3T6XA

Crystal structure of steccherinum ochraceum laccase obtained by multi-crystals composite data collection technique (20% dose)
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
495
structure length
495
Chain Sequence
VQIGPVTDLHIVNADIVPDGFVRPAVNAGGTFPGPVIAGNVGDNFQIVTFNQLIECSMLVDTSIHWHGEFQKGTNWADGPAFITQCPIIVGNSFSYNFNVPGMAGTYWYHSHLTTQYCDGLRGPFVVYDPNDPDANLYDVDDDTTIITLADWYHVLAKEMGAGGAITADSTLIDGLGRTHVNVAAVPLSVITVEVGKRYRMRLVSISCDPNYDFSIDGHDMTIIETDGVDSQELTVDEIQIFAAQRYSFVLNANQPVGNYWIRANPNSGGEGFDGGINSAILRYDGATTADPVTVASTVHTKCLIETDLHPLSRNGVPGNPHQGGADCNLNLSLGFACGNFVINGVSFTPPTVPVLLQICSGANTAADLLPSGSVISLPSNSTIEIALPAGAAGGPHPFHLHGHDFAVSESASNSTSNYDDPIWRDVVSIGGVGDNVTIRFCTDNPGPWFLHCHIDWHLDAGFAIVFAEDIPNTASANPVPEAWSNLCPSYDSAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Laccase
publication title Reaction intermediates and redox state changes in a blue laccase from Steccherinum ochraceum observed by crystallographic high/low X-ray dose experiments.
pubmed doi rcsb
total genus 138
structure length 495
sequence length 495
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6xA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6xA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6xA03
3CDZA 1J9SA 2W8CA 3TA4D 3NJLA 3QPKA 2XV3A 3NSFA 3UAEA 4KNSA 4EF3A 2J55A 3X1GA 4FA7B 3FQYA 1OOWA 1OV8A 1JOIA 2YARA 3X1NA 4DP4X 3PAUA 5B7EA 2IDQA 2UX6A 3PLYA 2XLLA 1KGYE 3IEAA 1ASPA 4KOBA 4GXFA 2QDVA 2UXFA 1WA1X 2QPDB 3NP3A 1AS7A 1TEFA 2CCWA 4NERA 2BP8B 4PAZA 2HX8A 4YSUA 4BDVA 3OMNB 3OMIB 2PLTA 2N0MA 2HLEB 1GY1A 2VW6A 2FJSA 3CDZB 4G71B 5I6MA 4G70B 1AANA 1V10A 2H5UA 5I6NA 2X87A 5B1JC 1NICA 1XB8A 1GY2A 3S3BB 1JZIA 4HHWA 2QT6A 1CYWA 4F7KA 3H56A 2EIMB 2MRYA 3NJMA 4UANA 5I6KA 4HALA 1GYCA 3BVDB 4AKPA 4YVNA 2BWDA 2BO0A 3CZUB 3NT0A 2HX7A 2VSKB 4KNTA 1KYAA 4FAAB 1BXUA 3TASA 2J5WA 1CYXA 1AG6A 2AFNA 4YSRA 4BDVB 1AG0A 2Q5BA 4QLWA 5AFAA 2YXVA 2FWLB 1R1CA 3T6XA 1RZQA 5I5JA 3NJFA 1ET5A 1WS8A 2GSMB 4E9VA 7PCYA 5AZUA 1L9QA 2CALA 2ZONA 1FA4A 3CVCA 1OCRB 3FU9A 1E5ZA 1NZRA 3T71A 4HCGA 1A4CA 3EH5B 4JHUA 3G5WA 3SBRA 2LLNA 2FNWA 2UXGA 1AAJA 2EINB 3FSVA 2CAKA 2FT6A 4A66A 1B3IA 2FTAA 3EH3B 2TSBA 2A3TA 3N2JA 1IUZA 2PPFA 3FPYA 3EHBB 4BXSV 1SDDA 1UATA 3ABMB 4KOCA 1KBVA 2PCFA 2JXMA 2OJ1A 1V55B 2WO3B 3CG8A 3UGEA 1DZ0A 3N55A 4TXVB 1CURA 3NJJA 5I26A 1PNDA 2QPEB 4JHVA 2PP7A 5E9NA 3FS9A 3X2QB 1VLXA 1AS6A 1PLBA 1L9RA 3QJRB 2GC4C 4M4RB 4DP2X 2J57A 4W9ZA 2IAAC 3FSAA 1SHXA 1DYZA 1QLEB 5B1AB 4AX3A 4L0PB 1TEGA 1AOZA 2MTAA 1FFTB 2EIKB 2ZOOA 5I6PA 4DPCX 2YAQA 1MDAA 2BP0A 2PP9A 3ASOB 4DP5X 1NIDA 3S3DB 2DWTA 2I85A 4DPAX 4AZUA 4YSQA 1YLBB 4BXVA 2FQFA 4YSDA 1ZIBA 2DWSA 3DTUB 1JZHA 4DP7X 2H3XC 3WIAA 1SDDB 2B08A 1AR1B 3QQXA 5B3SB 4G72B 2P80D 3FU8A 3S8GB 1W8EA 1A4BA 5EHFA 1GS7A 1AZRA 1HFUA 9PCYA 4N8UA 1QHQA 1SFDA 1SFHA 3WI9A 4A2FA 1TKWA 5TK4A 1N70A 1BQ5A 3JT2A 2XX1A 4KO7A 3QJSB 3IN2A 3X1EA 2UX7A 4P5SA 2IWFA 2PPCA 3TBCA 4A68A 1OE2A 2VMJA 2DYRB 1KDJA 3FT0A 1SF3A 2BZCA 2XXGA 2BP0B 3ZBMA 3FSWA 4DP6X 2XU9A 1PY0A 3ZX1A 3FYIB 2B3IA 2GBAA 2QDWA 1IBZA 4N4YB 2PP8A 4F2FA 2CJ3A 4CSZA 2XWZA 3KW8A 2OV0A 1SNRA 3KW7A 4JKNA 5B1BB 3ZIYA 1KCBA 1ZIAA 3FPXA 5ANHA 2XX0A 4HHGA 1J9TA 4F2EA 4AKOA 3WNJA 1ID2A 2HX9A 3UAAA 4YSCA 1ETJA 1MZZA 3FSZA 1L9OA 4AKQA 4YSSA 1ASQA 2IH9A 2YAMA 2CBPA 3HEIB 5IY5B 3GXUB 4YSEA 1NWOA 2XUWA 2PPEA 1NDTA 1XB3A 3HB3B 3UADA 4GY4A 2BWIA 1BQRA 3FQ2A 1AZCA 4BWWA 5D4JA 2TSAA 1BYOA 4K9JA 2WSDA 2GIMA 4E9TA 4NAJA 4YSAA 1SHWA 3IN0A 4BWUA 1NIFA 3AW5A 2BZ7A 4DP1X 1WA2X 1EHKB 3QJVB 1JVLA 4HIPA 1OE1A 1PLCA 4G7QB 2YAOA 6PAZA 1X9RA 2YXWA 1ILUA 1JZEA 1NIEA 2GI0A 3H4FA 4A67A 2FQDA 2X88A 3NJHA 1PAZA 1GSKA 1F56A 1RZPA 3FQ1A 1OE3A 4GYBA 1OCOB 1AZUA 3NYKA 4KO5A 2BW4A 3TBBA 5A7EA 3IBOA 2VW4A 2IDUA 1WA0X 4DP9X 1IKOP 1FWXA 4E9RA 2XV0A 3T9WA 2WO2B 4DP8X 7PAZA 4ENZA 2YAEA 4DP0X 5I28A 1M57B 1A8ZA 1NPNA 1XB6A 1JERA 1MZYA 2ZWNA 4UF7C 2IDTA 3FU7A 3V9CA 1OCZB 3OQRA 3IE9A 1ZDSA 2FQEA 3PAVA 4YVUA 1OCCB 3L45A 1BXVA 1OF0A 2Q9OA 5B7FA 3NSDA 2VM3A 4E9SA 3EF4A 1E30A 4WTQA 1ZPUA 3BQVA 1T5KA 2NRDA 1E67A 4BK5C 2Y69B 1ET8A 5B1JA 1I53A 1AIZA 2DYSB 3GYRA 3SQRA 2XVBA 1RKRA 3QJUB 3S8FB 1PZAA 3MBWB 2AVFA 1WAEA 2AZUA 4UAHA 2PPAA 4QKTA 4NB7A 3PCYA 1PZCA 3CVBA 2YAHA 1PF3A 1HAWA 1ZV2A 3UABA 2IWKA 3AG1B 2R7EA 3C75A 5PCYA 4A2GA 3PXLA 3FU7B 4E9XA 3NJNA 5I5IA 2CUAA 3X1BA 1L9SA 1GR7A 1L9PA 3CVDA 3AG3B 2AZAA 2RACA 1ZDQA 3T6ZA 5I6OA 5I6LA 3OD3A 5B1KA 1GS6X 2Y1AA 1AS8A 1ADWA 2JFCA 2UXVA 3ABGA 2OCCB 3DKHA 1AQ8A 2UXTA 1J9QA 2HRHA 2I7SA 3AY2A 2VM4A 2XV2A 5FC9A 3NJIA 4E9YA 3FYEB 2GC7C 3AZUA 2H47C 4HCIA 4A2DA 1QNIA 1CUOA 3T6VA 3AG4B 1NIAA 4CSPA 1KCWA 4HAKA 3GDCA 1E5YA 4GP5B 4P5RA 2XYBA 1JXGA 2R7EB 4A2HA 1BQKA 3QJQB 2W88A 1AZBA 2HZHA 2VW7A 1AZNA 1XMEB 3NSCA 1NINA 1MG3C 4G7SB 4G7RB 1BEXA 2PPDA 2I7OA 2FQGA 4YSOA 3T6WA 5D4HA 3V9EA 3EH4B 3NSYA 4YSPA 3UACA 2GB2A 1AACA 1CC3A 5D4IA 2IH8A 4PCYA 2YQBA 3NP4A 3OM3B 1W6LA 2ZXWB 1JZFA 1NWPA 1V54B 2AANA 3S3CB 3D12B 1JZJA 2PCYA 1GS8A 1PNCA 1W6WA 4BWTA 4Q89A 5F7AA 8PAZA 2J56A 1MG2C 3WNIA 4ZK8A 2BHFA 4A2EA 3NJKA 4WKXA 4Q8BA 1PLAA 5LDUA 3QJTB 3ASNB 3WG7B 4HCFA 3MX0B 1JXFA 1HAUA 2HRGA 1URIA 1IBYA 3H4HA 1RCYA 4KNUA 3TU6A 1GW0A 1M56B 1SF5A 1WS7A 1BXAA 3ERXA 3ZDWA 2VSMB 2FT8A 1NIBA 1SJMA 4M3HA 2IWEA 3WKQA 3PPSA 1BAWA 1M9WA 1ET7A 2HXAA 1A4AA 1X9UA 2E86A 2XXFA 1JZGA 1PMYA 3ABKB 3SBPA 2IDSA 3DIVA 5AKRA 3U25A 5PAZA 1J9RA 1ILSA 5TK2A 4E9QA 1J5CA 1BYPA 4GP8B 2JKWA 2YAPA 1E65A 1KDIA 1EZLA 4HZ1A 3ABLB 3OMAB 1L9TA 2EILB 2DV6A 3SBQA 1KV7A 4DPBX 1PZBA 2FT7A 3AG2B 4AI7A 2P80A 3NJGA 4X4KA 4YSTA 4YL4A 5I5MA 3PAZA 4KO9A 3JTBA 4W1TA 1NTDA 1IC0A 2DY2A 1JVOA 2EIJB 1NPJA 2VN3A 5F7BA 1N68A 3X1FA 6PCYA 2IDFA 1KBWA 2BW5A 4RH4A 4E9WA 2GHZA 5B7MA 1A3ZA 4GP4B 2BP8A 1JXDA 3WKPA 4KO6A 2YAFA 4MFHA 1A65A 1TU2A 1PCSA 1J5DA 3RYMA 1ASOA
chains in the Genus database with same CATH superfamily
1MCRA 1EEZA 4AQ1A 2WXJA 4LLQA 1KBGL 3ZO0A 1EEYB 4N25A 2KPNA 4R96B 2XSKA 2BJMH 2DMGA 3IJ7A 1RZFL 1PZ2A 1UHVA 1ED3A 2Y6TE 3V52H 3BZEA 3K8KA 1HI6B 4NKMB 2ZZUT 1BVKB 2FLBT 1YY9D 4LLYB 3X1GA 2EYTA 2HKHH 3QO1A 3CVIH 4DP4X 2DEXX 1XT5A 4MCZA 5FDWA 4CNIA 2ICWA 2OSXA 4C4BA 2XLLA 5K9OA 4PB9H 1V3JA 5BQDA 1E7UA 4LIQE 4KJQD 1OB0A 3KWVA 5D71L 1KULA 2DM4A 2GJRA 4XCYB 1FZMB 4M5ZL 2XNAA 3KYAA 5IHBA 3P4NB 1WA1X 3BWAA 1W72L 1WITA 1ZRUA 2GSIB 2ED9A 1OM3H 4ELME 1FP5A 5CZXD 3CUPB 4OD3H 2CCWA 3TXAA 1TVHA 4F8OA 2R69A 3OAUL 1THAA 4LFHG 1J8HA 3P3YA 3S96A 2MCMA 2VLRE 3PF2A 5J8OA 1NKOA 3DIFA 4ZDHB 4OKDA 4DGIL 2O93L 5EN2B 2V7NB 1QPKA 3D4CA 2G5BA 4WUUE 4LSUL 1R5WB 4D9RD 4ANVA 4KKLC 4UTAL 5HGHB 4N9OB 1HILB 3AWFA 1AHWB 2LU4A 3BP7B 4GIAA 4OQTA 4DO6A 1P5UC 3FQWB 2D31A 4FXTA 2APTA 1VADB 3C6SA 5EWIL 4AW4A 3RIAK 1JI1A 4X98B 3HE6D 3MGTA 4FZ8H 5GGVH 2B77A 3QQ4B 5CHNA 1E5BA 3OX8B 4K07A 5D93C 3UTOA 1TXKA 5HYEA 2DM3A 4X99B 3VX0A 3HE7D 3JV6B 4NQDA 4OLXH 4PJ7E 3W9DA 4NNXA 1GYWA 4U1MB 1I9RL 3GI9H 1MJ8H 5GRVL 4XOEA 3VFOB 2F5BH 5EEYA 1CYXA 3VI4F 4N2EA 1YAZA 1KY7A 2G2RB 3IXTA 1S3KH 2DLIA 1BXXA 2YXVA 1RZQA 4TTGA 3LIZA 1AC6A 1LP9A 1FYTD 1XR8B 3D4GA 2CLVB 4Y5VC 4KKAD 3PDOB 1IFGA 1CDYA 5FW7A 1M2VB 3CAFA 5KBPA 2HTKC 3N85L 3S6CA 2UXGA 1G1OA 2ZX6A 2HG0A 5TE6L 1OPGH 1J9CT 1LD9A 3KZ8A 5LDSA 3DVNA 1KGCD 3QA3B 2YMTA 3QQ9C 5MEQA 2V2XB 2A3TA 3M17A 2X1QA 4GSXA 4AL8L 2ZKHL 1NEPA 3JWOC 9CGTA 2WXIA 3C87A 4KOCA 4ZQKB 2F08A 5F1NA 3WLWC 5EOCL 1I8AA 2P43B 2WZPD 4KFZC 4BK4A 1QW8A 3B2MA 3UGEA 4TSAH 4L3EA 1PNDA 3NCWA 2PXYB 5F3BA 1MY7A 3IGLA 5CLXA 5B38A 2DWEA 1CXHA 4YPGA 3MJ9H 3CN4A 3P9MA 2NT1A 5AW5B 4RQQB 4K3EH 1GAFL 3L7EA 4X6CB 4JKPH 1Z2KA 4KUZH 1RVFH 1KCRL 1O5PA 1HH9A 1OAQL 2O1AA 4HXBH 5HHNA 5I16B 4HUMB 1M05A 3MLUL 4JM2A 3S3SA 2J1WA 4F5CA 3BH9A 3EH2A 1AGEB 1JPFB 4YSQA 3X3FH 3QXWA 1WVZA 4GO6B 2ZCHL 1GHFL 5IHLB 3BRDA 1FC1A 3LXAA 5HJDA 4EKXA 1MJ7H 2ZSWB 3O2DA 2KBGA 4G43A 2BSTB 2GJZB 3QDMA 4Q6IA 3IRPX 4YFLF 35C8L 3ZKNC 4GMTH 2ZUQB 1OD7A 4AGMA 4PWKA 3L1EA 5D6DA 3RVTC 1QHQA 1G9NH 2ROYA 1CDGA 1AD9A 5DUBA 2YHGA 5GGQL 5T3XD 4ENEC 3ECQA 4HT1H 1CN4A 1S46A 2H26A 4JY5L 5IW1B 4TNWF 1U8QA 3BE1H 3GK8H 4EUPB 5J06A 3BISA 1ZLVK 4E41E 3GJFH 3FMGL 4NFBA 3PWUA 2G5UA 3J07A 3OV6A 4A68A 1KIRA 2C26A 4OTXL 1GRWA 1OE2A 2LU3A 4MD0A 1KDJA 3TNMB 1K5NB 2AQSA 1IE4A 2BK8A 4HGWA 1DL7H 2FGWL 4PJFF 4EI6A 3HBPA 3QUGA 4QNPF 1CLOH 5KN5B 1XCQB 4NYLA 2B3IA 3BFWA 5EBGA 1H5BA 2WTRB 2OV0A 3ZIYA 1WDAA 5JPMC 1KCBA 3FPXA 2A4CA 4OJEH 5IB3B 3ELAT 3IFOA 2H0JA 1JMXA 1BM3H 4O02H 4AKOA 1KWGA 4HEPG 1VJSA 1E6OH 1ID2A 4YDLB 4PGEA 3II2A 1AO7B 4QRTA 4AKQA 4B9KC 5GJSH 5IY5B 3FB5A 1EEQA 2Z3FA 3UPRB 4OKVB 1YN6B 4NRZB 4Z7NE 1ZT1A 5HI4C 5I1DA 1MVYA 5FFOA 3GMNB 3GMLA 5I19H 3BQUA 1YNTB 2CBTA 4GQPH 2CO1A 2BVQA 4I0PD 1WZ1H 4UDTA 3NA4A 3QDJA 3P9LB 3CLFL 4O5LH 4X4XA 3SOBH 4JG0L 3O2VH 2FNBA 4WKZA 1BMZA 2G3MA 2J1ZA 4DQOL 1CBVH 1I7TB 2I32A 2CO7B 4KHXH 3K4DA 4PJCE 1WA2X 3P4MA 4IGBC 1KGJA 2YAOA 3NSXA 4ZS6D 2J12B 2D03H 4XGZA 4ADJA 3DGDA 1MJUH 1T0MA 4UQ2B 1WT5A 4OLZH 5FGRA 3UTTB 3TBBA 2ARJQ 3UAFA 2VJXA 3D69A 2JELL 2XT1B 3LKSA 3VG0L 5L0QC 3W11D 3QISA 4L4JA 3D09A 5CKGA 5AWNH 1CD1A 1NMBL 3LPFA 4P5TC 1DANT 3ULUD 3WTVA 4U33A 2WXFA 1B4JH 3QDGB 5ELIA 4OFYA 1LO2L 1C5CL 2A6DB 1J8RA 2VE6A 3TIDA 4KXDA 3EGSA 4K7PX 5ETUA 2R4RL 2X4QB 4OCRH 2Y5TB 2IXQA 5SWZB 3V7AE 3B1UA 5D70H 2NZ1A 3GM0A 3H9HA 4XN5A 5DLML 1ZJAA 3BSZA 3HN8A 3GGWB 5E4OA 3ZYJA 4HJ0D 4L5FL 2YMOA 1IC5H 3K46A 2ZCZA 1M2OA 3D2TA 3RI5K 4M7KL 5LCVL 2K6YA 2JV6A 4N8VG 3ATAA 3TYFA 4D8OA 2JJTC 4R90H 1AR1D 3G6JF 1HSBA 3STBA 4B7IA 4ILDA 2AZUA 2WLHA 2UVEA 4MDRA 4EI5A 4UQ9A 3D30A 4FG6D 5ACZB 2XN9B 5DT1L 1DQML 1GH7A 5TQ2H 4C54A 4L3ED 3A0OA 4NNYA 1XGQB 1BLNB 3SY0A 5GRUL 1JWSA 4F9LA 4FTDA 4CRPA 1E9QA 4A2GA 1F3DJ 4H25A 5A6IA 3S8WA 1RL1A 1L9SA 4YQXH 4WWKA 3EGDA 4AXWB 4S1QH 5F7EL 1RIHH 1MFBH 4GH7B 2CK0H 2H1PL 1QRNA 4LVHC 3TA3A 1K5WA 4BSJA 2OMVB 5I74B 1HEZA 4JM2D 3G5YA 5DD0L 3MA7B 4W9IC 3IJ9A 3U4AA 5A40E 1RHFA 2JFCA 3US1A 1GJUA 3GB7B 1KIPB 2N7SA 4N5UA 3MBXL 1KTDA 2HP4A 1KIUA 4H26B 3D0VA 4XOBA 3WD5L 4I0KA 1Z0MA 5IVXA 5D2LB 3ALWA 3QDMD 3U2IA 2FJHA 1YYLL 4LE8A 3DMMA 2NY5H 5T33L 3IKKA 1X6LA 3CQPA 3U83A 1U8CB 1ZTXE 2G9HB 4BZ1H 3TPUA 4QRRE 4CGUB 4L4TA 4TULH 1YCSA 2KUTA 3BRGC 4L9LC 3VH8B 4OLUL 4F58L 4ZMXA 5I0ZA 4G7SB 5D7IF 5KS9B 2MQCA 1OAXH 1AGDA 2B8OT 1CLZH 2GT9A 3IF1A 4HUVB 4NUQA 2Z93B 1NBZB 3AITA 1L5GB 1CICC 1P4BL 1WC7A 2B5IB 1A21A 4ZUWB 2YD6A 4QCIA 1U58B 4QHUA 2P5PA 5H37G 4WI4A 4WW2C 3O4LE 3BP5A 4OSUH 3Q6GL 2A73B 1U33A 3QUYA 3QARA 4FFVC 3IJYB 1FVEA 3K1KC 4D8PB 5AW0B 3ORJA 1ETZA 4S11A 2RALA 2LAGB 4Y4KB 1S9WB 4XPBL 3H2WA 3EJQA 1OWWA 4XRCB 2OJEA 3O45A 4PG9A 1PBYA 4JDTL 1TQCB 2A6IA 1DQTA 4QTHA 5C09B 2NY6B 4JJ5B 4AJYV 3T2QA 2V8MA 4LLWB 3TWYA 5CBAB 5TF1L 2L7QA 4MMXB 3WHXA 5D7JB 1JAEA 3WMSA 4MLIA 3GBEA 4MB3A 4NDMB 2A83B 5ID1A 5CJ8A 3FBKA 2HT3C 1PG7L 3NIGB 4U1IB 2H0PA 3L13A 4NLAA 4IRJC 1N10A 3IFLL 3LEXB 3QDJD 5MEOA 4IDJH 4HS8H 3NDZE 3VFTA 5D1XA 3RJDA 1LEGB 3F01A 2C9SA 1SM3H 5I2IA 4XE5B 4XOAA 1ZXQA 4ZX5A 1OAKL 2VZTA 2ZOLB 1MIEL 4FULA 2OI9B 5AKRA 4MBRA 4RWYL 3MLWH 1KENL 3OHXC 1XGPA 2MEJB 1N0XL 4ZO9A 5IBTL 5KZCD 2R59A 1C5DA 3FUJA 3QNXA 4HUNB 5EFIA 1E3XA 3AAZB 1ICTA 4UYPA 1KDIA 4AV4A 3SE8H 2XYCA 4LCCA 5JORB 4J2QA 3DURB 4RRPA 1UYWH 5C71A 2EDHA 3UROR 3ARDA 2DM2A 3ARFA 3ARYA 1RU9H 1AQDB 4KO9A 5CWSB 5F6IB 5FWRA 5J1SC 1R3JB 1NPJA 4J1UB 4IK6A 1JNNL 4OFYD 5E6IC 5C0AA 2XQBH 3X1FA 3KYMA 3QWNA 5FO7A 3JVGC 2V2WB 2IANE 4JQXC 5L6YH 5EEZA 4YXKH 3KPRB 4HJUA 4NZTH 4YOKA 1BGXL 2YRBA 3AREB 2QMJA 5DS1A 4M56A 3RY4A 3FUNA 3L1OH 5L4JA 2YOCA 3F6LA 3QORC 3PHOB 1WFTA 3SEPA 5GRJH 1MWAA 2XV3A 3NSJA 2Q2LA 3CLEL 4QTIL 4HG4K 2OS7A 2VERA 3LQZB 1NCDL 2CIIB 3HVDA 4WCYH 5I8EA 3RKDC 4JN2B 2YARA 3RJOA 3V95A 3VX1A 4DGVL 1KFAL 2EEBA 4HJJH 1MAMH 3TO4B 3RJQB 2AGJL 1A5FL 1OSZB 5LG1A 3NQKA 5I1AA 5E4IA 4I87A 3VGAB 4S0TD 1FN4A 4EI5D 1SLXA 2R2BA 3ZHLA 1ZA3A 4OJFL 4AZ8B 1BMGA 2ZXGA 2OMXB 4Z23A 4ZMOA 3CSTA 3LN9A 2A4ZA 4OZGA 4U1HA 1AMXA 1UT1A 1AS7A 5ISZA 4NERA 4ODTH 1KPVB 5AENA 4IRZL 5C8JB 5JHLH 1QABA 1H3PH 3OXRA 4IBSA 4LDOB 4PJIA 4WWKD 5GS2H 1BCIA 1C5BL 1XEDA 3H0TB 1QRND 1YJDL 1GY1A 3ULVL 3TA3D 5KSAC 5FK9B 1T80A 1T1YA 3CVHL 2IPTH 3RPIB 1XD0A 4XPTH 1L0PA 4OVUA 5DI8A 3TJEL 4N0YL 3IE4A 2EABA 1QEXA 4XN4A 5A2IH 5B1JC 3PDDA 4IIZA 2YJQA 5FPIA 2AK1L 3I50H 2GITA 4BSWB 1EZVX 1H0DA 3QI9C 4IU3B 1UA6L 4BK8A 4I18B 4KMTL 3U9PH 5EDSA 2EIMB 2ZIDA 2J6EL 1FGNH 3DMMD 1D5RA 1ZLEA 4CW1B 4ACPA 1EXGA 2YEZA 4HIEB 4M8QB 2YZ1A 3NT0A 2HX7A 4PLOB 4Z77A 2YPLB 3FOMB 1YSOA 3BPCA 4NC0B 4DN3H 5C0CE 5BZDB 4RA0C 4G9DB 5GQBA 2F61A 4L4TD 1UH3A 1URZA 4XP9H 5ICYB 2QADD 1WFIA 5GS1B 2ZP0T 3SDCA 2ID5A 1AG6A 3MRRB 4XBMA 2Y7QA 4V1DB 4YSRA 5J6HA 1YEFL 4MNGB 1KT2A 4JFFA 4NN5C 5EU6E 5KSBB 2AKRB 2K0RA 1WS8A 2OR9H 4G7VL 4E9VA 7PCYA 4UNUA 5BQ7B 4Z7UF 5I8KL 1J5OL 1AIFB 5BUAA 2J44A 1T7YA 2NY3B 3EBIA 3KL0A 3WUWG 3CVCA 1U8IA 3FU9A 4A7VA 1AD0B 3CN1A 4NJ9H 5EO9B 2EVHA 4EE2A 3BRFA 3VWJA 3W5MA 3AXHA 1QYGH 3KEHA 3UBXG 3GKWH 1DQVA 3NZ8A 3AXLB 3SCMC 4JFYB 2OTUA 3VXUA 2TSBA 3MACH 2D7QA 4P9HC 4LEEA 4HEMA 3B7RL 4AIEA 3ESNA 4ABUA 1C1EL 1GVIA 4C58B 1ZHKB 1BVKA 1KPRB 4XCCL 3WKML 4H44C 1ONQA 4KTDL 5DZPA 4QOKA 1F41A 4YX2L 3MLYL 4FE9A 4IOFC 5F9JA 3VXNB 3F65A 2X6VA 1J87A 1OK0A 1UCBL 4NFDA 4N0FB 2NXYC 2F7PA 1B0RA 5CUSH 3ZQXA 4TNEA 1AS6A 2YPKA 3GQFA 3GFUA 2E7CA 4KY1H 3QEHB 3SKMB 3OF6A 2OYMA 3F5WA 1RUKH 4LP5A 2AJUL 2ED8A 3AY4C 5GS3A 3P40A 4L4VE 1IM9A 5D1XD 4P4KB 1BFSA 1DVTA 5IW6B 2ED6A 3OGCA 3IFNH 5HVWA 3ZGHA 1LO0L 2PP9A 3K71B 1BLIA 3WDIA 2Y2YA 2ZCKH 4PS7A 4JR9L 1KPUB 3RHWK 4C83A 1ZIBA 2DWSA 3IGAB 2X3CA 4JS7A 1IVTA 3BZ4A 4HUUA 1FL5A 1T20B 2QR0B 2CDEA 2XWXA 4Z95H 3OG4B 3WIAA 4N6QA 3ARDD 4XPAL 3EYUL 1CR9L 1WPCA 1XH3B 3FU8A 3GMPA 3TYGH 2FWUA 3DNKA 3RUGF 4Z3TA 5EHFA 1GKOA 2DIAA 2JKSA 3ARFD 3K74B 4UTCA 3T2LA 2FEEL 4OF3A 5DRZA 1C16A 3MRIA 4GAJL 2C9VA 3PHAA 2LHAA 5C0AD 3T4YA 3EFOB 3EOAB 3POCA 2CKBL 4U1MA 2XZAL 1NCUA 1LTXA 2IWFA 1MXGA 4MD5B 4YO0A 1Q9OB 1X5HA 4CSSA 4FYTA 4FKKA 4YR6B 5D2NA 2QVMA 4IMLB 4ZPVA 2VB5A 3UTSB 2FSEA 3GLAA 3K5RA 1JGEB 2AMUA 4FQXA 2G3ZA 5JLZA 4KQ4H 3Q2VA 3P3SA 4OM1H 5I1GH 3VQ2C 3VGHA 1DQKA 1NMAL 4LSQH 2IFGA 1YZZA 4LZKA 2Y7OA 3FUFA 1U93B 3ARGA 5EU7C 3IDGB 4M7LT 5EUOF 4UIMA 2JCCE 4FLQA 4HOZA 2ED7A 2IFFH 5JHBA 1REIA 2AF2A 4D2NA 3FKUS 4KY2A 4BCYA 1KGIA 4WTZG 3WNJA 3VYOA 3WXVH 1FUNA 3BDYH 3BPNB 1EHLL 4UV7L 4S2SB 3QA3A 3TT3H 5BO1H 4NCC1 5F0JB 3LEVH 4X50A 1KXVC 4AENA 4WWPA 1ASQA 5B8CA 2AXFB 2CBPA 5ISZD 1JF5A 1U3NA 1XVSA 3L16A 2ZWLT 3IK2A 4CN6A 4NX0A 3WS3B 4F7MB 2YUXA 1TENA 1QI3A 4L2LA 5KAQF 4MA1B 3MBEB 2PXYA 1S9XB 4AVJA 5IQLA 4RGMB 5D8JH 3DHJA 1UXSA 4YHKL 4NJAL 3LB6D 2WTPA 1P84J 4BZ2H 3QJVB 1HCYA 1IGCH 2ADJA 3QFGA 4HIPA 5EC2A 4EDWL 3GMOA 2N3JA 2E7LC 4JFUA 4ZSOA 2Y2TA 4F27A 5AOZA 4M1CC 2X88A 4H20H 4DZ8A 5C7ZA 1F56A 4GW1B 4X0KB 3EHBD 3O41B 4HQQH 2UY7A 1AZUA 5EO0B 3QEQE 3WELA 3G08B 4X7TA 2W9DH 2ADGA 4LOUC 1BBJA 5FYLH 5BMFL 3QIUA 5EF1A 1UJ3A 3MFFB 4BZYA 3ZE2B 5BRZB 1H9DA 3LRKA 3CZGA 1O7SA 1GZHA 1XMWA 2F18A 3SDCD 5I28A 1FIGL 5IHUL 2R15A 4H8VA 2DLTA 3PL6A 4JFFD 3W39A 5CD3B 4TVPD 3EOTH 2APFA 5K1VA 1IEHA 2VXTL 4YMPA 2EUZA 3FU7A 4P48A 2BDNH 2NY0B 3R1GH 4FA8A 3MNDA 3A4AA 3P77A 1G7QB 3PV6B 2XA3A 2GAZA 2X2IA 4EUPA 5CGBA 5J4MA 1WAAA 1DQQA 3UZQA 3VFWB 4CJ1A 3T65A 3HZYA 3VWKC 3KLDA 1I1FB 3VWJD 3TPKA 5DUPL 3SGDH 5GGUB 2VERN 2Z6FA 4F91B 1SHSA 1ZPUA 5D96C 2BNRE 3F12B 2O61B 2EVGA 3QUMB 5FHBL 1MCSA 4BK5C 1A6PA 2VC2L 4IKKA 4JM0A 4P4RA 5KN5A 3MLXL 3GUTA 3MXWH 4I4WA 2EH7H 1VEPA 4IIQB 1DBBL 4QLRA 4QOKD 4QDGA 1HZLA 1XGYL 3MV7A 1EO8L 2VXQL 3Q1SH 4QKTA 2X4SB 3PCYA 3KYKH 1Y18B 4JJHA 2KLSA 5CCHE 1G7PA 1A7BA 1A6ZB 1OEZW 5IT2L 1XZWA 2FB4L 1A6UL 1C12A 2DMCA 4XN1A 3ZE1B 2WQSA 3S0PA 2BCMA 5D7LE 1CFTA 3OF6D 4H13C 3PG2A 5I5IA 3T0BA 1ITBB 1B4LA 4WFFD 3V4VH 4PJ5B 4Y19E 2F53A 3H3KA 3X13B 1ZT4A 4LVEA 4NQEA 1TQSA 4AQ8A 3CNKA 1CU4L 3AJ7A 5DTFB 4CDGC 3CMOH 1RZIA 2Y1AA 3IDYC 3OD3A 4CN1A 1FE8H 3HRZA 5DK0A 1QAWA 3D3VA 2Z31B 3HFML 2XQYK 1JNJA 2VDNB 4WU7A 1NGXA 3FQTA 4N8CH 4U7MA 1LNUB 4WEBH 1Q0YH 2E7DA 4D3CL 3RFZB 4ZS7L 4GUOA 3B9EA 4HS3B 5AW2B 3UJTH 5CLWA 5FS5A 5LBGA 5JDJA 3QZWG 4PG2A 4ANUA 2CDGB 4OV5B 3FB7A 5CZKA 5GGSY 1NIAA 1R0AL 1G6RA 4GP5B 1JPSH 2Q3ZA 3G5VB 1E9PB 3ZMRA 5D6CA 2J2ZA 1AR2A 4Q4EA 1AZBA 3GM8A 2Z91A 3UC0H 1A7OL 3MC0A 1PJWA 1EZSA 4M5YH 1DBAL 4LVOB 1WZMA 2VDQL 4IW4C 1SN5A 2EDXA 4FQXD 2OLDA 3GO1L 4I9WD 4ZMQA 5BS0B 2G60H 2E7BA 1CC3A 5HDOA 1JGDB 5T1DL 3AGWA 4OLWH 2O26U 3DGGB 3L3IA 2Y5TA 1A4KA 3FZUC 2V3DA 2WO4A 2C4FU 4H8WH 4PJAF 2YUWA 4FQQB 4L8DA 2VDRB 4P3DA 3THMH 5GS0H 2G5RA 4Z7WA 4PWEA 1PZUB 2H45A 3G6DH 1W6WA 1TZGL 4YE4H 1DLHA 3S36L 3JZ7A 1MCKA 4KJWC 2GTWA 5CEZE 5H8DA 2HJLB 4PBXA 3WHE0 3B5HA 3HI6H 5ENWA 4PRPB 4XNZB 1FNSH 4HCFA 4LOVA 1JXFA 4DKDC 3I9GH 1A6WL 3QIWB 4GSDH 1KB5B 1OL0A 4FFYA 4L8SB 4AUJA 1MH5A 1TZAA 1F8TL 1NUDA 2OSYA 1U8HA 4M3JA 1KJVB 3UCQA 4BSVB 2ODHA 3KLAB 3EO1A 1GC1L 2XTJC 3ERXA 1HDMB 5AD0A 4N2FA 2PXYD 1KOAA 4P46B 1IFHL 3G5XA 4TS6A 3FUDA 2WGNB 1EJOH 3HS0C 1GA2A 4IU2A 2K7QA 5DDHA 2VDPH 3QO0A 4FCAA 3RWIA 4XP4L 3C6LB 1MQKL 1B9KA 5PAZA 4HWBA 1MUJA 4K3DH 5TK2A 4F7EA 1XX9C 1U3ZA 3MUY1 3RGHA 5FKAB 1W0WA 5EOCJ 4X5QA 3KEDA 3ZL2A 2VGLM 4MAUH 3SY6A 2DQGH 2LLLA 2JKTM 4YBHA 1HHJB 5GGTL 2YA1A 5SV3A 4JO1H 3VDAA 1O6VA 2CHWA 2D2OA 2HFTA 3TGXA 4B9JA 5IJCC 1J12A 3ATFA 1QBLL 3QIUD 1RJCA 2IVFC 4KAQL 4J3TA 5IHHA 1UZ6F 3US9A 2O5YH 5EU7E 2DWXA 1A1MA 2ERJC 2VRAA 4UILH 3DA0A 3O9WC 3TV3H 4DN4H 1N6QL 4PP2B 3PL6D 4ZAKB 5JW3H 3D34A 4BRVA 4Y2OB 4R0LC 4U6YB 2Z4TA 1QSFA 2R83A 4PR5A 3BVNA 3BVWA 1CD0A 2XZQL 3IMRA 1BZ8A 4ZZKA 3LD8C 5D1ZA 1IQDA 4AJWA 3L3HA 3D9AH 4MBOA 2VR7A 4KROC 1RPUA 1EMTH 2FIKB 2Z93A 4MTMA 4NN6B 5J9PA 2XFXB 3IDUA 4KPHH 3H9YA 3GIZH 2OMYA 5SWSB 3HAEH 1IJNA 2QQNL 1U58A 3BUPA 2DICA 2ZYIA 5HVHC 4NC2B 2NSQA 3C5SB 4NNPL 5DHYA 3SGKC 3MV7D 4MA7H 1E3FA 3W0WE 1P7KA 4XCEB 1A47A 4D0DA 3IJYA 3CPLB 4KVNH 2J21A 2VKWA 2Q87A 1RAMA 4TOYL 4XT1C 4B60A 4LCIH 2BFVL 2C7FA 1L9MA 1WJ3A 4MXQD 2R1XB 5HSFA 3WIIH 2IMMA 3L4WA 3TT1H 3U9WA 4KDTA 1LE5B 4RBPH 1Y6MR 5F1KC 4U1SB 2XWBA 5IQ7L 4U6XA 1U3HA 1PKQB 1Q72H 4NQED 3B9DA 3CDZB 4HHAB 2VLME 4P0DA 3U6XS 5C0BB 1UM4L 5GRXG 3F7PC 4G70B 2DTSA 5I6NA 1A3RL 3D3VD 4NRYB 4E42B 2X87A 4KRPD 2NY2B 3PWJB 4X5LA 2Z64C 1VKXB 3LQAL 5CFAA 4BFNA 5LNGA 3T04D 3FO9A 4ELMF 3ML9A 3QWOB 1JK8A 2KQNA 4M00A 3M07A 3VXSB 4MWFB 5DJDB 3EO9L 5IEKA 1GZQB 1GYCA 3CZFA 3RVWC 3T8XB 5AYUL 3W37A 3RZWA 4LP8A 4GKSA 1TDQA 3CFKB 4HF5L 2EICA 4OBRA 1L7TH 1F13A 3S3JA 5J1TC 1N8ZB 1FZKA 1IGML 3TX4A 3Q6FA 3KGUA 1V5JA 5ECJE 2HWZL 1NFIB 2X9YA 3OR6A 4MRBA 2BINA 1F3DH 3BKCH 5E7FA 5HGDB 3TZVC 1AG0A 3O8XB 3OB0K 3QCTH 4Z7VA 2Y06L 1F1AA 3K1DA 5CIPA 3VI4B 2PF6A 4M62L 2EUWA 1ET5A 2AJVH 3ZTJH 1BQHG 3UX9B 1L9QA 3BCFA 5KVFL 1JZ6A 5CJOH 1OCRB 1R3HB 4LPVA 3B5GA 3BKYL 1PIFA 4XBEH 1GGIL 3T0XA 2UWEA 4Y0GA 3OKMB 1UQSA 5KVGL 2V4LA 2GPZA 4PJ7F 5C6TL 3VFUA 2WLKA 2FTAA 2NX5A 4JKWA 1KEGH 3E8UH 1D5BA 4HSCX 2OK0H 2DMBA 3FT3B 4LMQE 1BF2A 3FXIC 3B2UC 2WYIA 4JHBA 4YBLB 5JR1L 5JHLA 4XVSH 2OZNA 4HS6A 1I3UA 3NCJH 1ROCA 3QJOA 1TJHL 1X4XA 3W9EB 2HKFL 2WO3B 3BKML 3EJRA 4AM0B 4DZBA 2N01B 2WB7A 4X7SL 1F3RB 4HPYL 2BC4B 4HFWB 3QUKB 2IG2H 1MFUA 4HDIA 5J56B 5FCSH 2FHCA 3WJMA 3RIFK 4JRXE 2GK0B 2RCSL 4AC4A 4PRHA 2WBJB 4MSWB 3JWOH 2ADFH 4NHUA 4F7PA 4AYGA 5T1MB 2E76C 4OZFB 4ZFZA 2CNYA 4NKOB 4C8XA 1UWEL 2GJ6B 4UOZA 5EG6C 4FYQA 3FQNA 5LG6A 1WYJA 5A2JH 1VEMA 3HS8A 3D1MC 5DQJA 2R0LH 3MV01 4ZOBA 3K6IA 4G3YH 5T3XL 5C9KA 3RB7A 1FJ1A 1P5VB 4HH8A 2EC8A 2JKRM 1MELA 3Q9QA 1HXYB 2E7HA 5B3SB 1SYVA 1BAFH 1G94A 2PCFB 2XG4A 4G72B 2F58L 3WDHA 1W8EA 4KH9A 3MO1A 1FFOA 4IDLA 1FNAA 3O6KH 4FQLL 1SFDA 5C9JA 1S9KC 2P5WE 3QWRA 3NK4A 3F3HA 1QHPA 3L54A 5BVJA 4XNUL 4G1EB 4QTFA 2DQIH 1XV8A 1INDL 4K71B 2PCPB 2VSCA 3QRLA 4S1DD 1LK3L 1QSFD 4A6YB 1BVOA 4RMTA 3PP3H 4I48A 1Z1WA 4M1GH 3DPBB 2IC2A 1ZHBA 5GS1A 4M6NL 1C8PA 4UWQB 5D1ZD 2A9AA 3GHEH 4JPSA 2BP0B 3VW3H 3V6OE 3ZBMA 3S4SB 3KPLB 1GYAA 1PY0A 4XHQA 5DRNB 4PJFB 3EJCA 4KXBA 4LRIA 4A55A 4J6IA 3FRUA 3REWB 2R69L 1A7NL 1T6WA 2IAMB 1T4KB 5B1BB 1J7VR 7FABH 1MCEA 2B2XL 4NAMA 1QW9A 4NZ8A 1HCVA 4L1DA 4R7DA 3SPHA 4F2EA 3WFEL 1NCIA 2I26N 4P57A 3KNBA 2EZ0D 4ERSH 4KK6C 5CU9A 3HPJB 4MQ7A 4ZXBC 3RVUC 2QV2A 3ZY7A 3O3DA 1KLUA 1F11A 2NOYA 4OQTL 3QXAB 1IAIH 2JB5L 3GD1C 4YK4B 4PLJC 1UTDA 2OZ4H 1ACCA 3CX5K 4AW7A 4ODXA 3ZU8A 1H6UA 4KKPA 4KXZH 3D0AA 1TQTA 1PPIA 2WK2A 3M88A 3NESA 1CK0L 3D2UA 3PHQA 1U3HD 2APBA 3GLDA 4KBPA 4P3CL 4QHLA 2ZCLH 3WNLA 4KUCF 1JG9A 1D6VL 3T2OA 2KHAA 4H88H 3IMBA 1ZVYA 2NDFA 3IYLW 1SY6H 1BFOA 3O6MH 3QNZA 5DJXA 1FG2B 5IMOB 3F7YA 3L5IA 1Z5LB 2XZCL 4ISVA 2WWKO 4K55A 2YXWA 3S88L 1CLCA 5F96H 3ULUL 1AJ7H 1E8YA 5C7XL 2FX8L 2ZKMX 3BUYA 1OP4A 1YEKH 4JPIA 3OC8A 4Z7NF 3MOAL 3LIZL 3VD2A 5LN4A 5GGRA 1GGUA 1X5ZA 3DROB 1PIGA 1NC4A 1E3ZA 5T5NG 1W0VA 2P7TA 2EDNA 4IRSA 5F88B 1NSNL 4CVXB 4YZWA 1BFTA 1CGYA 2YAEA 2XDHA 3OHMB 2FD6L 2HSIA 4P2QE 4X5WA 3TWCL 3QUML 4ZD3H 5KYWB 2AJZB 4KWUA 1XB6A 5EMYA 2ZWNA 4PJCF 5F9AC 5MI0B 4N6RA 3P69A 3V0WH 1NEZA 1OCZB 5BUGA 2JQMA 5IREA 5LXGL 3D39B 1BF5A 1NDMB 1OY3B 1D5IL 3GXNA 1GOHA 5D1QE 4G6FD 1X5XA 1TCMA 5SX5H 3VFRB 1IEAB 1Q9OA 5C0FA 2JTDA 3NSDA 4FQPA 1T6BX 3G5ZA 4ZMTA 4RNRA 2WVVB 2NX5D 4ZUTA 2C9QA 3IFPA 3CU1A 4B9CA 1YEHH 1TT6A 1WIPA 2A0LC 1I53A 4AEFA 1QASA 1FVCB 3L4TA 3S8FB 4WGKA 5HYJA 2CE6A 5BW7A 2VN4A 4Z3HA 3RB5A 3G6JB 5KUKA 3SBWA 1RIUL 5C6WH 3ZT6A 4G9FA 4UOW0 2WAHA 1ZGLA 1OT4A 2G0LA 1ZV2A 3RY5A 3KPNA 5HHME 1OW0A 3RGVB 5CP3H 3NFNB 5HD8C 4CMHB 3S97C 4PRIE 4PRHD 5JA8B 2XN0A 4GEJA 3L1GA 3VA6A 2EUXA 4ZW3A 1MW0A 1BG1A 1E2VA 3O2DL 4U1JA 5CNHA 1A6TA 2HVBA 2RACA 1W16A 1RUPL 4JPQA 1UACL 2PYFB 2WJ5A 1JIBA 1GS6X 2VQ1B 1F1DA 3BHBB 1ADWA 3EO0A 1EDYA 4WI7A 3DO7B 2HRPL 2UXTA 4WV1C 2IQ9L 3CFNA 2WBWB 1D5MA 2VM4A 3G6AB 1TO5A 4PV1C 5IF0B 4FABL 4WEMB 4RGOH 1T1WA 3S5YA 3CQQA 1JGVH 5F3HB 2C3VB 4K5MA 3NIFE 2ESVA 1UUSA 5CN3A 2NNCA 3U0PB 4JHAH 4JN1L 3ULVE 5DJZA 2FYYA 3GRWH 1FNGB 2IH1B 2OTPA 3QWRD 4MAYB 4F37F 3BH8A 3BT2H 1B2WL 3APMA 3U7YL 1IL1B 5IFHH 2NTFB 1N26A 5C97A 4L3CB 2Z1KA 1XMEB 4HUXA 3T2NL 1NCWL 2WANA 5CP7B 3F6IA 1R47A 1MEXL 4QMEA 4X6DE 5D7IB 4KKNA 4UIKH 2VXUH 2ZX7A 1MFAL 3UGXA 3JTSB 4Y1AA 4WRLA 4Z0XB 3TCXA 2XIIA 2ZKYA 1L9NA 1NGWA 4EOWH 2YWYA 3CSYB 3HJEA 4BJLA 3D12B 2CJUL 2CR6A 1RY7B 3HG1B 3U0TB 1R3IL 4B96A 3H2QA 5E1QA 4X4YA 2FR4A 2NY4C 1MHCA 4GRWH 3FB8B 4XPHH 1DJHA 1LHZA 1KTBA 3LVEA 4Q8BA 4TSBL 3TCTA 5JPNC 5LBSH 1MJJB 3WG7B 2VDLH 1J1OL 2HRGA 4PY7B 3UL4A 2OXHA 1DBJL 2J8OA 2PO6C 2YK1L 3MLZH 4P2RB 1XSIA 4DIXA 3QAQA 4N90D 4PTTB 4RISH 4Y5YB 3V10A 3ZDWA 2IBZY 4LVNC 1TFPA 2B16A 3HHSA 3O3UN 5DCCA 43C9B 1YUHB 2OMTA 4LLMB 4LNVA 1AY1L 2EJ1A 1D9KB 4FQIL 1A02N 2NQDA 32C2A 5DK2A 4Z78B 4TSCL 3WLBB 2CLZA 4CVZA 4FG2A 3FO2B 3DIVA 4ATTA 2K3TA 1RUAL 3A4DA 4X8JA 1RZGB 4Y2DC 5AYQA 2NUPA 3V4LA 2CZNA 4L3AA 2DQCL 2C9XA 3IMTA 4TRPH 2VZOA 2B0SL 4IYKA 1DVQA 4K7PH 5D1ZI 1F1GA 3S2AA 4OB5H 2DQ6A 1DJZA 2A9CA 2DV6A 4JE4B 4X9YA 1FZOA 1MIMH 4XX1G 3GJFB 1D6EB 1CFMA 1BZ9B 4WW1A 5ID0A 1MFDH 4HJGB 2V2TA 1MCQA 4IRSD 1T21B 4ZPTB 2F8XC 4Y4FC 1USZA 3BSZL 1YPZA 1TUPA 2JJSC 4X9HA 2QSQA 5DD5L 1R9FA 1N68A 1QEWB 1Q9LB 3BZ5A 5EZJB 3T0EC 5IJKC 4U1NB 2PETA 3A6BH 3C2AL 3P3TA 5K9KB 3WKPA 4JFSA 3DV4A 2B1HL 1TQBC 1A65A 3FCTB 3LKRA 3PPEA 4YDNA 1VCAA 3D07A 3IVKA 4BUQA 2O5ZL 3RWDA 1G7HB 3GUFA 1GC1C 3Q3GA 2B14A 3P0VL 5AAMC 4OFDA 4O02B 4HH9B 1CMOA 3BAEH 4TV3A 5FYKD 1TJXA 1RHHB 5LJYH 1T1ZA 2BCKA 4YDZA 2LGNA 3MRJA 1CFVL 3IJSA 2H7WA 5B7EA 4Z9KB 3CFCL 5F1SA 3RTQC 3FQUB 4YWGH 4MQTB 2JKLA 2Y9RT 4PMFA 4G9FD 4XH2B 4WK4B 1O6SB 3OKNB 2H1LM 3DRTB 4V33A 5H2BB 3LKOA 1LDSA 4OZHE 2NY1C 5HHOB 3NZHH 1KELL 3ARBC 1BZDA 3E0GA 4AH2A 3RQ3A 5IBLC 3CWGA 4HKBB 5IJVA 5IB5B 3SPIA 1QFUL 1N3NB 2P5EE 4IOIA 3QHZH 2QEJA 3UTPD 3FB6A 3WAJA 4YFEA 4P04A 4FQJH 5JZ7D 4NQCE 2HT2D 3ULSA 3TTSA 4HAGA 1I1RA 1NM4A 1A6AA 2BSSB 3EIFA 4XZUB 3A4EA 1RZ8A 4GG8B 1JYWA 2HN7B 1U8KA 4BSVA 2WCGA 1BW8A 1MCOH 1S9VB 1SGKA 1OB1A 1VSCA 2X10A 4DEPC 1XBRA 5L2JB 3M8OL 3KPSB 4XNXL 2NXZB 4FNLL 3WS6A 2W9EH 3M1CA 4KJQC 4F3FA 4N2HA 3BPLC 4WSKA 4K7FA 3H7BB 3CZKA 3ZTEA 4EIGB 5IIEB 1YY8A 1FAIH 2P45B 4HALA 5ALCH 2ESVD 2WZ5A 1TOXA 2EDWA 5CZXC 1MI5A 2YQ2A 4PJ9B 2EDFA 4X6BA 2W07B 3IU4L 4Y4HA 2B4CL 3QZMA 3U7WH 5MENB 1HHJA 3KJ6L 4G5ZL 2JTYA 3GIVA 2A6KB 2W0FA 4XMLL 4Z3IA 5GZOA 2QELA 4LSPL 4PJBA 2EYRB 4TNVF 3TBWA 1YQVH 4D9QD 5KVEE 1ORSB 1MFMA 5DWUH 4M6OL 3TS8A 2IWGA 5BRZD 2X70B 5AFAA 4UU9B 4JKLA 4WFHE 3HAEA 2GSMB 1KBKA 5ESAB 2BVOA 2PYEA 2VXVH 5BV7L 3KPPB 4Y1AD 2EC9U 1JI2A 2B9BA 5SWZE 2CLRA 2V37A 1FL3A 2FE0A 3II3A 4Z7UB 5J0BA 5BUPA 3NFPA 1HWHB 3HE6C 4GKZB 1D5ZB 3LHPH 1QVOB 5AEAA 5AL8A 1HZKA 3MRMA 5D71H 2A5UA 3OKLB 4M5ZH 1U36A 3HE7C 1B0GB 2EXTA 2AABL 3DX6A 3FPYA 4M48H 5T3ZE 5D9SA 3RNQB 4IHOB 4RGND 1OF2B 1JUFB 3STLA 1UATA 1L7IH 2BIMA 3QK0A 4FQCH 1JK9A 3IGKA 5C0GB 1YEIL 4H7VA 4TXVB 4DGIH 4FMFA 5C08A 2QPEB 5E9NA 3SD2A 4LSUH 1PLBA 1DDTA 4P9HH 2YFOA 4UTAH 2XKNB 4KKAC 4GI8A 3FSAA 5IUCA 2D4FA 3U1PA 4CADB 1FFTB 3T5WA 2NCMA 1G0XA 2PW1A 5BOZG 1XD1A 3JWNE 5FF6A 2YAQA 1MDAA 4AGOA 2PWGA 1EVUA 4ODWB 4N0UA 4TVSa 5JYMA 2XPZA 1DJIA 1S7QA 4HV8A 2BSRB 5JOEA 4AGNA 1WICA 4QGTA 3GMMB 3HZKB 3QAZB 4BFFA 1P5UA 4LHUA 4PJXA 4TNWK 4UMGA 1BVZA 5CSZA 1UADC 4NRYA 2H3XC 5E8NB 1OP3K 5TDPA 2ZOKA 1IGYB 1KN2H 5D2LE 3V5HB 1QSEA 3H42H 1H3VA 2VLLB 4XBGA 1A4BA 3CDYA 4PS3A 2D3NA 5LKNA 3HUJE 4N8UA 2VR3A 3AQXA 5F97E 1MWAL 4PVMA 1K8DB 2X6UA 3SE3A 1N70A 1R3LB 2CBOA 4ZMYA 4NS0A 1C9SA 4ONHB 3V8CA 4PI0A 4U1KB 5EZLA 2VUYA 3OKEA 2X0VA 3N85H 4QHMB 4UMSA 5GS0D 5A6MA 3SKOA 1SLVA 5TE6H 3SQOL 4NZUL 2A6JB 1UB6A 2C7UB 4X80L 3W5NA 4X4MA 1BYNA 3VI4A 3ZXAC 3FSWA 4AJ0A 5EEUA 4JFEE 4PTUA 5CEXB 2ZKHH 1EERB 4KJYB 1QO3B 2W95A 1AXIB 2ITCA 2PP8A 3T3ME 5KYNA 2XN2A 5SWQB 4WW2F 1KZYA 1Z9MA 4XPFH 3PQYE 3BLPX 1GGTA 3NH7L 3DDGA 4L1LA 1GYUA 3OKDB 1UT2A 1KTCA 5EUOB 5IWLA 4K2UL 4GUPA 5DJ6B 4NPYA 2GABA 4XMZA 1ETJA 1HN1A 1L9OA 1NEUA 2KS0A 2OXGB 5EA0H 5I0VA 5GISL 1SMDA 1GAFH 3GXUB 4F15C 1LK2A 1A0QH 2P48B 4JFDA 4PV8B 5C92A 1HSAB 5G2NA 5E24E 2QSCL 4AQ1C 2DF3A 3E9TA 1KBBA 1RUMH 3MLUH 4JFPA 8FABB 2YD9A 3G7TA 4X5XB 2K3HA 5D4JA 4YXLH 3D18A 3PUCA 1BYOA 4HIJA 4P2OB 1DE4A 3NIGE 4HFWA 5FM8A 4D7PA 1TZOA 3DUUA 3ZSSA 1KIQB 2JCCF 3NQIA 1S8DA 4YDKH 2GTQA 2YOAA 4YHNA 4UB0L 4AYFB 4PVBA 1J88A 1DQLL 2Z4QA 1MRFH 1R5VA 3PABA 4RSVA 35C8H 4OZ4A 5DF0A 2GI0A 2GJ6A 4WI0B 4PUBH 4QXVA 3F58H 4TVPL 3NPZB 1GSKA 5GGQH 1HEJC 4WHYH 3CVIL 4JY5H 2EKSA 4AGLA 5IQ9A 4L1SA 2X3BA 4OJCA 4WHTA 5AOIA 2W0PA 5GIRB 4KFMA 4PB9L 4L9DA 2VLKB 5GZOD 1FV1A 2RMNA 3T9WA 1KCUH 1XF5B 1THCA 2WXHA 4PRNA 2ZXCA 2JI1A 3INUH 4RDQG 4NXSA 1S7SA 4I0PC 1OM3L 2XPYA 1LWHA 1NFAA 2FGWH 4OD3L 4MNQB 5HHPB 4IS6B 4FFTA 1GSMA 1PVHA 3APDA 1ZDSA 3KPRE 1VENA 2WKLA 2BY0A 4N1HB 5GSVB 2QLVB 3ME0A 1KN4H 1M1XB 2VM3A 3MJ8A 4ZS6C 4ADGA 4HIHA 4BFEA 4GKNA 4GSRA 4LB8A 4AOFA 2WLLA 4CGTA 5AZEH 3CFEA 1TTGA 2R1WA 2RBLA 2OZ4A 1YMHB 1F86A 3F6JA 3W11C 1HHHB 1JRHH 4NO3A 1M7IA 2SEBB 4WSGA 5TPWH 1KTRL 5GGVL 2XY2A 5SWSD 2ENSA 2EO1A 3ULUC 4BH7B 3OVUB 4GW4B 1BM7A 4FLHA 1I8MB 4NSKA 5DC9B 3B2VL 1BSIA 4ZMLA 4MD4B 2W60B 5AW3B 4OLXL 5C08D 4AYEC 4PGJA 5L7XH 5GHWL 1RJYA 3GI9L 3AG1B 1MJ8L 1EJ6A 4LASL 5FUOL 3OB8A 3V5DA 4JG0H 3ZKQD 3P1VA 4DQOH 1R5IA 2CGYA 5IBUG 3TBSB 2F5BL 2R23A 3FH5A 4MJIB 3HNSH 1FHNA 5JIMA 4U05A 1MCCA 2BRQA 4OLVL 1S3KL 1NFDA 3F05A 1AP2B 3BGMA 2ADIA 4HJ0C 1NKGA 4H8UA 5IVZB 1U8NA 3HR5A 4WDIA 1ZS8A 5I6LA 3HZVA 1P6FA 3BVUA 2XCMC 1NL0L 3IJHB 2ZX8A 5E94B 5BJTB 2JELH 4LHUD 4IGBA 4YC2C 4YHOH 4KZDL 1YYCA 4LLDA 1OPGL 2GC7C 2X4RB 3FYEB 3JT0A 1Z5LA 1EJ8A 4FG6C 4FNPA 1LGVA 1P6AB 1QSED 2AK4B 2E0PA 1UENA 2NNRA 3GMQA 4AVKA 1CE6B 3NGBC 1FNEB 1FSKB 3C8KB 3CFBA 3T6VA 3VXSD 3MRNB 1E5YA 4N2GA 3QUZA 5C0IB 3MX0A 1RULH 7CGTA 2BOBA 3LDBB 4TSAL 5DMGD 2AQRA 4XMTA 1MG3C 1CTNA 4V1DE 5FUCC 1CO1A 5AOMA 2BVYA 4JM2C 5FO9A 2L7EA 4L5FH 4YSOA 3V9EA 1PSKL 4ZUVB 4G5AA 5I0YA 1Z66A 4O51B 5IG7B 5LCVH 1E8ZA 3Q8FA 4KJPD 1DQDH 1N2RA 4GLRH 4HK3N 4JKPL 2YQ3A 1FYTE 4OT1L 1RVFL 4HXBL 1JFQL 3OAZH 4MX7B 5E8EA 1EXUA 4WHCA 4Q6IC 3WE6B 2ZYHA 3T0DA 3FRPA 1F6FB 1DQMH 1TCRB 5E08L 3CN2A 4PJAB 4S10A 4IJ3B 4XXWC 2FJFB 4WTWA 8PAZA 4OJAA 4P2CG 3V8OA 2JJTA 4AIOA 4AJVA 1JYVA 5TE4L 2VSDA 1KGCE 3E6FB 3ZW3A 4JFQA 1KLGA 3FQRB 4FG4A 3VFVA 5F7EH 4TUJB 5KVFE 4GMTL 5EEWA 3D85A 2H1PH 5CJQH 4JFDD 5D5ME 5FV1L 4BQCA 3HZMA 2BIIA 4MJ6B 1LL1A 1F6AB 4DHLA 2BP5M 1KJ2A 4HT1L 5D7KD 1P4LB 4BFGA 3KDMA 1MRCL 3BE1L 5HGBA 2IWEA 2B1AL 3B9AA 3SDDC 3RGVA 3GJFK 3MBXH 1KJ3H 1HHIB 1ET7A 4CA4A 2M83A 1Z9SA 4NO0A 4NRXB 2X0WA 3WD5H 3WHE1 3ABKB 3BX7C 2VJ8A 1S7WB 3AMLA 1NMCC 3ARWA 4NBYB 5DZAA 5DZJA 4HC1A 4YHPA 4WFEE 1YYLH 4XB3A 5CU5A 4AEHH 2GJ6D 2ALAA 1O7VA 3KWTA 2EDJA 3ABLB 1CT8A 2EILB 2AV1B 3MRHA 3R8QA 4HOWA 2XBZA 2CXKA 2I27N 4OLUH 4F58H 1T1XA 5IF0A 2ZXQA 4DEUA 1HL8A 4PW3A 4AMKH 2BNUB 5ESQB 4FNRA 4EN3B 2I9LB 3WN5B 5HHQB 2FGZA 2F8OA 3EYFB 5GJSL 1CGSL 2VN5A 1SHMA 1L3WA 4Y89A 1AGFA 3CFMA 2IQAA 5C6PB 1JNHB 4M9PA 2JK5A 3CHSA 3U48A 3EYVA 4PGDB 3Q6GH 1D5XA 4LAQH 4OCLC 2JMRA 4RSYA 4F33B 4FI8A 1X6NA 2BOCA 4PJHA 4YBQD 1CGXA 3VNYA 5IFAH 5F8QC 2KYIA 2OTWB 3FFDB 1IM3B 3LSOB 1WT5C 4HOXA 3ESMA 4FOMA 5IMKA 3O2VL 4GAAA 4XPBH 3VD1A 4LSTL 5DQ9B 4P23C 4JDTH 4N28A 5AVYB 4GRMA 3VSUA 2GSGB 2OKMA 1FO0B 3I75A 1SXAA 5DGRA 4DCQB 1WBXB 5EIVA 2D03L 5DYFA 3FAWA 1MJUL 4KOBA 1PG7H 2UXFA 2G4EA 2ICWJ 5ICZA 3IFLH 3GRBA 3T77B 5AWNL 3PE9A 3CK0H 1HOCA 5HI4D 5T1LB 3L4ZA 2Z65C 3PWPB 1UEMA 43CAB 2HLEB 1G4RA 2J5LC 1A64A 4AT6A 1J8HE 2VLJB 4XN7A 2FJSA 1HZHH 3L3KA 2QKSA 5BZWB 3IRCA 1KNOB 4G71B 4OLYH 1E28B 1F58L 1AANA 5DRWB 4ETQA 3I3DA 2PNDA 2X40A 3QQNA 5D70L 1G6RL 2BVPA 2N4IA 4FXKB 4EBQH 4F7CA 5I75C 2OL3H 3OHXA 1SQ2N 1A2YA 2WP3T 3N41F 1IC5L 1R3KB 3LZPA 5AVXB 4WNQA 1JNNH 5B38G 4Y16A 5K1JA 3SOTA 2O72A 3QNYA 4F9LC 1S5HB 4R90L 1QRKA 5F9DC 2VSKB 1NBYB 2YLKA 3MCYA 1UOKA 3QUZD 5JXAH 2VLRB 1LO4H 2ZICA 1K9TA 2Y23A 4WWKC 3ARTA 3QBTB 4NQDE 2X4PB 3O6FC 4XMXA 3ZE2E 1ZHLB 5I71B 1QBAA 4L8CB 1YDPA 1ANUA 3TA3C 1EX0A 5TQ2L 3VXTA 5JHMA 4WUUB 3NN8B 5B3JE 2VWEC 1JPTL 5CEYB 4M4RA 3J7HA 3AFLA 4QTIH 2D7TL 1GZPA 2WQXA 4OIIH 2Q86A 4JQXA 1KACB 4H40A 4OD2A 1NCDH 5F1IB 4ZUSB 1BWWA 3ZPDA 1RIHL 3N0AA 2CK0L 3HCVB 1U3JA 3RFRA 3D39D 1QUPA 3CFJB 4PSPA 2P4AB 2ALWA 5FB8B 1VEOA 2XZZA 2PTTA 4FFYL 2BVUA 3IWUA 4KKRA 4LESA 3VGEA 4OJFH 3DMMC 3SDAA 3V6ZB 1Q1PA 4PJ7B 1LE9A 2AXGB 5IMMB 1CTMA 2ICEB 4XTRD 2YZ8A 3C2SA 5TDNB 2GTZB 5TD4A 4I5BA 5GGRY 2QADC 1EK3A 2AQPA 3SPJA 4NQXA 3S7GA 3V4VB 4FZEH 3D85D 5IQOA 2DEYX 2F1EA 1CURA 4RMUA 1X5LA 3CVHH 3O3EA 2NY5L 4HWBL 5E6ZA 3TFKD 4TUOA 3ZT7A 5J89A 5I1EH 2YR3A 3TJEH 4JG1L 3ZE1E 4DP2X 1XXDC 5IM7B 1EV2E 2VAJA 4WO4A 4TULL 1T0NB 1Q9WB 3MJ7A 3RGVD 4M6ML 2BPBA 4NO0D 4PJ5E 5DZVA 5KSAA 3GSWB 4PJEA 3SPCA 4X7EC 1CLZL 3DX8A 1BIIA 4KMTH 3DRQB 5I8CB 2YEQA 4HZLA 4EPSA 5BOJA 5EU3A 1XIWB 4HJEA 2FQFA 3QEGH 3QZNA 3ROLB 3CMGA 1A3QA 1WLHA 2O6CA 3VCLB 4F5CE 2VDKB 3M1BB 3T8MA 5L8JB 4Y5XA 1ES0A 1X7QB 2QL1A 3S8GB 3EDJA 2EO9A 1GS7A 4IBUA 4NC1C 3GZQA 2IBZX 5IUSA 3F00A 4G7VH 4WEUD 3FHQA 1XCTB 1J5OH 4C56A 3BGFB 3JT2A 3UJJL 1XF3B 3G3LA 2LVEA 3IN2A 3O11A 1QWNA 5D1XC 5ES4B 2X4NB 4LNRA 1ZGLP 3F7RA 1CLVA 4LCYA 5B3NA 5F89B 5CO1A 2HH0L 3UFIA 5IB4A 5BS0E 4HS8L 3GSRB 1C1EH 4FCHA 2DLEA 2WB1A 4LCCC 4XCCH 4NM4H 4LL9A 3QJHA 1SM3L 2QKIC 3WKMH 4F92B 1P7QB 3D0LA 1JZDC 2OW7A 2NPLX 1Z0NA 3ARDC 3DX1A 3EJTA 3MLYH 5C70A 3POHA 3Q8CA 1NC2A 3ARFC 1MXDA 3LKNA 1T0OA 2C1OB 5AZEL 4FA6A 1WIOA 4L37B 3L9EA 5KBMA 2FO4B 4NENA 1DDHA 4PY8I 1UYWL 3BO8B 4BQ8A 4E41B 3UH8A 1YMMA 4WLCA 2X1PA 3GLEA 1FCCA 3DETD 1KSRA 2XUWA 4QI3A 1GMIA 1RU9L 3NOIA 4HFUL 5C0DB 1W9XA 2VDPB 2RIKA 3N1MC 3PJSB 3MUUA 1GJIA 4N86A 3FQ2A 5E6SB 2XQBL 1U8OB 2V8LA 2YSSA 2R27A 5JW5A 3R4DA 4JR9H 3CFDB 1QFWI 1B2YA 2ATPB 4ZO7A 2A74A 4N85A 3AY4A 1J18A 1E2ZA 1OGAB 2DWDB 4NZTL 4PBVC 2Y4SA 4RLDA 4D0BB 4FNTA 5DU7A 3QDJE 1LVEA 2OMZA 3EYUH 1CR9H 1HH6B 3MYJB 3QYCA 4FLSA 1PLCA 2VZSA 4BFOA 4F57H 3LZFL 5DD6A 1ZY9A 2XBTA 3HPLA 4GAJH 3ATBA 4NUJB 4Y16D 3O0RH 4Z7NB 3HC2A 3B4NA 2AI0L 4G42A 4LEXH 4A7TA 2NNXA 1IAII 1T7XA 2WXPA 1EWHA 3LQMA 4KXZI 1Y07A 4JANB 3UOAB 2J71A 1Q94A 1VFAA 4PGBA 1NMAH 1OVZA 3WFCL 4PRAA 3OZLA 1QR1A 3RUGA 3F7VB 3VMNA 3S48A 5IR1A 5FA4A 3OQRA 3TH2T 2ISDA 1H3PL 4PJCB 3LB6C 5EC1B 5JHLL 4I13B 5HGAB 4XC3L 1A6VL 4ODVL 1OCCB 3BAIA 1BXVA 1OF0A 3LX9A 3ML8A 3UYPA 4XPTL 3EF4A 3NACL 4AM0Q 1H8LA 3WFHA 2GW5A 3EHBC 4UV7H 1SXZA 1UWXH 3SDAD 4JDZA 4LCVA 2MPAL 3Q06A 1XEUA 3V6FB 5JW4N 2D7PA 1T3FB 2R8SH 3PWVB 3I50L 1MW3A 1YEJH 3MBWB 4I77L 3QJXA 2AVFA 4N2OA 3SDCC 3U9PL 3DTDA 4JCLA 5LNDA 1FGNL 3UIZA 5EOTA 2NUTB 1COBA 2YAHA 5G4NA 4L29A 2IH3A 1YG9A 2RTTA 4DN3L 2R7EA 4J39A 4J27A 4YEFA 3FT4A 4G6KH 1QSVA 2B7DT 2PCXA 1Q9KB 4NJAH 4WO4D 4XP9L 3SD5A 5J57B 3KHQA 4X9FA 2H6OA 4Q74A 3VWJC 4EDWH 3K2MC 2UV3A 2Q1EA 4M61A 1KCLA 1PKQE 5E51A 5EBLA 3QRFM 4JQVA 2A9NH 2V17L 1VFBA 3QXDA 4UOW1 1SVCP 5TH2A 4U3SA 3LS4H 1RH8A 3EFFA 2HVJA 4AYFA 1LM8V 2E7LA 4HW6A 3WJLA 3V0VA 3SKJL 3KPQA 3ZTNL 2CRMA 2I9TA 2VMDA 4PD4J 3F2LA 3JTTA 5D93B 5IVXE 5DWPA 4GUCA 1XZ0A 1NAMB 1MHEA 4CJ0A 4C56D 1XGTB 3L5XH 1I82A 4M93C 4ZODA 3F83A 4YAQB 3MFGB 1K8IB 3OKKA 2M1KA 1N59B 1NINA 3BYYA 5T5NF 1KG0A 2HG5B 5CUSL 4L4TE 4UOJA 5E8DH 5A2FA 1XR9A 3T6WA 3DVGB 1DEEA 5DJ8B 3MJWA 1UWGH 3KHOA 3GSXA 3T1WA 1RUKL 4CVUA 4RRPG 2WYZA 5IHWA 2Z8WC 3X3GH 4OH2A 1BPVA 2H32B 4AE0A 1F4HA 4PCYA 2YQBA 3NIFF 4Y5VB 5ALBL 3IFNL 3ULVF 1JGLL 1OGTB 3B8SA 2ENJA 1EO8H 1HVXA 1MHHA 1NC2D 4ELKA 2HUHA 2ZCKL 3QH3B 2VDOL 2R0KL 2AVGA 1PNCA 2FB4H 4BK5A 3NTCH 4Z95L 3GWJA 1TZIA 1YMMD 1G9HA 2XACC 1PX8A 3QJTB 4XO5A 5INCB 4X6DF 1I7UA 3ZZSA 2FZ3A 3TYGL 3U4BH 1Z9NA 4LOFA 3I74A 4M5SA 4KZCA 4N8VB 4Y1SA 4CVWA 1HJCA 1UVQA 3DXAA 1HCFX 2JQAA 3HC3H 3TCLA 3HMXA 3EUUA 4FQXC 1JZ3A 3ZR5A 2BSDA 2KI6A 1NIBA 3FK3A 2EXWD 2OSLB 3RWJB 4X9IA 3O4LB 2OQJB 2ILLA 3SBPA 25C8L 3ZKMD 2H3NB 5C07B 1J11A 5D1XE 1ILSA 5I1GL 4OM1L 2XN1A 4HD5A 2BY2A 3BP6B 5DEZA 3KXFA 1QBBA 1R0AH 5A2KH 3SE6A 4MDIA 1L9TA 4B9ZA 3SBQA 5B8CC 1KV7A 2ZWSA 5BJTA 2DLHA 4R7LA 3FFOA 5LQBL 2P80A 1A7OH 3MV11 4BIKA 3BWSA 3PAZA 4I3SL 1L6ZA 1YNLH 2DZEA 2I07A 2VDQH 3BDYL 1Q8MA 4NO2A 3OJVC 1CDJA 2Z34A 4W1TA 3UC2A 3TT3L 2KQMA 3GO1H 4MMYB 1IAOB 3LEVL 5E56A 3VYNA 1IARB 2PXYC 1G6VK 4Z5RA 4J4PC 5T1DH 4RH4A 5FYKL 3U9UA 2GHZA 1SEBB 5B7MA 4WU5A 2XTSA 5EIIA 4WI8A 5DVNA 2BH0A 2J1YA 1PCSA 1J5DA 1P2CA 3KPOB 4F2MA 2WQVA 2NNFA 5I1HH 4G8IA 1M4KA 1JF1A 1S5IL 3VXOB 3VTMA 1SUHA 3QP3A 3NSFA 5D8JL 3GSVB 4KNSA 1QWUA 5KVDH 4LSSL 3LKPA 5DURB 4GXUM 3FQYA 4BZ2L 2WNXA 1CDHA 4OGAD 1A6WH 2QGDA 5L2KA 4MXWL 3O3AB 2WINB 1GZHC 5HHVL 3WE6A 1DVFA 1NDGA 1RIVL 4G1MB 4H20L 5JPMB 4TUUA 6FABH 3PL6C 3RHWF 3VXMB 4HQQL 3LVTA 5JIIA 3LRSA 2IANB 5MEPA 4HULB 1UOLA 5FYLL 4R7VA 3OAYK 4FJ6A 4KI5C 1QA9B 4MA8H 4LSDA 3VD5A 3WCYA 3U46B 4TLSA 3LN5B 4U1LB 2BP8B 4OZGE 4ICXA 5L8KB 2PWEA 5ISZE 3OMNB 3DOIA 1EXHA 2VITA 5J12C 3EOTL 1K4DA 3KBHE 3N40P 3K6SA 3QFDA 5EBMA 2BDNL 2C9PA 5IW3A 3R1GL 4LGPB 4LBEA 3RZCA 3ILPB 1V10A 3FU0A 3J2PA 5GGTH 4HSAC 4PCSA 4PBWD 1NICA 1GKEA 5EPMB 3TN0B 1E27A 2V5SA 5JQHC 2WQRA 3QCVH 2MKLC 4KAQH 4X8XA 4OZHF 3N9GL 4JO5A 4JPKH 1RJZA 3SGEI 4N1CA 5I9QC 1JNLL 2CU9A 4M1CD 1UM6H 2CO6A 4PJDA 3VFPA 3FF8A 2P26A 3EH1A 1NJ9B 2LTQC 1WBYA 1QBMH 2EH7L 2XRAL 1PYWA 2GCYB 3E9UA 1GGYA 2MNUA 1WCBB 4YIQA 3Q1SL 3KYKL 3U6RA 4YN3A 1BOGB 2FL5B 4N2KA 3MRLB 4P5TB 4JHZA 1YN7A 2FWLB 2D7MA 4KTYA 3T6XA 3WN5A 3KVQA 4HKZA 4C4KT 2NLJA 2WTOA 5AZUA 3T0WA 4G8GB 2CALA 4KRPC 5HY9A 4LLUB 1K85A 3N1QC 2ZP9A 2BMKA 3EH5B 3UPCA 4I3RL 4NNPH 5I76B 1WBZB 2FNWA 5JNYA 5F7UA 2ZG3A 3S37X 5E5RB 3MNZA 1FE8L 5F0MB 1NCCL 4PG2C 3ZDZB 4X6FB 3BP4B 4IBVA 2WSPA 2ZF8A 4LKXA 1SJHB 5C0CB 4TOYH 2PPFA 2BFVH 3UAJC 3D25A 3VXUE 3IMSA 1OKEA 2DJSA 2UY6B 1Q0YL 2CO3A 4HIXH 4IKNA 5GRZA 4M7JL 3TBYA 5EU6B 1X5IA 3QUXA 5IQ7H 2GEQA 4JDVA 3B56A 3DXAD 4QOKE 4JHVA 4DGWC 1UM4H 1JPSL 1ZVSA 2IALA 2X4UA 3T0AA 1YNKH 5IK3B 4EZJA 5CBEA 2E7MA 2R2EA 4IEFB 4AQZA 5B1AB 5FLUA 1AOZA 4EO5A 3I6GB 4Z3GA 1E90A 3SYAA 3NG5A 2G60L 4FMVA 4LVHB 1KY6A 1LQSR 5AYUH 3FTGA 4HG4J 2W80C 4OLWL 4HF5H 4PRDB 4AUUA 4ZX6A 1XFPA 4HWNA 4UZUA 4FXKA 1ZEAH 3DBXB 4DKEH 3THML 5GS0L 2JXMB 5I1LB 4XAKE 2P80D 5KBNC 4KVCL 2VIRA 4WJG3 3G6DL 4YE4L 4LF3B 4ABQA 1R3KA 1N0LB 4ELMA 1MW2A 4HX1B 4UBDD 1IFRA 1BVLA 3HI6L 4M43L 2FECI 1FNSL 2XX1A 4N2BA 4ZT1A 3LKQA 3I9GL 4GSDL 4X8GA 2XVLA 3BZFA 4P5SA 1B6UA 1D7BA 1X9LA 3L4YA 4XI5C 5KVGH 3BN9C 4OCXH 4L9LB 4R8WH 1N5AB 4Z76B 1F4WH 2XJKA 3TO2A 5IB2B 4XHJD 3L6FA 4WNJA 2AJSH 4YLQT 5DRXA 1R33A 5D2NE 2LLGA 1EJOL 1R46A 4TNFA 3ROOA 2WXLA 1B88A 4MCYA 3MNVB 1CICB 3HUJF 1A1OA 4R4BB 3ZDYE 5CCKH 3BKMH 1YEGL 1CXLA 5DS8B 2JIXB 1O7DE 5L2KD 3L17A 3TJHC 5KBDA 3VSVA 3OR7A 4WW2B 5EEXA 5A16B 1DVFD 1BVNP 2DQGL 2YBRB 3UBXB 2RAMA 4JO1L 2RCSH 4NP9A 4YSSA 4S1DC 4EUPG 2DDQL 3L08A 4CMMB 1J1XL 4PFEA 2E9WA 3LV3A 2O5YL 3KWUA 2DQDH 4Z7AA 5JHDA 2D9QB 4P2RE 4UILL 4YNYB 3TV3L 5CFHA 1JD7A 1UJTA 1F00I 3IMUA 2AJYH 1OSEA 3T3MF 3WFDH 3C08H 2HJKB 3UTZA 5T3XH 1HHGA 2P3YA 3RZCD 4BWUA 4X5RA 4B6ZA 3MOBH 4JG5A 2BZ7A 2FLMA 5IZ7A 2W94A 4DP1X 1ACYL 1JVLA 4PJGB 5ESVB 2BIQA 3A47A 1K6QL 3GJEA 4GBXA 1MPAH 2WIIA 1EMTL 2HLAA 1H15A 2EAEA 3MRPB 3BLKA 3QULB 2J7LA 4KPHL 3OLEA 4P8QA 3GIZL 2C4FT 5E0FA 1R34A 4GW5A 4RAUB 4L2YA 5LGKA 3NCCB 1LK3H 4MJ5A 4L23A 3VCLA 1CXEA 4H0IA 3FQXB 3MUJA 1FWXA 4KDTC 3JV5A 3NIGF 3QJFB 1ZHNB 4LCWB 2OA9A 2YIHA 3GBNL 5EV7A 1U3HC 2W59A 4F24A 1NPNA 3CBKB 3Q48A 3WIFB 4LCIL 4J28A 5FYJD 2IDTA 4EN3D 3CHPA 3WIIL 5E6IB 4XR8C 3TT1L 4J3OD 1I3GH 1FI8C 5LGJA 1ORQB 3SJVB 4RBPK 3GTTA 2Q6WB 2ZG1A 1DVSA 4LQFH 4DEWA 3MVSA 4J12A 5AVSB 4AIXA 1J86A 1WAAE 2GBUA 2VAAB 3WFEH 1T5KA 3QORB 4JZOB 4KX8A 1DSFL 1EAPA 3BESR 3QEQB 3QE5A 4PV9B 5TFSL 4YS4A 2Y1VA 2WMPA 2XWEA 3OZKA 4OQTH 3E8VA 3I6KB 4FADA 3TNNA 4ZZFA 1PZAA 5AVRB 4UUJA 3LOWA 1JGUL 4W4NA 2AQNA 2H8PB 2LQRA 3QUXD 2DLFH 4P3CH 1CK0H 3FFCB 5F7KC 1OTTD 2R1YB 4Y9GA 5HHOE 1Z9LA 4UYQA 3E3QE 1UD6A 4DPRA 2CXGA 1K4CB 5JTWA 2PW2A 5KVMC 2YD3A 3DDFA 2EDOA 5KSUA 1ND0B 3B3BA 4NO5B 4ZFOB 3EW3B 1JHTB 2CCLA 3MRDB 1NBVH 5C0DA 3A21A 5T1LD 4F8PA 3S88H 3ULUH 4EQ2A 1PCXA 5HDBF 2FX8H 2BNRB 2Z35B 5FX3A 3RWFA 2F53E 5ITBH 3LIZH 5CJOL 1A1NB 2Q0ZX 3IPBA 2H2SD 3IAQA 4NQEE 1T5XB 4PYGA 2HRHA 3BVTA 4XBEL 2IPKB 5TGBB 5HBBA 5J6GB 5DC4B 2QPFA 1XL6A 3KDPB 1KWKA 1JRHI 1JCKA 1PGRB 4ECNA 5D7SH 1TQUA 3NCEB 3B3IB 4A7SA 2FD6H 3E8UL 2FWSA 2OK0L 2DQFA 3QI9B 4XVSL 3QHFL 1RERA 1FF5A 5AOLA 1KCWA 3U2JA 5LXGH 1JBJA 2DKMA 3QJQB 4OAWB 4Y19B 5KANG 2W65B 3WY2A 1AZNA 1UURA 3HB3D 1EHAA 4DW2L 1H3WM 4B9PA 4YUEH 2BHYA 2IG2L 3ZYIA 4DETA 4RDQF 5HYQB 3KYNB 3UACA 3JWOL 1W72B 2ADFL 3ALPA 4QHKI 4R26H 2HJFA 4Z7UE 2X38A 3OM3B 5EU5A 1NWPA 3DPDA 4ZX4A 1AQKL 2IIJA 2R0LL 4R7NB 4YHIB 2AEIT 4G3YL 3B2UD 3SCMB 2YKKA 4XMKH 2BHFA 3RDTA 4J8RB 4WEEA 4Z7WE 1MN4A 2EEFA 4U6HA 5EU4B 4E5XA 1BAFL 4HISA 3DJ9A 2FJUB 1AZVA 1C08B 1URIA 3O2DH 3T4AB 3O3BB 4WJ5B 5GS1C 5JHDD 1RUPH 1U8MA 2AQTA 3MRKA 1UACH 1EH9A 4ZG1A 2NXYB 4DK6A 2DQIL 2HRPH 4OJDH 1BZ7A 4KZEH 1Z9OA 2EADA 2OAAA 4BE5A 5BXFA 1AKJB 3AT8A 5KYYB 2FBRA 1GOFA 4P5KB 1QD0A 4FABH 1NLDH 5E6UB 2QQLL 3CU7A 1HWWA 2XWJA 1I3RA 1I4FB 1AXSA 2W81C 1QFWL 3NAAL 4FFZH 3VFNA 4GBXD 3VSTA 5HYIA 1BYPA 1CD9B 4GP8B 4WV1A 2VZUA 2JKWA 3ISRA 4NEHB 5D5MF 3MRBB 5E1IA 4PREA 1T04A 4BQ9A 1XIWD 5IFJB 3U7YH 1T22B 2FBJL 4G8EB 4DPBX 5IEHB 4R3SB 1U91A 3NJGA 1OTSD 1Q1JH 3BEVB 4WO0A 3RWEA 4APQA 1RURH 1G84A 4OCSL 4B5ZA 2CRIA 3VE0A 3OMZA 2DQEL 4PB0L 5FEBA 5AB2A 1MFAH 3IDJB 4ZOCA 4B9FA 3DOSA 2O5NA 4UM9A 4GT7A 5KJRH 3VMPA 1HQ4B 3EG9A 4Y9EA 1WFOA 3QZWB 4E9WA 1IAIL 2X2YA 1A3ZA 2OZ4L 4A38A 3NPSC 4GAGL 4R6UA 3RYMA 1QSFE 1N4XL 4A39A 1R3IH 3T09A 2ZCLL 1J1PH 4HKXB 4HA1A 1SRDA 3SKNA 1M6OB 4LQ1A 4OF5A 1GJWA 2LAAA 4QY8A 3MLTA 3O6ML 4XNMB 4EN2A 2EYSA 4B41A 5E0QA 3X1NA 2DN7A 2GUYA 5FXCH 3LZLA 4IRSC 5F96L 1DBJH 1WFUA 1AJ7L 3DK0A 2YK1H 3I02A 4ODUA 3RWHA 4TQPA 3U82B 2WNWA 1YEKL 4OUUA 1DQJA 2JWYA 3FCSB 3KH4A 4LT7A 4L1BA 3HLAB 4AG4L 2XTLA 1KXHA 5JPNA 1U8LB 4YDJA 4QRRA 1SPDA 5HPMB 1DUYB 1PLGH 3U36A 3VXQA 1SBSL 5J1AB 4KQ0A 1AY1H 2L7JA 5BZZA 4HUWB 2YS4A 4PLJD 2X1WL 1AFVH 3T1FA 3KL3A 4BDVA 3MOQA 3OMIB 4ZUUB 3WNMA 4K9EL 2P8LA 4H8HA 2JKXA 3ZLQC 4AWJC 4MJ4A 2ZUSA 5E5MB 2CPCA 2ARJA 3NFSL 3OJMB 1JYNA 2VZ1A 4QYOA 3ECBB 3FT9A 1F90H 2CDFA 3D4YA 4GS7C 1W91A 4N0CD 5IOPB 2ADYA 3U1SL 3QNFA 4N2AA 5SX5K 4Y7MA 3I85A 4KUCD 1N5YH 2XV6B 4Y2DA 5BW7C 1F18A 4ZW6A 2QGCA 4O2EA 5DJ0B 1CYWA 3SBWC 3BSZH 3DX9A 3M46A 5DS2A 2RB8A 4ZNEE 2R2HB 5EDXA 3TESA 5DD5H 2DJ4A 1E4XH 4OZIA 3LN4A 4PH8A 1TITA 1J05B 4OGZA 4KNTA 1O6TA 3DO4A 3JWDH 2VLKE 2B1HH 4NKDA 1NCNA 5JZ7C 2F9BT 2HT2C 5GZND 3MNWB 3P0VH 4OLEA 3DX4A 4W9KC 4DT2A 4MNQE 4WSJA 4RZKA 3L2LA 3RRQA 2ZONA 5AUMA 1HHKB 4Z7VE 3WEXB 3HHMA 2Z92A 3SO3B 4I2XA 1TZHA 1CFVH 2B59B 2DLGA 2X9WA 1QP1A 4JHUA 5IKCA 4H2AA 1HYRC 2GG1A 2K45A 4MA3B 2ATAA 3V0DA 2EE6A 2ZX9A 3VWKB 2AMGA 5JO5B 1AQHA 1CPUA 3STZB 1KJ2L 4GIOA 3GSVA 3RY6A 4FTVA 4ANXA 3RDTD 1RK0B 5B3JF 3COOA 3VGGA 1QFUH 1G7LA 1KBVA 3WO4B 4RGOL 2R9HD 2I24N 1RJLA 4QRFA 3ULUF 3CDGB 3BI9X 1KJMB 4EXPX 3PGCA 1HYSD 1DSWA 4JFHE 4HC1L 1MFEL 4G1MA 1PFCA 4U6TA 4FNQA 1LP9F 5GSRB 2YXFA 1VF5C 4EQ3A 2YPVH 3BT2L 3QR0A 1RFDH 1G7MB 3CZJA 2RFXA 3EYOA 4UDUA 5IMLA 2XWTA 3SE4A 1K72A 1KTLA 3WENA 1RV6X 4DFIA 2MTAA 2GUOA 3M8OH 4EDXA 3PYCA 3TIEA 4J3WA 4PRHE 3Q7JA 5EUKA 5F72S 4UIKL 4DPCX 5HYSA 2FATH 5A2AA 5BZXA 1EIBA 5JDSB 2AXHA 5J7CC 1LEKB 4ESKA 5B39A 1MCIA 4RGNC 4YSDA 2HFEA 3HHRB 3IU4H 3L7FA 3IDYB 5AW8B 4EOWL 1WH0A 3KJ6H 1UD8A 4XMLH 5ICXA 4LSPH 1MFCH 3QQXA 1PY4A 3QSKB 1YEDB 1NM9A 4G80B 3VRJB 2AK4E 4APQD 2Z8SA 3L3DA 1Q0EA 4JRXB 1HC1A 3C6EA 4E0RA 3MREA 1TKWA 1TTBA 2O6EA 2JKNA 3S9DB 2YMXL 4UM9D 4B7LA 2VDLL 1W15A 1FFPB 3X14B 3NEEA 2IBGA 3EBHA 1BECA 3KCPB 3G04A 4RMVA 4JAMB 5HDRA 1DR9A 2JLPA 1XH1A 2LR4A 2WUBH 1M3IA 4JM2F 1OP5H 1U0QA 4RISL 2HVKA 1KXTA 4AYMC 1RQ5A 1CXFA 2AAVA 2VL5A 1Z7JA 3C60A 4GG6B