3T6WA

Crystal structure of steccherinum ochraceum laccase obtained by multi-crystals composite data collection technique (10% dose)
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
495
structure length
495
Chain Sequence
VQIGPVTDLHIVNADIVPDGFVRPAVNAGGTFPGPVIAGNVGDNFQIVTFNQLIECSMLVDTSIHWHGEFQKGTNWADGPAFITQCPIIVGNSFSYNFNVPGMAGTYWYHSHLTTQYCDGLRGPFVVYDPNDPDANLYDVDDDTTIITLADWYHVLAKEMGAGGAITADSTLIDGLGRTHVNVAAVPLSVITVEVGKRYRMRLVSISCDPNYDFSIDGHDMTIIETDGVDSQELTVDEIQIFAAQRYSFVLNANQPVGNYWIRANPNSGGEGFDGGINSAILRYDGATTADPVTVASTVHTKCLIETDLHPLSRNGVPGNPHQGGADCNLNLSLGFACGNFVINGVSFTPPTVPVLLQICSGANTAADLLPSGSVISLPSNSTIEIALPAGAAGGPHPFHLHGHDFAVSESASNSTSNYDDPIWRDVVSIGGVGDNVTIRFCTDNPGPWFLHCHIDWHLDAGFAIVFAEDIPNTASANPVPEAWSNLCPSYDSAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase
publication title Reaction intermediates and redox state changes in a blue laccase from Steccherinum ochraceum observed by crystallographic high/low X-ray dose experiments.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 136
structure length 495
sequence length 495
chains with identical sequence B, C
ec nomenclature ec 1.10.3.2: Laccase.
pdb deposition date 2011-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6wA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6wA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6wA03
3NJGA 1SF3A 2BP8A 2GBAA 1SNRA 4A68A 1M9WA 4YSDA 4YSUA 2X88A 3MX0B 1J9SA 1QHQA 3HEIB 4E9XA 2ZOOA 3CG8A 3FU9A 1L9OA 1M56B 1ZV2A 4UF7C 1IBYA 3QJQB 1BYPA 3AY2A 2N0MA 3NJJA 4BDVB 1I53A 2IAAC 1NPNA 3IN0A 1AR1B 3X1EA 1FWXA 3ZBMA 5I28A 4YVNA 3PLYA 1BXVA 2XWZA 1A65A 1JZFA 1NWPA 2FJSA 4ENZA 4DPBX 2CJ3A 1IUZA 1NIDA 1MZZA 1PF3A 3SBQA 3PCYA 1OCCB 1AACA 2I7SA 2B08A 1XMEB 1N68A 4AZUA 2MTAA 4W1TA 1XB6A 4F7KA 4GYBA 5TK2A 2AZUA 3D12B 1BQRA 4AI7A 3EF4A 4BK5C 2DWTA 3EHBB 4F2EA 2H47C 2X87A 2FT8A 1PZBA 2J5WA 4M3HA 3SQRA 1AOZA 1PNDA 3MBWB 2YAPA 1ET5A 4E9WA 1PAZA 2AFNA 2XX0A 1TEFA 2HX9A 3OD3A 1QNIA 3ZX1A 5B7MA 2DYSB 2YAOA 4AX3A 1W6LA 4JHUA 3NSCA 3JT2A 1AZCA 2FTAA 2DYRB 3FSVA 2OV0A 4DPCX 2A3TA 2YAEA 1FFTB 1PLBA 3FU7B 2FQEA 3ERXA 3OMAB 4CSZA 1PNCA 2PP7A 2QDWA 4G7QB 3EH3B 1DZ0A 2VSKB 7PCYA 3NT0A 4HCIA 4KO5A 2IWFA 1TEGA 3WI9A 1NWOA 1BQKA 2HXAA 3PPSA 4NERA 4GXFA 2YAFA 3PAVA 2PPFA 4G70B 4DP9X 1AZRA 1DYZA 4A2GA 2QPEB 1GY2A 2ZWNA 4WKXA 4JKNA 2FT6A 4AKQA 3OM3B 4DP4X 2BWDA 4A66A 2UX7A 1AS6A 1KDIA 4UAHA 5D4HA 1ILUA 1AANA 1T5KA 1A4CA 1OOWA 3RYMA 3FU8A 2UXTA 2LLNA 2J56A 2CBPA 3EH4B 4TXVB 2VW7A 2JFCA 3ABLB 2PPCA 1ET8A 1AZUA 5D4JA 1AIZA 2HZHA 1PLAA 1SJMA 4X4KA 1JZJA 3CVCA 4GP8B 1V54B 2DV6A 2YAQA 1OCOB 3QJTB 3X2QB 3FSAA 4NB7A 3ASOB 4DP5X 1XB8A 4AKOA 1JXGA 3BQVA 2AZAA 4Q89A 4BWUA 1KCBA 2YQBA 2FNWA 4DP6X 2VM3A 3G5WA 1J9RA 3H56A 3NSYA 5F7AA 1WAEA 1GYCA 1X9RA 1IBZA 3SBRA 1IKOP 4QLWA 2HRHA 1ADWA 4HHGA 1RZPA 4A2HA 4AKPA 1A4AA 3NJMA 3OQRA 3H4FA 1J9QA 3WIAA 2BZCA 1ZDQA 2HX8A 9PCYA 2CALA 1ZDSA 1RZQA 2IDUA 3X1NA 1E67A 2R7EB 4KNUA 2MRYA 3QPKA 1BQ5A 3WKPA 3NSFA 3TASA 1X9UA 3FQYA 2WSDA 3QJRB 2BP0B 4BDVA 2BHFA 4HCFA 2BW5A 4KO7A 4JHVA 1AAJA 2ZONA 1OV8A 2EIJB 2NRDA 1AQ8A 2GSMB 2IWKA 1OF0A 8PAZA 3DIVA 1ASQA 4YSAA 3ZIYA 4E9RA 1MG3C 1A4BA 2GI0A 2GHZA 3CDZB 5F7BA 5A7EA 4YSRA 1BAWA 3NJLA 4GY4A 1ASOA 4RH4A 5D4IA 1NIBA 2PCFA 4P5RA 1YLBB 3TU6A 2JXMA 4GP5B 3S3BB 2PP8A 1AG6A 2IDSA 1SFHA 1V10A 5B1KA 2PP9A 2BW4A 4A2FA 1J5DA 1F56A 5I26A 3X1FA 1JXFA 1PZCA 1ID2A 1KYAA 1EHKB 1M57B 2UX6A 1AG0A 4BWWA 4DP1X 3ABKB 4FAAB 1J9TA 3TBCA 2VW6A 3IN2A 1JVLA 5I6PA 3NSDA 5B1JC 4EF3A 3UGEA 1CYWA 2B3IA 1EZLA 1KGYE 3AZUA 4GP4B 2VW4A 3UAEA 1JVOA 1E65A 3T6WA 5I6NA 1UATA 4E9QA 1R1CA 2YAHA 3QQXA 2XUWA 3FYIB 3FU7A 4YSQA 1OCZB 1BYOA 3FT0A 5B7FA 4M4RB 1WA0X 4HCGA 2GC7C 3IBOA 2Q5BA 1E5YA 4BWTA 1SF5A 3FSWA 4FA7B 5E9NA 4G7RB 1OE2A 5AZUA 3NYKA 1L9SA 1AZBA 2XX1A 2ZXWB 4G71B 2H5UA 2GC4C 3WG7B 2XV2A 1KV7A 3BVDB 1SHWA 4KOBA 5I6LA 2IH8A 3IEAA 2YARA 1XB3A 2EIKB 1ILSA 1PLCA 3N2JA 4G72B 5I6KA 1GS8A 4YSOA 2QPDB 3QJVB 2J57A 1JZHA 1TKWA 3WNIA 2W8CA 2GB2A 3T9WA 4CSPA 4YSCA 2TSAA 3WNJA 1L9PA 3NP3A 4BXVA 2XV3A 3FQ1A 1J5CA 1SFDA 1SHXA 5I5MA 2FT7A 2RACA 2DY2A 4QKTA 5B1JA 1A8ZA 1KBWA 3DTUB 5I5JA 3DKHA 1ZIBA 1CYXA 2AANA 1NZRA 4L0PB 1L9QA 2CUAA 4BXSV 1BEXA 2IDTA 3T6XA 1E30A 4P5SA 2EINB 4HZ1A 4DP8X 2PPAA 3S8FB 2EIMB 3CVBA 1NTDA 2Y1AA 1IC0A 1L9RA 2FWLB 1BXUA 2XVBA 3FQ2A 4HHWA 3U25A 3KW8A 1L9TA 3X1GA 1SDDB 3AW5A 4ZK8A 5I6MA 3L45A 1JZEA 1NICA 3AG1B 3FS9A 4G7SB 2YXWA 2PPEA 2BP8B 6PAZA 4K9JA 1PY0A 1NINA 4MFHA 3ZDWA 2QDVA 5FC9A 1GW0A 2IDQA 4DPAX 1HFUA 3FPXA 2R7EA 3CZUB 2YXVA 5AKRA 1AS8A 3S3DB 1JZGA 1B3IA 1JZIA 1KBVA 1QLEB 2HX7A 5LDUA 3T6VA 2OJ1A 2BP0A 3CVDA 3QJSB 2XLLA 1GS7A 3UACA 2PPDA 2Y69B 4W9ZA 3FYEB 2XV0A 2DWSA 4YSEA 1OE3A 3H4HA 1HAWA 3CDZA 1E5ZA 1KDJA 2UXVA 1NIEA 3TBBA 1PZAA 2UXGA 3NJHA 3EH5B 4YSPA 4HALA 1ET7A 4NAJA 5IY5B 1ZPUA 1WA1X 3AG4B 2AVFA 1MDAA 5EHFA 5B3SB 3UADA 2H3XC 3FPYA 2WO2B 3HB3B 3V9CA 4E9TA 3OMIB 1RKRA 4HAKA 2Q9OA 2QT6A 3FSZA 2BO0A 1CC3A 4DP0X 2OCCB 2E86A 1URIA 1GR7A 3TA4D 3UABA 3GDCA 4E9YA 1A3ZA 3NJKA 1RCYA 2J55A 4YVUA 2XXFA 4Q8BA 5I5IA 6PCYA 3X1BA 1OCRB 3C75A 1WS7A 3JTBA 1BXAA 1NPJA 2FQGA 5AFAA 4A2EA 2WO3B 1HAUA 3ABGA 1OE1A 1GSKA 4UANA 1PMYA 1WS8A 1NIAA 2GIMA 3GXUB 2IH9A 1WA2X 4KO6A 4PCYA 3S8GB 2TSBA 1MG2C 5ANHA 3PAUA 1ASPA 4YL4A 1GS6X 2FQFA 2P80D 3IE9A 2HRGA 1MZYA 2IWEA 3NJIA 5PAZA 1CURA 1AS7A 2CAKA 3WKQA 1VLXA 3N55A 3ABMB 5PCYA 3T6ZA 2BZ7A 1JXDA 2UXFA 2P80A 4KO9A 4E9SA 1NDTA 2YAMA 1JERA 3OMNB 3PAZA 4KNTA 2CCWA 3ASNB 3AG2B 3NJFA 1KCWA 3S3CB 1W8EA 1ZIAA 4WTQA 3V9EA 7PAZA 4KOCA 3AG3B 2VM4A 3QJUB 2FQDA 3T71A 5TK4A 1GY1A 4N4YB 2VSMB 4DP2X 2I7OA 1FA4A 2HLEB 2XYBA 2PCYA 3NJNA 2I85A 2VMJA 1TU2A 3PXLA 3UAAA 2XXGA 1PCSA 1AZNA 5B7EA 4HIPA 1CUOA 1NIFA 3NP4A 4N8UA 3SBPA 4E9VA 5B1AB 4DP7X 4A67A 4PAZA 2BWIA 1V55B 4KNSA 2W88A 3GYRA 4A2DA 1SDDA 2EILB 2JKWA 1N70A 4F2FA 2XU9A 2IDFA 2VN3A 4YSTA 3KW7A 1W6WA 5B1BB 1ETJA 4YSSA 5I6OA 2PLTA 1JOIA
chains in the Genus database with same CATH superfamily
5GS2D 3UEZA 5B3JE 2X2HA 1OF2A 3KBPA 3HNSL 3BWUF 4Y1AB 3A22A 4IRJA 4HXBH 2DOCA 4LAJH 3RL1B 1KFAH 4K3HA 3JWNG 4E9XA 5GRJH 5KJ4A 4HPOL 4N2AA 4IBQA 4U1LA 3HI1B 4UF7C 1BYPA 4G6AD 2R0WL 3LZFH 4BDVB 9CGTA 2IAAC 3A24A 5KZCB 4OCWL 3OLGA 4RQQB 1X5FA 1JMXA 2EKSA 2L3BA 2WXFA 2BMKB 4F7EB 1G6VK 4KXZI 5DUPH 1G6RB 2CGRH 4KRPC 3LKPA 2HJFB 1S7XB 4KJYA 4YBLC 3Q3GA 2A0LC 3C87A 2A9AA 2FJUB 4LLYB 1UCBL 4R4FH 5F3FA 3L3KB 4P2QD 4WY7L 4ZOBA 5F7WC 4Q58C 2A4CA 4ZNCD 3HZYA 1AIFA 4P8QA 3T8XB 4GYBA 4S2SB 5TK2A 4XOBA 3T3PB 1S7SA 5JW4M 1JK9A 3QGVA 4YPGA 1S5IH 3NPSC 4IOSA 2A9MH 3A4EA 1GTNA 2D7TH 4PJ7E 2Z8SA 4H1LH 1MCWW 3G5VA 5IQ9A 4X5WB 2EIEA 3CUPB 1KBKA 2ICEA 4FQIL 1GAFL 2HX9A 3FONB 3RPIB 4ETYA 3VX1A 2YPLE 4PTTA 4GKSA 5IT2L 3QIUA 1M7IA 3UGUA 4N8VA 3GSXA 1EAOA 4WGWB 1BEYH 4P4KD 5KBKA 1K6QH 5E9AA 4AYMC 2D3VA 2UVEA 2K8QA 3GBLA 3GUTA 4WCYH 1WICA 5DU7A 1FFTB 1PLBA 4Y8DC 1CGSL 4RRPG 2OMYB 4EI0A 4R4ND 5IHLB 3RFRA 5JDJA 3UTSE 3HC3H 2N0KA 1AZVA 1G0XA 4OF0A 4G7QB 4NKMB 4JRYD 7PCYA 3FFCB 1U30A 3CFMA 3C08H 4OLVH 4MMXB 4TL4A 3STLB 5D7LD 2VDKL 4RGMB 3TBYA 3UX9B 3WJLC 1LE5A 5E6IC 5EIVA 1N3NB 4TSCH 3B6SB 3ZDZB 4LGPB 4LQFH 5I1CH 1R0AL 1I4FA 3FT2B 3NFPA 4KK5D 2NY3B 4WI8A 5EBLA 3TN0A 4C54A 2EDDA 2Y72A 1F4YH 4KKLD 1U8IB 5KYNA 1F11B 1PX3A 2V2WA 5SV4A 2XN9E 3WEXA 3QCTH 1SEQL 3SPGA 2CMRH 4F3FA 2G5BA 1KENH 5IF0A 3NZUA 2J56A 4W9DC 1CFVH 3IKKA 5D1QC 5I0ZA 3IVKA 5DHMC 3MV01 2JFCA 2IGTA 4QRPA 3BO8A 3DI2B 3VXQA 1HEZB 1PLAA 4BH7B 3BVNB 4UTBA 3ULUE 4IGBB 3PABA 2KL6A 3GKWL 3BKJL 1NDGA 2Z64C 2VUKA 1YEFL 3GPSA 1UB5B 3GNML 3MYZA 4ABQA 3QJXA 3R7QA 1VZHA 3V5KB 4C8XA 1BP3B 4L8CB 1KFGA 2P45B 5M94B 5IBTL 4HS3A 1M7DA 1JRHL 4Q14A 4LLQA 1QLFB 4JDZB 5F7AA 3RX5A 2Z1KA 1GYCA 4M8QB 1X9RA 2NZ1A 3ZKNC 1JYXA 2H4EA 5E24E 4GBXC 2M83A 4WI5A 5DRXB 3V10A 3LN4A 2WZAA 2PF6A 3WO4B 2DQCL 2F08A 5IR1B 3HBQA 4X9YA 43C9B 3CVHB 4AUJA 5CCJA 5A2KH 3QZWB 4QRBA 3TURA 1GRWA 1GGBL 4HKZA 3MKGA 4JR9H 4PRDB 1MLBB 2BY0A 2X70A 1NCCH 4YDVB 3MZGB 1JNNH 1BZ7A 4XHJD 1WFIA 3K2IA 3CXFA 1MCRA 1ANUA 1PCXA 2CDFA 1XF1A 2CO2A 2OSLA 5DD5H 3DXAD 2BNUA 2P5EB 4AY0A 2C3HA 1UQSA 3CFBB 2DWEA 3KPOA 3DIVA 2LLGA 1VFAA 1RP9A 2V4LA 2R39A 2XWTB 2O1AA 1L3NA 1SM3L 3WFDL 4XN4A 3CHSA 4MD5A 3H6AA 5DVPA 3VXMB 3R8BB 1NGWB 1DVFD 1D6VL 3APMA 3N5AA 4P2AA 3ML8A 1NANI 4Y4KA 1LO5B 4PB9L 5TH2B 4UZSA 3REVB 3SYOA 4N9GA 2PP8A 4FOMA 4KVNH 2Y6SC 3IJ7A 2O5ZL 3EYUL 4HKJA 2EUVA 2XFGB 4O51A 5F7FA 5T1KB 3TT1H 1Y18B 4CMMA 5L8KB 1HYSC 1UACH 4LVHC 4DEWA 3PP3K 3S48A 4LB8A 3N9GH 1PZCA 2AV7A 4U6XA 3N1GC 3TEYA 3HOGA 1X9QA 3ZUCA 1UYWL 4GAYB 2IJ0C 1J9TA 4JN2A 3TO4C 1JGEB 3D50A 3TBCA 5BZWB 4WF7A 1CQYA 3UPCA 4BQBA 4MMYB 3T4AA 2GCYB 2VC2H 5F0MB 4J28A 2MNJB 2Q76A 4JPVL 5DC4B 5FUCC 4HJJH 4ORGB 3TA3B 5D1XA 1R1CA 3L13A 3BC9A 5C7XL 3IJHA 2V8LA 4LCYB 4PP1C 5I1GH 5CJXA 1OCZB 3MGOB 4JFOB 2UY6A 2VR5A 1DANU 5HVFB 2X10A 3MBXL 1OAYL 1WHPA 5E9NA 5AZUA 2VOTA 3B5HA 1AZBA 2CJUL 4NQTA 4OZ4A 4XP6L 3PXHA 4NQEE 5TF1L 5GQBA 1H15B 1IAOA 2BHUA 5C0IB 5JHAA 4LSVH 3W39B 2X7LB 2IH8A 1MFEH 1NMAL 1TMQA 1XDTT 3O9WA 2FHBA 3VFRB 2ZNWA 1PFCA 1C08A 1NBZA 3APCA 4LAQH 2HRLA 4BHUI 1CFQB 4WNQA 2FATH 3LXAA 4CSPA 3U30C 4YSCA 4GSQA 3JWOC 1SLWA 4FHKA 4Q0XH 3KLHD 2ZUUA 4Y1TA 2KBGA 1UA6H 1G7HB 2WQVA 3QZBA 4JM2C 1QLRA 1SOKA 4UDUB 4W68A 4GS7B 4Z78A 4X99A 3UIZA 3RWCB 3V5HA 5J1AA 3KPRE 3TH4T 1TVBB 4FFWC 3AABA 2G75A 1JPST 1TZGL 4K71C 3MCYA 2Z31B 3L4WA 4XI5C 1TU2B 4G42B 1ZOXA 3QUKB 2EINB 4JZJC 4M00A 2AV1B 1DJIA 4XE5B 4X6DE 1P69B 4OUUA 2DMGA 3B43A 1NTDA 1NMCB 4J8RA 4D9RD 1LK2B 3D4CA 1NC2B 1Q9OB 4DQAA 1UT2A 5EU6D 3AW5A 3QULA 2R4RH 4PS7A 3G08A 5IVXF 2WKGA 1UOLA 3K6SA 2J5LC 3KVPA 1GOGA 1JZEA 4MMZC 4Y19E 3H3BC 4KV5E 4IKLA 5E8PB 1KEML 4KHXH 3BN9C 3I3DA 3QUMB 3MLYH 3H3PH 1MCWM 1P4LB 2DJSA 3TIEA 2V2XA 4LSRL 2E8YA 4M03A 1HN1A 5F89B 2DWYA 3GXFA 2BH0A 1PY9A 1OF2B 1T21A 2C9XA 3VE0A 2YD1A 2ZKMX 3DSFH 3AITA 1NBCA 1B2WL 3IWVA 2WXRA 3S3DB 2HT3D 3AT0A 4U1LB 4FI8A 4HISA 3FRPA 1T6BX 4N8CL 4EAEA 1WSST 5LBSL 2A9NL 4I18A 4EI5C 2WKOA 4OU3A 3ARGD 3PQYB 2D7NA 2EKSB 1NQBA 1CGUA 3EJYC 5LNEA 3LKPB 2F54A 4KJYB 3Q3GB 4LXFA 1E4XI 2DQEL 1KDJA 1XCQB 3T04D 2X4TA 1V8HA 3E8VA 3HZYB 1FVDA 2P44B 4F93B 3ARFA 2HH0H 1S7SB 3DDGA 3RVUD 5LDSA 1JK9B 4YPGB 4P46A 4WJG3 3Q05A 5CO1A 1LO0H 1N19A 5IGXL 5C6TH 5J89A 4KH2A 2B8OT 2DQTL 5IJBC 4HAKA 4OFYA 4AL8H 1YEIH 3OF6A 2GW5A 1T04A 3KHQA 5EFIA 4KWUA 2YSTA 2HLAA 3IGFA 3G5VB 4JO4L 5F6HI 1HE8A 5IQ9B 5F21B 2ICEB 3IMUA 4R97C 4GKZB 1GR7A 1PEWA 2PXYC 4PTTB 3QIUB 1RPKA 1M7IB 4KKPA 1IIIA 4N8VB 1UM4H 3GSXB 4G3YL 5D2LE 3IXTA 2ZYHA 3SJVB 2YFNA 2W9DL 3Q6GH 3GUTB 3MV7A 3MMEA 5HJGA 5CILL 5TQ2L 4EDXB 5IJDC 4ELKB 5IV2A 1D2PA 1HH9A 2AK4D 5DUJA 3QDME 1QPXA 4NS0A 5AAPA 1FC2D 3IDJA 4LU5L 3RI5F 1HXYA 15C8H 2CKBH 1TF4A 3KWXA 5MHSE 4N2NA 2G4GA 3TBYB 4P4RA 4UB0L 1XEUA 2O5YL 5INCA 3F7RA 5DVKA 4LLWA 1GS6X 4Q9QH 1IT9L 1BX2B 3GXDA 3M88A 1TTUA 4PLKD 1B88A 1F1DA 5A2FA 1I4FB 4P0DA 3NFPB 4YX2L 5K1JA 3T6ZA 4R84A 5EBLB 5IVXB 2CJSA 4Y9FA 3TN0B 1JHTA 1IM9A 4URKA 1E40A 2YK1L 2XG5A 4Z8FH 1L7TL 1SUJA 3QJHA 4XN1A 2V2WB 4JO5A 4I87A 4JY5L 3BD4A 3WEXB 4X8GA 5CZVH 3ZL4L 4N25A 3O8XC 4QUOA 2FH8A 3DV6B 5IF0B 3JVGA 2G5BB 4F3FB 5F0PB 1NLDL 4XVSH 1HZHH 1U3HC 5CR1A 1FA4A 4QRPB 3UTPE 1FNFA 1DUYB 3BO8B 1RURL 2FHFA 4Z7IA 3NJNA 5CGYD 4PCTA 3PABB 3PXLA 2XXGA 1A7RH 1WP6A 1NDGB 5C08E 4HIPA 2AJ3A 5BO0D 4JKWA 4WUKL 4MJIE 5F7EH 1NCNA 1W8OA 2IQ9L 3HPJA 3I85A 3I74A 4X4YA 2C4FT 1Q9LA 1UT9A 2YPKB 4HS3B 1M7DB 3J2PA 5FLUA 2WZ5A 4LLQB 2JKWA 5B4MD 3GS4A 3FW6A 2BXYA 4AVKA 4QOKA 5LXGL 3WEAA 4MNQD 4HWEL 2MMXA 5JIPA 3V0WH 3VYOA 4F37F 3LN4B 3UPRA 3D2UB 4XP4L 4A55A 3BZFA 1SNRA 1QWNA 2XV6B 4H13C 4A1RA 1MREH 3GXPA 4HKZB 4RA3A 2DLHA 3E6FA 1NGPL 3QEGH 2DM3A 2EDQA 1E8WA 5FO9A 3HN5A 2X70B 4W9IC 1KXHA 1X5HA 3M07A 3OAYK 2D3NA 3MACL 3MRGA 1BZ7B 5L0QC 5HDBF 1I53A 3V2AR 5L6YH 2Z8WC 1FWXA 4KMTL 2CDFB 1FIEA 5I15L 1T83C 1FFQA 2VXQA 2BNUB 4G8FA 4N2IA 1UQSB 3KPOB 2DWEB 5D7EA 3OMZA 1VFAB 5B39A 3QUZD 4J2QA 1YUKB 3P4OB 2NDGA 2R1YA 1DJXA 4MD5B 5TPWL 1QR4A 1TVHA 2FLRT 1W91A 2HJKA 3CMOL 4L0YA 3QIBA 1H3GA 4F15C 4QRSA 4W4OC 3GLDA 4MXVE 4N9GB 2YN3A 4PJBF 1UURA 1PZ5A 2DKUA 1ZLVH 3UPAA 4HKJB 3P77A 4XPHL 3UC0H 4CMMB 1KJ2A 5DK2A 4DTGH 1TETH 4KTYA 1INEL 1X5KA 5IB2B 3QXWA 2AV7B 4U6XB 1QX1A 3DJZA 5CHNA 5I17A 3S37X 4JN2B 2EXTA 1MAML 5DK0A 2AEIT 3AGVA 2H9GA 1KUMA 3T4AB 2NUPA 2WKOF 2Q76B 2B14A 2CLVB 4OQTH 2VJ0A 1LEKA 1MCFA 4Y5XC 2HUHA 2VN6A 3IJHB 1M1XA 3D69A 1EDHA 1NCJA 4XC1H 3QZPA 5IROD 5EOQH 3L3OC 2WXLA 5TE6H 2V0AA 4OB5H 4NCC2 2UY6B 3FTYA 1HEJC 1T22A 3K91A 5KANG 2BIQA 4PGBA 1F90H 5JOPE 3Q1SL 4Z7OE 4OZ4B 2PN5A 3OV6A 2FUTA 1IAOB 1CU4L 1D9KA 1NWOA 5IHBA 4UDTB 5BRQA 3LRHA 1CICA 1BAFL 1KB9J 3O9WB 2ED7A 5AW8B 4Z3JA 2E5EA 5FDYA 4IKIA 1G7PA 3KYAA 1C08B 1NBZB 4HFWA 3VWKD 4G6JL 2J1XA 5K5YA 3W38A 4Y5VA 4M93B 5HHPA 1DQML 1FYTD 4GW5A 4R5TA 2BVYA 1OSEA 2VZ1A 2ADIA 1HT6A 3BP6B 5AENA 1AMXA 1G84A 2LU4A 1J86A 4ADJA 4J7RA 5HHOD 1QLRB 2WIMA 1S4IA 5T1DH 3QFJE 5L4MA 2D0FA 2X4OA 4OCRH 4Z78B 1I9JH 1JG9A 1H5BC 1GA2A 3V5HB 5AVYB 3GSRA 3I50L 5J1AB 1XF4A 1UZ6F 3VXSE 1N6VA 3C8HA 5ES4B 2G75B 2NXYD 1CR9L 1YZZA 4JUTA 1YQVH 1A6WL 1AIZA 2QZ5A 3W2DH 5JA9A 3EO9L 3QWRD 1UWXH 4D9LL 5BCAA 3QQ9D 1RUAL 2AJZA 4LHUD 4BFBD 1KN2H 1FO0H 4MJ2A 4OUUB 4UTCA 1XB8A 4J8RB 3N1FC 3U1SH 3BQVA 4OJFL 4BELD 1DSYA 3FC8A 2DPKA 5JIQA 4TKWA 1GOHA 1IGMH 3QULB 4PG9A 5HVGB 1X3DA 3G08B 3OZLA 3VU2A 2HN7A 3SQBB 3K6SB 2P7TA 4NFDA 2NY4C 1YNTA 2J20A 1IKOP 4HS8H 5AW4B 1G7QA 2EIZA 2AK1H 4PJBB 4XPFL 3TIEB 2V2XB 2ZZUT 1JZ3A 4OLYL 1RZPA 3PWPD 5DWUL 1WBYB 3S2CA 2MCPL 1NBQA 2HVJA 4WUUE 4FMKA 1LYQA 1T21B 5D7SL 3VE0B 2ZX5A 5AOJA 4ZAKB 1NM9A 5EORH 1UEYA 2OMBA 1OEZW 1RU9H 5E9DA 1I1AC 2GJ6E 2Y36L 5IJKA 4DN4L 1TTGA 2GITA 4M7KH 3L3JA 3RZCC 3FRPB 4KQ4H 3OKYA 4TQEL 3TBTA 3VXRA 3DPBA 4I18B 3F7PC 4J39A 3Q2VA 1NFAA 2XJLA 3A67L 2GSMB 2PCXA 4WHYG 1A25A 1UFUA 2BM3A 4HWBA 2F54B 5I30H 3CN4A 3ECWA 2GHZA 2ZWSA 3QE5A 1VEMA 2VLKE 4I7ZC 1A9BA 1GVIA 4RDQG 2X4TB 5F7YC 1OTTC 3K81A 1FVDB 2F58H 1GYAA 2E75C 1USZA 3ARFB 4ZTEA 4BK4A 4ZD3L 1WLHA 2RBLA 4P46B 5IFAL 4Y4FD 1T1YB 5DHDA 1F1GA 3FTZA 3L1FA 3P4NA 5ID1A 2XQYK 5EFIB 3BLPX 2HLAB 3F58H 5TE7L 5L9DL 1YG9A 5C07D 5J13B 4HLJA 1G9ML 2QZQA 5DRNA 2DEWX 2AABL 2M1KA 2MTPA 2WTRA 3QUYD 2B3IA 3NIFE 4R4BA 3NIGE 1MCQA 2AQQA 3VQLA 2UUDH 2IH1A 3IXTB 5FO8B 3ILQC 5M7QA 4D7PA 1D7CA 3MMEB 1KCVH 1IMHC 4YSQA 1RHFA 1D7DA 3LS4H 1U41A 3U2JA 3OGOE 5IV2B 3WNMA 4N1CA 1MRCL 1F6FB 5EOCJ 3SDAC 1SF5A 2PWDA 3FSWA 4NRZA 4CU8A 2DQGH 1T0PB 3MNWA 5ADOH 3QIWA 3IDJB 3I6GB 1EZSA 1HXYB 1ONQA 1MW1A 2EXWD 3GHBH 2H5UA 1ZXQA 2Z3FA 4G7YH 3U4AA 3WG7B 2CM6A 4XNDA 4P4RB 1GZHA 1E28A 4L3EE 5INCB 2AXHA 3OG4B 4LLWB 4DETA 2X53A 3K2UL 2H6PA 1T0OA 1TQBC 4G7VL 2BRRH 4YSOA 2DLFL 4FKKA 3C6EA 3P30L 1X5AA 4LASL 1JHTB 1IM9B 1Z1WA 5DD1L 3DX1A 4PUBH 4GG8A 3RTQA 3T5WA 3RLSA 3D09A 3QJHB 1FIGH 1I7UA 3ARDD 1K3IA 4GQQA 4FG0A 4QYAA 1JDAA 4JGMA 4K5NA 5E7FA 5I5MA 2E59A 1SBSL 4J3VA 5BRZD 4XXWC 5IWLC 2Y25A 2QVTA 4DFHA 4LCIH 3LS5H 2IPUK 1BPLB 3OL2A 4F9LC 5C0CE 4B96A 3DJTA 3PV7A 1TZHA 1HCVA 3N85H 4HIIB 2UZXA 1AFVH 3LVTA 5D2NA 5HDQL 3AS2A 4LDLB 1Z5LA 2AANA 4PRHD 5EWIL 2FBJH 1NFKA 2G0LA 2L0DA 1E9PA 2PPAA 3VVWA 2AJ3B 4H1LG 4N0UA 1U8KA 1OTUC 3HPJB 4X4YB 2ZUQC 4P05A 1Q9LB 1BZ8A 3X1GA 3CE1A 4IIZA 5F96L 4ODVH 4X0NA 3OBAA 4HP5A 3L45A 3L5IA 1S7WA 2IFFH 4Q9BA 3CLFL 4Q9RH 4HUCA 4PJFE 2BINA 1VKXA 3ALWA 3UPRB 5E1GA 5H94A 3TZVA 3BZFB 1PLGL 4MFHA 2YO3A 3PV6A 4TVPE 5SWSD 3S3JA 4XBEH 2PWHA 3E6FB 4WLCA 4L9DA 2X1PA 1JF1A 1OARL 5CSBA 4BSWB 5FO9B 3CZUB 4FXKA 3TWCH 5I75B 1C1EH 1CGYA 4YHZL 3MRGB 2MPAL 1KC5L 2PMZA 2R0ZH 4AQOA 2X6AA 1I9EA 1GPOL 1A9VA 3ROLB 1CDCA 4Y1AE 3ILEA 4ZMXA 5EBWA 4OLZL 3B2DC 3CHRA 4G8FB 2DIAA 4L4TA 1ULVA 3G5XB 4PV1C 4UT7L 3B2UC 3V4VA 1RIVH 2J44A 2ICWA 2OXGA 4MSWA 3ZTJG 1FE8H 2IXQA 4WJKB 2R1YB 2WJ5A 1RULH 1MCOL 2C34A 1TVHB 4HMEA 4JQIL 2HJKB 3BKYL 3HLAA 3WE1A 3BT2L 3CH8A 3ZE2F 1PZAA 3FN0H 3QIBB 1PW3A 4YZFE 4QRSB 1BVZA 3WIHA 1KLUA 1ITBB 5L7XL 1PZ5B 5DMKA 2JLPA 3EYVA 3DGGA 3P77B 4DO6A 5F71A 1KJ2B 5DK2B 1XCXA 5E6SB 5KN5A 5DVNA 2ED6A 4N9OB 4BCZA 5FYLH 3OJVC 4EUPH 4NLHA 5CHNB 3ULUC 3PUCA 4GQPH 5I17B 4POZC 1MH5A 4GMSH 5KVGE 4V33A 2V7NA 4M7LL 2JJUA 3MRBA 3QHFH 1XH2A 2H9GB 1N8ZA 1DQQA 1LDPH 4DK5A 4GAGH 3IDYC 1T7WA 5ALCH 3MV7D 5L8LB 2NUPB 4N26A 3FUNA 1QRNA 3VW3H 4HCRL 4HEMA 3X3GH 1LEKB 3LJ3A 2XXFA 1BHGA 4NZUH 5ICXA 4R26H 1M1XB 3D69B 3BSZH 4GQZA 3X1BA 4HKXB 3KPSE 3QISA 4S1RL 1IQDA 2WO3B 1T22B 3ABGA 1OE1A 3O6MH 1QTYT 1ZY9A 4TPRH 3O2VL 4PRBA 4RX4A 5C0BD 4R5VA 2YEQA 5GRXG 1BWWA 5C70A 4KKCC 3HS0A 1RJLA 2Z8RA 3QZLA 2QGBA 3QUMH 1OP4A 2TRYA 1BJ1H 1D9KB 4PJCE 3RJOA 1IC5L 1KTDA 1CICB 3EJCA 1K3ZA 5FW6A 2R56L 3RY4A 2EZ0D 1B3JA 3FHQA 1DJHA 1J1OH 3H6JA 1G7PB 4HFWB 3DX4A 5PCYA 4KI5F 3FFCE 4X5LA 4Y5VB 4TTDC 3NN8A 5HHPB 4GW5B 4HH9A 2J8UA 4NZTL 2ADIB 3SGEH 2KHAA 3S3CB 3ZDZE 5DHYB 5F9OL 1NSNL 2AJXL 3NIDE 2X4OB 4PGEA 3AG3B 3GSRB 1UH2A 1XF4B 3CSYA 5K1NA 4Z0XA 2WIIA 1OK8A 1NLBH 5L88H 2XRAL 5CGBA 2EE2A 2VMJA 3AWGA 5KTEH 2C9RA 1AZNA 2AJZB 4ANWA 4XVUC 4K9EL 1PKOA 4XP5L 4NSKA 1H6FA 4Q97A 1FVCA 3RIFF 1E9QA 3OKMA 4M1CD 3P0GB 3H2QA 4KROB 3U6XS 4FG4A 2BWIA 3C5ZA 5DHVH 3BPOC 3DJ9A 3AXHA 5AW9B 4X7TA 2OL3L 3NK3A 3B1TA 4UI2A 2ZIDA 2HN7B 2WHVA 3OXRA 2P7TB 4V2BA 3SKJL 4YEFA 2B1OA 3ZE2B 5IEHA 2IDFA 3UP6A 2DN7A 3AM8A 4M3JA 4QXGL 2E46A 1G7QB 4Y4HC 2EIZB 4ERSH 1MLCA 3BHBA 3LEVH 4UMSA 2WZ6A 4LGRB 1LO2L 1NCDL 5HY9A 5JQHC 4U05A 1ZANL 3GKZA 3Q6FA 4TN9A 2HVJB 2ZXCA 2EDMA 1EJFA 3KLQA 3BEWA 1BQLH 1W0VA 3KVQA 1X5JA 1SPDA 1KLGA 2X88A 3OAUH 1YPZE 1IM3A 2YEVB 2ATPA 3PNWA 1L9OA 2GITB 1F4HA 1QW9A 5DFWH 5EU6E 3UH8A 4NIYE 4A2LA 4OGXH 3VXRB 3TBTB 5CN3A 3EDJA 3GHEH 4R7DA 2HAZA 2VL4A 4JJ5A 3DPBB 5CJOH 2FECI 1Z0MA 3DC0A 2V9RA 4Z77A 1BXVA 5JXAL 2FJGA 1DJSA 4MNGA 2WINA 1MIEH 1BFVL 2CJ3A 3L7EA 1EERB 3AY4C 5E5UB 3HAEG 1AO7A 2NYKA 3PCYA 4RMQA 1U3YA 3VA2C 3W5NA 1A9BB 1EHLL 4JDTL 1XZWA 3QFGA 3UGXA 1N68A 3G04B 5F2FA 5FGSA 2WWMC 3WHXA 2P5EE 4NCC1 1N2RA 2H47C 3D06A 2DBLH 2X87A 5EC2A 3P4NB 5ID1B 1VB9A 4WGKA 3VXME 2Z91A 2YAPA 2QADB 4ZXBC 5JW5B 2FRGP 4N8PA 4TLSA 2ZX6A 3MLPA 2J43A 2WTRB 4JFYA 4TUUA 4NO3A 2DYSB 3FMGH 3K74B 1G7JA 4R4BB 1FLTX 2O72A 3H42L 2IH1B 1AJ7H 4MDIA 4U4IA 2FTAA 3V7AG 2R59A 5I19L 1RPUA 1AQDA 4NPJA 3QQ3A 1JNHA 2A83B 2FQEA 1HILA 2M2DA 2LOEA 5D1ZD 3TJEL 3BQUD 1YJDH 4NRZB 4JDVA 1WEJH 1DZ0A 1LO3H 1B4JL 5F8RC 2VSKB 3AUVA 3QIWB 4U3XA 4XTRC 1ONQB 4J3OF 1PBYA 3KR3L 4AQAA 2APFA 3D7PA 3S0PA 1E28B 4NKQB 4PRPD 4HSQA 1SXNA 4HK0A 4AYFB 2YAFA 4WEBL 5ABZA 1TSRA 2WC7A 1UCTA 1DBKH 5IOPB 2BDNH 1CF8L 1GHFL 4EEEA 4GG8B 5AVWB 3Q13A 1FYHB 5F0LB 2BWDA 1I7UB 4NC0B 4IIQA 1U8MB 3FUJA 4DN3H 4A66A 1WJ3A 4Q9CA 4FTVA 5D4HA 3CFTA 4B9KC 2X0UA 2P5WA 3N0PB 5KVFE 1M6OA 1ZRUA 1PQZA 4N85A 4K8RH 4IRZA 1TZHB 2VW7A 4H88H 3FNKA 3U6RA 2UZXB 3HE6C 4XBMA 2PPCA 1TMCB 5D2NB 5T3XL 2W9EH 3OPZL 3CSGA 1K85A 5EN2B 2JIXD 3CQPA 5AB9A 3PXJA 3H7LA 2J7LA 3UERA 3PNRB 3BPNC 4N0UB 1J12A 3V6ZA 1J8SA 4AKOA 3MJ8B 1MWAL 1XSOA 2C4XA 2V7HA 3G6DL 5LAXA 5DK3A 3KLKA 4DP6X 2FR4B 4QRFA 5IFJA 2QBWA 2CPUA 4K94C 2Z6FA 4Q2ZA 5E7BA 4MB1A 4GLRI 2J8UF 5GZOC 4QLWA 4O58H 4JO1L 1VKXB 1RZIA 4FABH 5H94B 4NLAA 3KM1A 3U4KA 5E9DD 1ICTA 3TZVB 1EEZA 1KN4L 1WISA 1AE6H 2ZCKL 3N6YA 4HUNB 3FUMA 3PV6B 4TNVF 3ZGHA 1ZDSA 1NCWH 3MX0A 2XWJA 1JF1B 4ZX5A 3FT4A 5FV2A 3TVMC 4FXKB 3MO1A 2BOCA 3FCGA 3LIZH 5E6UB 1CDHA 2NNRA 2NTFA 1T7XA 2W80C 3ML9A 1IGIL 1U2HA 5CKGA 3EZJB 2AJSL 2XVGA 1AQMA 3NESA 5EBWB 3SEPA 3WFBH 5C6PB 2W65B 6CGTA 1QSFD 8PAZA 4AJYV 1OAZL 3B5GA 5DCCA 3NGBC 5CAYB 5DEGA 3V4VB 2ICWB 2OXGB 3NCYP 4MSWB 4HBQA 2IXQB 3VWJC 4EN3C 1BAWA 2KERA 2GK2A 2YSSA 3HLAB 2X5PA 3SN6N 2PCFA 5FA3A 2YKLL 1SBBA 3ESPA 2DDQH 2BNQA 4X7EC 1F3DJ 5DMKB 5AW1B 1ADQL 1KXVA 1MJUL 5B21A 3DGGB 3GI8L 3CFKA 3NSJA 1ML0A 1SJEA 5F7NC 5KN5B 4UQIM 2XXCB 3AQZA 3W37A 1M57B 2B15A 4BWWA 1MH5B 3EF7A 3ECBA 5JW4N 3HPLA 1VZIA 3MRBB 4O4YH 3IN2A 4BQ8A 1N8ZB 1DQQB 1RFDL 4HLZH 1OP5K 5HJBA 5I1EL 4PJAE 2AS5M 2VZUA 1T66C 3QAQA 3DVIA 1OLLA 4JREC 1QRNB 3P3TA 3HUJF 3I9GH 1OWWA 5FO7A 5ICXB 1UJ3B 2WUCL 5B7FA 1BFTA 1WTLA 2RTTA 2DQUL 1IQDB 3NACH 2NY2B 4K5MA 4BKTC 4IRSC 4UCFA 4FA7B 1RSFA 4PRBB 4IJ3B 1YEJL 3WKML 3JBG7 2HTKC 1RHHA 5LQBH 3HS0B 4G71B 1JDCA 3QQ4A 1RZKH 4ISVA 1W72H 4H25A 3E1ZA 1JGDA 4JG9A 1KTDB 4HUUA 4LEOA 1XB3A 5I6KA 1N7ML 3L6FA 4M5SA 4P9ML 3S37H 1JZHA 4B9IA 3ARWA 3NN8B 4HH9B 1QTSA 3C6LA 4MAYA 2J8UB 3EGDB 1NGQH 1ZT1A 2B0SH 4G83A 4U1SA 1MEXH 1XF5A 5I71C 2GJZA 1RIUH 4GKNA 4AG4L 5FCUL 5EIIG 3WN6A 3GSOB 3KXFB 3LD8B 4PS8A 3ZL2A 2FX9L 4PGEB 2GYSA 1PJ9A 1BOYA 4TV3A 1A1OA 2APWA 3EO0A 2EEFA 3CSYB 3PREA 4PJ9B 5IBLC 3CZLA 2XTJB 4XMKH 4Z0XB 2WIIB 3MUGB 3V4PA 3BD5A 4HWNA 4QTIL 2K6ZA 4YHYB 4ZS6C 4Z7WA 4K3GA 1MRDH 5LKNA 3Q8CA 2AAVA 4HV8A 3LRGA 1KXQA 3NA9H 4LRNH 4B3EA 3D39A 4NSKB 4KUZL 1FVCB 1E9QB 2Y2TA 4QRPE 2XVBA 3C5ZB 4PS4H 3U25A 4Y9BA 4AE1A 4X7TB 2DM4A 4GRLC 3OXRB 5DSCA 3K8LA 5IEHB 3WAJA 2AI0L 2CHXA 4FKHA 1NICA 3N44F 1IE5A 5ID0A 1P1ZB 4JG0L 1NFDA 1KCKA 1MLCB 5DRZA 5HYSA 4LSPH 5TQ0L 5HY9B 3EJSA 1XH3A 3Q6FB 4K9JA 1HWGB 1Y6MR 4ZTOH 1W0VB 2NSMA 4CVZA 5AAWA 5I1AA 1AH1A 1KLGB 1JN6A 1HSBA 1S5HA 1XCTB 1IM3B 5AZ2H 4QPEA 2ATPB 3PNWB 2WSPA 3FO0L 5BXFA 2EDOA 3MLSL 3ATEA 4YHML 2CK0L 3BZEA 5LDUA 3OHXC 4R7DB 4IDJH 5HJDA 2IAMA 4JJ5B 4N3UA 2V33A 3PWLA 1R3LA 4BFFA 2FJGB 4O2CA 3HUJB 3CHXA 5HHVH 4MNGB 3GINA 2WINB 4QAWA 4GNKB 3L7EB 5E8DH 3VFTA 1AO7B 3ARZA 3RFZA 3L4ZA 3IRPX 3SE9L 2CRMA 2E27H 4Z1PA 5EOCH 1I1FA 3RDTD 3WHXB 2YRZA 2OW6A 3NCBB 1N2RB 4F5CE 1GGIH 5IMLA 5AVTB 2LVCA 4IK6A 1NEPA 5EZIH 5IESH 2CLZA 1JI1A 5EC2B 2FO1A 2XBTA 2Z91B 1CC3A 1M3JA 1P4UA 2WXQA 4LKCA 3FUEA 3KJ4C 5CP3H 2D7PA 3HR5A 4LEEA 5FYJE 3MN8A 5J5EA 2OJEA 3TJPA 3FUFA 3EBIA 1YY9C 2G9KA 4H26A 1HU8A 5GGRA 4ELMA 4JFYB 4IMLA 4OLXL 2VISA 4NO3B 1G7JB 1D5BA 1GCFA 2J6EL 2JKIS 4W6XB 4K5OA 4YS4A 3DO4A 2IBBA 2BFGA 4MDIB 2GVYA 5D7KD 1FGNL 3WHE1 3S3PA 5DF0A 1AQDB 1R3IL 1JNHB 3QQ3B 1NEUA 4WDIA 1JNLH 1HILB 4I0KA 1E5AA 3WCYA 4JHWL 3T2NL 2VAJA 5ECJE 2B1HL 3SGEI 3EOBA 4CBPA 4GJTB 5DJ0A 1J88A 3R0MA 5FGBA 3S8GB 1KXTA 5D1XE 4AQAB 4MB5A 3PGFL 1CGWA 1IZJA 3I6SA 3C5JA 2VZOA 3U0PA 4RSYA 1ZHBA 2FQFA 1AGBA 4HK0B 4YDIH 5PAZA 2XQ0A 2CAKA 3CLEH 2XQBL 1F8TL 3L4YA 3RZCA 1H3VA 5J11C 4YDJA 3V6FA 4HSAC 4D8PA 4KVCH 4PD4K 4KO9A 2JCCA 2P47B 3LZQA 4E9SA 2X0WA 5D7IA 1CT8A 4IJTA 2BLFA 3MV9D 4ZFQA 3WTVA 5GS0H 1TUPA 2A38A 4IIQB 1KCWA 4L8BA 5A2BA 1VHPA 1FCGA 4MD4A 5AW6B 4W9FC 5B8CA 2F8VA 3EYSL 1RMFL 4L29A 4YFEA 2HLFC 5T33L 1M6OB 3GMQA 1KB5A 2WJ7A 3VGAB 2CR3A 1PQZB 3V9FA 1KY7A 2FQDA 5TK4A 4MXWL 3U6RB 1MQ8A 2H2SC 4OZHF 2YPVH 4XO8A 3DWTA 1WWWX 4BH8A 1BVNP 2PO6D 4IOIA 3A6BL 4BKLA 4CBZA 4YIQA 5CIPA 3BDXA 4RFEA 2OYLA 4ESKA 3V6ZB 2HFFA 4E9VA 3LAFA 1FP5A 1LXMA 2F1EA 2Q7AA 2YA2A 3DMMA 3L7FA 4CVUA 5B38G 2V7HB 3EFDL 2EQDA 2P9RA 5EF1A 3C8KA 3IF1A 4A2DA 2QTEA 5H35A 1U8CA 1GZQA 1O9WA 3MJ7A 4Z0BH 5IFJB 4PS3A 1YEDA 4L9LC 4Q2ZB 5T5FL 5C0AB 3DTDA 1IV8A 3P69A 1RZIB 1A9EA 3WXWH 1D5IL 4TRPH 3L08A 2A6DA 1FH5H 3WY4A 1EEZB 3MCLL 3JWOL 4M02A 4F7PA 4ZO7A 4P2YA 2EKJA 2Y07L 3QCUL 3SO3C 1OPGL 3MX0B 3W56A 2XWJB 4F8QA 2ZG2A 1IKFL 3FT4B 2CWRA 4UQDA 3MO1B 5FYKE 2BOCB 4UQCA 5HPOA 2X9ZA 1ZV9A 2A9BA 1AR1D 3SDYH 4QEGA 2X40A 1EIBA 1LWJA 3GO1L 5D7HA 5I28A 3CSPA 4HEPG 5IMMA 1JJUA 4NQDA 2FJSA 5E2UH 1IUZA 3K6FA 5DEGB 3A0OA 3TWYA 3B2VL 1F13A 5JXED 5DZNA 2F5BL 3BYYA 3TTYA 5JPMA 3VD2A 4JM4H 1N4XL 3NFNA 1P0SE 2VGLM 2YSSB 3QXVA 2X05A 5EN3A 3PJNA 5FA3B 4NYLA 3T08A 2X0VA 3HI5H 4L2LA 3UBXG 5D96C 1NFDF 2BNQB 3EHBD 3QDGA 2A2QT 3WMPA 2JJVA 3QUXC 1FFPA 1KIUB 1MCBA 2F54E 3GRWL 5JYMA 3I6LD 3INUL 5JHLL 3CFKB 1Z2KA 4M3HA 5EZJA 4EI6A 5IB4A 2F19H 4U7KA 3HPLB 3M8OH 4FD0A 1QNIA 3JWDC 4LVNB 3ZX1A 5CJ8A 5A43C 2H26A 4NM4L 2Q3AA 4CDGC 3BAYA 5FO7B 5ALBL 5LNGA 4ONGH 5GRUL 4YMPA 3MLVH 4MCZB 3KLSA 3OZ9H 4FJ6A 5SWZD 2P43B 4HIEA 1SXZA 4O02H 3RIAK 2AEOA 2X28A 4Q7DA 2JB5H 5JIIA 1U95A 1RHHB 3T09A 7FABL 1TPXB 2IBZX 3QQ4B 4W93A 5GGTH 4ISVB 4ABWA 3MV7E 3EG9A 5GISH 5LGJA 1JGDB 1LWRA 4LEOB 5KVEH 4NERA 2W07A 4V1DA 3L6FB 3OC5A 1IQWH 4XNYH 4UOZA 3DTXA 3GI9L 1GKEA 1H0DB 2JKJA 1YYLL 3N41B 4ZMQA 1X4YA 4XCYA 4FTVD 4MAYB 1HYRC 2G3NA 4OM1H 1GJUA 5C0BE 1ZT1B 1X6NA 5EZOH 4OSUH 4U1SB 1XF5B 5FB8A 3QORD 3CZSA 1CN4A 2VDLB 1SUHA 3IU3A 4KK9D 1A1NA 2C3GA 2CH8A 2JV6A 3K1KC 3ZO9A 2GK0B 4Q6YA 3RJDA 4CILA 1A1OB 4N5ED 4ODHH 3O6FA 3QEQA 1T0MB 5EC1A 4L5FE 3V4PB 4NGHL 2WCGA 3B5TA 3G6JA 1EHXA 3MGTA 2OP4L 3DUSA 4Z7WB 2YAQA 3HIZA 4HV8B 4LF3A 3QJTB 5D70H 3NTCL 3D39B 2VLJD 3F01A 4X8CA 1E6OH 4EUPG 4DP5X 2FYYA 3HG2A 4WEUD 4C4UA 4DW2L 4ZO9A 4MA8L 1D5MA 2C4FU 2EEDA 1RAMA 1QWUA 1J0IA 3VO0A 3Q8FA 4JVWA 3G5WA 5DSCB 2JCCF 3Q44A 5D7IF 4FERA 1AHWA 2I27N 4BFEA 2QMKA 3WGVB 3MUJA 1NFDB 4PM1A 3ARYA 4BUQA 5DRZB 3J8F7 1A6ZA 4KJWD 5DFAA 5HYSB 5HHMD 1M7XA 2DB8A 2Z7YA 1XH3B 5DGRA 4XVJL 4JGUA 4CVZB 5I1AB 5DHEA 3V0AC 1PPIA 1JN6B 4QOKE 1HSBB 1S5HB 4LIQH 2AEPH 4R7XA 4XX5A 5BXFB 4RBPH 4YNYA 2JKNA 4JB9L 4TNWF 3BZEB 4KTDL 4D9QE 2WLYA 5IHHA 3IDGB 3N43F 2GG1A 1KYUA 4C58B 3LKOA 3PWLB 1R3LB 3NSXA 3RU8H 1CBVL 1WBXA 3LCYA 4GAAA 3DX6A 4MMXC 2RCSL 3MXVL 5EUKA 4UNTA 2WOBA 4RGMC 4Y5YA 1YHPA 1MG3C 3VFTB 3RFZB 4G11A 4DUXA 2NY3C 4Y2DA 4NKIL 4EZKA 3KCPA 3MRFA 1TJIL 4JZJA 5IMLB 3BN3B 1L3WA 5KOMC 4P3DA 4BE5A 1AGDA 2CLZB 1OHZA 1OGAD 5JZ7C 3MSPA 4ZS7L 3E0GA 3U0TA 4F92B 4J4PA 5CCKL 1ID2A 2H2PC 4LKCB 2VDRL 3OAWA 3UAJA 3UCQA 1MCPH 1WK0A 3ARED 4DVRH 3BYTA 4LT7A 1MJJA 3BWUC 4H26B 1RK0A 5D7JA 4ELMB 3ECUA 3MJ6A 4IMLB 2VISB 3UGEA 1ACZA 3MTRA 4RRPA 1D5BB 3LHAA 1EZLA 1F42A 3AZUA 1FRGL 1A7NL 1UATA 4CAGA 4IGBC 1MELA 1JPFA 4WDIB 5AW0B 5G5DA 2KLTA 1R5IA 1LP9A 4GSRA 1E2VA 1MJ7L 1EFQA 1RJYA 1Z9NA 3EOBB 4GT0A 5DJ0B 1GC1C 2YD8A 2DJMA 1PG7H 5E03A 5GS2H 2W91A 1HCZA 3AC0A 3ESVF 3C5JB 2CM5A 3U0PB 2G3ZA 1ZHBB 4TQ8A 4JPKH 5I0VA 3WHE0 2ZUWA 4Y0GA 1S9WA 2Q3ZA 3PP4L 4MQXD 3WO4C 5DJAA 2ZUVA 1G9EA 3D8MA 4YDJB 3V6FB 4D8PB 1F5WA 2JCCB 3HE7A 3Q8EA 4IBZA 3NCWA 5D7IB 1CT8B 4KY1L 1JYWA 2HKAA 5CU9A 1BD2A 4FQXD 1YAZA 2OCJA 3F6JA 4DKDC 3FQ1A 4L8BB 5F9AC 4LSTH 2VQ1A 3MC0A 1BVOA 3CX2A 3JTSA 4MD4B 4NUQA 5E6YA 5B8CB 5I1KH 4P2RA 4L29B 1E3FA 3RX9A 4GG6F 4ODWA 3HC2A 3GMQB 1KB5B 3FKUS 4RVBA 5B1JA 4M6NH 1T6VN 4NO0D 3UO8B 2DJUA 3HG1A 3OR7A 3BUDA 4BH8B 3MRNA 4IOIB 5T3XD 1BM3H 2NYYC 1YC7A 1NAML 2A1WH 5CIPB 3LKRA 4YIQB 4RFEB 4JN1H 3G5YA 3KPQA 4J3OH 2HFFB 4FL4B 4B0MB 2F15A 1N26A 3DMMB 2X4NA 4KY2A 3RURA 3MA7B 3C8KB 1HDMA 3IF1B 2OX5A 4K7PY 1U8CB 1FNEA 1GZQB 5IVNA 3MJ7B 4MZIA 4QWWC 5I6MA 1YEDB 1A7OH 3LVEA 4JEGB 4OLEA 1EVTC 1KJ3H 4R7NA 3UDWC 2H3NA 3PL6D 1A0QL 1HEHC 4PW9A 3Q2CA 4BINA 5FLVA 5EA0L 1A9EB 1CTMA 1EHAA 3RDJA 4JFFD 4P59L 4A63A 4GQ9H 3HRPA 1CXHA 1WWCA 4UINL 1F3DH 3FRUA 4S1DC 4XX1G 1P9MC 2PUQT 2J1ZA 2GABA 3TA3C 4CL7A 3E8UH 2R7EA 3KG5A 1JZGA 3BAEH 4FFYL 1KBGH 1USQA 3DBSA 3O4LA 3TCTA 3CVDA 1P4IL 5C0RL 3LH9A 3B9KD 2AJVL 3H53A 5FM5M 3BWZA 4NUMA 5IMMB 5E9DE 1MQKH 2BVUA 4NQDB 4Q4EA 4P2OD 1BREA 4XHQA 5CEZL 3ZXAC 3TYGL 3H4HA 1DQIA 3VXRE 4DWHA 5JPMB 3U36A 3NFNB 3VH8G 4XOCA 1G0DA 1ZAGA 4WFED 4NYLB 4S0HA 3K4AA 2WP3O 3QDGB 1WIOA 4M7ZB 2WQWA 1FFPB 5ECGA 3WXVL 3TF7C 1XIWD 1TYJA 2XA8H 4XMWA 5FUZH 4U1JA 4EOWH 4DOHB 3V4UL 5EZJB 5IHWA 1EWHA 4EI6B 3OWRA 4GRWB 4Z7VA 3KWUA 5IB4B 4RMUA 1FLRH 5DUBA 4KZEH 4GS7C 2EE3A 4I48B 4IS6A 1P7HL 2J8OA 3UYOD 4H2CA 3LDBB 1EA9C 2CNZA 4LRIC 4FULA 2H26B 2XWDA 5DMGC 5GGQH 1JGUH 1U58A 1CE1H 2EEAA 5JR1H 3FBQA 2GT9A 2J55A 2Z31C 4TYUA 5MEND 1R4XA 4BRJA 3FF8A 1HH6B 1ZKAA 4GG6B 5E6RB 1NGYB 4KRLB 1YNLH 5CD5C 1WIUA 1NMCC 3GLZA 4F2MA 4HIEB 4JO2H 3R8QA 5HYJD 2EDFA 5D72L 3GT6A 2WZPD 4N6QA 4ACTA 5GHWL 4KRPD 4D2NA 2FWUA 4EIGB 2A0LD 3EG9B 4I3GA 1XFPA 4JFVA 1SOSA 2W07B 4V1DB 4G5ZL 3ENEA 3KPNA 5JPNA 1MF2H 1T2QL 3DTXB 1DSFL 3ABMB 4NI6A 4JLRA 4Y16A 5DJZA 1SQ2N 3II3A 3EJZC 4E36A 2IMMA 3MNDA 3CXHJ 4IRJC 4K3DH 2YAMA 1JERA 1ZTXL 2JTYA 4LLDA 2YGOA 3ZYIA 3WJMA 4EIZC 3FUHA 1DQLL 1QWHA 5GSVA 2CBTA 5FB8B 4B9ZA 4P9HC 3IU3B 7TAAA 1A1NB 3HMXL 1ZIAA 3M17A 3UJIL 2COQA 1F00I 1EBPA 3CAFA 3L4XA 1G9NC 3O6FB 3QCVL 1U8NA 3IU4H 1LP9F 2B2XL 3QEQB 3QO1A 4N4YB 5EC1B 3O6LH 2I7OA 3T71A 2K4AA 2ZICA 4PWJA 3G6JB 3MGTB 3NRQA 1F58H 3DUSB 4WHTA 1VZGA 3GBNL 5L4IA 4CNIA 4LF3B 5GGUB 4EXPX 3MV11 1O6SA 2XWCA 1NCHA 4YE4L 2O5XL 3C8DA 3ET9F 3K3QA 2FYYB 3M1BA 2AGJH 2NT0A 1MN4A 3PHQA 2X9WA 3OC8A 4K23H 2F1BA 2JJSA 3BUPA 3CFJA 4JBSA 4F37K 5I8EA 2XZAH 2V9TA 1LL1A 5AOKA 1N70A 3AQYA 4F27A 2CGYA 3L81A 2VXUL 5AVQB 1AHWB 2H3KA 5AVSB 3ZMRA 4ZMYA 5C9JA 2QQNL 1JI2A 4N0UE 5JOFA 2ICEC 5D9SA 1A6ZB 1E50A 3QRGL 1N12A 2FGWL 3VXUD 3QIUC 2O6FA 3LPOA 1DFBL 3HLKA 2LAAA 1QHQA 3EH1A 5CCGE 5KG9A 5J1TC 2ZOOA 4YNYB 1ZV2A 4FYTA 4WSGA 3NJJA 1R5VA 3ESUF 1PX4A 1MW0A 2ED9A 3LKOB 1GMIA 3G7TA 3JTTA 3MJGX 5D1QD 1WBXB 3SPVA 5ILTH 3DX6B 5H2BB 5EUKB 2CBQA 1JMZA 4Y5YB 4H8HA 2Y24A 3PRZA 2JNZA 4NWUL 4XNUH 2WP3T 1FGVL 2WXIA 4PSPA 5F1IA 5IM7A 4Z3GA 3LRKA 2YRLA 1EXGA 4NM8L 4U2YA 4OTXH 4YE0A 1F3RB 3GUFA 4WU5A 5CXPA 1BOGA 4Y2DB 4LHJB 3KCPB 4PP2A 5F1KC 4L4TE 2WYHA 3MRFB 5E2JA 3TN0C 1UXSA 4FQLH 3VFNA 4P3DB 3FN9A 5J0BA 1AGDB 3RWJA 4PJHA 3LOWA 5BS0A 1CGTA 3U0TB 3OSKA 3UG5A 5IQ7H 5HDLA 4C56A 3ZKND 3DGDA 2OR9H 3LN5A 3S97C 3CBJB 1ACYH 1UGKA 2Y06L 4GBXD 3T77A 1MJJB 3ISWA 1RK0B 5D7JB 1U6AH 1CK0H 4FNUA 4N2FA 4I9WE 1T5WA 2WLNA 3SDCA 1SN2A 4PJ5D 4JANA 1EV2E 1FBIL 3JT2A 1HIMH 1RUQH 4HJ0C 4RA0C 3SB3A 3L4UA 2OMWA 2A3TA 5B3NA 1J18A 1KIRA 1JPFB 3K6OA 5G5DB 4RIRA 4BFNA 4CSZA 1R5IB 3WNOA 1LP9B 2Q86A 3U1QA 2VDNL 1RJYB 2QSCL 1MCLA 3LHPH 2OJZL 2VR7A 1QRNE 5I8OH 4HEME 4PWGA 4PGJA 1PZDA 3RA7L 1MFDL 4KZDH 3CBRA 4KKBC 4QHKJ 4LLMB 3WY2A 3ZZSA 2AJUL 3ZQWA 4BD4A 3KEDA 4BSJA 3SOBL 2VN7A 1IGTA 3F04A 3OLDA 4M62H 2APTA 5DJAB 4LL4A 3E9TA 2DW5A 4Z7VF 4JW3A 4WKXA 3HE7B 4G9FA 2VLMD 1OGPA 2Y6SD 5KUKA 4AMWA 3JV0A 1ODUA 1R17A 2VLRD 3ULUL 4MD0A 1BD2B 4H8VA 4PJXA 5CS7A 1HYSD 2DTMH 1YMMD 4CC4A 1XSKA 4M43L 3FQXA 2VQ1B 3QWQB 5GS1A 3JTSB 1AS6A 1E4KA 1P5UA 4YHLH 5E2VH 4P2RB 1AANA 1E4XL 4ODWB 3TO4D 2EDJA 2FO8A 4HLEA 3X3FH 2O5NA 4PB0L 3PDOA 1WRFA 3CZGA 2J8UE 3HZVA 4U1IA 3HG1B 3OR7B 3GTNA 3PHAA 1JF5A 3D4GA 5C2UB 3K6IA 1SJMA 3MKKA 3MRNB 1JZ5A 1HNYA 2DV6A 4PP1D 4L3FA 3LKRB 3SGJA 3G5YB 3KPQB 4KRMB 4FQ1L 4Y4KC 2FJFA 3KH4A 2AXJA 4J27A 4X4XA 2WXKA 3AMKA 4H8PA 1ZGLA 3CXDH 2XTJE 1KPRA 4X6FA 4LK4A 5C2BH 5CMAA 1TO4A 1HDMB 1JV2A 4W9CC 1FNEB 1L9MA 2VM3A 1NCAL 3OKNA 5GJSL 5HGHA 5A16A 2HMIC 3NDZE 4JFHE 4R7NB 2Y5QA 2AQ3A 1H9VA 4OCNC 2H3NB 5TFSL 1HL4A 3CZKA 1ADWA 4P04A 3UG3A 2OMVA 2EDHA 3FRUB 3D05A 4A7SA 4K2UH 3T4AC 2GTZA 1DTUA 5CFHA 2R7EB 5D1XC 2Q6WB 3WENA 2FX7H 3L5HA 2MRYA 3FO1A 1NMBH 5CJXC 4JM2D 3GLEA 3O4LB 1IGYA 2HPTA 3U9PH 4U7MA 3WNKA 2ADYA 2VDPL 1GKOA 1N8OE 4FFZL 2L7JA 2DI9A 2ZX9A 4XB8A 3U7YH 4ZJ9A 4QXUH 4JQVA 4O5LL 2A4EA 2OSXA 2IOOA 3ZSTA 4FFWD 1CE6A 2BIIA 4F57H 4YSAA 5FUOL 4YXHH 3VGEA 2CKNA 4DQOH 1UD5A 4TULL 4XI5D 3S6CA 3ZZ1A 5I1JL 4JKPL 5HD8C 1D7FA 3U36B 3FN3A 3O9WC 2H0JA 2R9HC 5JOEA 3W5MA 1JWSA 4MJ4A 3PJLA 3ZRFC 4Q4IA 1NCGA 4MNGE 1J8RA 4YAQA 1OP3H 4UYQA 35C8L 1NBVL 1I3RA 4M93C 1ZA6A 1FDLH 4KKNA 3DK2A 2VDQL 3L1OH 4L48A 3KBFA 4U1JB 3AQXA 2NY5C 2VDLH 1RUKH 3IWUA 1MUJA 2R69H 1EZVX 3FHEA 5IW6A 3BN9D 43CAB 1H3UA 4Z7VB 5H8DA 1OO2A 2VKXA 5DUBB 4IS6B 1KLFA 1DN0A 5E2WL 3WIIH 1JYNA 5K39A 3V4PH 4HZLA 1JTTA 3FOLA 3C09B 1U58B 1INDL 1NCOA 3M45A 1Q0EA 5GSRA 3X14A 2GT9B 3T6WA 2VABA 3IB4A 4KGLA 5GXBB 2YAHA 2L7QA 3RQ3A 5ITFB 2LHAA 4RGNB 4XGZA 5I6XB 1FI8C 1QTPA 2CA4A 4YZWA 4NN5B 3MNVA 3KEHA 1WA0X 3WO3B 4EI5D 1XAUA 3CZFA 1EUUA 4OD3L 4F2MB 4ZUTA 5LNDA 1IJ9A 4ANVA 2X4RA 3EJYD 3IYLW 4RZKA 1GJWA 2GAZA 2CG9X 4OCYL 4GXVL 1CDIA 3OJMB 4R0LA 4KOBA 2ZOWA 4X83A 5CZKA 5CLXA 4S0SD 2R0KH 3MRCA 2ICWI 4XP1L 3KPNB 4Y16B 4K3JL 2GBUA 5DJZB 4JLRB 1IJNA 2ZP9A 5T5NG 2P26A 2J57A 4HOWA 1BIHA 2K6WA 1GIGL 4S10A 1BQHG 2D7TL 2WXHA 4LLDB 2MIZA 3WJMB 3BMVA 3KGUA 5JUEH 2HYMA 3MRKA 1HE7A 5GSVB 3R1GH 3GSNH 5DZLA 5GGVY 1SHXA 3NCYS 4X6BA 1IAKA 4I18C 5LVEA 1XWVA 3HMWH 3M17B 2PXYD 4N24A 5I18L 3QRBA 1KPVA 1U8NB 2VYRE 3QO1B 4AEEA 1PD6A 3EYOA 2R1WA 4KXDA 4WFFD 3VYNA 2ZF8A 3QJOA 2E8ZA 4PJIA 4GQRA 4FTVE 2R29L 1IU1A 4A39A 1E30A 4CNIB 4DP8X 2P5WE 3B2PA 2G60L 5D5MA 3NBNA 1O6SB 3ARFC 4OFQA 5IHZB 2OYMA 4FXTA 3M1BB 3GWJA 5I8KL 4P46C 2VDML 1K72A 3PHQB 2KI6A 3FU5A 4TVSa 1LJMA 3BPLB 5G55A 3CFJB 3QHZL 4D0BA 3OKOA 5I8EB 1FL3A 2VSCA 4WEEA 5LBGA 3UOAB 4HC1H 4DH2A 2NNFA 5C9JB 2YWZA 4E41A 2M8XA 4PJXF 5J13C 2VMCA 2EE9A 4OT1L 5JOFB 1HOEA 5D9SB 3FUIA 3UZEA 3HKFA 1RZJC 2R4SH 1J8HA 4NCDA 2OZ4H 2C9VA 3PDDA 3BDYL 2GEEA 3ZDWA 4AV0A 2E9WA 4AZ8A 3P9WB 5KG9B 4BCYA 1MXGA 1NC4A 5KVDE 4LCUA 2BNRB 1F4XL 2HT4C 1R5VB 3T6VA 1QSFB 2YD6A 3O8XD 3H54A 5BMFH 1GS7A 3F12A 2BSRA 3VFGH 3O3AA 1HHHA 1U3HD 4MZ3A 4YXKL 1S9KC 2XV0A 5CU5A 1E3ZA 4KTGA 3RWHA 1SZNA 1XF3A 1OE3A 3DOIA 3GJFH 5F1IB 5IM7B 3STZA 5EBMA 3WYRA 4WU5B 1BOGB 4FADA 4U3SB 1UA7A 4PP2B 4X9BA 4F24A 1E0OB 4K94L 3AG4B 3W11C 5DTFA 2D8KA 1XD0A 1DO6A 3VFNB 2HKHL 4WHDA 2WO2B 3HB3B 3RWJB 3U4BH 3V79C 4PJHB 3BGMA 1RKRA 5ICUA 3S34L 5LWYH 1T89A 3LN5B 2YQGA 4PLOB 5FHAH 2NQCA 3T77B 5DFVC 5EZPA 5JO5A 5AW3B 3JVGC 5J6GA 1SLVA 2BNQE 2WLIA 2KH2B 1WCQA 3TA4D 4ZO6A 3OR6A 3EDKA 2ZWKA 4ZI8A 3VG9B 2Y7MA 4YDNA 3SDCB 4CN6A 5EZLA 1CG9A 1UENA 4JANB 4HYTB 5BQDA 1NCCL 2LV4A 2ZD0A 3B83A 5CIPH 3WU1A 2OMWB 3BCDA 2CCLA 1RZ7L 1VEOA 2A6IA 1KIRB 1LDSA 4RZCA 1WITA 3DHJA 4RIRB 1DBBH 2XJKA 4M6AA 3O4OB 1QYGL 5DD5L 3VRLF 2Q86B 3TT3H 4QJ4B 3IETA 3GXUB 2GIMA 2ISDA 5ESVA 3S35L 4DO5A 5JIDA 4ALAC 3WUZA 4FI7A 4HG4J 1NDMA 4NJ9L 5DWPA 1JHLH 3WSQH 2CCVA 2J25A 5JTWA 4A04A 2AJYL 1MZYA 4XWOC 1I3GL 1VLXA 3HNSH 2HP4A 5J06A 2R2EA 3BUBA 1CFTB 4XMUA 4WZ9A 3V55A 1WZLA 2VR3A 1OAQL 1TT6A 3ZDXF 4OBRA 2FNBA 4MD0B 4N0RA 4EXKA 4PJXB 4HULB 5I75C 1T7VA 3FQXB 5IB1A 4BKSC 5GS1B 4OCWH 3OZKA 1P5UB 4FQCL 5AYQA 2EH8L 1ETB1 4B7IA 2HPOA 4JCWA 3KCWA 6TAAA 3DLQR 4HD5A 4ZYKA 5KSBA 3PDOB 5FGCB 4ZFOL 2VO8A 3HZVB 4H1LA 4U1IB 2LTQB 4WY7H 3EH2A 1ZJAA 3L9EA 4ZPVA 3RIFK 3VFUA 4Z7QE 4XNAA 3HVNA 4AEIL 4WW2A 4ZG1A 3QO0A 5B22A 3NCJL 5D4QA 4ZUSA 4XCNA 4JRFA 3QIBC 2FJFB 2V5YA 3NABL 4X4XB 1IEBA 4XMZA 4HS6A 1ZGLB 4QCIA 1YDPA 1KPRB 1NL0L 5CMAB 4YQXL 1JV2B 3T0EA 1ORQA 4FTDA 3BP7A 4MA1C 3OKNB 5HGHB 3OAZK 5A16B 2BS8A 3WE6A 4MJJA 4OCXL 4Z7WE 5AWNL 1M7UA 1KXQE 1GAFH 2E4TA 1R47A 3D39E 3JV4A 5IT2H 5E4EB 1E43A 2OMVB 3FTGA 1OT2A 3M6DA 2QKSA 3FB8A 2GTZB 1N9PA 1H3XA 1MJ8H 4DKEL 1M56B 1NFDE 3FO1B 4J3SA 1IBYA 4PJIF 1IGYB 3AY2A 3L4TA 3SE8L 3KM2A 4N20A 3HG0A 3MI6A 3SIKA 4KTEL 2VDKH 3PWJA 3T6QC 1NUDA 1CE6B 4DPBX 2B4CH 4GMTL 1LLAA 4RISL 2H1LM 4BSVA 4Q74A 1D9KC 3KYMA 1R0AH 2XN1A 3QQNA 2R0LL 1CICC 1X5MA 3EO1A 5CEZD 1V7MH 4HT1L 1JWSB 1ZK5A 3KLDA 4LSQH 5J9PA 3EW3B 1T7ZA 5BS0D 2X89A 3F00A 4YAQB 4Y5VC 1NOLA 4U1HB 4LARL 3JT0A 1I3RB 1ZA6B 3QYMA 3IFPA 2WXGA 4WO0A 1O7VA 5MP6L 1SEQH 2NY4D 1MUJB 1Q0YL 5IW6B 4U3HA 2QQQA 2P5PA 4I4WA 3X12A 1ET5A 3AS0A 1UZ8A 1TEFA 3DRQB 2VZSA 3I3EA 4LPCA 3OD3A 3ZDXB 4WFEE 3PFQA 2Q7NA 1KLFB 2I60H 1DN0B 2X3AA 2X42A 4QTFA 5K39B 2I25N 4HZLB 3FOLB 4RDQF 1DQTA 3X14B 5GSRB 3TEXA 5I1HL 3GKWH 1I1AD 2VABB 1MCIA 3BKJH 3IFLL 4JPSA 1G7LA 3KYKL 1YEFH 3O2DL 3MTXA 3D3VD 3RZCD 4XGZB 3WN5A 1PNCA 2KYIA 3MNVB 4ELME 4H2AA 3PS6A 5IMKA 1JRHH 1UKTA 4KROC 4ZUTB 4FFTA 1DBJL 4KO5A 4X98A 2GAZB 1UWFA 3B3IA 3RGHA 2VXVL 4R0LB 2KDGA 3BP4A 5CJBA 2DQCH 3PPSA 4ZQKA 1C5BL 1OTTD 3MRCB 2C3WA 4E42A 4ZW3A 3MRHA 4DP9X 3ZGIA 1DCLA 1GGBH 4GIPD 4BK5A 1LO0L 3L1GA 2B9BA 1OCWL 3BT0A 3O3EA 4AKQA 5HYJE 4IHBA 5IJKC 1XR9A 4KRNA 1DP0A 1LNUA 3MRKB 1MI5A 3INOA 2Z93B 2XY1A 4X6BB 1IAKB 4AJ0A 2IMNA 2JCCE 5D7IE 4LFHD 1KPVB 2EVJA 3OKKA 2R1WB 4AT6A 3WFDH 3RNKB 4DCQA 1J1XL 1E4WH 4PJIB 1D6VH 2Y3AA 1Q94A 3ILQD 4UT6L 5HYEA 1SXCA 1JZJA 4FQHB 3UYPB 3W81A 1OCOB 3ZE0F 5D5MB 1Y1DA 3NRPA 2O5ZH 3EYUH 4GXUN 3VQ2C 1W9XA 3SDAD 1BYNA 4OJDH 15C8L 3PGDA 1BGXL 2CKBL 4XCEA 4D0BB 3OKOB 1FL3B 4O00A 1DDHA 3MRQA 4X2UA 2O61A 1KTBA 3QJFA 1UYWH 1ZLEA 4DGIL 1KJMB 3EXLA 2QADC 4E41B 5GPRA 2WCSA 1OW0A 3RGVA 4A7UA 4YJZL 1J8HB 2F6AA 1THAA 3N1MC 3ZR5A 5L2KA 4JPVH 1AY1L 3ES6A 4PGZA 4XZ4A 2UYLA 4XBGA 2HX8A 4Z8FL 4AZ8B 1QLEL 4AQ1A 5KSBF 4B53A 1A22B 1X9LA 5C3TA 2V17H 2VERA 4QKXB 5SX4I 3KNBB 1MIML 1NC4B 1NKOA 4YBQC 3SDDB 3NSFA 3TASA 5G4MA 5E1HB 3MBXH 2JMRA 4WW2F 4OFVA 3HAEA 4XVSL 2BSRB 5KEZA 3ULAB 2CJUH 4XP6H 3O3AB 5TF1H 1AAJA 1HHHB 5CSGA 2NRDA 3QIWC 4GIOA 2D03L 4P99A 5J1SC 1MY7A 1XF3B 2DTSA 1GZHC 3CZEA 2VB5A 2VXSL 3STZB 4A37A 1FAKT 2MPVA 4P3WA 4WI9A 1KGUA 5E23A 3MRMA 5EBMB 3Q9PA 4LNVA 3D4ZA 4I0CC 5IHUL 5F7EL 3BZ4A 5DJDB 2P28B 2KMWA 1OTUD 1DEDA 3GB7B 2WTOA 3SZ6A 1MFVA 4NQDE 2AEQL 3K80A 2YD9A 1W15A 2YPLD 5DTFB 3U46A 4OZGF 3RTQC 3BGMB 4IKJA 4OCSL 5D1QE 3POHA 3IMVA 5CJQL 3X1FA 2JLLA 1HZLA 4P5TA 3V0WL 1EH9A 1KGCE 2A99A 1LWHA 3P73B 1KJVA 5JO5B 5J6GB 3BXNA 3EFFA 3QDGE 1WE5A 3D08A 3N06B 3OR6B 5GS3A 4NFCA 1TZGH 1AGCA 3UTSD 3KJ6L 3VG0L 3D87B 3TCLA 3TBSA 5D2NC 5EZLB 1LGVA 3D2TA 3B56A 4DOHE 2MNUA 2AHIA 3BE1L 5MEPB 4JZOB 3KWTA 1RH8A 2A6IB 5E2TL 2JELL 3CJJA 4GRWE 4RZCB 3P02A 3FU7A 3LV3A 3F84A 1VDGA 3IETB 1EEYA 5JIHA 3DX8A 2FIRT 3JV6A 3QBTB 3U0WH 1EMTH 4AK1A 1L9SA 4HUWA 3AFLA 1KEMH 5KYUA 1UOKA 2ZYRA 4YHNA 3B2UD 1FL6A 3BLKA 4HJSA 2GSIA 4PJ5E 1ZLWH 4DGYL 4LSRH 4DAGL 2F8IA 1QO3A 5BVPH 2YARA 2EIKB 2XN9D 1ILSA 4WRLA 4NZRL 4PGCB 4ZSOA 5CNHA 3TZVC 1TJXA 3HG3A 1FF5A 5AW7B 2R2EB 5F44A 2XNAB 1B2WH 3B7UX 2H0FA 2LW3A 3DROB 2H6UA 3Q01A 2CDGA 5ICZA 4N8CH 2VQ4A 3T0VA 4FXKC 5GRZA 2IANA 2A9NH 5IB1B 5LG1A 1XXFC 2QGEA 4V1DE 4AV5A 3GMLA 3JWDL 3ULUD 4POZD 2E9IA 3T8MA 4AIZA 3MZTA 1NPUA 5DQJA 5KSBB 3BUQA 5C0GA 3N3EA 1ES0A 4H1LB 4PJEF 4OQTL 4DKTA 4MCYB 2DQEH 4QRRA 2BFVL 1SQMA 1ZIBA 2P1YA 5HVHB 4ZPVB 5LN4A 1VAHA 3VFUB 4L0PB 3QNZA 2ZP0T 4XC1L 2QR0A 4JPWL 4WW2B 1QSEA 3QO0B 5ELIA 4ZUSB 4LPYA 1UADC 4XCNB 3OHMB 3VRJA 1V3KA 4JFEA 2X6CA 1PY4A 3B7YA 4TUKH 4HS6B 4HJ1A 3MLUL 3QEQE 4J3OC 4I8DA 4TVPL 5IGXH 1ZS2A 4I1PA 1H3PL 1ORQB 4UQAA 3BP7B 3WOVA 3G6JE 4KKCD 3HJEA 3WE6B 4JO4H 4JPIA 1IGCL 1BBJB 4WHCA 3JV4B 5IG7A 1M4KA 4G7SB 4IBWA 4YOKA 3FTGB 3VTTA 6PAZA 4G3YH 2CKBA 1QKZL 2PWGA 4OZGB 1PY0A 2W9DH 2BS71 3X11A 4TTDD 4AYGA 5KOVC 3QZWG 2K7QA 5FR3A 2IPKA 5CILH 2NR6A 5TQ2H 2YJQA 5IB5A 4MA7H 4U49A 4M1DL 2O26U 2EECA 1KTJA 2FDBP 3JWNE 5T1DL 1Z32X 5DA0B 3V0FA 4W9JC 3A4AA 1G6RL 4LU5H 2NY2C 3ETBF 3ATDA 4XO5A 2NY6B 3PWJB 4IJ3C 4K7PL 4MS8C 4IU3A 3UJJL 4PRID 3HS0C 2O5YH 4PW4A 4BSVB 4LDEB 3KYMB 2X2JA 3NVQA 3C5XA 3ZHKA 5KVGL 4YX2H 3EO1B 5I1IL 3L3IA 2OK0L 4MLIA 4PWKA 4XVUD 5DZAA 1YVLA 5J9PB 5F3BB 4MYPA 5AL0A 5T3ZE 1IAMA 1L7TH 1QUPA 3A21A 4M1GL 4ODUB 3AXLA 3T3MF 3IFPB 2XKNA 3MU3A 4JY5H 5DJYA 2ZX7A 5AZEL 3OMIB 4E9TA 1O6TA 4Z23A 2JKLA 1ESOA 1QQDA 5E08L 3KDPB 4I4WB 3X12B 1NLDH 4L18A 5FKAA 2YBRA 2AQ1A 4Y4HD 1UZ8B 3LD8C 4NO2A 4XVTL 4G6KL 3PYCA 4FDWA 2NY1B 4UTAL 5FM8A 1RURH 2KS0A 3GDCA 3QYNA 1RU9L 1G7MA 1QG3A 2ADFL 2XTJC 4HUXB 1N10A 1CFMA 3IJ9A 4J6RL 3TXAA 4NAMA 1CLZH 4YHYC 1S3KH 1G7LB 4FS0A 4KQ4L 3CSBA 6PCYA 4WUKH 5ESQA 5GJTH 2GJPA 2GJRA 5E5LA 2IQ9H 3C75A 3WN5B 4Z7NF 3D85A 3FF7A 3QG7L 4PJEB 4U2ZA 4A2EA 3ARRA 4AYDC 4AYBA 5IMKB 1SJVA 1PMYA 3F2LA 3C5ZC 5LXGH 2E56A 4HWEH 4X98B 1FN4B 2TSBA 3H9SD 3E3QE 3B3IB 1T6WA 2OR7A 5AOZA 2QTVA 1WFMA 2FEDC 3B2XA 3PAUA 1L6XA 4UT9L 2ZUYA 3AM8C 3B9VA 4XP4H 4ZQKB 4E42B 1LP9E 5A40E 1C5CL 1CURA 3GEWB 5E4IA 3MRHB 4G43A 2EDKA 3BFOA 5LXVA 2ARJB 2WWMD 1ZK9A 4CA4A 1NGPH 1XQ4A 5T1MA 5EIIA 3O3EB 3KPRD 3BAKA 3I2CL 3GZPA 1XR9B 3ASNB 3MACH 5A2LH 4NQSA 4C47A 1AI1L 1T20A 1LNUB 1MI5B 3F58L 1AD0A 3MJ9L 3QUXA 4OGQC 4KMTH 4ZXBD 5MEQA 4GUPA 2EABA 1F86A 3RVXC 1UOWA 4PR5A 4UM8A 1QFWI 1QFOA 3OKKB 3ABZA 4AT6B 1BD2E 1JS4A 1QFHA 2DMHA 5TPWH 1JZ4A 4DCQB 1TCRA 4QRTA 2NUTB 2XYBA 3CMOH 3SDXA 1MCKA 1Q94B 4U6HA 3UAAA 3ZT5A 4Y19D 2VWEE 1A5FL 4BFRA 2JQMA 3LS4L 4P2RE 4RNRA 3ROOA 1VACA 4PREA 4UAOC 3T0ED 2VC2B 3KYOA 1GC1L 3SBPA 1IGJA 1XXDC 4F58H 3NEEA 2Y23A 1AXSA 1CLVA 5ADOL 4XPHH 1X4ZA 5CLWA 3HG1E 1DJYA 1WVZA 3PGDB 4TOYL 1INEH 4ICWA 4XCEB 4XTRD 5CP7A 1DDHB 3MRQB 3VI4A 3QJFB 4PGDB 4AW7A 4WFFE 3GRBA 1RK1A 4NNXA 1MAMH 3HG4A 1AHMA 3CVHL 3QA3A 4OIFA 4XXDA 4M6OL 1WGOA 4LQ1A 3RGVB 5I6OA 1LMKA 4FLSA 4M6MH 5L2KB 3ES6B 2CBOA 2UYLB 4XBGB 4YSDA 5AKSA 3BFQG 2BP3A 4AQ1B 5KYXA 2JCWA 1LM8V 1XGTA 4XBPB 1VPOL 4OD2A 5HI4C 4U0RB 1TSHA 5ABAA 1DZBA 3WEOA 2V3DA 3QJQB 2K6YA 1YECL 3ARBB 4R90L 2N0MA 2YRBA 3JQOB 4LCIL 3HAEB 4AW4A 3L4VA 1M6UA 1CU4H 3BAJA 1AP2A 3HE6D 3TL5A 4ENZA 3NH7L 2FBJL 1A3LL 1BAFH 2YOCA 5IP4A 3SBQA 3ZJAA 4Z7NB 2PETA 2X89D 3MRMB 4B95C 2K9UA 4AZUA 4G6JH 1OAUL 5I0YA 1S7XA 2DMBA 3BZ4B 3F6IA 4LLYA 3II1A 3ZT7A 1DQMH 3L3KA 1BQRA 5FWQA 3ZQXA 4CC1A 4UM9A 3GK8L 3U46B 4UBDC 4MJ6A 2W0LA 4AGPA 4XN8A 1RJZA 3GDBA 3GSWB 4QMEA 3TFBA 4IIQC 4TM9A 1FO0A 3SZKC 3TV3H 5FEBA 4P5TB 4Z76A 3RPKA 5GZOD 5K9QG 5BUAA 1EO5A 1KJVB 3I50H 3BXNB 3T0DA 4MCMA 3VGAC 3EFFB 3U7AA 2E7CA 1CR9H 2Q8BL 3HHMA 4HPHA 2YAOA 3QDMD 4N1EA 3TBSB 1YY8A 3P9LA 1RXLA 3CUPA 3HNTL 3S96B 1W6LA 3EO9H 1W0YT 4JHUA 3TWCL 3UFIA 4D9LH 3S8WA 1F2XK 1AZCA 3NK4A 1RUAH 4JY6A 2PYEA 1B0IA 1MHEA 5AAMA 3TVMD 3C6SA 5MHSD 4KI1A 3FU7B 3LV3B 4YHKL 5T1LD 3GBEA 3VI3A 4OJFH 1ZV5A 3RX7A 1LO4L 3KL0A 1CXIA 4IEFA 3MLRL 5GZNA 2IQAA 4Q6KA 3DX8B 3JV6B 4HU8A 3GSQA 2OMYA 2NNCA 3SBWA 1PX8A 1WPCA 4HUWB 5KYUB 2QMJA 4YHNB 2WLLA 3QI9A 4BK8A 2XIIA 5IK3A 2GSIB 4XPFH 2BC4A 3VWJD 1F0LA 4RGNE 4OLYH 5KVFL 1QO3B 5DWUH 3QC6X 5LB1A 2MCPH 4F2ME 4GIAA 5LAPA 5D7SH 1M2VA 1NOAA 2XG4A 3QUGA 4R7LA 1N3NA 2Y36H 4DN4H 3LIUA 2CDGB 3FT2A 3BEVA 4TQEH 1WZ1H 5AYUL 4MDJB 4U33A 3UTPD 2IANB 2RALA 4KKAC 2B7DT 1MVUA 1WYJA 3WNPA 3GMLB 3MBEA 4UAHA 5C08D 1U8IA 3A67H 4DZBA 1WTGT 5DQJB 1JVKA 2EDRA 3WS6A 4MJID 1UD6A 1Q4NX 3TS8A 1NCBL 1T66D 4EN2A 4QRRB 4ZMLA 4DK3A 1TG8A 2XICA 4R26L 5C97A 3QNZB 3T2OA 2IALA 2QR0B 3ATBA 4X4KA 4KUCD 1EHNA 3UTTA 4HOXA 4ZD3H 3ZE1F 2KDYA 5IFAH 4JFEB 5J4MA 1S7QA 1T3FA 3J27A 2C8NA 3HZKA 1HHGA 4IRSD 3LNIA 5EBGA 1J8KA 5E6IB 1KXVC 1KCBA 4LBAA 5LCVL 1EPFA 1D7BA 2HTKD 5FGRA 3AXIA 3QUML 5FM4A 4LHUG 3GIZL 5TE7H 3V5KA 5L9DH 3PGCA 3JZYA 1G9MH