3T6XA

Crystal structure of steccherinum ochraceum laccase obtained by multi-crystals composite data collection technique (20% dose)
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
495
structure length
495
Chain Sequence
b'VQIGPVTDLHIVNADIVPDGFVRPAVNAGGTFPGPVIAGNVGDNFQIVTFNQLIECSMLVDTSIHWHGEFQKGTNWADGPAFITQCPIIVGNSFSYNFNVPGMAGTYWYHSHLTTQYCDGLRGPFVVYDPNDPDANLYDVDDDTTIITLADWYHVLAKEMGAGGAITADSTLIDGLGRTHVNVAAVPLSVITVEVGKRYRMRLVSISCDPNYDFSIDGHDMTIIETDGVDSQELTVDEIQIFAAQRYSFVLNANQPVGNYWIRANPNSGGEGFDGGINSAILRYDGATTADPVTVASTVHTKCLIETDLHPLSRNGVPGNPHQGGADCNLNLSLGFACGNFVINGVSFTPPTVPVLLQICSGANTAADLLPSGSVISLPSNSTIEIALPAGAAGGPHPFHLHGHDFAVSESASNSTSNYDDPIWRDVVSIGGVGDNVTIRFCTDNPGPWFLHCHIDWHLDAGFAIVFAEDIPNTASANPVPEAWSNLCPSYDSAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase
publication title Reaction intermediates and redox state changes in a blue laccase from Steccherinum ochraceum observed by crystallographic high/low X-ray dose experiments.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 138
structure length 495
sequence length 495
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6xA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6xA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6xA03
2YAMA 2YAEA 2JXMA 1JXGA 2H5UA 4G71B 1MZYA 4M3HA 2CBPA 2AVFA 1M56B 1F56A 3ABMB 4YSEA 1W6LA 2GC4C 4BWUA 2XYBA 4PAZA 1MDAA 2YAPA 2JFCA 4L0PB 2YARA 3T6WA 3OMIB 1RKRA 1PCSA 4A2HA 1MG3C 2HX8A 2QDVA 2UXVA 2RACA 2OJ1A 2HRGA 5TK4A 4GP8B 1JVLA 1JXFA 2BP8A 3PCYA 2GHZA 5B7EA 2CALA 3WKPA 2DY2A 2PLTA 1SHWA 4DP0X 1A4BA 2H3XC 1OOWA 4Q8BA 2FQGA 1OE1A 5LDUA 4E9XA 5B1BB 2FQEA 5EHFA 1BQ5A 3OD3A 2EINB 1AAJA 2XLLA 1ID2A 3T6XA 1V10A 1HFUA 3S8FB 4QLWA 4AKPA 2GC7C 1QLEB 1XB8A 1ZDQA 3HB3B 2WO2B 1A4CA 1NIFA 2PPDA 3UADA 5D4HA 3UABA 2TSAA 3GYRA 4AX3A 1RZPA 2BHFA 1XB6A 5IY5B 1MG2C 4W9ZA 3N2JA 1WA1X 1OCOB 1AOZA 2R7EB 1OF0A 1NPNA 1WA0X 2CAKA 2I7SA 3FU7B 1GYCA 2Q9OA 1CUOA 4BWWA 1OCRB 1JZIA 3NJMA 2PCYA 2EIMB 3X1FA 3FPYA 4YSQA 3NJJA 2PPFA 4YSAA 3FQYA 1E65A 3NYKA 3D12B 1JERA 2B08A 1TU2A 2IDTA 4KNUA 4HCFA 2PP9A 4DPAX 1EHKB 3EH5B 2PPEA 4G70B 2PPCA 2PCFA 3FSVA 1JZFA 1J9RA 4E9SA 3ASOB 1SDDA 3KW8A 1EZLA 4JHVA 5I6KA 1B3IA 4GYBA 5D4IA 3WNIA 2UXGA 2PPAA 3NSYA 6PCYA 3AY2A 1PZCA 1NTDA 3UGEA 1CURA 2J55A 3FYEB 4DPCX 1WA2X 4DPBX 4Q89A 2XXGA 5B7FA 2FNWA 1J9TA 4KNSA 3V9CA 2ZONA 4N4YB 2IDSA 1ET8A 1PMYA 5A7EA 3DKHA 3IEAA 1J5DA 1KV7A 2FTAA 3X1GA 4GP4B 4DP4X 4UAHA 1JZHA 3PAUA 3MX0B 2Q5BA 1ZIAA 3NJFA 1N70A 2IAAC 4G7QB 5B3SB 1E67A 4QKTA 3CDZA 4UF7C 5I5MA 4NB7A 3OMAB 2CJ3A 2XX1A 2BP8B 3NP3A 3T9WA 3X1EA 1SFHA 2I7OA 4A67A 2BW5A 7PCYA 1M9WA 3CZUB 2FQFA 2HZHA 3DIVA 4AZUA 3U25A 4BXSV 4YSDA 2BZ7A 3UACA 2CUAA 3IN0A 3ASNB 4G7RB 4DP1X 1AS6A 1A8ZA 2BO0A 3ZBMA 1NWPA 2BP0A 3H4HA 3CVBA 3CVCA 3QJSB 4F2FA 1NPJA 3NSFA 5I6MA 1PZBA 5I26A 2HRHA 3NJHA 2XX0A 1BYOA 2VMJA 4BDVA 5B7MA 2DYRB 4RH4A 1ASQA 4GXFA 4G7SB 1NZRA 1R1CA 2OV0A 1XMEB 3AG1B 3NJGA 2EIKB 4P5RA 3NSCA 3H4FA 3PLYA 5I6NA 2Y1AA 3G5WA 5F7AA 1KYAA 1NIDA 4FAAB 4G72B 3T71A 2B3IA 4YSCA 4YSPA 3FPXA 1L9TA 1PZAA 3L45A 1QNIA 2DWTA 4A2GA 4YSOA 2YAFA 2YAOA 4EF3A 2J56A 1ETJA 1AQ8A 3GDCA 1SDDB 4YVUA 1CYWA 2PP7A 4YSSA 2ZWNA 1PNDA 2X88A 2XWZA 1M57B 3QQXA 2P80A 1E5ZA 2UX6A 3WIAA 1AR1B 1AIZA 2QT6A 1JZEA 3AG4B 4NERA 5I6LA 2TSBA 2UX7A 3AG2B 3FSZA 4W1TA 2QPDB 3FU8A 2QPEB 1ZPUA 2FT7A 4K9JA 2YQBA 1ZV2A 1AS8A 2XUWA 3OM3B 5ANHA 1AZBA 2W8CA 3IE9A 5B1JC 5F7BA 5B1JA 3SBPA 1PNCA 1AZNA 4DP7X 3TA4D 3UAAA 3S8GB 4UANA 3NJNA 2XV2A 1RZQA 1AANA 3CDZB 1SF3A 1SJMA 1E5YA 2XU9A 3SQRA 4DP5X 4HALA 2HXAA 3GXUB 1HAWA 4KO5A 2GI0A 1RCYA 3FU9A 5FC9A 1WS7A 2IWEA 3EF4A 3QPKA 1IUZA 1ILUA 2YXVA 1AZRA 1X9UA 1AACA 1A3ZA 1TEGA 1TKWA 5B1AB 3X1NA 1JVOA 2X87A 8PAZA 3NJIA 2I85A 1FFTB 1KDJA 3OMNB 5AZUA 2DWSA 2QDWA 4E9QA 1FA4A 4KOBA 1OCZB 4E9VA 2BP0B 3FQ2A 4F2EA 1L9SA 1PLBA 2FJSA 5PCYA 5PAZA 3T6VA 3V9EA 3SBRA 1BQRA 2Y69B 3ERXA 4DP9X 1SF5A 3QJQB 2VM4A 1NDTA 1MZZA 3MBWB 2R7EA 1OE3A 2WSDA 4BDVB 3X1BA 2IDUA 2XVBA 1ILSA 1VLXA 2IH9A 3HEIB 1SNRA 2J57A 4HIPA 1OV8A 1A4AA 2VW7A 3FS9A 1BYPA 3JT2A 4JKNA 1BXVA 1HAUA 3BQVA 1NIAA 2EIJB 1NIBA 1BAWA 3DTUB 3AW5A 3FT0A 1PF3A 1QHQA 1GW0A 3FSWA 5E9NA 1PY0A 2AZAA 4CSZA 4HAKA 4N8UA 2GSMB 1TEFA 2BWIA 3KW7A 1KDIA 3WG7B 2MTAA 1BEXA 2YAHA 3ABGA 3UAEA 4A66A 1JZGA 2JKWA 2NRDA 3H56A 3EH4B 2BZCA 2XV3A 3TASA 2IDQA 4X4KA 4P5SA 4BXVA 3TBCA 1IKOP 5B1KA 4YSUA 1IBZA 2IH8A 1DYZA 1CYXA 4CSPA 1J9QA 1AS7A 2UXFA 1E30A 3NJLA 3IN2A 1I53A 4TXVB 1AG6A 3EHBB 1GSKA 2BWDA 4YSRA 1URIA 1OCCB 1UATA 1GS6X 4HHWA 1NWOA 3PPSA 3ABLB 3NJKA 4E9WA 4YSTA 1GY1A 4HHGA 2HLEB 1AZUA 2ZXWB 5TK2A 1IC0A 3RYMA 2H47C 3NP4A 1L9RA 2WO3B 2BW4A 3JTBA 4GP5B 4KO9A 1ASPA 3FSAA 4A2FA 4AI7A 2GBAA 1KCBA 2VM3A 4BWTA 3QJRB 1SHXA 2FT8A 4KO7A 4DP2X 3N55A 1GR7A 1W8EA 1L9PA 1JZJA 1BXUA 2AZUA 1ZIBA 2AFNA 2MRYA 4NAJA 4E9YA 3QJTB 3AZUA 1OE2A 2XV0A 4KOCA 1PAZA 3T6ZA 3TU6A 3TBBA 5I5JA 3AG3B 3ZX1A 1L9QA 1ET5A 1W6WA 2FQDA 3S3DB 2FT6A 3S3CB 1CC3A 4FA7B 3C75A 1L9OA 1XB3A 2W88A 2XXFA 3ZDWA 2VSMB 3OQRA 4HZ1A 4E9RA 4DP8X 1V54B 1BQKA 3PAVA 1AZCA 5I5IA 2J5WA 1ADWA 1AG0A 2IDFA 3BVDB 3EH3B 1NIEA 3QJUB 2UXTA 3CVDA 2FWLB 4E9TA 1WAEA 5I28A 2OCCB 1J5CA 2GIMA 4YL4A 2VW6A 3WKQA 1JXDA 2LLNA 3CG8A 1WS8A 2E86A 3PXLA 4WKXA 1BXAA 1KBVA 1X9RA 2ZOOA 1ZDSA 4M4RB 3X2QB 4YVNA 2PP8A 6PAZA 3FQ1A 5AKRA 2CCWA 1KGYE 3IBOA 1IBYA 2HX7A 5I6OA 3ABKB 1KBWA 3SBQA 1GS8A 2N0MA 4WTQA 3FU7A 4MFHA 4HCGA 3FYIB 2GB2A 3WI9A 3S3BB 2IWKA 2A3TA 1GS7A 1KCWA 4AKOA 1JOIA 3WNJA 3NSDA 1PLAA 1SFDA 4KO6A 4KNTA 4DP6X 4ENZA 3PAZA 1ASOA 1NICA 2DYSB 4ZK8A 2YAQA 7PAZA 5I6PA 1T5KA 1V55B 2IWFA 1N68A 4A2EA 3QJVB 1FWXA 4GY4A 5D4JA 1DZ0A 5AFAA 3ZIYA 2HX9A 2YXWA 4A68A 4A2DA 1J9SA 1A65A 1GY2A 1ET7A 2VSKB 4HCIA 1PLCA 2EILB 2VN3A 2AANA 4JHUA 4BK5C 4PCYA 1YLBB 4AKQA 4F7KA 3NT0A 2VW4A 2P80D 2DV6A 1NINA 9PCYA
chains in the Genus database with same CATH superfamily
1J1OH 4EXPX 1BOGA 4EQ2A 3QEGL 4OIAA 3V0DA 4O4YH 2J73A 3MRHB 1ZK9A 5EZJA 1C8QA 4P8QA 3SZ6A 1BDYA 1U8KA 5I8OL 3WLWC 2Y5EA 2XJLA 1OQXA 3WOVA 5TD4A 1R5IB 3BWUC 3NESA 3QP3A 4XP6L 3I50H 2YARA 2E9BA 4MAUL 2H3KA 4OJAA 4IBWA 1JYWA 2OTWA 1XL4A 2RB8A 4D0CA 4MDJB 1E4XI 2G2RB 5F7DB 2BIIA 2NY5L 5DFAA 5GIRB 3QDGD 3EDFA 1KY7A 2OSXA 1OQOA 2Q76A 1JVLA 2NW3B 4UIMA 4Y9CA 4ZDHA 1EMTH 4XMKH 1AO7A 5JTWA 3WDJA 2H3XC 2KBGA 2V2XB 1A66A 4LBAA 1E3ZA 3D4YA 4PJ8B 4OCLC 1LP9A 1SMAA 1I8LA 1KT2B 1GZHA 3TJEL 2KZKA 4KROC 3QUKA 2NX5E 5IB1A 3G3LA 3RTQD 3U6XA 1YEDA 4ONHA 2A7BA 3UL4A 2F54B 3ZE1E 3UO1L 1HXMA 1OGPA 2Z93B 5D7KD 1A2YA 1ZDQA 4D0BB 2WO2B 2DEYX 3R1GL 4FG0A 1V7MH 1NBVL 1IE5A 1I1AD 4GKOA 2ICEC 4HEPG 5D4HA 1QMUA 4EKJA 2WINA 1OWWA 1GGYA 3PAYA 5TDNB 4PRPE 1NL0H 4PJDE 3UBXB 2JB6A 1WA1X 4YFLF 1D9KC 4XVJH 4BFNA 3JZ7A 3HJ0A 4G8GD 3F12A 4P4KB 3UTSD 4LCWB 3OXRB 2B1HH 3KWWA 4P5MA 2EVGA 3P30L 1JNLH 3MLVL 4JCWA 1W0YT 1SJEB 3QDMD 2IJ0C 5BPPA 3IB4A 2HLFD 4QXTA 5JR1H 5E8EB 4HIJB 5I30H 2Z6FA 1E9QA 4OIFA 1XCWA 1RXLA 2PYEB 3T4AC 4LOUD 1F90H 2B8OT 2O5NA 2C3VA 1UH2A 1RVFH 3FW6A 2XKNB 2X4RA 4LNRA 1JZFA 5F7LB 5AYTA 1QFUH 5GGSA 3TWCL 4R4NC 3KW8A 5I18H 1RU9H 3WFCH 4PP2A 2X2UA 2DQIH 2VISB 3Q2NA 4G7VL 4GYBA 2UXGA 3U0TA 2GTZA 4WTZG 4C4BA 3FQWA 2QZ5A 3QFJE 5IW3A 1BV8A 5ESVB 2XTJD 5TDPB 3I6GA 3FYEB 5E8DH 1Q72L 4DPCX 2J1KA 3PQYE 4HEME 3GUTA 2GQHA 2DOCA 3O3EA 1TVHB 3BDXA 5ERWA 1J5HA 4PW3A 4KMTH 3OV6A 2ZCHH 3V9CA 5BO1L 1W8OA 5KJ7E 3S97C 1GKEA 2QPUA 1ET8A 4HPYH 2NCMA 3KYOA 4AIZA 3MA9H 1PW3A 1P9MA 2FH6A 1F4HA 3NFSH 5HHMB 4GP4B 4AGPA 3LKPB 1ND0A 4J12A 3MRKB 4JRLA 4ISVB 4PM1A 3QORA 1RUAH 4Q4IA 1KJ3H 1D7CA 2O26U 4P2QE 2R69H 4MA1C 4ELKB 4HC1L 5A40E 4NSKB 4MD5B 4AW7A 3MRBA 3K81A 2YGPA 3LH8A 5AYQA 3KJ4C 1TSRA 2QJDA 1H3GA 3S9DB 2J2ZA 1U8MA 3FUEA 4U1SB 4HT1L 3HE6B 4ZYKB 3VDAA 4ZX6A 1BP3B 4TLUA 2BZ7A 3UACA 3RWEA 3BIBX 2YMXH 3EKCA 1VADB 3SB3A 1SXCA 3TT1H 3B2VH 4R90L 5FDWA 2R8SH 2VZSA 3N3EA 2UUDK 3EYOA 3VD9A 3OKEA 5J6GA 3QIUB 4QTIL 3BP4A 1WFUA 3MUGA 5AALA 1KEGL 1G9NC 5I6MA 1S78D 4L29B 1YYCA 1SEQL 1U6AL 1I9JH 1YEGH 4J5VA 2E5EA 2NYKA 2G9HA 4RH4A 1AGDA 2G60H 2ENPA 2VIRB 1MFBH 2H32H 3KBPA 1X5AA 4YHYB 1RPUA 2HUEA 5GZNA 4PB0H 3NSCA 5GRJH 4ZFGH 5FFLA 1T1ZA 1DN0B 1SYVB 1ZVYA 3BISA 5EC1B 3T3MF 3UIZA 1NAMA 4IU2B 3G5WA 1KYAA 4G72B 4L2LA 4LCUA 2MH4A 3DVNA 5FYKE 3TZVC 5LXGH 2VMCA 4MA3B 3C09C 1FZJA 1GL4B 4E0RA 1MHEB 2D4FA 4PCSA 5AWNL 3FKUS 2MCPH 4AVHA 2EIZB 3HR6A 5SWQB 5FGBA 4G6AD 5C09D 5HGDB 2P8LA 4I3GA 1AY1H 2DMHA 3MA7A 1WHOA 2UX6A 5CFHA 1IEBB 1JGEA 1NANH 3I84A 1I7RA 2AW2A 2I60L 4P2AA 5JOFA 3MRCA 3G9VA 2GABA 2TSBA 2Y0SA 4UV4H 2A6KB 1COBA 5C08E 1AE6H 3ULVF 1S3KH 1RJZB 2P4AB 5I1JH 2RTTA 3C6SB 3CXFA 1AS8A 2DBLH 4S1SL 1BM3H 5MENA 3C8KA 2DIBA 3SQBB 3E1F1 4EO5A 1URZA 4YHNA 3QR2A 2GJPA 5JIPA 5M94B 5F7DA 4FXGC 5E00A 4EDXB 1DCEA 2XN1A 4IBSA 4Y1AE 5GIRA 4GKNB 5CS7A 1HHHA 1B88A 2J72A 4AWJC 5DTFA 4DP5X 2NW2A 4MNGB 2V2XA 2H6UA 1AH1A 4ZI8A 1MVFA 2K3TA 2G0LA 2PNDA 4TQPA 3EF4A 4XBPB 4FQ2H 3X3FL 1T20B 2FX7L 5J57B 1MHPL 4GB9A 5I1GL 4WUUE 3HS9A 4K9EH 3RWJA 1A22B 4HBCH 4AYID 2F8VA 4HUKB 4L4VB 3RTQC 5I1LB 3SE3C 4NWTL 1JYNA 3OMNB 5E6YA 2RIKA 4BA8A 3MC0A 4D0BA 1TJGH 2DYPB 2VXVL 4XBGA 4S2SA 1F18A 5E2VH 4FL4B 5C0AE 3PPEA 1JGUH 1I1AC 2RGSA 5KVGH 3ERXA 4NQEA 3LXCA 3GBLA 1NM9A 4OZGF 3G6DH 5ITBL 2H1PL 5AZEL 3UBXA 1OAXH 2Y36H 5CUSL 3D09A 4UQIM 4LCWA 1YSOA 3NN8B 3OXRA 3ZHNA 4KKZA 5I16B 3BW9B 4HWZB 4R6UA 2LU4A 1EXUB 4XN9A 4RBPK 3VGFA 1BYPA 4M03A 1V3KA 1CWVA 2AXFA 5BRPA 1EGJH 4LOUC 3MZTA 2QVTA 5G4OA 5JHDB 3UPRA 2VDNH 3MOBL 1TQTA 2EDLA 5CP3A 3VI4A 1U92B 4OGAD 5IVOA 1X4ZA 3R0NA 1DBJH 4CVZA 4JM4L 5F89A 3ABGA 1JZGA 1DQQB 1K4CA 2BZCA 2VXSL 1TJXA 1A14L 1IKOP 3EUUA 4Z7WE 1WZLA 2XTJC 4TUKH 1H15A 1H0DB 2VC2H 1YPZA 1WC7B 3DX0A 5LGHL 2X6UA 2VQUA 1E27A 3HMXA 3VFUA 1NGZB 3B9AA 4IBVA 4WUKL 2I69A 5GRUL 1UD2A 1T1XA 2YKKA 4E2OA 3MMEB 3S36H 1INEH 2BS9A 2BVQA 1ZMYA 3MRKA 1ZA6B 3G6AB 2J8HA 3IS1X 2YR3A 4ISVA 1VPOL 2HFFA 3GSNA 3BN9D 1IC0A 5I5RA 3RYMA 4BV1A 4RVBA 4OQTA 5LGJB 4J3SA 4U1KA 4PHZA 3ZKXC 4MD5A 4RAHA 1X5GA 2N3JA 2EVJA 2AJVH 1SVBA 1T7XA 4ZOAA 2NZIA 4MNQD 3WFBH 5CEZL 4Z95H 4HUXA 3QZLA 4HJUA 3HRZC 5F3BB 1RUPL 2HCZX 3VFRB 2NY4D 2CA4A 3CDYA 5TQ0H 5DQ9A 2P26A 5SX4H 1VADA 2K6YA 1UM4H 4KVNH 1E5BA 2MHAB 4JS7A 2QVKA 4TVPH 5DD0L 3TU6A 4BZ2H 1DEDA 4J39A 4ODHH 5KAQG 1J1XL 4MAYD 5FW7A 1KTDA 1RZ7L 3MRPA 4CADA 1M4KA 4X6EB 5CM1A 2FT6A 4I48A 5D7JA 5DJ2A 1V05A 1HH9A 2Y3AA 1FRGL 5DRWA 5CZVL 1WK0A 3HE7B 4P06A 1X7TA 1S78C 1GPOL 2ZF9A 2VDLH 5F1NB 1NFKA 3OQRA 3QNYB 3GK8L 4N90D 4DP8X 3OAZK 3SE9L 2X7LA 5FKPA 5I1CL 2R4SH 3MYJB 1N4XH 3O9WB 2LLLA 4KPHH 3APFA 3GEWB 4UWQB 3EH3B 2EYTA 3UJTH 1DN0A 1NIEA 1HZKA 2CLRA 4IU2A 3CLFL 3R06A 1UUNA 4HK0B 5KSAD 1N5AA 43CAB 1JWUA 4CW1A 4JGNA 4WY7H 3KCPB 2ZTBA 2I32A 2BWQA 1Q0XL 2FZ3A 2WCGA 4LL1A 4MA3A 4KHTH 1QSVA 3CH1A 4HKZB 1CDHA 1HL8A 3RIAK 3DOSB 1NEZB 2ZOOA 2HJKB 3FOMB 3VUAA 2IMMA 1K8IA 3H55A 3B1TA 1UWGH 1LNUB 3DRQB 3FQ1A 3MV7B 4G6AC 3LKNB 4HJGB 1HHGB 2K78A 2HLAA 1BIHA 1J8KA 2TRYA 5ICZB 1SJHB 2A3TA 2D7MA 4AQ1C 1RHHB 2NQDA 2BIMA 3BAEL 4IOFD 4JW3A 4GI9A 2ITEA 1XCTA 2VL5B 3BWSA 2A6KA 3VXUE 2Z65C 1P5VB 2C3HA 3ARPA 4QRRA 1WJ3A 4WHDA 2WWOA 3L08A 4K7PX 4Y2DD 5DJCA 1LHZA 2NY1D 3KPTA 3S4SA 3BZFB 4M7LT 4YZWA 5EOQH 1CD1A 1LWJA 4U1NA 4DVBA 4EDXA 3RZCD 4M8UA 3R8QA 5FF6B 4PJ9D 4ZTPH 4E9LA 1UUSA 2R56H 3KR3L 4S1RL 4JZNA 2XQBL 4D9LL 4PCYA 2C8NA 3OSKA 4RGOL 2IXQA 4WVRA 2KS0A 2C7FA 3T1FA 4YHMH 4URTB 4XBPA 1HL9A 2NYZA 3KS0H 1FE8H 3LVTA 1U33A 3G7TA 4PGZA 4NQCE 2HFEA 3CFCL 4G82A 2D4DA 2OTUA 1TQSA 3QSKB 4BFEA 2NY7H 4XMVA 1FZMB 2XZAL 1GC1L 5DO2D 4UT6A 4KDWA 3ABMB 4FKKA 5ACZB 1G7QA 4BWUA 2DYPA 4L8CA 4G1MA 2H6PB 5JOPE 3D85A 1FVCA 3BZ4A 4NZRH 4Z7UA 4G8EB 1XV8A 2F5BL 4G6MH 4AMKH 1UM5L 3G6JB 2AK4E 4TPRL 3C08L 3VQ2C 1NCDH 2YOAA 4IS6A 4X7TA 4MHHG 5HDBB 3FFCB 5E1IA 4YX2H 3CFKB 5D1ZD 5B8CB 1RZJH 5EU6A 5EV7A 2W1NA 2V2TB 4K3EH 1KPUA 3F58H 4G6JL 4LSRL 2Q7YA 3V8CA 5I16A 4HWZA 2BP8A 3IRZA 2IF7A 1CDGA 3RIFK 2PLTA 3LMJH 2C3XA 3OXSB 4QRBA 3I3EA 1QEXA 2EO7A 3L3DA 2OMTB 2DLEA 2QSQA 2QSCH 2ILLA 2Z35B 3L17A 2FQEA 3AXLB 1EZVX 4MJ5B 1A9BA 3HHRB 1MF2H 2APVA 1O9ZA 1V10A 5E9DE 4PJAB 1ZVSA 1LD9A 5BW7A 5E94A 1PZ5B 2IV8A 4U4IA 4ZPTB 3BT2L 4QXWA 4OGAC 5DJZA 4QYAA 1JMZA 3MO1A 3MGAA 4ZUTA 1A7BA 1B4JL 3ZKMC 4TVPD 1VGEL 1OT2A 1RZPA 4IW4C 1ZLUH 2G2PA 4UINL 5SWSE 1IGIL 3ELAT 3WMSA 1A7OL 1WBZA 1QR1B 2CHNA 2WB1A 3K72B 3AU0A 1QFWL 1Z3GL 4RQQB 5JORB 1ED3B 1S2EA 5DEJA 1NGZA 2MIZA 2XN9D 2PWFA 4I2XE 1JERA 3BVXA 4JY5L 2BVUA 3DOHA 1F58L 2FX8L 4GRWH 5I8OH 2PTTB 3G6AA 4Z3TA 3IDIB 5MERB 4XP6H 1BWMA 3GS4A 4JY4A 4X80H 2KLTA 3ULUF 4MAUH 2OMZB 3BN9C 3NIGB 3STZB 2BSBA 3VA2C 5LGJA 3P3YA 5J9PA 2E9JA 4UIKL 4IBUA 4NNXA 2YEZA 4J3XA 4CNIA 1XH3A 2ZICA 3L2NA 4I1RA 3K91A 3S34H 2DWEA 1MCPL 1X5IA 2PPAA 2E7CA 3IT8D 3TBYA 3WL9B 4AVJA 5KSBA 3BAKA 4J2QA 1CTOA 2ZSWB 4B53A 1RIHL 2NY4C 1URLA 1BF2A 1CXFA 5HDOA 5C0CA 4JPWL 2DM2A 2MHAA 4KMQA 3OR6B 4WHCA 1PMYA 1E9PB 1HCFX 3N44F 2Y1VA 4HPHA 2NY3B 3TA3B 4MAYC 3QW9A 4XPTH 3ZTEA 4JVWA 3CLEL 5C70A 1GOHA 4XNAA 3F5WB 1MHCA 3FN0H 1VEOA 2OPCA 1XH0A 1GOGA 3GIZL 3M17B 4WWPA 1IBDA 3QNYA 5HHOE 5I5MA 3E3QE 2R39A 3MYJA 5D7KE 3TYFA 1FO0A 2KYIA 1EXHA 1HINL 3PABB 4WSKA 2XTSA 5KVFL 5EFIB 2CK0L 3VWJA 1FIGL 1T2QL 3P30H 3GBNL 3CZUB 2BSTB 5KSAC 2XG5A 3WY3A 4PJGA 3KHOA 3UCRA 1SQMA 4G8GE 4RETB 1VZHA 4YJZL 2P5WD 3BGFC 4EN3B 4K9EC 1NEZA 1VACB 2WAQA 1NWPA 2YKLH 1IGYB 1UZGA 4TSBL 1RZKL 5GGRB 5C0GA 1TG8A 5G5DB 3CK0L 4Y5VB 4WF7A 3DRQA 3TWCH 1OEZW 4ONGH 5SWZE 4NO0A 1RP9A 3L2LA 3L4CA 1XL6A 4A1RA 1DQTA 2VMJA 2I9LA 3V55A 5ICZA 2DYRB 4DGWC 5AZ2L 1ASQA 5ICUA 2PR9A 4M7ZB 1RHHA 1R1CA 4JFYA 4L0ZA 5DQDL 1RZ8B 2VL5A 1OF2B 2B7DT 5BO1H 5F7AA 4AVKA 3WN5A 1RFDH 4QYOA 1YNTF 2B3IA 4EIZC 2NY1C 1JK9A 2XTJE 4L4TD 4ZMZA 3ULVE 1W8NA 2YAFA 1YUHB 1X9QA 4NPJA 3EO1B 5IJKA 3RZCC 1EHNA 4PJ9C 2PP7A 4N0FB 1NH6A 4KZEL 4UUJA 4XRCB 2X89D 1BFSA 2BDNL 4U49A 1MJ8L 4UM9A 3UDWA 4GG6A 5JQ6H 2MFNA 4BKLB 5IVXB 3QHFL 4H0IA 4HC1H 4PVLA 4U2YA 3QS3A 4IGBB 4OH2A 2P80A 3U7YH 2Z31C 5ESAA 1E5ZA 4Q52A 3VXMD 4I7ZC 3WJMA 3V4VH 1OPGL 4KZDL 3UJIL 3S5LB 3DETC 4G9DA 1FUNA 3AG4B 5DO2C 1N64L 5ACZA 4HT1H 1BJ8A 1Q94B 3IKKA 1OGTA 3POHA 2BRRH 1ZV2A 3K6SB 5GRVK 1XAUA 1J7VR 1DSWA 2WXHA 3GSWB 4G59C 3ZT5A 1XIWA 4L48A 3QB7C 3FFCA 4PTTB 2EYSA 4QTIH 3ASWA 2YXMA 3OHXA 4X7CC 5DMGC 2WNWA 4QWWD 2D7PA 3CFNA 4A7TA 3H3KA 4ZMWA 1E5YA 4O02A 4HALA 5L8LB 5EO9B 4JO2L 4LEBA 4Z7VB 2AVGA 4HLZG 1ZT1B 4FZEL 3LNFA 3QPKA 2Z35A 3FQNB 4IHBA 4A6YB 1KB5H 3VVWA 3WKML 4MJ5A 2Q8AH 3R4DA 2OL3B 3DJSA 2DTSA 4JB9L 2AEIT 3ET9F 3CZEA 4LXFA 3UAFA 2C4FU 4IMLA 4LAQL 4HFUH 1UB5A 4JRXA 4ZPTA 3RB7A 3TF4A 4G83A 2F8XC 5F7YC 3BVNB 1KYOK 4JFFD 4KOBA 2NLJB 2V5YA 4A2MA 5E2UL 3ZIMA 4EI6A 1IFHL 3ECBA 1R3KA 3NPSB 4UOJA 4U1MA 1I85C 4YZFE 3AMKA 3MBWB 5I75B 5C0RL 4U6TA 1QR1A 3TF7C 1ILSA 3FUKA 2WUBH 4DGIL 4XC3L 1T5XB 3MLPA 4U6HB 1CBVH 3WEOA 4RA0C 4U7MA 5CEYA 4KC3B 4NI3A 1B2YA 1AGEA 2I60H 3ZO0A 3UBXG 3QEQB 3BQVA 3II1A 4TYUA 5FYJL 3ZL4H 4JJHA 2HG5A 2JELL 3N06B 1IAIH 4RLDA 4OV5A 1WTGT 3AW5A 3Q05A 5MERA 3HTLX 2AZAA 4LCIL 3I6SA 3QA3A 4WO4D 1TEFA 3ZXAC 3STZA 3LKOB 5BRZE 3D7PA 1KDIA 3Q1SL 3LVEA 3PJSB 4BSWB 1QNZL 1R47A 1U91B 2PO6A 4LP8A 3PWJB 3FF8A 1SY6H 3W82A 3RPIA 4GUCA 4L1DA 3S6CA 5LNDA 3IDXH 4DO5A 5LQBL 4MJHA 1E4HA 1ZSDB 2X41A 4FJ6A 4LSVH 1UCBL 4CSSA 3A67L 1DANT 3QG6A 4U31A 1T4KA 4JEGB 4XO5A 3VI3B 2IGFH 3PFUA 2W9EL 3QJOA 5GRVL 2KQNA 3UEQA 5I1GH 1BFOB 3UTOA 1NGWB 3MRRA 4P46D 4IHOA 2DQUH 4RISH 3KPLA 1OCCB 4NWTH 2XN2A 4I87A 1JHKL 1KCKA 2ZYSA 2VDKH 4YHIB 5FV2A 1IC4L 3HI5L 5EWIH 3TBSA 3GXMA 4E9WA 4TLKA 4RWYL 4PJFE 3KZ8A 1KELL 1IEAB 3DX6B 3WY2A 5AB2A 3M17A 4Y19D 4KRLB 4YXLL 1E3FA 2YBGA 2H1PH 3ISWA 4UNVA 3EGXA 3IE4A 3ZYZA 3GSQB 5CINH 1EO8H 4FEIA 3VE0B 5CCKL 2ODHA 3N42B 5IBTL 5F9WB 2J1XA 4GRWF 3V6FB 3ZL2A 2PXYB 2Q2EB 1DVZA 1SHXA 2FT8A 3GZKA 1EWHA 1QPXA 5F0PB 5JXEC 4KKLD 1X5XA 4B9IA 4NAJA 2DI7A 3OLGA 1DQDH 5B39A 3N1MC 1BMWA 1IGJB 4Y4KB 5IUCA 5ALBL 2W0LA 3W0WB 2CO6B 1D3CA 4H13C 3U48A 3MOBH 2DQHL 3KEHA 4BE6A 4XMLL 3Q3GA 4FA7B 4YC2C 4JM4H 3FB6B 4GKLA 5IG7B 3QQ4A 1XB3A 4OLUL 3MGOB 3PS6A 1AZZC 3GMNA 4E9RA 1GA2A 1A14H 2O72A 1AZCA 3KWXA 4RRPA 4WDIB 4B9ZA 1RZJC 4L3CB 1TPXB 1C9SA 1OF2A 4XHJD 1JN6B 3CVDA 3MSPA 3OKLB 3HG1A 3MFFB 1TTFA 4YMPA 1WAEA 2ZKHL 3EJRA 4NAMA 3TP4A 4GW5B 1P4UA 1UT1A 3H2QA 1JXDA 3GDBA 1KXHA 5GRUH 4L8DB 3OAYK 1YUHA 3HS8A 3ZE2B 4RFNB 4ZXBC 5T5FA 5KBKA 5DUPH 1FAIL 1BPLB 5J4MA 1VPOH 3AWFA 3KBEA 3QDJB 4Z7OE 1HJBC 4YVNA 4H20H 3SDCD 1T1WA 4W9KC 3NCYP 3OWEA 3PFQA 4NLAA 3K6DA 3ZUCA 2V7NB 4RAVA 1HKFA 4R3SB 1A1OB 3R7RA 1UOWA 1E42A 1Y1DA 2GUYA 4R2GB 5T1LB 5CN2A 1K72A 1OLZA 4YDNA 3REWB 3TO4D 5KYXA 1VKXB 5CEZH 3MRQB 4F7TA 5IESL 5IEKA 1K4DA 1SFDA 4DP6X 3EOTH 5FHBH 1ASOA 2D7TL 3BPLC 3A5VA 3GT6A 2YEQA 5I6PA 3QIWA 2WJ5A 3MRDA 1QRNA 1D6VH 4MCYB 4I89A 4MNQE 1A4JA 3B9KB 1LE5A 4NX0A 1RZ7H 4PTTA 3L9EA 5GJTL 1MI5D 1QUPA 3O6FA 1FFNB 1CZ8L 1ET7A 1KLUB 1QSED 1RD6A 2EE0A 3KS0J 1RIUH 4QWWC 5CZVH 5DRZA 4ZW6A 4BK5A 2EIBA 5I1IL 5DA0B 1E2WA 2TAAA 3TVMD 5J3HD 5EO9A 4JDTH 3S4SG 4Z7VA 2SEBB 3S48A 1EAPB 2W9LA 5D2NA 3NOIA 1P4IL 2WXFA 4TUOB 3FQNA 5GGVH 5I1CH 4A6YA 1VDGA 1ZLEA 4WW2A 3Q6FB 1L0PA 3ZYJA 2EE3A 2CBPA 2R0WL 4YSEA 4YDMA 4OJCA 4G9FB 4I0PB 1IGFL 1JDAA 4ODUB 4OSUL 1Q0XH 1UWFA 3GBDA 3D39E 5E4EC 1LEIB 4X4XB 5EIVA 3STBA 4L0PB 1B9ZA 3QULB 2W91A 1N6VA 3MQIA 2A9BA 1RKRA 3HLAB 3VXRB 3DGGA 3MX0A 1GGCH 1EHLL 1TMQA 4MA7L 2VWEC 3QIBB 3EGDA 1JFHA 3BZDA 3B3BA 1T5XA 1UKSA 2H2PD 2ZWYA 3L3OC 3VQLA 4AQZA 3MKGA 4DKAA 1G7JA 2V17L 4GQQA 2LGNA 5J6SA 4PUBL 3BAEH 3DPBA 1WZKA 2I9TA 5DDHA 4ZAKA 1ID2A 5KVGE 2BFVL 4PJ5B 1CBJA 2YK1H 4GSDL 4NCC2 4F2ME 3CN3A 2QKIC 3C6LA 5JPMB 2ESVD 5KUMA 1HOCA 4WO4C 4KKPA 4X4MA 1A4CA 2EXSA 1KLFA 4N5ED 4BSWA 2YUXA 3OKOB 3TBVA 3ROOA 5ITFA 2J44A 3F6IA 4JGMA 4RMWA 4DN3L 4OF6A 3KR3H 3FN3A 2VITA 4D9LH 1ZRUA 4W9ZA 5D7SL 5F3FA 3SJVA 2AAAA 2PWEA 1KN2L 3VRIA 4RGOH 1WA0X 3DSNA 3FU7B 4EIGB 3QQDB 3GIVB 1A7RL 3IMBA 2J3SA 1UZ6F 5K1VA 1A4KA 4PWIA 1NGWA 3BQUD 1EEZA 4P46C 2D2CC 1RK0A 1GC1H 5D1QB 4AM0B 4OI7A 3U9WA 2XVLA 3DX7A 2BOBA 4HCFA 4P2RA 2H1LM 3K5RA 1EHKB 3T0EA 1ZS2A 1BHGA 4OM0L 1UM5H 2AQSA 1RK7A 4YHPB 3ZPDA 1Q9OB 2PYFB 1MPAH 3CFEA 3FU3A 5I74B 4CMHB 3BCFA 3IJ9A 2O4EA 3K74B 3O6KH 4HIHB 4XOEA 4G6JH 2G3ZA 4LSRH 2OX5B 1PZ2A 4FTVB 4P07A 5EO0A 4YN3A 3WNLA 3FTGA 3ZDZB 4CVWA 1MCQA 3TPUA 5EPMA 2EC9T 2UZXB 3LH9A 2FR4B 3U6XS 4FULA 1B0GA 1ICTA 5T3XH 2CO6A 3P9MA 1OP4A 5CEZD 4Z6AT 2DICA 5F3HB 1KV7A 5A1AA 2NXYB 2VN7A 3RJOA 4FN0A 3BLPX 3E0GA 3U4KA 2FB4L 1VGEH 5KVEL 3LAFA 1GGBL 4EZJA 4JRYA 5JPNC 2DZEA 4JFUA 3Q1EA 4WDIA 4L3CA 5J6HA 3FOLB 4XPGH 1A7OH 3BH9A 2K8QA 4YIQB 3WD5H 4WWKB 4JM2D 4ALAL 2P47B 5DHVH 1Q0YL 1WIUA 1QFWH 1Z3GH 3TH2T 2JJSC 1LDPL 1M9WA 3D4CA 3MCG1 4GW5A 1INDL 3HC0B 3HNSL 3UG4A 4OM1L 1BGXL 1S9YA 3JTSA 3S36X 3X13A 4IRSA 5EB9A 1FPTL 2FBJH 3QJFB 1NJ9A 4PVMA 5F0JB 2IBGA 4PFEA 1L7IH 2R15A 3CVBA 1IL1A 1FO0L 5CMAB 4LRNL 3SDCC 3BVTA 1FFRA 4PJHA 1RSFA 1HSBB 3EOBB 4H1LA 1PG7H 2W0PA 4UIKH 4R3SA 3CXHK 3NVQA 2O5YH 1YO4A 3D2UA 5DYFA 5T1KA 5K33A 5IQ7L 3K2KA 1YRKA 1NEZG 3FT4A 1MCPH 4BDVA 5KBDA 1RIVL 1VESA 4S0SD 5FYLH 1DJXA 3TO4C 2VN6A 1Z7JA 4N86A 4JZJB 5EU4B 3L5WB 1RIHH 4F7PA 1XCQB 1G0YR 3SY6A 1TVBA 1Y6KR 1SM3L 4Q7DA 1G7MA 2EDHA 1DDHB 4DFHA 1ETZB 1FYTB 4F9PC 2H6OA 2YAOA 5BMFL 2VOTA 4PLJD 1G6RB 2GSGA 2LT9A 4Y4HA 1G7IA 1CFNA 4PY8J 4JVPA 3UH8A 1U8JA 3G08B 4YGVA 4ZUWB 4TSAH 3TVMC 4Z3FA 1E7UA 5LB1A 5J3HC 4FABL 2FSEA 2X88A 1O7DE 4TUOA 1QI4A 2P8MB 3ECQA 3ARGD 1HINH 1YNKH 2XWBA 3Q6FA 4LLYA 2CK0H 3C12A 5L2KD 2WQRA 1I8IB 3QPQD 1T2QH 1WBXA 3ARDB 5D1XC 4XCFH 2AC0A 4IBZA 4M56A 4YLQT 4I0PA 4MZRA 3DUSB 4AK2A 4XO8A 1LEIA 4WK4B 1NM4A 1P7KB 3BDBA 1PGRB 1TR7A 1N8ZB 5GSVA 4LPTA 3QZWA 4G42B 3GQFA 1RZKH 3S88L 4ILDA 5C0BE 2NR6A 3IDJA 1DBAL 3CK0H 4IBTA 4M62H 2EH7H 2VZVA 4AGMA 1UD6A 1UG9A 5L0QC 1AANA 1JD9A 4JCLA 4PJEE 3CDZB 3N43B 4OB5L 3RWGA 1DE4B 5C0IA 2P5WE 1A3LL 2UWEE 2ZWSA 2XQYA 2Y7QB 4GW4B 4WV1C 2H2PC 1KYFA 2QQQA 3L3GA 4RIRB 1FNEB 3DA0A 3RDTC 5EU5B 4RFOH 4UTBA 4XNZB 5IM7B 3SDDB 4Y9GA 8PAZA 1VERA 5ID0B 4FNLL 4ZUSB 1MQ8A 2JTYA 3PHQB 3PWPB 5HY9B 5IFJA 4X5WB 5KG9B 4M93C 2WLHA 4FHKA 3VAEA 3MJWA 4N5EC 3V4UH 3CDCA 5T3XD 1F11A 3GHEL 1VAHA 1M2VB 2VM4A 3GJFB 3E8UH 1WRFA 2NX5B 1MJ8H 4NT6B 3MGTA 4U1LB 2CRYA 2X70B 4TQEH 4M7JH 1DQIA 4S10A 3VD3A 3GIVA 2BVOB 2IG2L 3LNEA 3QHFH 1V3JA 1U95B 1NAMH 4XNXL 3ZE1B 4QHNA 1AO7D 2FWOA 4D0DA 3CNKA 1WAPA 4P0DA 1DO5A 3FB5A 1OPGH 1A64A 3BQUC 3HG4A 1ORSA 4PG2A 3UJIH 2H0PA 4J8RB 1N64H 5HGAB 1IVTA 2N1KA 3TN0D 4PRPB 4KTEL 5A6LA 4PJDB 3C2SA 3ZZQA 2ALAA 3RHWK 1CDYA 4LP4A 3VXME 4YHOL 2YZ8A 3PUCA 4XBEL 2NDGA 4CSZA 5DS8A 1Q9OA 3PGDA 1W0WB 4N0YL 4DKDC 4PIRF 2JE8A 4AZ8B 1PJ9A 2HVJB 4JQVC 2JQMA 5J1SC 5BS0A 3DMMA 5CJOH 3VXQB 3UZQB 4KX8A 1TVDA 3QYMA 3BEWA 4C59B 4LRIA 1B4RA 1L6ZA 2CDEB 3O3AA 5AG8A 1UA6L 4JO2H 3BOVA 2WZ5A 1G4MA 3VFMB 4YO0B 2WXRA 4GRWE 4P9HL 3WKMH 4OD1H 2FR4A 4JB9H 3MUJA 2VAAA 3MCKA 1AI1H 4PV9B 1OHZA 4HLZH 1BF8A 4HJJL 4LAQH 3GNMH 5BQDA 2HVKB 3QAZC 4HHWA 2Y25A 3QFJB 3MVSA 3ZE2E 5E2UH 3PQYB 3GWJA 1XZ0A 3N0AA 4AV5A 1PYWB 5I8EA 1BECA 1WD9A 3BFOA 3HG3A 1ZANL 4WEUD 4Z7QE 3SGJC 4LIQL 3OF6A 4Z7NF 5INCB 3NP4A 4APQC 4KO9A 4OBRA 2XBZA 2VQ4A 2FO4B 4Z5RA 3WIIL 1NLBL 4XOBA 2R4RL 2BCMA 3NA4A 3O4OB 1J87A 3VGAC 5TF1H 3L1FA 4PJCF 1TJHH 4JM2C 1OGAE 4UQ3A 4XC3H 2CRZA 2QVFB 4DIXA 4F91B 4JREB 2CLZA 5D7HA 1ZS8B 1DN2A 2AFNA 3DRTB 4HH8A 3L3KB 1NMCB 4P2QB 2JJTC 2MSPA 1B4LA 4CSTA 3AG3B 2D31A 3GMQA 3IMRA 1OP5K 4MRBA 1HL4A 4WNSA 4TLSA 3HHMA 2OMVB 1U8HB 2FJFB 5LAXB 3ZDXF 3UROR 3I75A 4YDLB 3WMPA 5L88L 2X4SB 3EOBA 1QNZH 4PRNB 2F1AA 1TIUA 3ILDA 1WAAA 4CGTA 4C56B 2VSMB 4U1IB 3UZEC 5DJ6A 2YFOA 3QXDB 1BQKA 2Z7UA 5F88B 1XR9B 2VL4A 5LQBH 3TONA 4HF5L 1UASA 1CFQA 4GXUN 3A0OA 3A67H 1AG0A 2VXTL 2MQ0A 3SE4A 1XCQA 1F6AA 5FO8B 1DZBA 2HKHL 2P3YA 1HYSD 4HV8A 4E9TA 3L6FA 4GAGH 3KXFA 2OCCB 3GLEA 2VJXA 3LSOB 4X5PA 4HH9B 4V1DA 3S98A 1EFQA 2NY2D 4IIQB 3VGBA 5IB3A 1JHKH 2A74C 4Y9BA 3B6SA 4FP8L 1PQZA 3ULAB 3HI5H 4Z3GA 3V0IA 3C9NB 4PLJC 5EBLA 3DOIA 1KELH 4ANWA 1KMGA 1MY5A 3G08A 3D08A 4L9LA 4ZUWA 3OKMB 3KDPB 4XAWL 3MJ9A 3EYQD 2F0CA 4F5CA 2CJTA 2YS4A 5CCKH 3ARGC 3HMXH 1I8IA 2N59A 3BPOB 1GS7A 1XGYL 1KOAA 1HX0A 4AKOA 5GZND 4ENZA 1JNHB 3LEYL 4WFFE 3UAJC 3C5JB 5T5FL 4WU7A 1P7KA 2EH8L 3GSNH 3V95A 1UWXK 3IDYC 1DUYB 1NCCL 4OQTH 5EDXA 5E6SB 2QQLL 3BXNB 1DZ0A 4LEEA 5AFAA 1XXDC 2NSXA 1GC1C 1RJLB 1KSRA 2DQHH 1FYHB 4LSDA 4JAMB 3PV6A 4XO9A 3RILA 3T4YB 4NRYB 4XMLH 5HJ3B 1DE4A 3QVAA 4Q14A 4YDIH 3VYOA 5E23A 1MLCA 1ZGLM 1XCXA 4I1PA 4AEHL 1TF4A 3OAUH 4HKJB 5JMRA 1LK3L 2VZOA 2IPUK 1JGDB 4YGAB 4ZRGA 3BCDA 4BIKA 3MV8B 3G5XB 2AK1L 2F9BT 3ZDYE 2EXWD 2AXGB 3EBHA 2H26B 1JXJA 3CHSA 4FERA 2VR8A 3GGWB 4Y1AB 2ZKHH 3KPSE 1FH2A 3GTVA 4HK3J 2R1WB 3B2XA 2WOYA 4D9RD 1SEBB 5MEND 4NUMA 3GKWH 2AJZB 1QSFE 1NBQA 1R5WA 3ZHFA 2BY2A 1QBLH 2AHIA 5DYOB 4FQIH 1TMCB 4WUUB 4A6YL 1SLVA 2CDFA 2NX5A 4MB4A 4NT6A 1Q9LB 2GEEA 4JRFA 1X5ZA 3D51A 5DJYB 1U95A 3IYLW 1JXFA 3AUVA 1A7QL 3WKPA 2BSCA 4CUCA 5CSZB 1WZ1H 4HX1B 5C0AB 2MKWA 4ENED 2DMGA 4P04A 2FQGA 3QCUH 5EZLB 4E9XA 1E4WL 3UTTB 3LEXA 1I8LC 1GZHC 5J8OA 5LNGA 4IBYA 1TKWB 4UDUA 3T77B 2F54D 3T6XA 1Z6JT 5DRNB 1JUFB 2DBJA 5CBAB 3D05A 4S0TD 3JSSA 3MCLL 3ATDA 2NUTB 4NN6B 4AZ8A 5FYJD 5A2KH 1DHKA 4NQED 2ZNXA 3VXQA 1S7QB 2LE9A 3QC6X 2ZSVB 5AOJA 2BHFA 4KAQL 4ZSOE 1BMZA 1MG2C 1PD6A 3EO0B 1ZHKB 1I8AA 2CGRH 4A7GA 1UJ3B 2LLGA 3OAWA 4YO0A 1I3UA 4LCWD 1MI5E 3EBGA 4DKEH 3MRMB 3HBPA 4BWWA 3D2TA 4MJIA 5IW6A 3FO9B 3QRFM 2QHRH 4AQAA 3NJJA 1YMME 3BKYL 1JJUA 2X1QA 5E6RB 2F1EA 2HVKA 2Z1PA 1IGFH 1N19A 2FYVA 3D0AA 3GSXA 2K8MA 4HEMA 4NO3B 4Y7OC 3KCWA 2O93L 1PYWA 1WCBB 1N5YL 1Y6NR 5D1XE 1AXTL 4I8DA 2O6FA 4Z78B 2X53A 1RV6X 3P73A 3MRIA 1UYWH 3CDFA 5KJ4A 1TNMA 2YC1A 4MXWL 4C58B 1NC2A 1YC8A 3NSYA 3BH8A 3MV9B 4UT6H 4F15B 4NZJA 2V17H 5I19H 1X3DA 2XXGA 5HHXH 4PR5B 3W5MA 3K6OA 5LN8A 4OQ1A 1KB9K 1S7TA 2Q20A 4N4YB 1JV2A 5EEWA 5AYUL 3WTSA 5D7IF 4G2AA 4GSDH 4JFQA 5LBSA 4GO8A 4PV8A 5AENA 4F92B 2BHUA 3GJEB 1P9MC 1O5DT 3ATFA 4I1NB 2CUHA 4Y7MA 5G4MA 2JF1A 4ES8A 5KS9E 4PBXA 4X5XB 5DC4B 4PRNA 2QKSA 3QORC 2FJHB 2NQ3A 5JIQA 1MKFA 4DN3H 3EYSL 1RZKC 3FU0A 2ESVE 2CJ3A 5I1AB 2HTLD 5IEHB 3ARBA 4XZUA 4L8BB 4I3RL 1MAMH 3DV6B 4LOFA 4BJLA 3Q13A 5CJXA 3M1CA 1Y0LA 2EDOA 2BLFA 3OGCB 5E08L 1J12A 4DZBB 1HH6B 1U8QA 3U4AA 4YPGB 2LAGB 1Z9SB 1HYSC 4KDVA 2CBTA 4I77H 4KROB 1KBGL 2HZHA 3V0WL 4AZUA 1ML0A 3U25A 4FQHA 1QA9A 2EC8A 3DX4A 4OUOA 1BZ9B 2NY2C 2RQ8A 4HGWB 1IAMA 4L18A 1S7WA 2HMID 3COOA 1F97A 3R0MA 3FN9A 4ATWA 4WW1B 3A6BL 4OM0H 3CC5B 5C86A 1MOEA 1F3JB 4N2GA 2ICEB 3OKMA 5D7JD 4JUSA 1E40A 2A9ML 1OAZH 3ES6A 3QZBA 4UQ2A 5DF0A 3GI8L 3ZN6A 3EYQC 2GAZA 1O6SB 4K2UL 3CFJB 4CMMB 1UH4A 2GIYA 5EF3A 3SZKC 2XX0A 1D9KB 1TQCC 1YCSA 5E5MA 5FDYA 3EJSA 5CU5A 1ZLDA 1XHHA 3WFZA 3ZZSA 5GS0L 1CQYA 1XMEB 1Q9WA 3D8MA 1JNHA 1QW8A 4JJ5B 5GZNC 1RZFL 2ZX5A 3F7LA 4JY6B 4H1LG 4K3JL 3S35L 1K5WA 1SLWA 2DQTL 1XSIA 3NIDB 3PIQB 4YDKH 1FNAA 1X4YA 5FKAA 3BP6B 2CKBA 3R18A 4N8CH 3T4AB 3VFOA 3BXNA 4LDEB 3MDJA 3V4PB 2X9WA 3SO3C 2X4OA 4V2CB 3WXVH 3T4YA 1G1KA 4NI6A 1B0RA 4NRYA 4FMFA 4YBQC 5HJ3A 4GBXA 1FH5L 2CHZA 1HCYA 2F19L 3VXUB 5C08A 2FB4H 5F9DC 5FGBC 3PV7A 2BVTA 1GGBH 1PNDA 1U2CA 1QLFB 4FI7A 2D8KA 2IDCA 3WTVA 2IH3B 3C8HA 2Z91B 1ZJBA 1KTLB 2AXGA 1Q0YH 3APNA 1U3JA 2EXWC 5IMKA 3FQRA 3DHMA 3GGWA 4JPKL 3VYPA 5A43C 3VXOA 2CIKB 1LDPH 3AG2B 3ZTCC 4FXKA 3FU8A 4J3VA 5L9DL 1BGXH 4QRRD 3BO8A 3V7AG 1M71B 4J3OG 2LQRA 3FONA 4NQXB 4C4KT 8FABA 1V27A 2LVCA 2V0AA 1SBSH 3V4LA 5IVNA 3IDUA 4RMBA 1U8OB 3OG6B 4BCYA 1N7ML 1YEFL 2APBA 2ARWA 4NQCB 4XPFH 3WMQA 3FQTA 4R97C 1FO0H 4M1GH 5J89A 4LRNH 1FGVL 2VXQH 5AB0A 1KIQA 2XV2A 3UTPE 5DZLA 5DJYA 4MA1B 4RDBA 4KTDL 4AYMC 3F7YA 4Y8AA 1V3MA 2VLKE 3SKJL 2BNRE 4HS8L 2XC8A 2WMPB 3QJHB 1RIVH 4NRZA 5CSZA 4HX1A 3HI6L 3JV4A 2AK4B 4NM8L 3KJ4B 4ENEC 3N41B 4L9DA 4OLWH 4HWEH 2NZ9D 1ZCRA 3VFWB 4HUVA 1M7XA 4PJ7F 1VIWA 1TKWA 4L4VD 5KEZA 4OCWH 1IQWL 1TO5A 3DVGA 1GTFA 1TZGL 1VJSA 2DYPD 4WI6A 5L8KB 2WIMA 5AVZB 2YN5A 3D85D 4JDVB 3V6BR 3ZTDC 2XWJB 3FCUB 3MODH 1DQVA 5C07A 1K9TA 2IANA 3TIEB 1H6TA 1G7PA 1N0LB 2YJQA 3WNKA 2W80C 2G4EA 4BK4A 2A73A 2EICA 3RUGF 5EU6D 1I4FA 1UJ3A 2IH1A 4ODVL 1IM3B 1IFGA 1CXEA 3BC9A 4FLSA 2WSDA 4UTBL 3BWZA 5IQNA 3EDKA 5E9DB 1DJIA 4NIKB 3VMOA 2JLPA 2I5YH 5MEOB 2AITA 1AGFB 2V5TA 2BNUB 2WP3T 1XSJA 3O2DA 1RZGB 4PRIA 1EVUA 4PTUA 1HAUA 1KXTA 2NPLX 2BSRB 4FLRA 4N1CA 1IJNA 4M6OL 1HHJA 4Z7WA 5JHDD 1C08B 4RESB 1KV3A 4OLZH 2N01B 5SWSB 5EOTB 5L2KE 3DARA 3C09B 1J0IA 1L7TL 3WNOA 3S88H 3QUXA 3EG9A 4PB9H 1MWAB 3HR5B 1MJUL 3GTTA 4FFTA 4Y5XA 5JQIB 3H56A 4JKKA 4L1SA 5JDJA 4I2XB 1SXSA 4Z7NE 3NTCL 5TE6L 4UQAA 1NGPL 2C9PA 4GOSA 3HNVH 5HHQB 3M1OA 1AS7A 5IBUG 4EOWH 4MQ7A 5I1DA 4MXVF 3HPLB 3K0WA 2GSIB 1P2CA 4BELD 4XPHH 1GSKA 4MDIA 5I17B 1N10A 3V0EA 3PPSA 1FL3A 4EI5B 2WVVB 4QRAA 1ZHLB 2ZJSL 3BUYB 3VXPA 3OZ9L 4XPBH 2JK5A 2WY3B 4O02H 4FXGB 5TK2A 4BH7A 3T8XB 5GPRA 4K73A 3ZDXE 4GXVL 5IFHL 2OQJB 5BUAA 4WENB 1ASPA 2HTLC 3DV6A 3S5ZA 3VSUA 2IG2H 3WE6B 3ESMA 1QEWA 3K46A 3OGCA 4JFTA 3ZRFC 4GINA 5EA0H 3IU4L 1FBIL 4F57H 5T3XE 4QGTA 4PRAB 1DSYA 1BYNA 2WYHA 5BQ7A 2ZIDA 2ISDA 3RTQB 1BZ9A 3KLSA 1J5OL 2X2YA 2WYZA 1DVFA 4O2EA 4KTEH 1BPVA 2YQGA 3PWLB 4EI0A 4RAUA 3GHBH 4AJ0A 3JUYA 3UBHA 2XZCL 2HMIC 5DT1L 2NMSA 4XBEH 4YDVA 5IK3B 1I1AB 1ZEAL 4R5VA 5D7JC 1CC3A 1JWSA 2R23B 4HZLB 1O6SA 3KDMA 3KVDD 4ZTOH 2WTRA 1A6ZA 3C75A 1I31A 1L9OA 3T0VA 2RR3A 4OGYL 5IV2A 2R0ZH 3L1OL 4HZ1A 2PW1A 3F8UB 4G8GB 3BJ91 1UKTA 3BUBA 3MCYA 4IEFB 1HQRA 1K6QL 1X7QA 3B8SA 4EBQL 1BBDH 3VWJD 4JY6A 4PS3A 5HJDA 3SCMA 4P9HH 4XNQB 1L6XA 2AEQL 1SOXA 2E47A 2ETWA 5SWZB 4HG4J 3AT9A 3CZKA 1ZAGA 1WS8A 3V4PA 1GMEA 1H6EA 3MREB 4N9GB 3THML 2WBXA 4KY2A 1U8NA 5LAPA 3VXUA 3BUPA 4OJFH 4KUCD 3LYRA 3GJFK 5FYLE 2AEPH 3WBDA 1ZOXA 5EEVA 3GRWA 4UQBA 2N1TE 3BVWA 5E8PA 4NO0D 2YUZA 4A7SA 1QLFA 3ML8A 2DKMA 3WIIH 2XTJB 1UXSA 1NLBH 3UTZA 2R4RH 4TRPH 1BXXA 3H9HB 3OTTA 2WV3A 2WXJA 1R5VA 2CIKA 4JZOB 1EEQA 4FEMA 4WGWB 1PLAA 4I9WD 3OKDB 1JZ6A 4E5XB 3PAZA 1G6RL 3GSRA 3K71A 2KPWA 2ZG3A 3N40P 1ODUA 2C9AA 3SOTA 2IWFA 3ZW3A 3ZL1A 3Q8BA 3IDGA 1U8OA 3MJ9L 4A2EA 1PZUB 5ANME 1SOSA 4NQCA 3SYQA 4NC1E 1R17A 5LUMA 2EDRA 4Q6YA 2J6EH 4A2DA 3BKJL 5L88H 3H1ZA 1VA9A 2ZX6A 2J1WA 4FI8A 3ZKXB 3L3HA 4UM9D 2N7AA 3ZT7A 3NT0A 3BE1L 4LHQB 4WWNA 2P80D 5DI8A 1TENA 4G6KH 2Z92A 2J4WL 3VFWA 2YAEA 3IGAB 2NZ9C 5CILH 4F3FA 2ZOLB 2HKHH 2BVPA 4PRDA 1CFTA 2WPGA 2VDQH 4OZIF 2HFGL 1DBML 1HCVA 1WF5A 2XIBA 3UERA 1HXYB 1T0PB 5EBWB 3IFOA 2QQKL 2JFCA 3AAZA 4XAKD 4FP8H 4FL4C 1JPGB 1CFVL 2EDMA 3UEZA 4MJ2A 3M6DA 1N0LA 1XIWD 3FFCD 1AMXA 1M7DB 1UENA 3WENA 3REVB 5EEYA 2O61B 3PWUB 3ZRSA 1IM3A 4DJMA 5K39B 2YSSA 2FEEI 3IU3A 4TNVK 4XAWH 2UXVA 3S96A 4XPAH 4C4KO 1A9VA 3QXTA 1KYDA 1PIFA 3TEXA 5ACMA 4BFJA 1AGFA 2BNUA 1S3RA 2WZ0A 3UYRL 1SHWA 2BM3A 3AUWB 3O11B 3JWOL 1JAEA 1P53A 5T1DH 3CH8A 5DUJA 4D2NA 3LEYH 3P77A 4QHMB 1AAJA 2ZXBA 1I8KB 2VSCA 3D0LB 5T5FH 1C08A 1EBAA 2EH8H 5SWSA 1IC7H 4JRXD 5D2LF 3N40F 4AKPA 5BW7C 2IPTL 2EDTA 4Z8FL 1XB8A 3HB3B 1CJYA 1GJIA 1G9HA 4S11A 2CGZA 4MVBC 2PPDA 3DUUB 2ZWZA 3SKUD 2DEXX 1MWAA 3QHZH 3UADA 3LPGA 1FG2B 1H3PL 1YA5A 3EJQA 4I2XA 5JA8B 3MNVB 5AVYB 4R26H 2VJ8A 1D5IL 3LH2L 1OCOB 5C9KA 2IQAB 3AWGA 5G2NA 1LK3H 4N0UE 5HHQA 5E2WL 4AQ1B 2FIKB 1QOKA 1T0NA 3P4OB 12E8H 5KUKA 5BRZB 3X14B 3KM2A 1BVZA 1FZKA 3VCLA 3HRPA 1WZMA 4E41A 1OSYA 4AJVA 1A6UH 3E6FB 1S7VA 4N0CD 3S2AA 3HZVA 4EI5A 2DDQL 3TNNB 1T2JA 2PPEA 3VQ1C 2WP3O 3UC0L 4PI0A 3SY0A 1MREH 4IJTA 1K5NB 4KHXL 5DUML 4E9SA 4M1CD 2AAVA 2J88L 4ZMAT 2D0FA 2PO6D 4NNYB 3U0PA 1R33A 4ODWA 1ZTMA 1AR2A 1FC1A 4D9RE 5MENE 4FI6A 3B5TA 3GZPA 1CFMA 4R9HA 3U36B 4ES9A 3ILPB 4MXQD 4PJFB 1L0QA 2PR4H 3TXAA 4HUCA 4FFVD 2JXMB 4XNUL 5FO9A 2BHYA 4U6VH 1U8LB 4R7DB 4DFIA 2ZOKB 1E4WH 2C1PA 1XF5B 2P46B 5HHOA 1EJ8A 3TM6A 3PWLA 3WO3B 4XE5B 3NCBB 4LGPB 5L8JB 2YBRB 5INDA 4ZO8A 4I85A 3W57A 1DQJB 3TBTB 2EKSB 4HZLA 3L9RA 5KOVC 1B6UA 3BMWA 1ZIAA 4JQIA 5BOJA 5DUBB 2BPBA 3BIKB 5AOIA 4KAQH 5GXBB 5DRXA 2XX1A 1QACA 1VFUA 1J18A 1ITBB 2Z8SA 4CN6A 1SFHA 3Q8FA 3MOAH 1HKLL 1KZYA 3LKRB 3CV5A 2VR5A 3VWJC 1DBKL 1WYJA 3P2DA 4NQEE 3GMLB 5LBSL 1FDLL 4YXKL 1KJ2A 3KLDA 4E42B 1GH7A 4LL4A 1X5KA 2KZWA 3OR7A 3BKYH 2Q6WB 3Q43A 4G8AC 1NBZA 4HKBA 4YSDA 4RCAA 3DV4A 3MREA 1N3NB 4FE9A 1I7UA 1PX4A 2WUCL 5C7XL 4ZS6D 4XP9L 5C2BH 3ILEA 1QG3A 5G4NA 4O58H 4ETQB 1KCSH 3MBXH 5ICXB 5I0ZA 3VFPA 1CLVA 4MXWH 3DECA 1MVUB 3VGEA 2BCKB 4OT1H 3H9HA 2CDGB 2OV0A 3TWYA 1PY4A 1NUNB 2EACA 1MFAH 3DO4A 2EIKB 3FO2B 4EEEA 2YMTA 4E5XA 4AQ8C 4Z7OB 1XGQB 3MV11 3HG1D 3D9AL 2H32B 3WN5C 4POUB 4FAAB 4FHBD 4YSPA 3FPXA 1PZAA 2E76C 1KULA 2W0FB 3ZO9A 1G7LA 1YPZE 2WZAA 2VLME 2J43A 5IJKC 4YNYA 5JNYB 2IADB 4GUPA 5FYKL 1SDDB 1WFJA 4YVUA 1JL8A 4Z0XB 1XSKA 4MGXA 4QAWA 4FZ8L 2VCOA 2Y23A 2R1XA 3IM1A 4KX9A 1NC4A 1YN7B 4TQIA 3BAJA 5E6IA 3DHPA 4AL8H 5C0JB 3UCQA 1U93A 4I3RH 3DTDA 4MNQB 4YUEL 1JYVA 4H8WL 1YJDH 5A16A 4BQBA 1TLKA 3L13A 4XT1C 3WS3A 4EIBA 2Q3ZA 1FVEA 2NY4B 5T3ZE 2A4EA 2CPCA 2FD6L 2WIIA 5E51A 5CD3B 1YECL 4OZGA 1C5BH 5EBWA 4PJ7E 3TYGL 3I2CL 3QIWD 3L4WA 3KVPA 4MAYB 1QRND 1DJSA 1HILA 4NYLB 2EKJA 4JCMA 3IF1B 4HYTB 1JFQL 3SHSA 1XIWC 1M7DA 3A6BH 4GAJL 1LO2H 3HMWH 3CPLA 3LQZA 3O6FD 3PWUA 4Y4FA 1P1ZA 5K39A 1MLBA 1Z5LB 3OHXC 1OIOA 2BXYA 3GI8H 1CIUA 2XDHA 3OKNB 5HHPB 5D7LE 3FUMA 4PD4K 3RUGE 1RULL 2X1PA 1YHPA 3D39B 4WJ5B 3VD4A 1WUZA 4NBYB 4RGND 2GCYB 2ZP0T 3EOAA 4B97A 5GS0H 1ECYA 4UMSA 5IT2L 2FGWL 4OUUA 4QHMA 3TEUA 3SPVB 5TTRA 2GUOA 4K3JH 4LCYA 5IR1B 1JVOA 2Y5QA 2I85A 3P4NA 1B0WA 3BGFB 3ILQD 4TUUA 4M5ZH 4MKTA 1N2RA 3GZQA 3MNWB 2GT9A 4H1LH 5C92A 1BIIA 2FJSA 4KKQA 3SBRA 1MCEA 2OMUA 1NBYB 1F86A 1FH5H 1SF5A 4X6CF 4HLEA 2F19H 1TTCA 4NKOA 3C2AH 5L2JB 1EANA 2ED8A 2A83B 2IQAA 5KYUA 1ZLSH 2YIHA 4EIUA 4ZQTA 1TTUA 4F2MB 3DX3A 2FIKA 4AIEA 3QQ9D 2FEDD 5BRZA 3X14A 1IX2A 4W9EC 5AL8A 4DGVL 5IFAL 2H1XA 1DEEA 1GTNA 1IRAY 1FVDB 4JPKH 4XNYL 3W9EB 4A7UA 4N0CC 4MXVE 3FT1A 4ZAKD 5L9DH 1S9VB 2NY1B 3Q5YA 4GKSA 3VXTB 8FABB 4P9HC 5IQ9B 3EFDH 3C6LD 5IJVB 3TGXA 1T0OA 1IC1A 1JNNL 2BWIA 1N7MH 4ORGB 4PJ9B 4GSUA 4JFPB 4J3OH 1ACXA 3CDGB 3QEHA 1PU0A 2DQJL 3E9UA 2WZ6A 2PO6C 2VDNB 1FGVH 2OKMA 4I3SL 4QRRE 2IALB 4P57B 4KTDH 3CCHB 3U36A 1QFHA 3NDYE 1GKOA 1SVZA 3O0RH 2Z31B 4HS8H 4QRTB 4MXQC 4H5SB 3N44B 3N1GC 4FFVC 1T7YA 1U8LA 4NM8H 4NRXB 3P4LA 4R7DA 3VB8A 2A9AA 2ZOKA 1B9KA 3A24A 3FRUA 5DK2B 2GTWB 4CVXB 2VC2B 3HC4L 3D07A 4M9OA 4H8VA 4LLMB 4G3YL 4IK6A 4P2YA 2DWDA 4P2RD 3PWVB 3T0ED 2GFBB 5CLYA 4QRQA 1U58B 1H3WM 3M45A 3PHOB 4N22A 4LOVA 5DUBA 1YEKL 1MFMA 1CO1A 3OB8A 4M7KL 3CJJA 1NFAA 4ELMF 4WKZB 5FM5M 2HRPL 1TZHB 4UTBH 2MOGA 4AV0A 1RMFL 3GSOA 3MRGA 5HSFA 5CNHA 5FCUL 3K4ZA 4NLHA 4NUPA 4JGJA 4U7SA 1JPSH 4JRWA 1QASA 4E42A 1JZJA 3B83A 5IHBA 2DQFA 1MCOH 1XGTB 2Z4QA 1AZVA 3FXIC 4G8FA 2XV0A 4XX1G 3T6ZA 3RE0A 3W0WD 1INQB 5I5JA 4H44C 3MUUA 4LHUA 4M4PA 2X6AA 1Z9MA 2B0SL 3D4GA 1OT4A 4ZS6C 4BQ8A 2HFTA 3C8DA 3PREA 3BZEA 3G04B 3AS3A 4N6QA 2B59A 4G8IB 5DJ8A 2PWGA 3TFKD 4AGNA 3BLKA 1L7TH 4IKKA 4ZFOB 3SGEH 3WY1A 3RJQB 1MJUH 1YEJL 2W88A 4K0OA 2BCKA 4JRYD 1KWKA 3QQ3A 2R2BA 3CFBA 4P23A 1N0XL 5TE6H 2CDGA 5D93C 4UZGA 1E50A 4NQSB 3AJ7A 1TJIL 4HW6A 2VDLB 2VABA 3BVDB 4P59L 4CGUB 2KMWA 4MNHA 5ENWB 1YQVL 1Z9NA 2H32A 1BVKB 4OCSL 4F7CA 3K5SA 4XNDA 2V3FA 2V9RA 3WY4A 2VQ1B 5GS0D 2E86A 2LU5A 4IRSD 3VFNA 1BJ1H 3BVVA 1NGYB 4NCC1 3QG7H 1UCTA 4TQ8A 2ZJSH 2AKRA 3RI5K 5J56B 1KG0B 4Z0XA 4XI5D 3HVNA 1U30A 2HT3D 1QP1A 4GXVH 3UXFA 2P52A 3AFLA 5IFHH 4KRMB 5T1KD 1JDDA 2HX7A 3D2UD 5C0JA 1WWAX 5GSRB 2VERN 2EP6A 5MHSE 1CICA 3T3PB 3T2OA 1RJCA 5FLUA 1KCWA 3V4PL 3IXTA 4P3DB 3CN1A 5CD3A 3ZQXA 3RWDA 1RURH 4CC1A 3VD0A 1P4LB 3CBJB 3CXDH 3SDXB 4KY1L 2WXLA 3QIWC 1J05B 2V4LA 4N2KA 3GRWL 3IF1A 3ZKND 4OZIE 5DT1H 3HFML 1QQDB 3NH7L 4IKIA 3RX7A 4G1EA 5EOCH 1U3NA 3CSGA 1AKJB 3O6FC 4FQXA 4UB0L 1MIMH 1BVLA 2D9CA 5ADOH 5C0CE 1OM3L 3MV01 3VX0A 4Y4HD 4JMXA 1A1NB 5HHPA 4BK5C 4PRBB 5C3LD 3FTUA 3D39A 3KPMA 1Y7VA 4J3OD 4RGNC 1HSAB 4FLQA 5D2NC 4Z9KB 5IKCA 1BJMA 4LEXH 4D9QD 4WW2C 4EBQH 5F7MC 5FW8A 3V5DB 4HXBH 4Z76B 1JXGA 2X4TB 5IR1A 4W9HC 3VFVB 5IOPA 4PJEB 2V2WA 3CQPA 3GXFA 4I0PD 3ECUA 2P5WB 4PVNA 1MELA 2FWSA 2G5BA 2NTFB 2UWEB 1E9OA 3ILQC 5CBEA 1T7WA 1UVQA 3MNWA 4TMPA 4F8PA 4X9IA 3NDZE 4H2AA 3MLTA 3THMH 4OF7A 1MQKH 2HWZH 5D2LE 5B22A 1ZWIA 3PJNA 3VXRD 4YC2B 2NR6D 2W07B 2A6IB 4NKIL 3H54A 3H9YA 3HLKA 4PJGE 1WBYB 5I75C 4N2HA 1DUZB 3QPXL 5DA4A 4FMVA 2AJ3A 3B1UA 3HI1A 4W68A 3AU1A 2MCAA 3QQ9C 3SDYH 2BFGA 2FEDC 2XA8L 3CZFB 4PW4A 1A4BA 5CEXA 1FVDA 3U4BL 4FFZL 4DGYL 2VN4A 4WTWA 4W70A 4PREB 5IF0A 3RL1B 4YS4A 1YZZA 4AUJA 2KI6A 5F9JB 1JNJA 4ZAKC 1S5IL 1I1FB 3VXTA 5B3JF 2XRAL 1RPKA 4L4TB 5BZWB 4N9OB 5IVZB 2DEWX 3C6LC 1WT5A 2GC7C 4W9CC 4NO2B 3VH8B 3MJ9H 2Y07L 4ZXBB 2G75B 4ORGA 4PH8A 1CT8A 3LQMA 5AUMB 3HBQA 4I9WE 2Y4SA 2B4CH 3CDGA 2VRKA 4TOYH 2DTMH 1VFAB 3C5SA 1JG9A 1LEGB 2JV6A 2ZE0A 3E6HB 4YR6B 3RX8A 4OF5A 5H37A 2EDXA 3CCHA 1XB6A 2NUPB 3DX8B 4LQFL 3IJEB 2J8UF 3IDNB 3VXMB 1A6TB 3JTTB 2FHFA 4NRXA 3NABL 1X5FA 1NANI 3H9SA 2PCYA 4XCEB 3RNQB 3GMPB 1XF2A 3FPYA 5DK2A 4CVXA 4HJ0C 2OK0L 4GG6E 4NHCL 5DHEA 2I24N 4TQHA 1MWAL 1NCWL 4W9LC 2WANA 3T0EC 3QYCA 4G70B 3PHOA 4R0LA 3DTXA 5KAQF 1R3LB 1GCYA 3DX9A 1SDYA 4GRWB 1WH0A 3FCGA 4ETYA 2CLVB 2GBUA 2KC0A 5LWYL 5I6KA 4NAQA 5BS0D 1JTOA 3DMMD 4X5RA 4NQDA 3QUMA 4XAKE 5FO7A 4FTVD 3WKYA 2L7QA 1AFVL 5AVQB 7FABH 1OP3H 4Q89A 5FYJU 1ZXQA 1FQ9C 1CE1L 1EDQA 4Z7QB 5IHZA 3U2SB 5KYWB 3WTXA 2RBLA 2X3BA 2V37A 5FV1L 1YJDC 1MFEL 4M6ML 1RZIB 1J5DA 4JFFB 5E4EB 5KSVA 3DBXB 1L0YA 1NCNA 3KBFA 3KJ6H 3G04A 3U79A 2IPTH 3FTSA 1OGAB 1U8IB 3TFKC 4ZFOA 5DJXA 4FF9A 4LBEB 3WTYA 3KPOA 4WLCA 4ZZKA 3HZYB 3OF6D 4WFGD 4EUPB 4QKTA 5KANI 5JW5A 2WVUA 4UF7C 4JRXE 2GJZB 4YWGH 4XWGL 3PNWB 1YNTA 4ZMNA 4GT0A 5DD6A 5LGYA 3GLZA 5F1IB 3V0JA 1JGLL 1TPXC 5GGUB 1PDKB 1NSNH 2OZ4L 2Z34A 2NNCA 2I7OA 4F93B 1C16B 2BW5A 1HEZB 4IRJA 2QGBA 2OW7A 3CFDA 2C26A 2DQEL 7PCYA 1JWMA 4MZIA 4JFWA 2P24B 1TZIA 2BJML 4G5ZL 4M6NH 2CR6A 5GS0C 2BMKA 3V5HB 1ZY9A 2VLJA 2QKIB 3CFMA 4IRSC 2N7SA 2XZQH 4WO4B 5JZ7D 4FG6D 4ZFFB 3BKCL 1AXSA 4XXWA 1KG0A 4B6ZA 3CVCA 4MB5A 4NZDA 3UC0H 5GS1A 4PJXF 3HHSA 4XI5C 1CGWA 2HT3C 3L9BA 3FB8A 4FMKA 4V2BA 3B7UX 1M1XA 1KJ2L 1H8LA 4UQ9A 1ZV9A 2E0PA 1SXAA 2BZDA 3D0VB 1G7HA 4DGUA 2L7UA 1JGVL 1U0QA 4KTYA 3P4MA 3ZSSA 3NG5A 4QTHA 2CBQA 4K3DH 1T22A 2E75C 3F00A 5J7CC 5I66B 4QO1A 1A7PH 4LP5A 3KXFD 3T71A 4PJIB 4V1DD 4NFCA 5IB5A 1PFOA 1NEPA 2YMOA 5D1ZI 1ZPLA 2DWTA 3DNKA 3CWGA 4U6YB 1Y6MR 5JO5A 4E5XG 3ULVL 2Y24A 3GDCA 1A1NA 2R2EB 5I76B 4Y4HC 5EMYA 4PRBA 3L81A 2WLIA 1LL1A 1OGSA 1CLCA 1P0SE 2QLVB 5F1OB 3WLBB 1PBYA 2OR9H 4O51B 4J2XA 4J3OC 3UIYA 3PP3H 4AYEC 1HKLH 5C0BA 3RIAF 4QTFA 4W4OA 5FK9A 4NERA 4YXKH 2V5SA 1DVXA 1WEJL 1X9LA 1ZPUA 4OCXH 3V4VB 3HNTL 2BHZA 5DEGB 4K7PY 2XUWA 4TUJA 2X4UB 4Z7IA 5K9KA 1MCHA 1F8TH 1HHKB 2WUCH 5C7XH 1VF5C 2W07A 1AQDB 4H26B 4NP4L 4XP9H 1VCBC 2NR6C 2O5ZL 2WNXA 4YFDB 3O2WH 2ED9A 3UAAA 3ZDYB 4DP7X 2EYRB 3KLKA 1DUZA 1KF9B 3KYKH 4X7DC 1M3JA 4R4BA 3NIFB 5JPNB 3KPSB 4DUXA 4X6CE 2B20A 2MNJB 1VSCA 3AXHA 1T21B 3QO0B 4Y89A 3CSYA 5KSUB 1QSZA 2GK2A 4FFWD 2X9YA 3WCYA 4W9IC 2BRQA 2IWEA 4PREA 4CBPA 2DMCA 1DP0A 1QSFB 2NTSP 2Y06H 4NKQB 2YXVA 4X9GA 3NFPA 5F9JA 1I1FA 4AQOA 3D9AH 4QPEA 2WKOF 5A6MA 1KB5B 1BX2A 3I50L 4NO2A 3C6EA 3VH8A 4ZXBA 3PRZA 1MJ7L 5DD3H 5AUMA 2BP0B 3UJJH 3SDCB 1DVTA 1IM9A 4YR6A 3QJQB 3ZE0E 1S7SB 1YQ2A 2NX5D 1EMTL 1P6FA 4XMKL 3IJEA 1OE3A 4TTDC 2IPKA 4M5YL 3IDNA 4J3UA 1A6TA 2WVTA 2IDUA 1AD9A 4PMEA 3TO4B 4MX7A 1L0XA 4A39A 3DO3A 4K23H 2PTVA 4YUEH 3RNQA 3GMPA 4NENB 1KIRB 2CKBH 3HIZA 1CD8A 3S8WA 4N8PA 2WNGA 4PG2C 4R7LA 2CHDA 3S37H 1R75A 3LS5H 4QF1B 3L4ZA 1EZVY 4IOIB 4NBXB 1W72H 4ZSOB 5BVJB 4U3SB 1XWVA 1V7ML 2EEDA 4XCYB 4DO6A 1MI5B 3NZ8A 1JFQH 3WG7B 2IQ9L 4LGSB 1A1MA 1D6EB 1NL0L 3CFTA 1VRSA 1HWGB 4J7RA 5D71L 4ZW7A 4Z77B 1YMMB 5HJGA 3RURA 3TVMB 1A6AA 1Y07A 1JRHL 3B7RL 3DMMC 4LSUL 4OCYH 1QRNE 1W9XA 4LRIC 2B1HL 2BOCA 5DVLA 4ELME 3QXAA 5EEZA 2ADYA 1JNLL 5I2IA 5TPWH 5JR1L 5DEFA 5I30L 3MJ8B 4DQOL 4HFWA 5D1XB 3NJLA 1TQWA 4MJID 2P7TB 3HG0A 4LCVA 3U2SA 3TEZA 5IT2H 3I02A 1AC6A 5DHDA 4JFVA 4QT5B 5DO8A 3BSZA 2GKIA 1EA9C 3KPRE 4WHTA 1UATA 3V0GA 4O2FB 5GISL 4RGNE 2Q86A 3CMOL 3KYNA 1V8HA 3QFJD 5D6CA 3VM7A 1HWWA 5KYYB 1OGAA 2VH5H 4N2CA 2EIDA 4LBEA 4I5BA 3AVEA 5HVWA 3FT2B 2DQIL 2VDKB 5L0QB 4EUPA 3RVUC 4DK6A 5HYJE 1IGTA 4TV3A 2GJZA 2BW4A 2FX9H 3PNWA 5FA3A 1DDTA 1T7VA 3D33A 5E8DL 4WV1B 2NY0D 1PDKA 1NC2D 4Z3IA 3RDTB 2GEQA 4H7VA 1HEZA 3BP5B 4KMTL 4N28A 2ZCHL 2YD8A 5C9JB 5KS9B 5IFAH 2P24A 3VRJB 1ZIBA 4JPQA 2MRYA 4XNYH 3MA9L 4P2QD 1AC0A 5ECGA 2VGLM 1PLGH 2ESVB 4M93B 1CF8L 5HDLA 4FG6C 5JZ7C 1N26A 1AP2B 1OM9A 2VSDA 3C87A 1FP5A 1NFDA 3Q8CA 1RUAL 1L4IA 1VFBA 5DFTA 2R69L 2FE0A 5JMOC 1K2DB 4I3SH 4I0KA 1H3TA 1Q9KB 3MUHL 3O2DH 4WNQB 3QFDA 4A7VA 2ZUTA 3D0VA 4N8VB 2XPGA 5I5IA 1QHOA 3ARBD 5EC2B 2J5WA 1ZVNA 1RUKH 3PDOB 3SE4C 4C83B 4ATTA 1HEJC 4NHUB 5E1AB 1BJ1J 3LN4A 1BLIA 1HOEA 5HVHC 2W59A 1WFMA 2YMXL 2ORBH 43C9A 4CC0A 3B2VL 3JWNE 3KYMA 5EIQA 3SJVE 2R8SL 4F27A 2D2OA 1JF6A 4JN1L 4CDHA 2JCCF 4G3YH 2XT1B 1VGKB 2EUWA 3LN5B 1MW1A 2HT2D 4AUUA 1X9RA 4TULL 1MJJB 1AGBB 3A4FA 1E4KA 1BFVH 4OF0A 5LCVA 1I9JL 2KDGA 4L9LC 1YEKH 3WS6A 4N68A 5CFAA 1MFCH 2D0HA 2G60L 2HRPH 2B4CC 4L3FA 1RMFH 1MFBL 3WNPA 1NLDH 4GW1B 2ROXA 4YE0A 5EU3A 1HDMB 4Q0XL 2H8PA 2VO5A 4XH2A 1SXBA 5GRJL 2WWKT 5CAYB 3FH8A 4HIEA 2H3NB 4XB3A 3KLHC 5K9QG 2CD0A 4LVHC 5EOCJ 2ZX9A 3TEYA 5LXGL 3VDCA 3KGRA 2MOQA 3QAZB 2CK2A 2OJZH 1JPFA 4YXHH 1A6WL 2VN5A 1C5DA 1FWXA 2C4XA 5D4JA 2WXOA 3I74A 4H26A 3VTMA 2O5XL 3WEXA 3QCTL 2MCPL 1QO3A 4OLEA 1OSZA 5F7UA 1BQHB 4APQB 5ABZA 4AEEA 1NKRA 4C55A 2HVBA 1AY1L 1NGQH 5C08D 5EN2A 1T21A 3VGAB 2FUQA 1AVAA 1QUNB 2VW4A 4FFWC 4DEPC 4JM2B 1P4BH 3MKKA 2ALWA 4DW2L 2YAMA 4UV4L 1PZ3A 2XACC 3UTQB 1YQVH 2AVFA 3VA6A 1KB5A 2DBLL 1BBJA 1BM3L 3NCFB 3L4TA 3OX8B 4R4FH 1O7VA 5B3JE 2VLKB 4L05A 2BNRB 4F33B 1HC1A 4CJ0A 4L5FL 3DXAE 3T6WA 4FYQA 4UU9A 5C8JA 3CBRA 3CQQA 4LEOB 3PHSA 3NFNA 4BINA 2COVD 1VFMA 4H0HB 1CLYH 2RACA 2OJ1A 5FB8B 4B9KC 3SDAA 3LKQA 2JB5L 4FQ2L 2E9WA 1YY9D 4D8PA 4K9EL 3B2MA 3IMVA 4JX0A 4Q8BA 3QUZA 5LDUA 4WI4A 5B1BB 4MMXA 4IOIA 1J0HA 2NQCA 1BQ5A 4HCRA 4ZSOA 3OVUB 3F7VA 3K8MA 1TJGL 1JV5B 4KY1H 4QRUA 2A74B 4HKXB 1JGUL 3AROA 3JYCA 3GRWH 1UQSB 3VXNA 1MN4A 5A2FA 1A0QL 2IOOA 2WBJC 4Z77A 5C07D 1U8PB 4X98A 2RD0A 2D7NA 3EW3B 3LN9A 2SODB 1KC5L 1NOAA 2WC7A 2XN0A 1EK3A 5AKSA 4ZFZB 2G3NA 3A3YB 3ELQA 3KPNB 4KH9A 3TO2B 2XI9A 2B77A 2XG4B 3ARGB 4JG1H 5L2KB 1N67A 4PY8I 5D1XA 2P7TA 2X0VA 3LHPH 1R3HA 1UGNA 1OB0A 2N4IA 3CC1A 1KGIA 4WZ9A 1R46A 4QXVA 4PRID 3S35X 3G5VB 1EGJL 5H37G 3DX1A 3B9EA 3U4EA 5JIIA 1A7NH 4O2FA 2OSWA 4BM7A 2VDNL 4IJ3C 2XWXA 3LV3A 2X42A 3IDYB 4Z7NB 5KYYA 4K71B 2UYLB 4N5UA 5ISZA 3STLA 3IJ8A 3P3UA 4D9QE 5DWPA 3L4XA 3ARUA 5DJ0B 4PVBA 1NCJA 1HI6B 5F9OH 2WBWB 3HC3L 3FJTA 5TE7L 5ID1B 3VNZA 2PW2B 5CXPA 3ASOB 1BVOA 5BZZA 3QUXD 4AIXA 1BREA 3JYBA 4NKDB 4IU3A 5FFGA 1A25A 4LLDB 4TUKL 1KEMH 1N8OE 5D5MF 1HZHH 2NY0C 1I9IL 4QMEA 4LPXA 4P48A 2VXUH 4ERSH 1XF3A 5B21A 5C0EB 4A38A 3U46A 2XPZA 5C9JA 3KWTA 1QBML 5KJRH 5IWLA 1F4XH 4JREC 1UD4A 1DANU 3SKMA 5GRZA 2XZZA 4Y16A 3WFDH 3X12B 1INEL 2IDSA 1NDMA 1U8KB 3D3VA 1S7UB 2BP3A 5E8NA 1NOLA 2OYLA 3O3UN 2QVIA 2K9UA 4HLJA 1R34A 3OLDA 4B9FA 2LFGA 3WIHA 3QUYA 3QUML 5I8CB 5DR5L 2OTWB 4D0CB 3INUH 2Q5BA 1N70A 3SKOB 5EH1A 1WGOA 2GTQA 3C5ZA 3HOGA 2AJVL 2Q76B 4UIMB 5EC2A 2CJSA 1P6WA 2FL5A 3ARBC 4AE1A 4KITB 4Z95L 4U0RB 3NZSA 4JO5A 5CJXC 3HCVA 4XCCL 3WKNA 4JPIA 5TQ0L 1LP9B 1MNUH 1UM4L 2JIXA 3BX7C 2FQFA 2CHXA 4UILH 1NBCA 2E74C 4K3GA 4ZFOL 1AIFA 1YEDB 4ODHL 1YEEH 4ONHB 5DHVB 1DVFD 5MEPA 1NCWH 2HKFL 3MLUL 3ZBMA 3B8YA 1A2YB 3W9DA 35C8L 4PYHA 3US0A 1CTMA 1AGBA 3L7EB 1IBHA 3I9AA 3UG3A 1XGPB 4JFZL 4HVBA 2VDLL 4FRWA 2WINB 3EDEA 2R1YA 2VQTA 3N50A 3UO8B