3T6XA

Crystal structure of steccherinum ochraceum laccase obtained by multi-crystals composite data collection technique (20% dose)
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
495
structure length
495
Chain Sequence
VQIGPVTDLHIVNADIVPDGFVRPAVNAGGTFPGPVIAGNVGDNFQIVTFNQLIECSMLVDTSIHWHGEFQKGTNWADGPAFITQCPIIVGNSFSYNFNVPGMAGTYWYHSHLTTQYCDGLRGPFVVYDPNDPDANLYDVDDDTTIITLADWYHVLAKEMGAGGAITADSTLIDGLGRTHVNVAAVPLSVITVEVGKRYRMRLVSISCDPNYDFSIDGHDMTIIETDGVDSQELTVDEIQIFAAQRYSFVLNANQPVGNYWIRANPNSGGEGFDGGINSAILRYDGATTADPVTVASTVHTKCLIETDLHPLSRNGVPGNPHQGGADCNLNLSLGFACGNFVINGVSFTPPTVPVLLQICSGANTAADLLPSGSVISLPSNSTIEIALPAGAAGGPHPFHLHGHDFAVSESASNSTSNYDDPIWRDVVSIGGVGDNVTIRFCTDNPGPWFLHCHIDWHLDAGFAIVFAEDIPNTASANPVPEAWSNLCPSYDSAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Laccase
publication title Reaction intermediates and redox state changes in a blue laccase from Steccherinum ochraceum observed by crystallographic high/low X-ray dose experiments.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 138
structure length 495
sequence length 495
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6xA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6xA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6xA03
5PAZA 1X9UA 2ZXWB 2XXFA 4YSOA 1IBYA 1KV7A 4A2GA 3T71A 2QPDB 3RYMA 1M56B 4M4RB 2QDVA 2FT6A 1IUZA 4G71B 3PAUA 3FSVA 2A3TA 1AS6A 2P80A 1A4BA 4BK5C 1MG3C 2WO2B 3UADA 2YAMA 2JFCA 2UXGA 2IWKA 2JXMA 5B7EA 1ASQA 1J5CA 3QJSB 1WA2X 1PF3A 2YARA 5I6PA 2PCFA 4N4YB 2EIJB 1NTDA 4X4KA 5PCYA 4M3HA 5ANHA 2XU9A 2VW6A 1NICA 2BHFA 4CSZA 1SNRA 2MTAA 2YAEA 5E9NA 6PAZA 2LLNA 4PCYA 2GC7C 3FPXA 2PPEA 3FT0A 1NIBA 2VSMB 3HEIB 3AY2A 4A2DA 4P5SA 1OE1A 2PP8A 3C75A 3PPSA 3NSYA 1AZNA 1BQKA 2H3XC 2X87A 3X1GA 3GYRA 2HX9A 2FWLB 3G5WA 3T6XA 3ZIYA 3TBCA 4A2FA 2JKWA 4E9VA 3TU6A 2VMJA 1ETJA 2W8CA 2QPEB 2B08A 1SHWA 2CBPA 3IBOA 1J9QA 4W1TA 4HCGA 2Q5BA 2PPDA 1PNCA 2HX7A 4NAJA 4GP4B 1L9QA 2XV0A 4UANA 3SBRA 1JERA 2GSMB 1A8ZA 1XB8A 1CYXA 3AG2B 3X1NA 5B7MA 3FQYA 1N68A 3IN2A 5AZUA 4GYBA 1DYZA 4JHUA 1AG6A 4DP2X 1KDIA 3NJKA 1ZIBA 1GSKA 2UX7A 4HZ1A 1SDDB 2PPFA 4HHGA 4N8UA 2BP0B 3CVCA 4L0PB 3UABA 4BDVA 2ZOOA 4BWWA 2VM3A 3IE9A 4YSCA 1JXGA 2BWIA 1BXUA 2YQBA 1UATA 5B1BB 1J9SA 3PAZA 1NIAA 1TEFA 1BQRA 5I6MA 4QLWA 1R1CA 1ET8A 3AG1B 2YXWA 2R7EB 1V54B 4KOCA 4E9QA 1AS8A 9PCYA 2VW4A 2I7SA 2J57A 2FJSA 3DKHA 4F7KA 1CC3A 4Q89A 4YL4A 2IDSA 1IC0A 3T6WA 4GY4A 4DP0X 1E67A 5B7FA 3OMIB 4DP1X 4YSAA 1V10A 2IDFA 2YAPA 2CUAA 4A68A 3NJHA 3QJUB 1JZFA 3UAAA 2BZ7A 1EHKB 3JT2A 3AG3B 4HCFA 4UF7C 1AQ8A 5D4JA 1MG2C 1TU2A 1BXVA 1JXFA 2FQFA 2GC4C 4FA7B 2BZCA 3H4HA 5F7BA 1W8EA 3AG4B 1BEXA 1F56A 3FU7B 1NPNA 1PLCA 4YVUA 2YAOA 5I6LA 3PXLA 1BYOA 5D4IA 4KO6A 2YAQA 4YSDA 4UAHA 1L9SA 5I6NA 1KBVA 2VSKB 2XVBA 3NP3A 2J56A 3TASA 4K9JA 3NJIA 2BP8A 3X1FA 1NWPA 1X9RA 1L9OA 2FNWA 3IEAA 2QT6A 4F2FA 1GY1A 4BWTA 1ILUA 4JHVA 4DP4X 2IDQA 2GIMA 1SHXA 1BYPA 2UX6A 2FQDA 4MFHA 2EINB 1ET7A 4G7QB 1A4CA 4DP7X 1L9TA 3NSFA 5AFAA 5IY5B 3CG8A 2GI0A 5FC9A 1OF0A 1CURA 1ASPA 2IDUA 2XUWA 5AKRA 5TK2A 1L9RA 1BAWA 3NSDA 1RKRA 1URIA 1T5KA 1NIFA 5I26A 3H4FA 1AR1B 1AACA 3FSZA 3QJTB 4TXVB 3UACA 1SF5A 3GXUB 2IDTA 1A65A 1MDAA 2AZUA 2XV3A 3CDZB 5B1JC 2AZAA 2GB2A 1PCSA 1GR7A 1SF3A 4GP5B 3SBPA 2Q9OA 6PCYA 4DPCX 1AZRA 3FU8A 5D4HA 1JVOA 3TBBA 1OE3A 1XMEB 4DP8X 2IAAC 2P80D 4HCIA 1JOIA 4BXVA 1NZRA 3S8GB 4A2HA 3WKPA 1W6LA 1FFTB 4EF3A 1KDJA 1AZCA 3ASOB 2OJ1A 2EIKB 3WNJA 4G70B 2HLEB 7PCYA 2DY2A 4HHWA 3U25A 1OCRB 5B1JA 2PP9A 1GS6X 3PCYA 2DWSA 1TKWA 2FTAA 1SFHA 3V9EA 4DP6X 2W88A 5A7EA 1PY0A 1GW0A 1ZV2A 1KBWA 3FS9A 1B3IA 1AIZA 3UAEA 2QDWA 2BO0A 2ZWNA 1ZIAA 2BWDA 1I53A 5I5MA 1E65A 1NWOA 1PZCA 1IKOP 2TSAA 2DV6A 1BXAA 2XV2A 3FQ2A 2PCYA 3NT0A 1MZZA 7PAZA 1AS7A 2VN3A 1OCZB 3T6ZA 1JZGA 2EIMB 4KO7A 3NP4A 3V9CA 2YAHA 2HZHA 2XXGA 3N2JA 1HAUA 1M57B 3FSWA 1QHQA 2XLLA 1ILSA 3D12B 4YSEA 2HX8A 1M9WA 1PZAA 4G72B 1NINA 4DP9X 1W6WA 3CVBA 2BP8B 1QLEB 3KW7A 1J9TA 3ERXA 3WG7B 1PMYA 5B1AB 1PNDA 1SJMA 3QPKA 5I5IA 1JZHA 2AVFA 3ABKB 1N70A 4HAKA 3ZDWA 1YLBB 1CUOA 2CJ3A 3NJNA 4YSPA 1V55B 4YSUA 1AZBA 2AANA 1PLBA 2AFNA 2BP0A 3ABGA 3FSAA 1NIEA 2GHZA 4G7SB 4A2EA 4F2EA 3T9WA 1ZDQA 3SBQA 1QNIA 1OCOB 1KCWA 3OD3A 3PLYA 3QJVB 1AG0A 2EILB 4YVNA 1NPJA 5I6OA 2WO3B 3S3DB 2VW7A 3EH4B 3ZX1A 2J55A 2TSBA 1NDTA 1KCBA 5I6KA 3NJMA 1OV8A 1WS7A 2H47C 4E9WA 4DP5X 3ABMB 1L9PA 3IN0A 1FA4A 2WSDA 4KNUA 2PP7A 3EH3B 1J5DA 3SQRA 3BVDB 2XYBA 4A67A 4ENZA 4E9TA 5TK4A 2I85A 1RCYA 4KO9A 2UXFA 2DYSB 1E30A 3H56A 1KGYE 5I5JA 1AZUA 1OE2A 3FQ1A 3FU7A 8PAZA 4HALA 2BW5A 2Y69B 2HRGA 4AKOA 2OCCB 4GXFA 3OQRA 2H5UA 1WA1X 4HIPA 4PAZA 4AZUA 3N55A 2CCWA 2HRHA 1RZQA 2YAFA 3HB3B 4NERA 2J5WA 1E5ZA 4BDVB 1IBZA 1ZPUA 2DYRB 2PPCA 1OOWA 3EF4A 1GYCA 1SFDA 1JZJA 4JKNA 3FPYA 4KO5A 2Y1AA 2I7OA 3WIAA 3ASNB 2PPAA 3S3CB 4DPBX 3NJGA 2IH8A 1HFUA 1WS8A 3AW5A 4KNSA 2XX0A 4AKPA 4E9XA 3MX0B 4E9SA 2OV0A 3ZBMA 1KYAA 1PZBA 1E5YA 3S8FB 3UGEA 4BXSV 1PAZA 5LDUA 1GS8A 5I28A 1WA0X 2NRDA 2CALA 1BQ5A 3X1EA 2UXTA 1ASOA 3NJJA 3EH5B 3NJLA 3BQVA 1PLAA 4NB7A 2BW4A 1JVLA 1WAEA 2B3IA 4E9YA 2FQGA 3QJRB 3T6VA 1NIDA 3EHBB 1CYWA 3JTBA 4KNTA 3FU9A 2X88A 2IH9A 3FYIB 3CDZA 2DWTA 4G7RB 1DZ0A 4W9ZA 2E86A 4GP8B 1AANA 1GY2A 4AX3A 2MRYA 1XB6A 1EZLA 1ZDSA 2YXVA 5EHFA 1HAWA 2CAKA 1MZYA 5F7AA 2HXAA 1JXDA 1XB3A 3QQXA 1AAJA 4AI7A 1A3ZA 3OM3B 1ADWA 3WNIA 1ID2A 4Q8BA 3CVDA 4WTQA 5B1KA 3CZUB 2XX1A 1JZEA 3QJQB 4YSRA 4AKQA 2FT7A 1FWXA 2GBAA 4RH4A 4YSTA 3X1BA 1JZIA 3OMAB 1AOZA 3NSCA 2FT8A 1SDDA 4YSQA 1RZPA 2IWFA 4CSPA 4FAAB 2VM4A 2PLTA 4QKTA 3X2QB 2IWEA 3NYKA 1J9RA 3NJFA 4DPAX 2RACA 3PAVA 3OMNB 3S3BB 3TA4D 3WI9A 3AZUA 2N0MA 1OCCB 2FQEA 2R7EA 3FYEB 1GS7A 1VLXA 3DIVA 4ZK8A 2UXVA 4KOBA 4E9RA 4YSSA 3MBWB 4WKXA 3WKQA 3DTUB 1ET5A 3KW8A 4P5RA 5B3SB 4A66A 3ABLB 1TEGA 3GDCA 1A4AA 4BWUA 2ZONA 2XWZA 3L45A
chains in the Genus database with same CATH superfamily
3WIIH 3K7UA 2GYSA 1P6AB 1IBYA 4A2GA 2VLRD 1RULL 3RYMA 1FZMB 3MFFA 4XVUC 2HLFC 5J8OA 4LK4A 3MV9B 2ZUVA 2Y07L 1BHGA 2OMUB 3PAUA 4DW2H 1LWHA 1GZPA 1BIHA 4XNYL 2OR8A 2WO2B 1RZKH 2YAMA 5B7EA 4PR5A 2EVGA 4LL1A 1QEXA 1XGTA 1T1WA 2GJZA 3G6AA 3QJOA 5I0DA 2DRUA 3C5ZA 1LO5B 2XQYK 1A6AA 2XXMB 3IS0X 4GT0A 1QLRB 4OJEH 1AGCB 4M62L 1KJ2B 1QRKA 5K39B 3VXRE 1NANH 4JHAH 5ANHA 3V7AG 3V4PA 3MLUL 1VIWA 2I5YH 5HPMB 5IM7B 3S96A 5ANMA 2BIHA 5KS9A 3OKMA 3AY2A 4ZUUB 1WIPA 1QA9B 1OAYL 5KOMC 2R29L 5D71L 3SY6A 4AV5A 3OB0K 1BM3L 3VWJC 4G43A 2DQ6A 3T6XA 3B1UA 5GISL 2N01B 4BJLA 5MEPB 4S0SD 2CKBH 2X4RA 5CJ5A 2EUWA 4WFEE 2DDQH 1SBSH 1JGLL 2K4WA 3DBSA 2B08A 1U8KA 2CBPA 4J6RL 4NQDE 1UT1A 1L0XA 3FOMB 1F4XH 4ZXBD 3TA3C 1R3JA 3DROA 4ZG1A 1CFBA 1QPPA 1S5HA 4V1DE 4XPHL 4OD3H 3HG1A 4JKPL 2FECL 1T5WB 4NQSB 4JB9H 1UH3A 1BQHA 1SYSA 3M46A 4JY5L 1CD8A 5KSAB 3IYLW 1JERA 2O5ZH 4TVPL 1YMMD 1J1XL 2BSSA 1AZZC 4LCIH 3T09A 3C09C 3DGDA 4BV1A 3DO7B 3WNLA 4ACTA 4GYBA 3D7PA 1VERA 4WFFD 1CDUA 2WZ5A 4DEPB 2VQUA 4RNRB 2CGYA 2BP0B 3CVCA 2E3VA 1OTSC 3FO1A 2Y7OA 2NNAA 1B0IA 2N7AA 2VLLA 3FFCB 2ZUQB 5MI0B 5C08A 4PGJA 3VTTA 5B1BB 3U36B 4LFHD 4NJ9H 2A5UA 3AS2A 3MPCA 5IMOA 3MACL 3F85A 3QZNA 1U33A 4Y5VC 5AW3B 4DKFH 5D7EA 5EO9A 4E68A 1T1YA 5GS2D 3RBSA 1TENA 2ADIA 1IC4H 2UV3A 3RILA 1BJMA 2GJ6B 4PJFF 4XO5A 4IGBA 3RIFF 1JK9B 4KXDA 4DP1X 1AQMA 4WK0B 2BP3A 1VPOH 4YSAA 4M5YL 2GSIB 3MJ6A 3P4OB 5CP7A 5FM5M 5IQ7H 1OHQA 3BZ4A 4N0UB 3NZ8A 2VN6A 1AQ8A 4MDIA 4O4YH 4APQA 2Z3FA 4R8WL 5IG7B 2A38A 3MRQA 3E8UH 3KGTA 2FATH 2W0LA 1MCCA 1BX2B 3VTMA 1W8EA 2HKHL 1FVDB 3LEXA 1GZHC 5HGGS 5IFHH 2KKQA 4HJGB 1NEZA 3VJ6B 4RDQF 2YUZA 3GSVA 4XPGL 3BH9A 1L9SA 1F41A 2K8QA 3GZKA 5EU7E 3Q1SL 4X6CE 2V2XA 1I4FA 2WWKT 3UERA 3EF7A 1IQDB 4K9JA 3FQWA 1ZLUK 3TEUA 4GO6B 2DLTA 3VFOA 3VFTB 1ZS2A 4HH9A 5AOMA 2Y2YA 4OIBA 1AIFA 5E2JA 1E2WA 5I0XA 4HWUA 1DLHB 2EYTB 3PABB 4GUQA 3AROA 1JWMB 3EH1A 1I85C 4JDVA 2IPTH 2GTQA 3NZHL 4K71B 3I75A 2Q6WA 1H19A 3MGAA 5DJZB 1SHXA 1D5MA 1JXJA 1TTCA 2PWHA 3QDME 4PS4H 1YNKH 1RUAH 3BAXA 4ZYKA 5F0LB 3U9UB 3Q3GB 1W16A 1MVFA 5C0CA 2WGXA 1U93B 4NWTH 3MRIB 5EU6B 2IDUA 5JPMB 2OFQA 3LN4B 1CE1H 5HVFB 2WN2A 3Q43A 2YD2A 1KIPA 4U3CA 5AYQA 4XZ4A 3FSZA 4TXVB 4D94A 1CFQB 3GSUB 3IJ7A 4MS8D 4MMXA 3RZCA 4MCNA 4UBDD 1IFHL 3B9EA 3QXDB 4D3CL 4PWIA 3MRPA 5AVXB 4OLVH 1GH7A 2LTQB 4HS3A 1PCSA 1UD8A 4EZJA 4GP5B 4AXWB 2ADJB 5GSVA 3K2UL 1Q0EA 1OM3L 1G9MC 5D6DC 3GRWL 3L3JA 3TJHC 3BE1L 1Q9WA 3PNWB 4XN8A 3F5WB 4L2LA 3F01A 4HV8B 3WN5B 1X6LA 1YEHL 5KYWA 3KLHD 1IGYA 2KZKA 3QEQD 4YFDB 4R4BA 3WKPA 4KZDH 3M1OA 4S0TD 4LZKA 5I5RA 2Q86A 3MRCA 1ZA3B 3WTYA 1KBGL 3VE0B 3CXFA 5D1XB 4ZFZA 1XO8A 5KYYA 1RZIB 2Y1VA 5TQ2L 1AQDB 1RZJC 5C6PB 2W91A 4JFFB 2FTAA 5I1EH 1LJMA 2NW2A 3LMJH 2WZPA 5F97E 2LLLA 4ODXB 4CRPA 1T1XB 4LCUB 3DWTA 4HGWB 3Q6FA 4ICWA 3V0VB 4E42B 5F88A 2WQXA 1E9PA 1FRGL 4GAAA 4JZOB 1NAMB 4DO4A 3AU1A 3LIZL 2DV6A 2GCYA 2WLZA 3CVIH 4A39A 3HG5A 5EO1B 1DFBL 43CAA 12E8L 4FRWA 4Q6YA 3UL4A 1T89A 5I1CH 2H1LM 1P5UB 3KYKH 3ULVH 1QBMH 2ZKXA 4ODTH 4Q4EA 3T77A 4OSUL 5C9KA 1D5BA 3T6ZA 3GS7A 2FEDC 1D7FA 3US0A 4B9YA 5E2UH 3SGJA 1HH9A 3IM1A 4WTZA 1KPUA 4FI8A 1MW0A 4X8GA 1Q9LA 3JV4A 1QHQA 1G7JA 2F54A 4XNUH 3AWEA 4L9LA 4I18B 5A2LH 3K8KA 5JHLH 3MI6A 4PG2A 1CICC 4XBGA 1XAKA 3CVBA 3MFFB 4PGBA 3ETBF 3ZHLA 5C0EA 1JWSA 1UJ3B 1AR1D 1FZKA 4PJ9D 1IM3D 3NGBC 4XCEA 4JJHA 5B1AB 1GOFA 3AWGA 1F8TH 4G6AC 4PR5B 1IM9D 4ONHA 2NR6D 3BSHA 1XGTB 2EDTA 1T1WB 2GJZB 3G6AB 3T6QC 4MWFB 1WGOA 2H32H 4OCMC 4JCWA 5D1QA 1NIEA 2HFTA 5DVNA 2MNUA 1WFNA 4WI8A 3V4PB 4LDCA 3CDFA 1D9KD 3OAWA 2DOCA 5FUCE 2YZ1A 3S96B 4MB3A 5ANMB 4CUCA 5KS9B 3OKMB 5L4JA 4A6YA 1TZ8A 5KW9H 4H88L 2NY6D 4KVPA 1LK3L 5AVYB 2XJKA 3FRPG 4YJZL 3CK0H 1QO3A 3VFNA 2WQWA 4M8VA 1IGJB 3HPLB 4OZGA 1BFVH 4ZPVB 2WXRA 3BHBB 4NNPL 2X4RB 1WZMA 3DUSA 2F1EA 4KXAA 3ARBB 1CLVA 1N5AA 1RIVH 1U8KB 2D4DA 3ARGA 4B9PA 1YUKB 1R3JB 3DROB 4MXVF 1S5HB 1UADC 2FX9H 4UQCA 2OMYA 3HG1B 2XKUA 3H42L 4M9PA 3K6SA 4FXGB 4HBQA 2DKSA 1SYSB 1OLLA 5JR1L 1B4RA 3CXDH 4NQTA 5I30L 4MMZC 2BSSB 2JKIS 2DQJL 3WY4A 1T5XA 4FZ8H 3VGHA 1P5VA 2BM3A 3ESUF 3OAZH 3BKYL 1DN2A 5I8CA 3M7FB 3HB3B 3NIFB 2A1WL 1TZGL 5F1NA 3IK2A 3MLXL 3MRGA 4TTDD 3FO1B 1E4XI 5F3HB 3NH7L 5J0BA 2NNAB 3O4LA 4UM9D 4AYEC 1SFDA 1JZJA 2VLLB 1WFUA 5C08B 3WIAA 1YJDH 3LRMA 4U6YA 1WPCA 4X98B 4J5VA 3P3YA 1Z9NA 4ZO7A 1HFUA 4XAKE 4PV8A 5I17A 4GBXD 4K9EH 4KNSA 4HJEA 4WJG3 1QI5A 1KIRA 3BD5A 4DGIL 5EFIA 2ZKMX 3EJTA 4ZTEA 1QSEE 4G6FD 1PAMA 3C08L 2GITA 2E76C 4IGBB 1L6PA 1OARH 1MCHA 1PBYA 5KVGE 3GMOA 5CILH 2C9AA 3L7EA 3FULA 2MJWA 5CP7B 4QOKE 2E9GA 1AY1H 4YFEA 3NZ8B 2J6EA 3TFKD 1FORH 15C8H 4M29A 1KEML 3CQPA 3TT3H 3MRQB 3VH8G 4QXVA 4XMLH 2BIQA 2DMGA 2BDNL 4G9FA 4JRWA 4PRPA 3WV0A 4AJWA 2F8IA 1T0PB 1N2RA 2WKOF 5B38A 3LEXB 4KNTA 3LVEA 1PKOA 4G5ZH 4H20H 2X28A 2V5SA 1NEZB 3GSVB 3PWPD 2VUYA 5I73C 2XA8L 3FCSB 4C8XA 2V2XB 1I4FB 1CT8A 1MQKH 4NQEE 1HAWA 3CFQA 3QJFB 2ZKHH 1XGQA 2X6UA 1HQ4A 2X1OA 4BK4A 3FDWA 3FQWB 4MA7H 2CJSA 5BJTA 1KT2A 1A3ZA 4YK4B 4PREA 3IFOA 1A9EA 4Q8BA 3A6CH 1U8JA 1UWXK 4PRNA 5JMOC 4UMSA 1A7OH 2Q6WB 3I75B 4YSRA 2L7JA 1D5MB 5K9QG 4P2CG 5HDWA 1J05A 1KWKA 3FONA 4KKZA 5E8EA 4ZYKB 3NSCA 2FT8A 5ELIA 5C0CB 1QYGH 1EVUA 2ZOWA 3CZFA 4BK8A 3BKML 2HVJA 3P02A 1BMWA 3O8XC 4K2UH 3S35X 3OMNB 1FNAA 1KIPB 3AZUA 2WXLA 2Z35A 5EB9A 3QA3A 5DFWH 1Y18A 1WGVA 5IW3A 1ZXKA 2WQ8A 3QQ4A 1DLFL 1QRNB 2FZ3B 5FKPA 3VX0A 3RZCB 4E9RA 3REWA 3BUDA 1UKSA 1G1OA 3U4AA 4A66A 5B3SB 1A1OA 1ZVNA 5EZOL 4HS3B 5ABZA 1UCBL 3BT0A 4ISVB 4KRMB 4JBSA 1H3TA 3L3JB 1R3IL 2DB8A 1Q9WB 3GZPA 1YNTA 3TO4A 3MN8A 1JPFB 5MHSD 1WC7A 5KYWB 1IGYB 4IBWA 5GGTA 4F7CA 2AAAA 2EO1A 4R4BB 1RULH 3EHBD 3VFUB 5E8DL 2Q86B 3MRCB 4MXVE 3ZDZE 2Y07H 4MYPA 3FSOA 4ZFZB 1I9IL 2F74A 5HHMD 3U1QA 5KYYB 1V7NL 1D2PA 4XNYH 2Y6TE 2YGQA 3VDBA 4UDTA 4PJDB 4ZMAT 2NW2B 2EIJB 3CFJA 3CD4A 2NOYA 3L8QA 3Q6FB 3B2UD 3ZHNA 1IGCL 5F88B 1NBZA 1NICA 3SYPA 5IHLB 4M62H 1I7TA 4NC0B 2MH4A 1DVFA 2GCYB 3FBQA 3L3GB 3LKPA 3T08A 4MB4A 43CAB 3L48A 2VXUH 3MLUH 4BK5A 2P7TA 1BZOA 2VO8A 2PW1B 3L9EA 3EYOA 3BOVA 3GSRA 4FYTA 1D5BB 5KSVA 4MZ2A 1OAYH 2R29H 3AQZA 5D71H 3ESVF 5DK0A 1HH9B 4CN6A 3FB7A 4R7NA 1BM3H 1Q9LB 4G80B 3VA2C 3JV4B 5GISH 1G7JB 2F54B 3H7BB 4WV1C 1DBAL 1CDYA 2Q5BA 1JGLH 3QJXA 5D70L 4J6RH 2DI9A 4DWHA 2Q20A 1WFOA 4PGBB 2AK4D 5C0EB 1SOKA 3U46B 1D5XA 1JWSB 5KS9F 4XPHH 1FZKB 4ODVL 4JKPH 3TM6A 2P43B 4NQQA 1PZ5A 4IKJA 1CYXA 1RH8A 2XBDA 2W5PA 4ONHB 4Y16A 4JHUA 4TVPH 1J1XH 2N1KA 1G7PA 4RFOL 3OJMB 1GC1L 4TUJB 5D1QB 4NM8L 4OT1L 4PBWD 1JPSL 4K8RD 5JW4Q 4FCAA 2CDFA 3R7RA 1BXUA 1A3RL 2G0LA 3WUWG 1NBVH 4MCZA 2E7BA 4QLWA 1UOWA 4A6YB 3I6LD 2V7NA 2I32A 1QO3B 2WTPA 1CFVL 3VFNB 3QXVA 4AIXA 4KUZL 3QUYC 4OZGB 3HCVA 3MACH 5ICYA 2XPYA 4DP0X 4WRLA 1TVBA 1BQLH 2ALAA 1XF4A 2RH0A 1SN0A 4NQXA 2QV2A 1N5AB 1YZZA 2CUAA 5CJQH 4WCYH 3EOAA 5SWQA 3ARFA 3P4MA 4KRPD 4JPKL 3UTQA 5F7HA 3ZDYB 3VXNB 4BE6A 2L04A 3KPSD 3OTTA 3Q8AA 2BC4A 4H40A 4AVKA 1TU2A 4V33A 2X4QA 2EACA 2BX5A 3I9GL 1ZE3C 4R8WH 4K5MA 1F56A 1HXYB 4X80L 1T5XB 1OY3B 4MNQE 3VXRA 3VYPA 2QFRA 2HKHH 4Y4HD 4F8LA 1KACB 5I8CB 3D85D 2IMNA 1E7UA 3ZTJG 3HHSA 4W93A 1CDHA 2IH1B 4XPGH 1C5CL 2AHIA 2J56A 4XP5L 3O4LB 5HHQA 4KTDL 3D39A 4LLVA 4Y4FA 5T3ZD 5BXFB 5GGSA 4U6YB 4DO6A 4UT6A 4HOXA 3LD8C 4F2FA 3NDYE 2PKDA 1UD3A 4GMSL 3K6NA 2W80C 5I17B 3LQAC 5F21B 5JOFA 2OMTA 1KIRB 4YDMA 4PJGB 4PLJD 5KYUA 5D7KD 3LZOA 1EFXA 4HUKB 3TCTA 2IDQA 4AJ0A 1BYPA 5GRWA 5I6XB 4BQ9A 4IBTA 2DLHA 2GITB 2AAVA 1J87A 3NZHH 4IRZA 4P2QA 4ELDA 3GMOB 3PWNB 4GW4A 3IWUA 1LEGA 3CG8A 4OBRA 4WQOA 5EPMA 5FC9A 3EDJA 3FK3A 1FCCA 5IMKA 5JDJA 3O4OC 1URIA 2J25A 2ZYRA 2VR9A 3DURA 4GJTB 4G9FB 3REVA 2QKIB 1Z9SA 4U1KA 2A9ML 4JVWA 2Y7MA 1FAKT 2IDTA 3HE7A 4P2OA 3EO0B 3NEOA 1J18A 2V9RA 3C6LA 1NCUA 4Y2DD 4BZ1H 1IFHH 1UB5B 1HTYA 4D3CH 4Y7OC 1D6EA 1ZHKA 2R0WH 2BVOA 3H9HB 1XGQB 3Q8CA 5CKAA 4F9LA 3HZKA 4EI5D 4I1RA 3K2UH 4HUMB 1GKEA 3BE1H 3FU6A 4PREB 3TJPA 3NG5A 1A9EB 1YEHH 5JW3L 3CC1A 1U8JB 5L8KB 4PRNB 1TQUA 5DMGD 3WTTA 3C5ZD 4O51B 4NQCE 5JOPE 3ZL1A 1IB5A 3EZ8A 5E8OA 3G04A 5I66A 1KBGH 3PCYA 2DQCL 1KGUA 4DP6X 1J05B 2JB5L 4I5BB 3FONB 4CBZA 5E8EB 5A7EA 5FDYA 1MHCA 5TQ2H 5LQBL 3OXSA 4ZO8A 2ZNWA 3CZFB 5SWSA 4HKJA 1HE8A 1ZIAA 5ESVA 2HVJB 2VRQA 2BWDA 4FI6A 1KYUA 4K94L 5FS5A 25C8L 3QIUA 1EEYB 4MLSA 4XN9A 5LWYL 4JFDE 3RWIB 1FRGH 2Z35B 2JF1A 4FG6C 4U0RB 4DAGL 5C0NC 2XG5B 4NGHL 3LIZH 1D5RA 3QA3B 4JPIA 4J1UA 5KG9A 3ZRSA 3TBTB 1DFBH 3QQ4B 12E8H 5ECJE 2DW5A 5FKPB 3W0WA 3REWB 1PW3A 1CL7L 4N2GA 1A1OB 2N7BA 4OSUH 4PJDF 4MGXA 2MQGA 4HHAB 4F80A 1SQMA 1XGPA 2ERJB 1RVFL 3AXLA 3ML9A 4RMBA 1FN4A 2YGPA 5J06A 5BZZA 4DH2A 2R1YB 4E5XG 1YNTB 3TO4B 1SOXA 1CD1A 4LFHG 1WC7B 3KPRE 2P48B 4LPVA 4F7CB 1EA9C 2J5LC 2Z92A 1NGYA 1L0PA 2HFEA 5GGQL 2W59A 3X12A 1AHWA 5KBDA 1Z66A 1JPTL 4RAVA 1C5DA 1JGDA 4XWOC 5DZAA 3C5XA 2HYMA 3F04A 4UDTB 3VRLF 3U0WL 3B34A 3ABGA 3K8LA 4I3SL 5D7JA 5L6YL 2EDJA 4XHQA 5AAWC 1NBZB 3QUZC 1FYTE 4RWHA 3OD3A 3QIBC 1I7TB 1DVFB 1CBVL 3LKPB 3RB5A 3HKFA 4O2EB 4AQ8C 5FCSH 4XP4L 2P7TB 2HTKD 1K5WA 1NDTA 3ZSSA 3BWZA 4ELMA 3EYOB 3GSRB 3NRQA 4IGBD 1U8HA 2X3BA 5KSVB 3FTYA 2H47C 4H88H 5JXEC 4R3SA 1LK3H 5LGKA 2FX8L 2X12A 5DK0B 2WSPA 1MJJA 2BLFA 4QTHA 3F62A 1G7IA 1XVSA 3N40P 3FF7A 4NNPH 4APQD 2DEXX 3QHFL 1J5DA 4NAQA 4Z95L 2G5RA 4P4KA 4E9TA 1RZ7H 3PHAA 3RPIB 1NAML 5DWUL 5G5DA 4MZRA 5C0JA 3CHXA 3NVQA 1H15B 3IDUA 2WVSA 2R2HA 3AUVA 3ETBJ 4JCMA 1S7WA 1PZ5B 4U4IA 4P2RE 5E4IA 4Y16B 5J89A 5I30H 2B59A 2PR4H 4JM0A 2VLJB 2B16A 5T1JA 1KULA 1JP5A 2DQJH 4C54A 1NFDE 4LLUA 3KLQA 3LKNB 1ZGLP 3VXUB 1G7PB 1ESOA 1X5GA 2VDRB 2CZNA 3KR3L 2A4CA 2XDHA 3L5JA 2N7SA 4WHYG 1MRFL 3EF4A 3KLKA 3ZDYF 2A1WH 1TZGH 2E7MA 3FPYA 1T83A 3MLXH 3QYCA 1T4WA 1DDHA 4MCZB 3GXNA 4UQEA 4N85A 4JDTH 2V7NB 4Z23A 4JY6A 4BHUI 1R47A 1KYAA 2YA2A 3FT4A 1EO8L 2XPZA 1S3RA 3HCVB 1JNHA 5FYLL 5ICYB 2DEYX 1PZBA 1T66D 4PJXA 5TFSL 4DGIH 5C0CD 4GLRI 1TVBB 3LDBB 3WL9A 1TZIA 1XF4B 1BXXA 4NQXB 4B9KC 1V27A 4BGLA 3EOAB 5SWQB 3P4MB 3UTQB 1BQ5A 2OMBA 4C56B 3M8OL 4YUEL 1IQWL 2BC4B 4X4MA 1TU2B 1NOAA 5HI4C 2FRGP 3DDGA 2JJSC 2Z65C 4ACPA 2X4QB 4ZOCA 4NWUL 1KEMH 1EO5A 4QMEA 4PJGF 5KYXA 1TSRA 1RUML 3HE6D 3QDGA 2AEWA 4U3HA 3IAPA 4AC4A 5DEJA 3FBKA 2BDNH 1UJTA 3B1TA 3IB4A 1JN6A 3N50A 1MVYA 1P4BL 2ZP8A 4PJ7E 1ZV5A 1CF8L 3KBPA 2MQ3A 4OCNC 4YH6A 5F7AA 4KY1L 2XA8H 3GKZA 5I76B 2OK0L 2YD9A 1J0ZA 3DBXB 3D39B 4NZTL 1AAJA 4Y4FB 4JPVL 5GGSB 5AVVB 4LVEA 3HMWL 4JW3A 5AAMC 1GAFL 5T1DL 4WTQA 3UROR 2VZ3A 5JOFB 2V9UA 1BBJA 4FNUA 2OMTB 4BE5A 1EFXB 5IT2L 1DFXA 1M05A 2K4AA 5DVOA 5J57B 4P2QB 3IT8D 4L1HA 3TVMC 1YJDC 1I1AC 3DX1A 4GW4B 1LEGB 5HYJA 5E70A 5EPMB 4PRAA 1SJHA 4P9HC 5BVJA 3NYKA 4ZQTA 1OGAE 5IMKB 2AS5M 3BKMH 4JN1H 4K3EL 2R8SL 5GHWL 4Y1TA 4D0BA 1JAEA 3MV7E 2MTPA 3REVB 4LARH 1Z9SB 3JTSB 4U1KB 5CP3H 2YSTA 2WBJA 3GHBL 3HE7B 1EAPA 2F54D 3C6LB 1DLFH 3O6ML 5JW5A 1AOHA 1QTYT 5HGBA 4J3OH 3OLDA 1D6EB 1ZHKB 3FXIC 5EZOH 2BVOB 1ZLWK 3SD2A 5E00A 1UCBH 2QDVA 3VXSA 3HZKB 4K0OA 4WI3A 4LKCA 1MCKA 1R3IH 5C2BL 1UTDA 4JFSA 4LHUB 1IEAA 2YBRA 3B9KC 3TNMA 2IWKA 4TPRL 4GUCA 5LGYA 2BS71 5E8DH 3DYPA 4U3XA 1NANI 5FW6A 3G04B 1PU0A 3FU5A 5I66B 5D1QD 5KVDE 3KL0A 4HP5A 1I9IH 4Y2OB 4GS7B 1TCMA 5KVFE 1V7NH 4I0PA 1MHCB 4EN2A 3OKEB 3OXSB 2YOAA 3HJ0A 1A66A 1S78D 1XDTT 4HKJB 3EJUA 3BEWA 2KYIA 3ZE0E 3QIUB 5ERWA 1IGCH 3RTQB 5LBVA 2VSMB 3D0LA 4W4OA 2AKRA 4A2DA 4TUUA 4DGUA 5KG9B 1KJ3L 1PZ2A 3GWJA 4MAYA 3CU1A 4X99A 2YEVB 4AGPA 1DO6A 2JKSA 2XQYA 3AS0A 3T3PB 3QZWG 3QAZC 1SZNA 5AW1B 3ARGD 1HOEA 3HVNA 4H8PA 4WWKA 1ZKAA 1XGPB 2DQGH 1F5WA 2HFFA 3AXLB 5D96B 2D0FA 3BWUF 1FN4B 4FDWA 2D31B 3WDIA 1NCJA 4APXA 1JFQL 1CD1B 2B77A 2VXSL 3AGVA 1DBAH 1T7VA 4EUPH 3O3UN 1A0QL 1NGYB 3K1KC 2GSMB 2HFEB 3DHUA 1ZJAA 1TETL 3HUJE 1AHWB 3AG2B 4L0ZA 1XT5A 1P69B 5B7MA 3FQYA 2AJXL 4ODVH 1C5DB 1JGDB 2XXCB 5EIQA 3DVGA 5FA3A 4X7DC 3IF1B 3O2DA 4WIQA 2BSEA 3F3HA 3RVXD 4N2CA 4HS6A 4PJGE 5D7JB 3TX4A 1H6FA 4HEMA 2XZQL 4MQTB 4RFOH 1IEBA 1GC1H 1NBYA 3FCTA 5J5EA 4RRPG 4NM8H 4OT1H 1JPSH 2IQAA 4MJHA 4OW6A 1CDCA 5DFTA 5E03A 3G5XA 4IMKA 2QMJA 1BF5A 9PCYA 3QDJE 1Q4NX 3OZKA 4ELMB 2EDDA 4FERA 4ADIA 1U8HB 4MD0A 4ZODA 4OLYL 4R3SB 1H3GA 3QPQC 3EOYG 1CFVH 4QTHB 4KUZH 1G7IB 3RGVC 4ESKA 5H37A 2YAPA 2PCPA 1DCLA 5DQJA 2JK5A 1K8IA 5CS7A 5EC2A 3U7YH 1XHHA 3QZOA 2KL6A 2ATAA 4EMZA 4A7TA 3F7RA 4P4KB 1P53A 2KLRA 6FABL 4UF7C 4G9FD 4PRPD 5G5DB 1JXFA 4JPKH 5C0JB 1T7XA 2GC4C 2R2HB 1Z2KA 3THML 1UWFA 3WEAA 2J8OA 1SHMA 1PZSA 2AEPL 2WCSA 3I9GH 2WLHA 4LE8A 1YEIL 2B59B 2D3LA 4FULA 5T5NF 2ZWLT 2A9NL 4X80H 2J71A 5JPNA 4GT7A 4ODUA 2JJUA 2W07A 2YEZA 1XAUA 3CFBA 1LK2A 3F12A 3K5RA 3NP3A 3ZOAA 1OK0A 1HINH 4XX5A 4PW4A 1C5CH 5CD5D 4XP5H 3L7FA 3S5LG 2J8HA 4KTDH 4G83A 3BDBA 3BAWA 1ZTMA 2V2TA 3H1ZA 5AVQB 4JY6B 4H13C 1TQBB 1WFJA 2VE6A 3HS0C 4GMSH 4XOAA 5DCCA 2XWDA 1JNHB 4FNRA 4PJXB 1BJ8A 3B2XA 2B1AL 3PHSA 1TZIB 4J7RA 2B1OA 3QFDB 3TBWA 3WL9B 5IJCC 5GXBB 4PRIA 2DM2A 4W9FC 5G2NA 2QQQA 3ZT7A 2F8VA 3AREC 4DNLA 2DI8A 2VN4A 5F6IB 2D7NA 1T4KA 4I13B 2CGRL 2JVUA 5D93C 2V33A 1RKRA 4QRAA 3EYQC 4NC1C 4FFYA 5I26A 2ARJQ 2ODHA 5KYXB 2C4XA 5BS0E 3MUZ1 3T3ME 4ZOBA 3QUXA 4Q9RL 3UPRB 4XBEL 4A7VA 3T0EA 3L08A 2A9MH 1YY9D 1Q0XL 3R06A 2XN2A 2QTEA 4OCRH 1KB5H 3FU8A 3BAKA 3BAYA 5EUOA 3IGAA 5C09D 3QUMA 5IK3A 4R4FL 4U2YA 3O0RL 2Z31C 4A63A 2X4SA 4RVBA 1MCDA 3HC2A 3KXFE 3UBFA 5CBAA 4HS8L 4TYUA 4N5UA 1FCGA 4EN3C 1GS6X 5JW3H 1M05B 2TRHA 4MJ2A 1R3LA 3FS9A 4ZSOE 4F2ME 2DQCH 1DVFD 5HYJB 3I9AA 1JK8A 4PRAB 1SJHB 5I5MA 5BVJB 5LQBH 3F7PC 5EU4A 1O6TA 3LYRA 1AE6L 4K94H 4NPYA 25C8H 2EDHA 2H3NA 4R96A 2C9UA 4TNGA 1N4XL 1X44A 5LWYH 4S1DD 2FHFA 4DAGH 2WBJB 4NGHH 3NP4A 4TV3A 2CM6A 2IOIA 2P49B 2VOTA 1T20A 1U95A 4YBLB 5AB2A 1T7WA 5JW5B 3WLBA 5HGBB 1CL7H 1JE6A 1LDSA 2NNRA 2X0VA 4MJ6B 4OKDA 3TEWA 1MCRA 1GJIA 4GQZA 1M9WA 2J8UE 5JHDE 3KJ4C 2VLJE 3V4VH 5E00B 4R2GC 4NOFA 1RVFH 4JHBA 3VXSB 2OJZL 4LKCB 3VXUE 1A7NL 2DIBA 4HXAL 2C4FT 1J9TA 4NRXA 1CLCA 2FH8A 4YE4L 4J3BA 4NNYA 1IEAB 2P5WE 1KBPA 2YBRB 4Y16D 4ZMVA 2ZXDA 1OGPA 3T3PF 2ICCA 5GGQH 1X5XA 1A1MA 1V55B 3DMMC 3U0TA 1N0LA 1JPTH 1BG1A 3BGFC 2QZ5A 5B8CA 1SLXA 3VXPA 2AANA 4HJ1A 2EE6A 3FSAA 1KLUA 4OJAA 2AW2A 4IU3A 2NY1B 1E4WL 2B9AA 3MJGX 2CPUA 3U0WH 3BEWB 3IETB 5E6IA 4I3SH 5L6YH 5ERWB 4Q9CA 2KDGA 2WO3B 2EECA 3D0LB 3F83A 2AKRB 4XE0A 3PV6A 2WB1A 1CBVH 2ICEA 4PSRA 4X99B 1NC4D 3JUYA 3WS6C 3CLEL 4XP4H 3VFGL 2RHEA 4AIZB 4YDVA 4HZLA 4YMPA 3ARFD 4DP5X 4WFHE 4G8AC 3QR0A 3V4UL 4GUPA 1L9PA 5E7FA 3Q7JA 2HFFB 2EE9A 1HL5A 2FX8H 1SVCP 2PP7A 3IVKA 1IBHA 4APXB 2K70A 4U1NA 4A67A 3A47A 4FQXC 2H2SC 2C9SA 2NY3D 4Z95H 5F7YC 4WW2A 3UBXG 3VXRD 3CN4A 1U3HA 4L4VE 1NAMH 5DWUH 4ELMF 3KL5A 3MBEC 3UOAB 3KPLA 4AKOA 4HC1A 5FA3B 2E8ZA 3K91A 4HIPA 4MCYA 3MTXA 3ZY7A 3DTXA 4HS6B 5AL0A 1NUDA 1ANUA 1YAZA 4Y4FD 3VFVA 3NOIA 1WD9A 1FV1A 4TVSa 1QBBA 1IEBB 1NBYB 4GQ9L 4NO5A 3FCTB 2CO4A 3KR3H 3D09A 2JKRM 2IQAB 3BZDA 5DC9B 2EABA 5JXAL 4OB5H 3G5XB 5ESQB 2WNGA 4NQDD 5DGQA 3HLAA 1WICA 3BUTA 1YEFL 4E9SA 4GAFB 1QVOB 4QPEA 3VD7A 1I3GL 1JPGA 3E3QC 4V1DD 1N5YL 3KGRA 1AI1L 4LNRA 2NNCA 2BZDA 3PL6A 2X9WA 4RSYA 4GQQA 3FT3A 1EO8H 3DX2A 5FYLH 2PCPB 5EC2B 5DQJB 2JK5B 3MKKA 2WXHA 5TFSH 1FG9C 3BDXA 3BT2L 2X53A 4HA1A 3PAYA 1FO0A 5J12B 4YC2C 2CH8A 5HJDA 1XFPA 4DFIA 2YOCA 4YUEH 4P2OD 1ERNA 3MJWA 3ALPA 2ZCKL 4HISA 2X9YA 2JSFA 3FYIB 2DWTA 4NWUH 2E86A 4PJXF 1RUMH 3D50A 3GGWA 1W9XA 4ODUB 3TA3A 3TF4A 1KCUL 2OMVA 3CFBB 1LK2B 3F12B 2EE3A 1M7DA 2TRYA 3UTSE 1IC5L 1CF8H 4P57B 1JYWA 2YXMA 4OGZA 3DX6B 2EH8L 3OM3B 1QNZL 1DVZA 3VFPB 1CFTA 4LDOB 3L7FB 4KY1H 1NGQL 2OK0H 4NZTH 4JPVH 2IV8A 1AHMA 2V2TB 2MOGA 3C60D 3FC8A 1JZEA 4M56A 1KTDA 2GUYA 1GAFH 4X4XA 3EOTL 2VE6B 5T1DH 1XTMA 3ATBA 4OFPA 1I9JL 2GKIA 3CZKA 4ZX3A 3DRQA 4MS8C 5SWSD 1AOZA 3TBWB 3UTTA 4GG6B 1N6UA 3FQTB 5IT2H 1RJZA 4LVNC 4P2YA 1BQHG 2JQZA 3H3PL 3ZZ1A 1T4KB 2W60A 3P73B 2BCMA 1B4TA 4X2UA 35C8L 3W0WD 4R4ND 3KLHC 4XXWA 4DJMA 1MN4A 1RXLA 3RURA 3VG0L 2G3ZA 2F7PA 4K3EH 2R8SH 5GHWH 2QPUA 3KW8A 3NAAH 2YD4A 3QUXB 4R7LA 3I85A 1QHPA 5JIKA 3R06B 4NUPA 3GHBH 3VXOA 3RPKA 1F6LL 2C4FU 3VGDA 1V7ML 3BP4A 1F6FB 4FLHA 3JWNC 4PJ8D 3SGEH 1KV7A 1QEWB 3O6MH 2VKWA 5HD8D 1J11A 5DO2D 1D7DA 5DVMA 5EUOB 3IGAB 4FQ2L 3MA7A 2QVFB 3QUMB 4ZQKB 3QVAA 5DEGB 2A3TA 3SDDD 4NPJA 5H8DA 1PFCA 2X4SB 3L1EA 1KELL 5CBAB 2Q1EA 1MFAL 1MHPL 3QJSB 1PG7W 2D03L 3TONA 4F15C 3EYFA 1PF3A 3BUYA 4TPRH 4W9CC 2PCFA 4QJ3B 3TZVA 1WQVT 3WHE0 3RFZC 3HTLX 5AKVA 5E24E 2VO5A 1KENL 2OULB 4N2KA 3TP4A 1JK8B 1TTAA 4IK7A 3MGTA 5EU4B 2NCEA 2MCMA 1KGWA 4YHKL 2VJXA 4NPYB 5M95B 4JHZA 2APBA 2H3NB 3OF6A 5I1DA 1AR1C 1DZBA 5MENE 1WSST 4PJ9C 2HPTA 1QP1A 3HBGA 3OX8A 2VR7A 3TBCA 2C9PA 4OZIA 1T20B 1U95B 1P9MA 2EH7L 4PQXA 4G82A 1CMOA 1OB0A 3ZKND 2A4EA 2NR6C 2QL1A 2WUCH 4W1TA 4WW1A 4J3XA 4ZW3A 1R5WB 4JUTA 4HF5L 4AK1A 4KC3B 2FECI 4KZEL 3C87A 3IMWA 1L9QA 5EZLA 3W5MA 3FQNA 1JFQH 4NRXB 1LTXA 3OC5A 4HGMA 3SBRA 1D9KC 3KAAA 2VXSH 4NNYB 3V6OE 4FD0A 5J56B 3R4RA 3BFOA 1FVEA 1A0QH 4OLXL 2CUMA 2APTA 3R8QA 2NY6C 3PWLA 1TETH 4ZFOA 3K4ZA 3U0TB 3UCQA 1N0LB 3JWOC 1CLOL 3VXPB 2OAAA 1KLUB 4BWWA 4IU3B 4JO1H 4X6DE 3BAEL 1KOAA 1VA9A 4L05A 1HYSD 5E6IB 1BD2E 2NUTA 1NAKH 1NIAA 2IF7A 5ACMA 4BEIA 3WTSA 4EJ1C 4AY0A 1J8HA 3AG1B 2BVPA 1TPXC 3OSVA 2R7EB 5FLUA 2N0KA 2D7MA 3PV6B 4UMGA 2ICEB 1AGFA 2IG2L 1AYRA 1U3NA 2ICWA 5K33A 4F7KA 5IF0B 1P4UA 1B2WL 4ZMOA 2W9LA 3I84A 4FNPA 2MQ0A 4N2LA 4QGTA 3IJSB 4HZLB 1A21A 3CX2A 1UZGA 5AW0B 1XEUA 4D7BA 3R7QA 4GUPB 4KUCD 1H6UA 4OLYH 3KWTA 4NM4L 2LOEA 1JZFA 5G55A 3IVKB 4U1NB 4JO4L 1Q8MA 4GG8A 4TTDC 4XB8A 1PSKL 1GRWA 1MG2C 3AJ7A 2Q8AL 1BXVA 3QDGD 6FABH 4WW2B 1UGKA 4J3OD 3VSVA 5IZ7A 1S7UB 1U3HB 1MY5A 4N86A 5EOTA 2R1WA 1M2OA 1PLCA 1TMCB 3DX7A 3DX4A 4YVUA 3KPLB 4BA0A 1MAJA 3THMH 3CN0A 3N9GL 5IVXA 2FR4A 1KPRB 5IQLA 1H0DB 4MCYB 4QHMA 1TZHA 3GSXA 3DTXB 5HYQA 3W57A 3VFVB 1CICA 2Q2LA 2XVBA 2A9NH 1II4E 5DHVA 3JV6B 2UWEE 1RSFA 1F4AA 1K4CA 2BP8A 3H2PA 4C4KT 1XF2A 2IANB 2FNWA 3IEAA 3OG6B 4ODWA 2ITCB 4XC3H 3DI3B 4GEIA 3PU7A 3HLAB 2MCPL 4DP4X 2DQFB 4WTZG 2HG5B 4UTCA 1JPGB 2BSRA 5IW1A 2IGLA 3CNKA 3IXTB 4UOZA 2QKSA 5HYJD 3FT3B 3GXDA 5IEHA 1A4CA 1J9CT 4DP7X 5FYKL 5AFAA 4KWUA 1BZDA 4EE2A 2B1AH 1JDAA 4JRYE 4R7DB 4KTEL 5DC2A 5C3TA 5IREA 4ZNEA 4LU5L 1WCQA 5JZ7D 1FO0B 2DMKA 2J1KA 4DKDC 2DJ4A 5E99L 3K8MA 3WO3B 2WBJD 1NIFA 5CJXC 4YDJB 2CGRH 3H4FA 3VWJB 5KBMA 3GXUB 1PZUB 2ZWZA 2QQKL 2C9XA 5KVDH 4PS8A 3W82A 2WD0A 2G75A 1QKZL 2VL5A 2X7LA 5EIIG 4GG6F 2ZCZA 3GGWB 4TNWF 3TA3B 2OMVB 5E1IA 3VXSD 4XBEH 3DNKA 1DJZA 1RI8A 1Q0XH 5FECA 1M7DB 2AEIT 4KKCD 1BZ7A 3QDJA 3PYCA 3WTVA 4DQAA 1CFTB 1JVKA 2F53A 1KDJA 1VZIA 3V0HA 4F93B 2OJ1A 3C09B 3GI9L 4OQTL 1OK8A 3WNJA 2IPKB 4GXUM 7PCYA 4R4FH 2D7OA 4X4XB 2GABA 3O0RH 2YBGA 4I0PD 3OSKA 2WOBA 3DRQB 2NY1D 4TQIA 3FFDA 4HS8H 2EXYC 3UTTB 2DWEB 2PUQT 1RJZB 5D5MA 1ZK9A 4PIRF 1F3RB 4P49A 3CX5J 5CCKH 4FMFA 1N19A 1OLZA 2WYHA 4W9GC 3U2SA 4P07A 3RIAF 1RPKA 2Z4QA 5EUOF 2W60B 3FMGL 4MAYD 1IAII 4WNSA 4WKZA 5KSAC 1JBJA 3OZ9L 4NQED 3ZXAC 5LXGL 1AE6H 5T1KD 3EHBC 5LGHH 1JYXA 3ULUE 2DMHA 4WWKD 2YAHA 1N4XH 4AYGA 1KLFA 3FUDA 1CLYL 1QFUL 4WWPA 4WEUD 5LAXA 3VXOB 8FABB 3NEXA 2ZG1A 1LGVA 3BP4B 1L3NA 3ILDA 4Y2NA 5TQ0L 3CN1A 1H3XA 1PZAA 5BRZB 1FJ1A 1AQKL 2H0EA 4N5ED 4H25A 5MI0C 1W6WA 3FAXA 3QIWD 2B1HL 4LP8A 3N5AA 2EIEA 3MA7B 3GKWL 2XTJB 5EEVA 3QWOB 3WG7B 2OJZH 4Z78A 1A7NH 4TULL 4HXAH 3PWUA 2BSED 1A6PA 4YE4H 2PYFA 4JFZL 3BEVA 5C07B 4QCIA 3EYFB 5D72L 3BUYB 2BVEA 3WFDL 3EJCA 1AZBA 2K3TA 2PCFB 3VD9A 3WY3A 1WVZA 3VQLA 3GM0A 1RP8A 1J48A 1IKFH 3MA9L 1EHLL 2P5EA 1L3WA 4XPFL 4HEPA 4U3SB 1BDYA 2B2XL 2OBGA 1DBML 1AG0A 4R5TA 3L9RA 1E4WH 2WLYA 2IBBA 3AADB 5B38G 1KYDA 3ZL4L 2NY0B 2ZSVA 2O93L 3BZFB 2EDRA 2AJ3A 3AC0A 3HA0A 3NJXA 3QK0A 3ZJAA 2BNUA 3OX8B 1H3UA 2GHWB 4ZAKA 4FQIL 4OZIB 1KCLA 1PX4A 3KGSA 2WXPA 4FLOA 5IVZA 3CLEH 2WLNA 4ZOAA 3VFGH 3EGSA 1MLCA 4MBRA 3G08A 4WW1B 3RGHA 3V4UH 4P5MA 3QW9A 4W9EC 5TH2A 1YY8A 2RQ8A 3HG4A 4FA8A 2XVLA 4OGYL 3AM8C 4OZFA 4K8RC 3WMPA 3DXAE 2DYSB 5EZLB 3SN6N 1L5GB 3FQNB 1JWUB 2JQMA 2WVUA 5GS1A 1SMDA 2E47A 3D18A 3FU7A 1AHKA 1CK0L 2Y69B 4FQHA 4FYRA 1JSYA 2R69H 4FKHA 1N26A 4UTAA 1O6SA 2ZE0A 2CCWA 2BIMA 2HRHA 2N1TE 2J5WA 1IAIM 3IDIA 2BXYA 3KEHA 2VZVA 3GZOA 1E5ZA 4KDVA 3PREA 5EZIL 5IROA 4HU8A 4HJJH 1XSJA 5DRZA 3RVTD 4Z7QE 2Y1AA 2NUTB 5DJCB 3PFUA 5JPMC 1E7VA 2CGZA 2GJRA 3P9LA 5DHEA 2EYSA 5SV3A 4KRPC 1J8HB 1XF3A 2BVPB 1EGJL 3ARYA 4GEJA 4GQ9H 4WW2F 5AKSA 2NXYB 2CA4A 4QHNA 1AGFB 4AGMA 5JXAH 3SDYL 3S48A 5HYFA 4HCRA 3IGUA 5ISZE 3HPJA 1YEFH 4PRID 2LTQC 1K5NA 1I3GH 2DEWX 2OP4L 3ZKQD 4BIKA 3KVPA 5JA8B 5EN3A 3WS3B 3ZR5A 2UUDH 1AI1H 2R27A 1CJYA 3W38A 5J6HB 4OIAA 3JSSA 1YQVL 4M5ZL 4ZFGL 1INQA 5C0FA 3SYAA 3D2TA 4GG8B 4P05A 3WN5C 3BT2H 1K6QL 4FS0A 2B3IA 1P7KA 5E8PA 1O7DC 4HU2A 4DIXA 4XHJC 3QUXD 4I9XA 3P4NA 3JTBA 3T0ED 2R1WB 1KPVA 4Z3HA 3DX7B 4F7EA 4W9ZA 3CDZA 3BX7C 5IVXB 2FR4B 4AIOA 4PLJC 2ZCKH 3L5HA 4KMLB 1F18A 4QWWD 3HN5A 1MCIA 1TZHB 3GSXB 4QHMB 5HYQB 3TS8A 4XE5B 5EHFA 1CICB 4YIQB 5DHVB 4XVJH 5H4ZA 1KCUH 2OYLA 1K4CB 2KI6A 4DZBA 1MI5E 5MEOA 4ODWB 1IC5H 2ZXEB 3LPWA 1UVQA 1XGUA 1WIOA 2YZ8A 3DJ9A 4FQQA 1N3NA 2EH8H 2FJHA 2DLFL 1CG9A 1QNZH 4IBLT 4KK5C 2BOLA 2Y5EA 4BFJA 5JOEA 1NGQH 5F7MC 4ZZKA 2BSRB 5IW1B 1I8MA 3H0TA 1QLFA 4HUUA 1DUZB 4D0CA 1WHOA 3V0DA 6CGTA 3HFFA 3EOTH 3ZYJA 1K9TA 1I9JH 4ZUTA 2PLTA 5IUCA 2BFVL 1KGXA 5SWZE 4MNQD 3S88L 1XL6A 5D1ZD 4LLDA 4TQPA 4FNQA 2HVBA 2KLTA 3H3PH 2IALA 4TRPL 4EI5C 1LILA 4POYA 3IGKA 1T6BX 3DIVA 3WKQA 2WQAA 4WI0A 3VSUA 35C8H 1N9PA 5HVGB 2YRLA 4R84A 3B7YA 3LPOA 2IAMD 5DMGC 3VG0H 2G75B 2VL5B 3C5ZC 1NL0L 2HT2D 3L45A 3VACA 3I6KA 4GW5B 4FFWD 2J21A 5I18L 2GK0A 5FECB 2C3HA 1BZ7B 2V9TA 1V7MH 1UA7A 2FD6L 5FYJU 1G7HA 2CO3A 2IC2A 3PQYA 5CEYA 4X0NA 4WAFA 1NLBL 2F53B 4I3RL 4QXGL 1XCXA 3IMUA 2NSXA 4AUUA 4FQ2H 1FIEA 2YO3A 1UD2A 4I2XB 3C2AL 3T0DA 5F2FA 1MCQA 4FFZL 5HHOA 3SO3C 5BQDA 1X5FA 3N6YA 5AUMA 5EU5B 3FFDB 3MUY1 3E9TA 3WNNA 3UTZA 1MFAH 1MHPH 2OSWA 5BO0D 4KNQA 5TDOA 3L5IA 3QHZL 4PBDA 2D03H 5D5MB 3BW9A 3U2SB 1HWGB 4NSKA 4F5CE 1HEHC 1CXEA 3FPXA 1Z0NA 3FT0A 1NUNB 3V5HA 2BHUA 3E6HB 1OL0A 1KENH 1I8KA 3GINA 3HEIB 4LESA 4HPOL 5AW5B 4YDIL 2LFGA 4RETB 4Y8AA 5FR3A 1S9VA 2HKAA 3PPSA 2QHLA 4YHKH 5E0FA 4AQEA 1FNSL 2NUPA 3ZIYA 3F65A 4NRZB 1CU4H 3NIDB 2DJMA 5JIIA 5GJTL 1I82A 1KLFB 3K4AA 5LAXB 5EV7A 3NQIA 3DJRA 3GSNA 4AG4H 1VZGA 1F42A 1A5FL 1TITA 2EH7H 1FJ1B 1KG0A 4I3GA 4RA3A 5JOPD 1NDGA 2ZD0A 2J4WL 2VISA 3ZL2A 4KVNL 3D2UD 1U3HD 4PBVC 4HF5H 4RGOL 3DOHA 4KZEH 3T1WA 1OAKL 1Y0LB 3GJFH 4FFYL 1OM9A 4IHOA 4LXFA 2CO1A 1A7BA 4GKSA 5IJKA 2PYFB 3FO9B 4OZIF 2HTKC 3BEVB 3HZVA 4QCIB 4AMWA 5LCVL 5E5LA 3NABL 4IGBC 4JFDD 4LCWE 2UX7A 4FJZA 4LOVA 4OLXH 5HJ3A 1DTUA 3RE0A 1Q90A 4B95C 5D7LE 2X4NA 1VFBA 4POZC 3B3IA 3NK4A 2P5EB 1CLOH 2HFGL 3GTNA 2E4FA 4D9QE 3QS2A 5T33L 2L8AA 3MNZA 4APQC 3BAEH 4N1EA 3KLAA 4BINA 4HIIA 2FIKA 4KJQD 3RB7A 4NZJA 4CKVX 3TGXA 5AVZB 3PL6D 5HSFA 2AJ3B 3EFDL 3U0PA 2BNUB 3RA7L 3KJ6L 4XPTL 4XMPL 3KPRD 2IG2H 4OI9A 4L8DA 5TGBA 5IVZB 3ZKMD 1B2WH 5DD0L 2KPWA 3SCMA 1P7QD 1CXFA 3EGSB 3NJHA 3UAAA 2H3KA 3G08B 3FT1A 1QFWM 1AFVH 4ANWA 2CHZA 2R9HC 3JT2A 1F4YH 4HKBB 4P5MB 4KX9A 1YY8B 5TH2B 5EEXA 1ZHBB 4NM4H 5D4JA 1UKTA 2A77L 4JG9A 3SPGA 4YK4C 2VDOB 4JO4H 4KK6D 5GS1B 4CSSA 1PSKH 4I88A 2Q8AH 3D18B 3FU7B 4NZFA 4IIZA 3GMNA 5EN2A 1RIUL 4FQHB 2CJUL 1FYTD 2LV4A 1KXVA 1KWGA 3MYZA 1DVXA 1O6SB 4PJHA 3SDXB 4B0MM 2TAAA 4M02A 3N9GH 4UT9L 4R0LC 2DM7A 1T66C 4ANXA 4HWZA 2D8KA 4U7MA 4MBOA 3TWYA 3LPPA 1KEGL 1WLHA 1MFUA 4QKXB 3P9LB 2Y3AA 2EYSB 5MENA 4NZUL 1XF3B 1XF5A 4O2FA 2JCCA 4D2NA 2XFXA 3VD0A 2ESVA 4AWJC 3TEXA 2EEBA 2R51A 3CIQA 2VUOA 4MMXC 3RZCC 3UTTD 4AM0Q 5AD0B 5IVXF 3OJDB 3P30L 2MCPH 4ZMTA 1YEDA 1S5IL 2V0AA 2X10A 1K5NB 3NPZB 1OQXA 4G7QB 1KY7A 4UUJA 4E9LA 2F5AL 2ZX6A 2W1NA 3KCPA 2X9ZA 4A37A 5J6SA 4A04A 2MKLC 5C0FB 4P2RD 1INQB 4DKEL 5FYKH 1OAUL 4P3CL 4BA8A 5ES4B 1BAWA 1Z9PA 3VM5A 3EJPA 2HPOA 2CRIA 4GKOA 5DZLA 5E8PB 1HDMA 4KTEH 3DIFA 3LKRA 4PJCE 3V8CA 3WMSA 5HVHB 5BRZE 5J9PA 5E9DE 1KYOK 5E99H 1KPVB 1KCSL 5LBSL 4F7EB 3CDZB 1C1EL 1GOGA 4X6DA 2BIIA 3MOAH 1GR7A 2QQKH 2XI9A 3SBPA 6PCYA 2O5XL 1QKZH 4PY7B 4YQXL 3ATDA 2XTJD 3H8NA 4AVIA 1NZRA 3PP3H 1RY7B 2GSGA 1WBZA 2LU4A 2NY4D 2NSMA 4PYHA 5MEOB 1Y1DA 2QPSA 1UVQB 3O3EB 1XGUB 5CZXD 4FQQB 1T89C 4Y1AE 3EDDA 4IBSA 2HLEB 3BWSA 4MD4A 3TZVD 4C55A 5JW4R 1ZWIA 3N3EA 1UURA 4N9GA 3GI9H 4Z7UA 1RP9A 1OB1B 1RZ8B 2DWSA 3H0TB 4OQTH 1I8MB 3SGJC 1QLFB 4HUUB 5LN4A 4HC1L 2WY3B 5KJ4A 1PY0A 4AYID 5HP5A 4KROD 4L9LC 4PG2C 2A99A 1QWHA 4BCYA 4F7PA 3OF6D 4LLDB 4RESB 3B7RL 1E42A 4FXKC 3N1QC 3IJHA 2IALB 3NT0A 4JL1A 1OSZB 5AWNL 3OMZA 1MFNA 3FN0L 4WI0B 4AITA 1OQOA 2F7RA 3ZHFA 1CL7I 3FRPA 1COBA 3V9CA 3OZ9H 3EIFA 3PGDA 5J1AB 1J12A 1ED3A 3GSOB 3LV3A 3N2JA 1YSOA 3I6KB 3OZLA 3WKYA 2UWEA 5D1QC 1XSIA 2GK0B 1TVDA 2E46A 1CLYH 1QFUH 3BMWA 2X42A 1BLIA 4QF1A 4POUB 3TT1L 1G7HB 4OD1L 3PQYB 4ZBJA 5CEYB 5TQ0H 3VAEA 2A83A 3DVNB 5E6YA 1AQKH 4D8PA 3ETTA 5H35A 4QO1A 2B1HH 4TLUA 3UAFA 4JREB 4XX1E 3VB8A 4G8FA 3GKWH 1SN5A 1EHXA 1JDCA 5HHOB 2IOOA 3NIDF 1YLBB 2VH5L 4L3EE 4TULH 2G3XA 5AUMB 3BH4A 4NN7B 1DEEA 4JFZH 2VDLB 1KCRL 3UMTA 2Z7ZA 3MV7D 5D72H 4MVBD 3ARGC 3B5TA 3CHPA 4LVOB 3BW9B 3T9WA 3WFDH 4WFGE 3Q6GL 1P7HL 4JRXB 5K9KA 3GHEL 4JM2A 4NSKB 3PLYA 3CFEA 3IFPA 3TNNA 2P1YA 3LD8B 4EQ3A 2NXYD 3MA9H 1AMYA 4WO0A 4AW7A 1EHLH 3QARA 4KHTL 4YPGA 1I8KB 5DHDA 4XPFH 2FEEL 4DEUA 4WI7A 4J3OG 2Z1PA 4TNEA 1DBMH 5I1JL 4HUXA 4AQEB 3ZL4H 4RDQG 2WXKA 4E9WA 2OKMA 4LOUD 1NGWA 3KD4A 3M86A 3GMQA 1OAQH 3US1A 1IGFH 1O9ZA 4FQIH 3GSNB 4Z7OE 4MJIA 1T80A 1ADQA 3RVXC 5A2FA 3QO1A 4J3SA 1NDGB 1VACA 2VISB 3O4OB 3V0JA 3D4CA 1NKRA 5J3HC 3FQ1A 3VH8A 1J0JA 1F4WL 4NKDA 2QSTA 4IHOB 4GKSB 5K93A 2Q3AA 5I6XC 4WU7A 2C1OA 3HZVB 2BOCA 3U79A 5E08L 1WA1X 4IHBA 2A6DA 3EJSA 1CK0H 4JY4A 5HJ3B 4XO3A 1IBZA 4KX8A 1VFBB 2O26U 3DI2B 3SKNA 4TQHA 3G6JE 1GYCA 4B9GA 1UFGA 3ZKSD 5EZIH 3ZTDC 4ALAC 3KLAB 1K8DA 3IXAA 1DCEA 2FIKB 1DVYA 2ZKYA 4L8SC 1TUPA 2VGLM 2VXQA 3MGOA 5FOJA 2VDPH 1NCGA 2BVYA 4K07A 1EGJH 4DOHE 3MV8E 2YJQA 1WZKA 4LB8A 4L8DB 4TUKL 5FHAL 3EDFA 5TGBB 3SDXF 4A2LA 3SDYH 2NX5E 3SCMB 4AGQA 1XX9C 4O02A 1FIGL 1DJIA 2JE8A 5C0IA 2BPBA 5JIHA 2F08A 3VGEA 1J5IA 1DL7L 1H8OA 1OVZA 2OP4H 2ZOKA 3GMMA 4QRRA 4XGZA 1SJEB 1CIDA 4G8GA 1X9LA 4UQ3B 4OFKA 4XPAL 1YQVH 4ZFGH 4MJ5A 2LT9A 1J88A 5CD5C 1K6QH 2HAZA 5EN2B 1E4KA 5DVKA 3RHWK 5DD3L 2DL9A 4KXZH 2H4EA 4GP8B 2O6DA 2VQTA 2G30A 4PJHB 5HTSA 1QMUA 1EZLA 5GGRA 1X5ZA 1ZDSA 4I2XE 4W9DC 1FPTH 2A4ZA 2YXVA 5EG6C 1BPVA 3AAZA 1ZT7A 3QDJD 4HWZB 3H9SE 1NH6A 3BISA 2JTDA 3F7LA 5IBLD 3CXHK 1KXTA 2A6IA 4LOEA 3TV3L 4NT6A 3GXFA 5E2VL 4GH7B 3C5SA 3DV4A 4H7VA 1X5KA 2Z8VC 4U0RC 4OV5A 2JCCB 5DDHA 2X09A 3CZUB 3SOTA 5IWLA 4TMPA 2VABB 2RMNA 2ESVB 2FAUA 3QNFA 5I0YA 1TG8A 2DLFH 1ZA6A 1YEDB 4CN1A 2RBLA 4AGNA 3FF8A 4UUJB 4N25A 3KGUA 3DXAA 1YY9C 1G9ML 3GSWA 1Z3GL 3QIBB 1HHGA 3KCPB 3NIDE 4Z7NF 2IWEA 2PWEA 5F7FA 3L1FA 4OFDA 1VB9A 4YBQD 3TO4C 3QB7C 1OZUA 2WUBL 2ZT9C 3ATAA 4JO8A 4M6ML 3NCFB 2GI7A 2XY1A 5EZPA 1OSPL 1NCAH 2BFVH 1G87A 3DIFB 2APSA 3LKRB 3GS4A 1DUYA 3S88H 2QQNH 1PX3A 1M9SA 2BMKA 4FQCL 4ZK8A 4F91B 1ET5A 2ZX7A 1JHKL 4TRPH 2CDGA 1XWVA 4Z3TA 4M93B 3IAGC 4NP4L 3SGEI 5BW7C 1RIHL 1RZJL 3VXQA 1A4AA 3Q1EA 2HJLA 2VZOA 1AGEA 2XWZA 4IOIA 3SBQA 1XV8A 4HMCA 3QWRA 5SV4A 1DEDA 1NM9A 1GMIA 2IPUG 4GB9A 1DBJL 1NL0H 3MLYL 3WUZA 2FCBA 2DQDL 1KUMA 4ORZC 5I18H 3OLIA 1DVFC 2GSGB 4QNPF 4OQ1A 4F7TA 6TAAA 5L2JA 1UZ6E 1YC7A 3J2PA 4BK5C 2FD6H 4Q4IA 1ODAA 3HAEH 1CI5A 1MJUL 4N6QA 1NLBH 1R4XA 1J5CA 4MD4B 4I3RH 4L4TA 4QXGH 5H37G 3X11A 1ZWIB 3ML8A 4N9GB 4YDZA 4NENA 3LZFL 4S1DC 3C2AH 1YAIA 1NTDA 4ZPTA 4FFZH 2VR3A 3QWQB 5D7IA 1G0DA 3QRLA 1DSWA 5BS0D 5CSZA 1HKLL 3QHZH 4F7PB 1PEWA 1YG9A 4XCFL 3WUWA 5CIPA 4Y19A 4NNXA 3CC5A 3ZQWA 2K9UA 4ZAKD 4OD2A 4YHPA 1VFMA 4PRBA 4HPOH 2FSDA 3GYRA 4YDIH 3FRPB 4PVLA 3RI5K 4M5SA 2EJ1A 4A2FA 4Y16C 3LRHA 1ED3B 3LV3B 1FNSH 4HGKC 5CWSB 5E8NA 5DJ2B 1XGZA 4TL4A 2HSIA 5F0JB 1SN2A 1FNGB 1J9QA 1A8JH 5GJTH 5FV2A 1MI5A 2BNQA 1H8LA 1DJWA 5C0BA 5ID1A 4QF1B 3KYAA 1AKPA 4UOQA 1QSFE 1S4IA 2NNXA 2A83B 1A5FH 3S3JA 4D8PB 1LEKA 3SGDI 2J4WH 4QO1B 4KVNH 4A7GA 1IC7L 1JG9A 4G3YL 4FADA 3NCCB 5T1LB 4G8FB 1Z9MA 4RGOH 2XV6B 3WXVL 1RL1A 5JO5A 2VITA 4PRHA 1OAKH 2ZAIA 2L7EA 3LDBC 2OXGA 2FHCA 4NPKA 5A2CA 2DKUA 1DEEB 3P2TA 2YPVL 4C57C 1DJSA 3BRDA 5LCVH 5ABAA 1B6UA 1V3LA 3ARFC 3BIKA 3NABH 4DQOL 5GIRA 5DZJA 5K9KB 2YQBA 2QBWA 2WXJA 2R4RH 1UATA 5T5FA 3CFEB 3TNNB 3UAJA 2Z93A 1SY6A 3KS0J 5I6MA 2Z31A 2HFGH 4YPGB 5DFVD 5DK2B 1V54B 1UB6A 4IBQA 2AI0L 1C16A 3DKHA 3OAZK 4X8JB 4R6UA 4PLNC 2A9AA 3LPFA 4HOWA 2XPGA 5FK9A 5DTFA 5DC0A 3TBVA 4WSGA 1NGWB 3GMQB 3EFDH 3JTTB 4UQBA 3QORD 4EBQL 2ZKWA 4XCCH 3RA7H 3KJ6H 3CFCL 4XPTH 2P5WD 4XMPH 4XNBA 4B27A 1CO1A 5KSBE 1CVRA 4MJIB 3GMLA 4YBHA 5DD0H 1VACB 4KY2A 1N6QL 4Y4FC 4GRWB 2FIRT 1EBPA 2QVMA 3VXME 3MCKB 2XYCA 2FJFA 4DUVA 2J44A 3VH8B 4XO4A 4Z7NE 1C8PA 2A77H 4NKDB 2PO6A 4AVJA 2YUWA 3MNVA 3D08A 1QUPA 3B7TA 3L95A 1MWAL 3NPSC 4WU7B 2C1OB 4KO6A 3MRBB 3W2DL 3Q06A 4PS3A 3IDXL 3RVVD 1UEYA 2A6DB 2R0ZL 3IMVA 1RIUH 2K9FB 2CJUH 1AD0A 1OW0A 1BZ9A 2E75C 3EJQA 3SKNB 3G5VA 4WUUE 3X14A 5CEZL 4UT9H 3P3SA 3Q05A 3QDHA 4HK0A 1DVUA 4CGTA 2MSPA 1BEYL 3X1FA 3LN9A 1L9OA 1QWUA 3DOSA 3DUUA 2QGDA 1K8DB 3IXAB 3L17A 1KEGH 1HCYA 3A5VA 2BSTA 4WFHD 5DJ8A 5IJBC 2X2YA 1JPST 2DYPD 4ABWA 5I1IL 3MGOB 4CVUA 1HL4A 5F7LB 1IE4A 1HU8A 2Z91B 4NZUH 1QUNA 3LY6A 3HE7C 4P2OC 3IE4A 2AABL 4CMHB 2ZCHL 1L9TA 3P30H 2OQJA 1N6VA 5C0IB 4TSCL 1S5IH 1ZT4A 4FTVB 4L4VD 3F7VB 3GMMB 4YX2L 2ZOKB 4NI3A 4PMEA 3V0GA 4ZXBA 4QRRB 4RMVA 4XGZB 4F9LC 1IGIL 3C5JA 4G8GB 2F5AH 3TJEL 4GOSA 2I9LA 4DKEH 2JCCF 5ITBL 4PG9A 1OAUH 4P3CH 4UQDA 2ZAGA 5FKAA 1ES0B 2NXZD 2WCPA 3MBWA 3QAZB 1YMMA 4GQPH 2PWDA 2AGJL 2X6AA 3LKQA 3O6KL 2MOVA 3QEHA 1KCSH 5LBSH 5GGRB 2GT9B 5L4IA 4RSVA 1C1EH 2JJTA 5FGCE 4IBUA 4NO0A 3IKCA 2F7IA 3CQFA 3ZSTA 4ADGA 3ZRCC 2IAAC 1E4XH 3QR1A 3U83A 1BV8A 2O5XH 1KXTB 5D9SB 1FVCB 3FW6A 1OP3K 4YQXH 3C5SB 5CMAA 3O3DA 3ROLA 3ASOB 4PLOB 4OV5B 5DDHB 2H6PB 4PJEA 2AQTA 2DI7A 3RVUD 1OCRB 1G0XA 5I74B 3U25A 1GKOA 1ETB1 2EXTA 1AO7A 4JDEA 1W91A 2W88A 4EKXA 3RUGE 1ZV2A 4RIRA 4ZMYA 1CR9L 1MNUL 4UTAL 3RNQA 3GSWB 3J27A 3FUNA 3EADA 3BKCL 1E50A 1C12A 2ZUWA 2H45A 2MCG1 1HWHB 2YKLH 1DVTA 4WGKA 3WIHA 5LNGA 4QHKI 2G5UA 1BXAA 5F7NC 5I1GL 2XV2A 5HD8C 1SEBA 5DO2C 5ALBH 1DUYB 1IGML 1MRDL 1AHWC 4ZTOH 5I8OL 1JZGA 2HT4D 3LXBA 4KO7A 2CDGB 3CN2A 3RGVB 5AWNH 3VXQB 2EP6A 4HCRL 2HJLB 4IOIB 1Z3RA 2YFOA 2J20A 3RWFB 2C9QA 4RGMB 3ZTNL 2LU5A 1NINA 2X4OA 3MXVH 4NOBA 1CFMA 5FWQA 4X6EA 2HUEA 4ZW8A 4F7TB 4JZNA 5T8IA 5L2JB 1PY9A 2UYLA 1ZK5A 3TT1H 4OD1H 4DETA 2D3NA 1PNDA 5EUKA 2EIDA 5E95B 3A4DA 4PP2A 5EA0L 5M7QA 4HX1B 1N70A 3X11B 3LAFA 4YSPA 2OXHB 4FE9A 4NENB 3UDWA 3VB9A 1KC5L 2H0JA 4YLCA 3SO5A 3RPBA 4IRSD 4ZPTB 3UEQA 2EE2A 4KQ3H 2GFBA 2VH5H 2EE0A 2VZTA 5D7IB 1S7QA 1LE5A 3B8YA 2BY0A 1LMKA 3VI3E 5CSZB 3ZKNC 4P4KC 3QJVB 3GBNL 5DUML 1RPQA 3IJEB 2WQVA 3B43A 3Q6GH 1XGRA 3WUWB 5CIPB 4Y19B 3GHEH 4NNXB 3CC5B 4FN0A 3I3BA 4GIOA 3SJVB 4OIIH 4KHTH 3WN6A 4PRBB 3FCUB 1ZTXL 3OJVC 3U1PA 4KMTL 4HG4J 2YUXA 4M1CD 3K2IA 2OW6A 3X13A 4AGOA 2KDYA 5AOIA 2ZYIA 3OKLA 2D7TL 2JV6A 5E8NB 3AREB 4JKWA 2ZNXA 2XYBA 5C0BB 5ID1B 3BIBX 1T83C 5FA4A 2QQLL 1A4JB 3GEWB 1HYSC 1LEKB 3E1F1 3QEQA 4P23D 3APFA 3C6SA 3OAYH 4HYTB 1NQBA 1TQBC 4YHYB 5CUSL 2HRPL 5JO5B 2VITB 2VLKA 1F4WH 4PRHB 4PAZA 4WWOA 1BVOA 4P5TA 2O6EA 2YJLA 3MRRA 4M48H 1D2OA 3HS8A 4IYKA 3KPQA 4XMTA 5KOVC 5E08H 4ZO6A 3RJOA 3DJZA 3BIKB 5GIRB 1XCTA 5MEND 4B96A 1MCBA 3N44B 5D2LE 3CQQA 4GRWF 5F6IC 2Z93B 3LEYH 2Z31B 3T65A 3BC9A 1RUPL 3NJGA 1U2CA 2IH8A 4FCHA 5F9AC 3KS0H 1MJ8H 1UB6B 5FYJE 3GIVB 1OOAA 1GW6A 3TOPA 4NN6C 4EN3B 1T2QL 2WC7A 2X38A 1WAAF 2V5MA 1YPZE 2XPGB 5FK9B 1RAMA 1BWWA 3TBVB 1E5YA 3MJ7A 5IKCA 3UGEA 2SEBA 5LGJA 2UVFA 5TTRA 2O4EA 1THAA 5DHXB 3KVQA 1VEPA 5JNYA 3D87B 5FHAH 2VDLL 1R5VA 3GMLB 3X1EA 1X7QA 4Q97A 3BQVA 2FBOJ 5FUZL 4AH2A 1MCNA 1DL7H 1JVLA 5IVOA 3ZYIA 4X9BA 1G7QA 3QJRB 1MVUA 2WP3O 1YYCA 2FJFB 3L6FB 4PJ9A 3LQAL 5HJGA 1CYWA 4ZW5A 2EDOA 4N2FA 5IOPA 2X2IA 4XPAH 4IOFD 3S2CA 2ZQKA 3L95B 1IM9A 1BD2D 3T8MA 2BS9A 4LSPL 4OI8A 1M2VA 1WZLA 2NR6A 4IJ3B 2HT3D 3QH3A 5FCUL 4KGLA 5DD3H 1AD0B 4U31A 5AOJA 3X14B 2DM4A 3G5VB 1SXZA 1EZUA 2E6QA 4X7TA 4HK0B 4DPRA 4IRJA 4X50A 3DOSB 4XC1L 3DUUB 1JGVL 4FKEA 2J1YA 4XZUA 1FL5A 1XF1A 5DJ8B 1JCKA 2YD7A 3A67L 2FO4A 3DYMA 3FN3A 5DMJB 3TV3H 4BZ2L 5CN2A 1U41A 4GSQA 2WBJC 1F90L 1QUNB 3CVHB 4U0QB 1NMCB 4YSTA 3MMEA 2EEAA 4X5PA 3BQUA 1MIML 4YBLC 1F1GA 4D0DB 2IBZY 1WHPA 2DICA 4F24A 5IB4A 2OQJB 1XEDA 1ZT4B 3GM8A 4CADB 4ZXBB 3C5JB 4L18A 1G9MH 1Z3GH 2CR6A 4BFBD 2N0MA 1HC1A 3ILPA 2X3AA 2F1AA 4HKZB 4PG9B 1QQDB 2A2QT 2WUBH 3EJJX 4FG4A 4M6MH 5FKAB 2P8PA 3A6OA 3MBWB 3GUTA 3TPKA 1OSPH 2ITEA 1YMMB 5JTWA 2FSEB 2CBTA 3FUJA 3LNFA 1MCSA 1GYAA 4R83A 3I3EA 3QEHB 4FQPA 3TEYA 2R0KL 1F00I 4OVVA 3PHOA 1JHKH 2CO7A 1Q1PA 4I0PC 2MMXA 3KE0A 4NP4H 1RIHH 1RZJH 3CBRA 2NY1C 2QPDB 1M56B 1EUUA 2LR4A 4IIQA 5BOJA 3BSZL 4FL4C 1J1OL 1A9VA 4UM9A 2MNJB 4FA6A 2ADFL 5B39G 4E5XB 1FSKC 3MLYH 4N22A 4JPSA 4QTIL 2DQDH 5CMAB 3VGFA 3MV8A 3O3DB 1GHFL 1EUTA 2PMZA 3ROLB 1WF5A 3PGCB 5EC1A 3QYMA 1QG3A 2JFCA 4RQQA 3V6BR 1PX8A 1NKGA 4MAYC 4PJEB 3BN9C 4GBXA 3E8VA 4WHCA 2OSYA 1MJUH 5KANI 4F33A 4RIRB 4WWKC 4PIBA 4JM2D 4F1SA 4AL8L 3LZFH 4PWHA 3RNQB 4NZRL 3AT9A 1RMFH 3O0LA 1G7MA 1C12B 2W92A 1SMOA 1MWOA 3RL1A 2QGBA 1JI1A 1NIBA 3GMPA 4RRPA 1UFUA 5FW8A 1HKLH 4Y8DC 3GS0A 3QIWC 1JV5B 4M03A 1MIEL 2LFEA 2IGFL 5FPIA 2QADD 4FEIA 4JG1L 4XCFH 4ZI8A 4NUJA 5JMRA 4JANA 1WISA 3QHTC 2VDQL 3QPXL 4HBCL 5GS0C 4O2CA 2IBZX 3WBDA 1SHWA 3PWPA 3ZZSA 5D7IF 4LDLB 3HC3L 1YRKA 3T0AA 2AMGA 4D9LL 3EUUA 3T4YA 4NUQA 5CLZA 3FKUS 4P2AA 3IJ9A 4LCYA 2X4OB 5FYJL 3S6CA 4UINL 1XBRA 4YC2B 5DRWA 2J3SA 1HXMA 5IHZA 4JZNB 2WCGA 3JWDC 4IMKC 1DSFL 1RD6A 5EUKB 4PP2B 3ROOA 1VKXA 2OMWB 5CHNB 1IC7H 4DP2X 1A6TB 4G3YH 4LSRL 4YHOL 1PVHA 1RURL 4N20A 5L2KE 2GFBB 3ZDXB 4N0CD 4JFEE 1LE5B 1S7QB 1LP9E 4QRQA 4BSWA 5DQ9A 3WIFA 2DM3A 1KN2L 3ULUD 4GFTB 2OZ4A 2YPVH 5EORL 1FL6A 3OR7B 4JDZA 2Z34A 5J12C 3WSQL 5BQ7A 2FBJL 4FTVE 1HH6A 3MX0A 2H8PA 2BP5M 4HJIA 5CLWA 1CC3A 1WG3A 1T6VN 4PJ5E 3OPZH 3D9AH 1TTBA 2AI0H 2XWTA 4PRDB 3X13B 3H85A 1Z5LA 3OKLB 2PYEE 4XO9A 4PWFA 4LVNB 5JPNC 2ATPA 3ESNA 5LKNA 3QSKB 4ODSL 1S7XA 3VD2A 4WWNA 3GHPA 4OZHA 2OYKA 3N44F 3O9WD 3ECBA 3APCA 3LS5L 3J7HA 3CFCH 3BUQA 3PUCA 3KH4A 1JUFA 3APNA 5FA4B 1INDL 4Z9KB 1E43A 5CN3A 1XZWA 1ZVYA 3RVTC 2FGZA 2H6UA 1GMEA 4JKKA 4XB7A 3B9VA 1N6QH 3QEQB 1DQJA 1W72B 3MCG1 5T1MA 1CDGA 1R6VA 3C6SB 4WEMB 1B88A 1EJ8A 1MY7A 4MHHI 5AOKA 3AABA 3BVXA 1IKNA 1EXGA 2VLKB 4RGNE 1I9EA 1G6VK 3MNWA 5AW2B 4P5TB 3MRRB 5AKTA 1NCDH 1I7UA 1DQLH 2WTRA 3KPQB 1MWAH 5KUKA 4DN4L 3W2DH 1KXQA 4I7ZC 2R0ZH 1KF9B 2VB5A 4JFXA 5C6TL 2CKNA 2IXQA 1XCTB 1ORSA 3CSBA 3OKKA 4F8PA 1YA5A 5CEZH 3T65B 1E27A 3EGXA 3E7JA 4J28A 1BEYH 4TQ8A 4K15A 3SODB 2BVTA 4H1LA 4DKTA 3E80A 3D3VE 1J0HA 3H55A 1OCWH 1SLWA 3HLKA 3QUXC 4KKBC 5I1IH 2PW2A 3D25A 3MJ7B 3T0EC 3DXAD 1F2XK 5IKCB 3N1FC 2SEBB 3Q2VA 5LGJB 3OLGA 2WV3A 4JCLA 1ET7A 2GBTA 1QSFA 2FVNA 2OL3B 5JNYB 2ZCHH 4XBPA 3QZMA 4QWWC 2NMSA 3UBHA 1ASPA 2AP2A 4TSCH 2QGCA 3FUMA 4FXTA 4MB5A 3RJDA 4AH2B 2EUVA 2RJMA 4OLWL 3V7MA 4YX2H 3BZEA 1WDAA 2CBOA 1G7QB 1MVUB 1IGIH 1AR1B 4PJ9B 1E3ZA 1ZHNA 4JHWL 3TJEH 5HYSG 4XNDA 2DBJA 5IOPB 1G7LB 1U92A 2I9TA 5ITBH 2AZUA 2DLIA 3JV5A 4Z0BL 1IM9B 3QWRD 1A14L 1M2VB 2QELA 2VZUA 1YEGL 3QH3B 2AGJH 3V95A 3TBBA 1OE3A 1VHPA 3C8KA 4O00A 2YA1A 3I6GB 4K5OA 4MD5A 5ISZD 2GJPA 4X7TB 3AWFA 1ADQL 4IRJB 3BCFA 4M1DL 4XZUB 1B0RB 1FL5B 3IJYA 4P48A 3VFRA 4L4TD 2FO4B 3DGGA 1U8QA 4DGVL 1A6WL 1AYOA 3CCHA 3FZUD 4X4YB 2VMFA 2NY6B 4P9ML 1UENA 5B1JA 2PP9A 4TVPE 4YAQA 1H8NA 4RFEA 1SFHA 3BUIA 2HVKA 1H8SA 3SJVE 1BF8A 1MEXL 4XP6H 3TCLA 5IB4B 4PGZA 4OZFG 4UM8B 5DEFA 4GKZA 1HQRA 4ZS6D 4BELD 1MNUH 4FFWC 1I8UA 3VMOA 4UTAH 4I1PA 3RP1A 3BKCH 3ILPB 4YHLL 1IBGL 2NLJA 4EVNA 4DGYH 4PJEF 1WBYB 5I1GH 1JTTA 3GUTB