P2OB 3TESA 3AT0A 3FAXA 4PJHB 4FNQA 5T5NF 3NCJL 5BZDA 1AYOA 4WFHE 1X7QB 2C9RA 3HNVL 3KYKL 2VDOL 1JOIA 1KPVA 2EDQA 1OGAB 1FFPA 1SDDB 4BHUI 4RISH 5C6TH 1KGCE 1O5DT 4S11A 1GW0A 4AYEC 4JDVB 2MCPH 2VE6B 2XWCA 4AMKH 1IEAA 5DEGB 1QA9B 2WQXA 2OSYA 5L6YH 3GMOB 4IDJL