3T6XA

Crystal structure of steccherinum ochraceum laccase obtained by multi-crystals composite data collection technique (20% dose)
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
495
structure length
495
Chain Sequence
VQIGPVTDLHIVNADIVPDGFVRPAVNAGGTFPGPVIAGNVGDNFQIVTFNQLIECSMLVDTSIHWHGEFQKGTNWADGPAFITQCPIIVGNSFSYNFNVPGMAGTYWYHSHLTTQYCDGLRGPFVVYDPNDPDANLYDVDDDTTIITLADWYHVLAKEMGAGGAITADSTLIDGLGRTHVNVAAVPLSVITVEVGKRYRMRLVSISCDPNYDFSIDGHDMTIIETDGVDSQELTVDEIQIFAAQRYSFVLNANQPVGNYWIRANPNSGGEGFDGGINSAILRYDGATTADPVTVASTVHTKCLIETDLHPLSRNGVPGNPHQGGADCNLNLSLGFACGNFVINGVSFTPPTVPVLLQICSGANTAADLLPSGSVISLPSNSTIEIALPAGAAGGPHPFHLHGHDFAVSESASNSTSNYDDPIWRDVVSIGGVGDNVTIRFCTDNPGPWFLHCHIDWHLDAGFAIVFAEDIPNTASANPVPEAWSNLCPSYDSAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reaction intermediates and redox state changes in a blue laccase from Steccherinum ochraceum observed by crystallographic high/low X-ray dose experiments.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Laccase
total genus 138
structure length 495
sequence length 495
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6xA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6xA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3t6xA03
1ZIBA 2XU9A 4E9XA 3UACA 1OCOB 1JZGA 3G5WA 4UF7C 4TXVB 1A8ZA 1L9RA 3NSDA 3UABA 4M4RB 2FWLB 1RKRA 2Q9OA 2XXFA 3NJJA 1JZIA 2VN3A 3IE9A 3EHBB 2ZWNA 2BP0B 2W88A 2XXGA 4KNTA 2QPDB 1W8EA 3QJUB 4UAHA 2BW4A 3X1NA 2FT7A 1E5ZA 3QJSB 1ET8A 2HX7A 3X2QB 1L9OA 1NWPA 1KGYE 4YVNA 1BQ5A 2DYRB 4DPBX 1KDJA 1XB8A 2CALA 2VMJA 1IUZA 3OD3A 5EHFA 3NP4A 1AOZA 2CJ3A 1WA1X 1DYZA 2YAFA 4K9JA 3AG3B 2UXGA 1PY0A 1NTDA 4HZ1A 4DP4X 1JXDA 4DP7X 3H56A 3S3BB 5I6KA 2AANA 3NSYA 4P5RA 3PAVA 4E9RA 4AKOA 1BXAA 3NJNA 4HCIA 3ABKB 3ASNB 4BWWA 2YAOA 1BYOA 2YAEA 1V55B 2UX6A 1PZBA 1AIZA 2PPFA 2YAMA 1ZPUA 4G70B 1KCWA 4BWUA 3NSCA 1MZYA 2I85A 8PAZA 3BVDB 5B1JA 1SHXA 3PLYA 4N4YB 5A7EA 1NPJA 4KO7A 2E86A 4A67A 3KW8A 2YAHA 3OQRA 1F56A 1JZHA 3X1BA 2DWSA 1PZCA 3X1EA 4NAJA 2YQBA 4NB7A 3S8GB 4A2GA 3FSZA 1ILUA 1PAZA 3OMIB 5I28A 4KO6A 2FQEA 3T6WA 1QHQA 3OM3B 1KBVA 4L0PB 4DP8X 1WS8A 3FSWA 1N70A 3TBCA 2I7OA 1J5CA 1BAWA 1E65A 3UADA 5FC9A 3RYMA 2BWDA 3OMNB 4DP6X 4FAAB 1UATA 2QT6A 2PP7A 2XX1A 2PCYA 2UX7A 2R7EB 2EIJB 2IDSA 2BWIA 2XUWA 3WG7B 2CBPA 3CDZA 4ENZA 3NJKA 4DP5X 1KDIA 3X1GA 4A2EA 2GB2A 1ASPA 3ASOB 2PP9A 2JKWA 2FQGA 1MG2C 3WNIA 5I6PA 3ABMB 3MBWB 3CZUB 3ERXA 3GXUB 1OOWA 3UGEA 1ZDSA 2BP0A 3MX0B 4BDVB 4KOCA 1GYCA 4G71B 4YSRA 2QPEB 2OV0A 4KNUA 3QPKA 1OE1A 1E5YA 2GIMA 1MG3C 2EIKB 4PCYA 4HIPA 4YSEA 1JERA 1BXUA 4JHUA 3FQYA 1A65A 1JVOA 5TK4A 5B1KA 3N2JA 5B1JC 2PP8A 1NIFA 2AFNA 2UXFA 2X87A 3ZDWA 3S3DB 1NIDA 1X9UA 4WKXA 2ZXWB 1SFHA 2PPCA 2DV6A 2IDTA 3ABLB 5D4HA 1NIEA 3DKHA 1EZLA 1FWXA 1PLBA 2YXVA 2J5WA 2FTAA 1SDDB 4M3HA 4A66A 2BZ7A 3AZUA 3ZBMA 4BK5C 1JZJA 1EHKB 2GHZA 1OCCB 2J56A 5I26A 1J5DA 5F7AA 3WKPA 2YAPA 4YL4A 2PPDA 2MRYA 9PCYA 4BWTA 1JXFA 4GP5B 1SJMA 2VW4A 5I5MA 3EF4A 4N8UA 1DZ0A 4MFHA 3T6VA 1OE3A 3SBRA 3WI9A 1SHWA 4CSPA 3QJVB 3FQ2A 5IY5B 3FPXA 4JHVA 1N68A 2VM4A 7PAZA 3NJHA 2HRHA 3NJMA 1T5KA 2GC4C 3EH4B 5D4IA 3V9CA 1AG6A 2BW5A 4AX3A 4Q89A 2CCWA 1OCRB 2GI0A 3QJRB 4FA7B 3CVDA 3IN0A 2H47C 4YVUA 3ABGA 1GS7A 4F2EA 1BQKA 1ZDQA 2UXVA 1IBYA 2Y69B 3SBQA 3QJQB 2FT6A 1ASOA 2HRGA 3ZX1A 1NZRA 3FU7B 1GS6X 2OJ1A 2PCFA 2IH9A 1BEXA 4A2DA 3FS9A 3FU8A 1OF0A 4DPAX 2JXMA 3AG1B 4PAZA 4BXVA 1M56B 4ZK8A 3H4HA 1CC3A 1HFUA 4YSSA 1IC0A 1ID2A 6PCYA 4X4KA 3S8FB 2GSMB 1IBZA 1PZAA 2BO0A 2BP8B 2HZHA 2OCCB 1ASQA 1RZQA 4AKPA 3T6ZA 4NERA 1NIBA 3IBOA 2Q5BA 2A3TA 3NJIA 1TEGA 1PNCA 3S3CB 4QLWA 2ZONA 1JXGA 1TKWA 3CVCA 1YLBB 3UAEA 4GY4A 3FQ1A 1XB6A 2EIMB 1ETJA 4JKNA 1QNIA 2HX9A 2JFCA 5F7BA 1NWOA 1CYWA 1ILSA 4G7SB 4A2HA 3AY2A 1CYXA 1W6WA 4YSCA 1E30A 3DTUB 1JZFA 5AFAA 5PCYA 4GP8B 5TK2A 3BQVA 3PXLA 4DP1X 2RACA 2WSDA 1GY1A 3KW7A 3QQXA 4KNSA 5B7EA 2FJSA 2BHFA 2WO3B 4Q8BA 2VW7A 1AACA 2BP8A 3WKQA 3CG8A 3H4FA 1ADWA 4DPCX 1PMYA 3EH5B 3NYKA 2Y1AA 1BQRA 7PCYA 2TSBA 4BXSV 1OE2A 2B08A 2YXWA 3QJTB 4HHWA 1A4BA 3FSAA 1W6LA 3NJGA 3JT2A 3AW5A 2WO2B 3FPYA 2VSMB 2TSAA 1M9WA 1NINA 4G7QB 4HHGA 2XLLA 2AZUA 1URIA 5AZUA 1AS7A 1AZNA 3GYRA 4YSUA 4KO9A 1NICA 2IAAC 2W8CA 4YSAA 3GDCA 1PNDA 2I7SA 2XV2A 3V9EA 1XB3A 1CUOA 3AG2B 3IN2A 2FQDA 2X88A 1HAWA 1J9TA 2VM3A 2GBAA 1I53A 2FT8A 1QLEB 1KCBA 2QDWA 3DIVA 3WNJA 3D12B 5ANHA 2HX8A 1JZEA 1PLCA 4AKQA 4KOBA 5B1BB 3UAAA 3NJLA 1V10A 2PPEA 2IWKA 4G72B 1FFTB 5B3SB 5I6NA 2H5UA 1NIAA 4AI7A 3FYEB 2N0MA 1ET7A 3T71A 1SDDA 3JTBA 1XMEB 3FT0A 2EINB 2DYSB 3SBPA 3IEAA 1AAJA 1BXVA 2P80D 3TU6A 2IDQA 2XWZA 3TASA 5I6LA 1A4CA 5AKRA 2VW6A 3PCYA 1GS8A 5D4JA 2H3XC 3WIAA 4E9YA 3EH3B 1PLAA 2R7EA 4DP0X 2IWEA 3FYIB 2FNWA 3PAUA 1JOIA 1J9RA 2P80A 1ZV2A 2J57A 1AZBA 5I5JA 5B1AB 4E9WA 1GSKA 4YSQA 1TU2A 4GXFA 2XV3A 3ZIYA 2XVBA 1WS7A 1L9SA 3NP3A 4P5SA 2CAKA 3U25A 3FU9A 2IDFA 1FA4A 4BDVA 2EILB 1V54B 1OCZB 1MDAA 2ZOOA 5E9NA 2QDVA 1GY2A 4YSDA 6PAZA 4UANA 4RH4A 1R1CA 3NSFA 1JVLA 2XV0A 1GR7A 3FU7A 1RCYA 1PF3A 1KBWA 1RZPA 4YSTA 4F2FA 3CDZB 3T6XA 1A4AA 2IDUA 2B3IA 1L9PA 4G7RB 2IWFA 1J9SA 1L9QA 1WA2X 2PPAA 2YARA 3L45A 4DP2X 4E9SA 4GYBA 1ET5A 1WA0X 4YSPA 5I6OA 1VLXA 2DY2A 2UXTA 2XX0A 2VSKB 1GW0A 4DP9X 5B7MA 3CVBA 2HLEB 5LDUA 4KO5A 2IH8A 1KYAA 3HB3B 4F7KA 4W9ZA 1AANA 1BYPA 3C75A 3NT0A 1J9QA 2AZAA 1HAUA 2GC7C 3TBBA 1AS8A 1AZCA 1E67A 1MZZA 1NDTA 4YSOA 2J55A 2YAQA 1AS6A 4HAKA 4AZUA 3N55A 3FSVA 1KV7A 4E9TA 1AZUA 4A68A 2CUAA 2HXAA 1TEFA 3T9WA 2NRDA 2LLNA 1M57B 3NJFA 1NPNA 1SF5A 4E9QA 5B7FA 1AR1B 3PAZA 4WTQA 1IKOP 1AZRA 1CURA 2FQFA 4HALA 1SFDA 1PCSA 2DWTA 5I6MA 1WAEA 3HEIB 3X1FA 1B3IA 3PPSA 1AG0A 3TA4D 1SF3A 4HCFA 4HCGA 4EF3A 3SQRA 1X9RA 4W1TA 3AG4B 2XYBA 2AVFA 1L9TA 1SNRA 2BZCA 1A3ZA 1ZIAA 4QKTA 4E9VA 1AQ8A 4A2FA 5I5IA 5PAZA 1OV8A 2PLTA 3OMAB 4CSZA 2MTAA 4GP4B
chains in the Genus database with same CATH superfamily
3N06B 4APXB 2ATPA 3LN4B 1OQXA 3VFMA 3WFHB 2Y1YA 3DHUA 1UEMA 4V2BA 4ZXBC 1YEFH 3SY0A 3QEHA 3VFGL 1H6EA 1HE7A 2D73A 2FWSA 3MFFA 5AQ0A 5DUML 3RIKA 4EBQH 4HOXA 1I7RA 5GS1A 2BP0B 2ZX7A 4BM7A 4QXTB 4ZFGH 3IFPA 4LQ1A 2P5EA 2DQJL 3Q2NA 1E9QA 2C4FT 1TZIA 1KTLA 3PAYA 1NWPA 4W4OA 2WBJB 3WHXB 1PIGA 4JL1A 1HL4A 4WUUB 4JFDB 3FL7A 4NHUA 1RUQH 1O7VA 5F9WB 4XMLH 1WA1X 1KLGB 1UH4A 2J2ZB 3I9GL 4FNUA 5IJDC 1XSOA 3MRBB 1UZ6E 1ZE3H 3H9SE 2QVIA 1JPSL 3S3BB 3O3DA 2CG9X 4UNVA 1HEZA 12E8L 3H3PL 4LIQE 5SWSA 5J6SA 1D7FA 1NC4B 4N1EA 1JPSH 4AKOA 3HJEA 4UQ9A 1QTSA 3NJNA 3KLDA 5D55A 4AGMA 4UQ3A 4HKJA 2YAEA 3FMGH 2HPOA 2QQKH 3L3DB 3U1SL 3X13A 1P9MA 3NZSA 4J3BA 2ICWB 3BUBA 1IZKA 2Z8WC 3VWKD 1UB5B 2HRPL 3MNVB 4MMXC 4BWUA 3N85L 1P4LB 2WWKT 4UQEA 4I0PC 3HFFA 4ZFGL 5GSVA 3COOA 3U9PH 2HTKD 1NCCL 1YN7A 2AJUL 3SDAD 2CBTA 3HN3A 1J8SA 2IIJA 3L4YA 2NY7H 4ZW5A 1GPOH 2ICWI 3IU3A 5ALBH 2OCJA 1FNGA 4G9FD 2FATH 1QYGH 1Z0MA 4OB5L 5B8CA 5DVOA 2DQTH 5KAQF 3SDDD 3ETBJ 3MFGB 4KO6A 1QHQA 3ECVA 5AOLA 3TBSB 4ZUTB 1U3HC 3AU0A 3WYRA 3OAYK 3QUZB 3TBCA 1YQ2A 1BAWA 2DMKA 2Z0BA 3DO4A 4GXVH 3T0EA 5A2JH 4ZOCA 2WYZA 5D2LE 3RYMA 3MCKB 1CD9B 2DQUH 2XFXA 2ZXAA 4MAYA 4NPJA 4XH2B 3RWEA 3LZQA 5IMKA 3OJ2C 1I7UB 3GMMA 2V6HA 3S0PA 2X89A 4WFGE 3OB0H 3E80A 4OCXL 4Y1AD 3UL4A 2ESVA 3CMOL 3OKDA 2JCCF 1FNSH 3QPXH 4G43A 2EE9A 3I6LE 5IZ7A 4A2EA 1AZZC 2HLFD 3WJMB 3U0TB 4AXWB 2NY3D 4L8SA 2VN7A 5CEZE 4R7NA 3T4YB 5L7XL 3QQDA 1GSMA 3IMRA 3AQYA 3IAQA 1S78D 3MX0B 3TH2T 4Y2DD 2CO1A 4GG8B 2UZYB 2EVHA 4QHKJ 5EOQL 3GRWL 4OFYD 3RVTC 3H6JA 4HLZG 2GKIA 4JHUA 4JRYB 2APBA 3OLIA 4AMXA 3IU4H 3KPNA 3ORJA 4Q7DA 4WUUE 1FAKT 3ILPA 1J86A 2NTFA 4ZTOL 1TSRA 2G2NA 3DV4B 1HX0A 4WVRA 5L8LB 1JGUH 1TVDA 3FOLB 3QCUL 2YPLE 4XMPL 4LDLB 2EYTB 5ADPH 1S5HB 4RLDA 3SE4A 3KWVA 4N8CL 3WY1A 4H1LG 1SXCA 3MJ6A 4BK8A 3D48R 4PJ7B 4UV7H 3T65A 2FTAA 5I1AB 2LHAA 3C2AL 5FO7B 1BEYL 4YHKL 2PCXA 1U8QB 1W15A 3KBFA 3NDYE 2XN2A 5A7BA 5LGJA 5HHOE 4HIQA 4A7TA 2OP4H 1WFIA 3LKSB 4UZUA 3B2UC 1T5XB 4KHTH 1BHGA 5IQLA 2IQAB 3MRIA 1F5WA 2IV8A 1KMGA 4YDKL 5D70L 2I25N 4OGAC 4OBRA 4QRPA 5CEXA 3T8XB 3ECBA 3QHTC 3L5WA 5ENWB 3EF4A 1UM5L 2YD8A 4ABUA 4LLVB 2DEXX 1VGKB 3CPLB 4N0YH 3C12A 5C0CB 2OSLA 1QO3B 3MMEA 3A24A 5F7FA 5BQ7A 3IXTB 4FE9A 3G3LA 1TIUA 1E0OB 2GC4C 1U8NB 2XG4A 3BSZH 4LEOB 4NKDB 4NPKA 4QRTA 1UWEL 3G6JF 2FJGA 4JW3A 2ZP8A 3QDGE 4TNEA 4OZGF 2F0CA 3UERA 3G7TA 4DQOL 4NP9A 1CMOA 3UZEC 3VI3F 3P4MB 3LSOA 4PTTA 3EO0A 3ABGA 4P5TD 2DEYX 3EDKA 3UTSE 1GOFA 1X5ZA 3ATDA 5DJXA 5EU3B 2QLYA 5LWYH 2Z93A 5KYXB 3Q06A 2C9XA 2Y7OA 3F7PC 3S96B 5DHVH 4Q2ZA 4A2DA 4WI4A 1XEDA 2P8MA 3HMXA 3OC5A 4UT6A 2QKIC 4ZK8A 1KSRA 1XV8A 1Z9PA 1FYTE 1UQSB 5J12B 5SWSD 1AY1H 2HZHA 4AKPA 1BA9A 4M9OA 3SY6A 2YBGA 1C1EL 4MZRA 5DA0B 3DVFA 4XNUH 5CCHE 2WB7A 5EC2A 4BH8B 4GRWH 4XP9L 4ES9A 4KRNA 3DLQR 3QQ3B 1CG9A 2ZAHA 3FULA 3BWUC 2WWNA 4MA3A 4Y16C 4TTGA 1AGEA 4PJFF 2CRZA 1MVUB 3EOTH 1LE9A 4X6DB 3OKKB 3VQMA 3TZVA 3P69A 1ZT1A 3VFVA 3RPKA 4XN8A 4KK6D 4ZOBA 5MERB 1AHMA 4OSUH 1QLEH 2YJLA 3VTTA 2WBXA 1JZFA 3B2UD 4K5PA 1GIGH 1E4KA 2VXTL 1MRCH 3GMPB 4OJDH 2KUTA 4E68A 1UD4A 2WZPD 2K1MA 3QAZC 4JVUA 2DM3A 2CDEB 4KQ4L 4PJEF 4XCFL 3M86A 2YWZA 1UQSA 4MVBC 3U4EB 1G1KA 3QORB 4KVNH 3EDEA 4GAFB 3KJ4C 1BQRA 1FNEB 1N59A 1PFOA 3B9AA 5CUSL 4YHPB 3PL6C 1AVAA 1W80A 2G2PA 3OZLA 4EI6A 2AJZA 4BQ9A 5HHXL 1EGJA 3T8XA 2AJSH 5TQ2L 5AW7B 4DCQB 2H1PL 4JREB 1E4WL 2GTWA 2DM2A 5CMAA 4QT5A 4GFXA 2AS5M 1BAFL 3B6SA 1ZSDB 3RIAK 3QH3B 4I77H 4GIPD 3MC0A 1CJYA 3RNKA 2DQ6A 1MFAL 3U4BL 2VB5A 3GF8A 3WO4B 2OMZA 1X5KA 4GAGL 3MBXH 1NMCB 2BSTA 3GT6A 2ZUXA 2O5YL 4H0HB 1NICA 2QADC 4W4NA 2ED9A 2JI3A 3M88A 3D1MC 1JWMB 2XPGA 4OZFB 4ZXBA 3VQLA 3GSQB 4HIHA 1DBAH 4AQ8A 3AACA 1A6UL 4H0GA 1ZJBA 1QO3A 3MMEB 5KANG 2ZKWA 4KUZL 4NBZB 4PFEA 4K5LA 1L7IH 2EVIA 3QQ4B 3O6KH 2UVEA 4ZMZA 2IH3B 1WFMA 2B39A 5AW5B 1UYWH 2CDGA 3REVA 4JFQA 2PPEA 1S9WB 2ICCA 3U82B 3UIYA 1Z6JT 1FFTB 2JSFA 1KJ3H 1UXSA 3SD2A 5B3SB 3LKPB 3QC5X 4CU6A 1Q0YH 1NSNH 5SV3A 2G75B 3G6AB 2NY2D 1GTNA 1MWOA 2VMCA 1R3JB 2N0MA 2L7EA 4U0QB 1AKJA 1XMEB 3WU1A 2AV1A 1GL4B 3UG3A 4PS8A 4JS7A 5ID1B 1T0MA 4U7KA 5ELIA 2A7BA 3DTXB 2VISA 3QDJE 1V05A 1LP9A 2AC0A 1D9KB 3FQTB 3HHMA 4FNTA 3FQWA 3HI6H 4O2EB 3TNMB 3RL2A 4ZFZB 3WMSA 3EH3B 2WWOA 5HVFB 2B1HL 2NSQA 3RVUD 1AQKH 1U8IA 1O6VA 1V7NH 4ZBJA 1CF8L 3D85A 3K0YA 3KPNB 4PR5B 4UAOB 4JJHA 3SO3B 1TCMA 2BIIA 1XL6A 1X44A 2QMJA 3DO3A 5LAPA 3KEHA 2FE0A 1SMAA 4M5SA 3VG0L 2EO9A 3ZE2E 4MNGE 5KVFH 1PZUB 5CJXC 2FX8H 2V9UA 1KJ2L 5C07D 3MGTB 4UMGA 5DJYA 5C70A 1K2DB 1KTRL 2FH8A 4N2BA 1J5OH 3PWVA 3QYCA 3T8VA 4NO5A 5KSAB 4U6XB 2XN0A 3IGUA 2D9QB 4WUKH 4UDUA 5FUCC 2C9AA 1JGLH 3OZKA 1PZ3A 5GRUH 4RAVA 4PJGE 2X7LB 1QFUL 2D4DA 3GSRA 1GR7A 5T1KD 1PF3A 2LU4A 3RDJA 1RZPA 2V5MA 4OF3A 3V0AC 4G43B 4M8UA 4ZW8A 5D71L 4XPHH 3IJEA 2XXMB 4F1ZA 5HHOD 4DZ8A 1G94A 2XICA 1XCTA 3TA3C 3NG5A 2ALWA 3Q8CA 5I6OA 2CNZA 3OKNB 4BH7A 2XX0A 4YDNA 3C2AH 4GBXD 5AVZB 3FUNA 4OY9A 4R4BA 1U8JB 3C6EA 4NRZA 1F4YL 3WHE0 3ZYZA 4TLTA 2APXA 1AQDA 1EWHA 4NUJB 4X7CC 3OJVC 1OM3H 4KI5C 3GUTA 3GRGA 4YSOA 3WJJC 3CX5J 2APTA 3CFEA 4G8AC 3DX9A 2A2QT 3CPLA 3M7OA 2XWJB 5E5MA 5I76B 3IJ8A 4FN0A 4B41A 1R5IB 5FYKU 5KZCD 1T7XA 3B2VL 2W0PA 4NQSA 2XV6B 5EOQH 3Q9QA 2GUOB 1DN0B 4B9YA 2ADFL 3CIAA 1I85C 3UBXB 3EF7A 2CQVA 1CT8A 2A5UA 1BFOA 2H0EA 3QCVH 2F5BH 1JL8A 3MO1B 1UZ6F 3WUWA 4MSWA 4HALA 5LGJB 3I84A 4UT9A 2X4RB 1PCSA 2PYEB 4HG4K 2GYSA 2A9NH 2X9WA 4KHTL 3UJJH 4HCGA 1MFBL 1F3JB 1KJ2B 3X13B 2XYBA 4AE0A 2RJMA 2HJKA 4MJID 3STZA 1AOHA 5KTEL 3KD4A 4Q14A 3CNKA 4JRXD 1MQKL 3O4LA 1U58B 1VADA 1JGLL 2YMTA 2VLJA 4S1QL 5GRUL 3B9KB 3EJYC 1S9VA 1UC6A 2R69L 3GXIA 1ZLVH 2MTAA 3QZWA 1IFHH 1BPLB 1X5FA 2CM5A 3L1OH 4PRBB 3P3TA 4J8QA 5E8DL 4L8CB 2WLZA 2WNKA 3WN5B 1I7ZB 3G5WA 4G9FB 1UD8A 4LCCA 3VGFA 2X9XA 5G4OA 3APDA 3FW6A 3UJTH 5C0FB 1NFDE 1OAKL 3P11L 4IKJA 3REWA 3GRWH 3AREA 3MAWA 4JKMA 3ZHFA 3EYSL 2C4FU 5T5FH 3V4VA 3AY4C 3ABZA 3DI2B 2J8OA 2D3JA 2HT2C 2JTDA 1S5IH 2FJHB 4QHNA 5HGAB 3EUUA 4M5YL 4ZUUB 3CBJB 1XIWC 4APXA 1MCQA 1E4KC 5DSCB 4LRIA 4CW1B 4KK8D 5JLZA 4PJIB 4ETQB 1S7VB 3LRKA 5IJKA 2ZCHH 4HWBA 4PJAB 4X5XB 4YBQD 1IC5H 2IPKB 5DF0A 2YXFA 5LLIC 3I85A 1BXAA 2ARJA 1QTYT 3H9HA 3NCYP 3WFDH 5FFLA 5IR1B 2P5EE 3NIDE 4L5FH 2W94A 4FHBD 5IROA 5CZVL 1JDAA 5F1NA 2XQYG 3ZT5A 1AIZA 2HFFA 3DYOA 5JPNC 3FBQA 3K6FA 1QEWB 1ESOA 3K2MC 2XSKA 5GGSB 4LRNH 1XBRA 1J8RA 1AHWC 3WBDA 3FO9A 5D7KD 2VDLL 5CIPH 4NAMA 4KNQA 5DJZA 2Q86B 2Z6FA 4WO4A 4ZG1A 3VXPA 2D2OA 4FLHA 2D03L 2ED6A 3WNPA 1O5DT 5HGBA 1OGAE 3BPLC 1WZAA 4PLNC 3EO1A 2L0DA 5F3BB 4I48A 4JRYE 3QHZL 4LSSL 4UBDD 3S8GB 3B2PA 2X4UA 3L9YA 3QS2A 1BWMA 4A6YA 4NN6C 4ZRGA 3OM3B 4FL4B 2CWRA 3MNVA 4KHXH 4NRYA 1W0VA 2QPUA 3U9WA 1AZVA 3FSWA 2H32B 5KTEH 1FNAA 3DMMA 4BCYA 1YY8B 2CSPA 3L3IA 3PWPA 2OMBA 4YEFA 3SYOA 1NCBL 4DKFL 5E9DA 3DX4A 5IHUH 4OQTL 1G6RA 1C5CH 1NANH 2IMNA 1URLA 1SJEB 1XGTB 2D31A 4FG2A 3UO1L 3WFBL 5HVHC 4WI3A 3VWKB 4XZUA 3B7UX 1RHFA 4V11A 1A02N 4OLVL 5BW7C 4LF3A 1IAOB 1F4XH 2H6UA 1RVFH 4N6RA 4JHZA 1V8HA 4ENZA 4L1LA 2YZ1A 4Z3TA 4Q9RH 1IGIL 5AVVB 1IQDA 4IIZA 3WNIA 3U0PA 7CGTA 5FB8A 3ERXA 4LOUC 5D7JB 4B96A 1JGVL 4QXTA 2X6VA 2WBKA 3H0TB 4OJAA 5GGTL 2NUTA 4ZMAT 1F42A 5GS1B 3SY0B 5J7CC 4IK7A 2JMRA 1EEYB 4XBMA 3A5VA 3EJRA 3HMXL 4M93C 5E9DB 2AF2A 4GBXC 3OKLA 1QUPA 4O9HH 5F9DC 4P46B 2NR6C 8FABA 1JERA 3GJFA 4MJ5B 3TIEA 1P4BL 1KIQB 1CWVA 3L16A 4S0SD 5EDXA 1TMCB 3ZMRA 3O2WH 4R5VA 2WLIA 3D2TA 5C0BB 5ITFA 5E6IA 4MHHI 3AGVA 2YJQA 4MWFB 2W07B 1CK0L 2V9TA 3ZDWA 5SWZD 4M3KB 3VI4E 1CZ8L 2B2XL 1A6TA 2AQNA 4QY8A 1NAMB 2EEDA 5BS0A 1Z3RA 4IBVA 1HHGB 4XVJL 4UTBH 1Q9KB 5E6SB 4FI6A 4CILA 5E24E 3TO4A 2AXGB 2GSIA 2X1OA 5DO2C 4IM8A 5FYKE 3TJEH 2NY6C 3MA9L 2ZKHH 1OTSC 2HB0A 2ZWSA 1XWVA 5DJDB 5AW2B 1F6AA 2Y3NA 5I26A 2BRRL 2ARJQ 1RZKH 1CL7H 2VR8A 5J89A 1U8HA 4YL4A 3HAEH 3KPSA 2ZKHL 4KDTC 4PTUA 4KTEL 4N5UA 3NIFB 4RGNB 1L7IL 1JXFA 3RDTA 1COBA 3SQOL 2N1TE 3ENEA 3QIWB 3HG1B 4R96B 1DDHA 1AP2B 2ZYHA 3IJHA 4K9EC 3NESA 4QXVA 5DO2D 3H9HB 1UFGA 1U36A 2P3YA 2WUBH 5HDQL 5K9KB 2DQTL 1R0AH 3CN4A 4AGOA 1D6EB 5CEZH 3D39E 2VDML 3BXNB 5DHXB 4LVOC 3NJHA 3AMKA 4RX4D 1T5KA 2WKGA 1CFNA 1F00I 4C57C 3VD9A 1NEUA 4AX3A 3DJ9A 3V95A 3KLHC 4I77L 1I3RB 1TJGH 1U4FA 3V7AE 4CMHB 1XF3A 3DGGB 2YO3A 1DCEA 5HGBB 1IAIL 4AQEA 3KPSB 1L3NA 2H47C 4JDZB 1GS7A 2Y69B 4XMUA 5GRYA 1VFUA 1ZXQA 2J12B 4U33A 1U92A 4LP4A 1I8KA 3CV5A 3VWJB 2YPKB 2C1OB 4GMTH 4HUXB 4AY0A 3P4OA 1XGPB 3HG4A 4O2CA 3X3GH 5HI4D 5BCAA 1UACH 3CN2A 4Y4KB 1ZRUA 1FH5L 1CC3A 1FVDA 2KKQA 2VLRD 4TVUA 1I4FA 1ASQA 1AJ7H 3ZKNC 2QPSA 2X2JA 1TYEB 3U79A 1X4XA 1S6NA 3KBHE 5A3ID 2JQMA 4PJ8B 5D1XA 2BOCA 2QTEA 1DSFL 2ZQKA 3AB0B 4HPOL 3DWTA 4QOKB 4RZKA 3I2CH 5IHZA 1H8SA 5HJBA 1KV3A 2WQVA 3V55A 3LH2H 1GXEA 4XPAH 3CLFH 2X4QA 4LCWE 5D7LB 6TAAA 5FB8B 1A2YA 3MV11 5AVXB 4HVBA 1SLXA 3QHZH 1EJOL 4LSPL 3UZQB 3P9WB 2H41A 2OMXB 1E30A 4LIQH 2QMKA 2W9DL 1UT1A 4TL4A 4H20L 5T5NF 4N1HB 3F84A 2TRYA 4KV5F 1H6TA 2AJVL 1WC7B 3WN5A 2YOCA 3BZ5A 3E6FB 2JTYA 4PWFA 4POZD 4Q8BA 1CGUA 1FV1B 2BHFA 3CFEB 1ZLUK 4LLMA 5C0BA 4KFMA 1JVKA 1OT1A 2EDXA 2J21A 2QVTA 3KL0A 1U2CA 2WZ6A 15C8H 3STZB 4OCXH 3ELAT 5D2NA 3MJ9A 7PCYA 1OTTD 2L04A 1SOQA 1KCUH 2HFTA 1U93A 3HVDA 3LX9A 15C8L 3MLVL 2VH5L 3HUJF 4LSQH 3UYOD 2B5IB 1FN4B 4ZFOA 1P7KB 3KNBB 3DGCR 1MFCL 4JFDE 4MBRA 5K1JA 3ATAA 4ZS7L 3SN6N 3QO0B 3GXFA 3WLWD 4YFLI 4DZ8B 5EZLB 2BSCA 1J88A 2R1WA 3QT2A 3VA2C 4M6MH 4R0LB 3BLPX 1UWEH 1RK1B 1NLDH 4MCZA 5CP3A 2GEEA 2HG5B 3I02B 1IQDB 1UCBH 1NGQH 3PL6B 4ONFH 3C5ZA 3HI1B 4HBQA 5KS9E 5C07B 4NS0A 1EDQA 5ABZA 3GDCA 1CGSH 3DA0A 5E5MB 5I76A 3A4EA 3HCVA 3DO7B 2V2TB 4PJ5E 3QWRA 4JFTA 4NP4L 2R1XA 1PKQB 1XR8B 3GBDA 2WCSA 4HXAL 4GUPB 4C56A 4EUPG 2QDWA 1DSFH 3D12B 1YDPB 1ZS8B 4MYPA 4NIYE 1QFPA 4KOBA 3MKGA 4PI0A 2BJML 2X4PA 3NJLA 3II3A 3F83A 3PHOB 3AWGA 1CICA 5HDWA 3A67L 1BEYH 3D9AL 4XXWA 4A6YB 5I73C 5HHME 3L13A 3QUMA 2DYPA 1HC1A 1TTBA 3TFBA 2DI9A 5ALCH 4Z7OF 3KHQA 4NQCD 4OJEH 1MFDH 3TX4A 5IHBA 3FO0L 4AEIL 1FORL 1B0GA 5G55A 1ZLWK 3GM0A 1D5XB 1S7TB 4GAYA 4R0LC 2NPLX 1IVLA 4K5OA 3VH8A 2F74A 1XGQB 4R3SA 3FYIB 1P5UB 3LRGA 4L8BA 4XRCA 1A1NB 1EERB 1M1XB 3APNA 4K5MA 4XCYB 4JFQB 4RMWA 5D7HA 4PBWD 5A2BA 4RMUA 1KLUB 3UPRA 5I0WA 4L8CA 3D25A 4BZ2L 3LS4L 3M1OA 3QRFM 2XV3A 5DRWA 2XVBA 5I1KL 1TLMA 2XTJE 4R4FH 3BT0A 4YBHA 2JJTA 3P0VL 4LCYB 5I82A 1Q0EA 3ARED 1A0QL 1RPQA 3RL2B 4AYGA 4KZ0A 4ODWB 4KXAA 3O8XB 2J3SA 3QZMA 3V4UH 4JDTH 4X4YB 3DTXA 5HGAA 4NJ9H 4K7FA 4E41A 3FN3A 2YEZB 2FJHA 3MLUL 4X5LA 2DMCA 1R3HA 4YHIB 1XR9A 2BC4A 3VJ6A 1PTZA 1CL7L 1D2PA 3NCEB 3J8F7 3HE6D 4X7TA 4OIIH 3TN0B 1J9SA 4EDWH 4DSYA 3FCBA 5IT2L 3QR1A 4GG6A 2ZAGA 1JWUB 2AK1L 4M29A 4ODXB 5B7MA 1RZ8A 4KJQC 5D1QD 4LCCB 1KIRB 1KJ2H 1TTCA 1UA6H 3DXAA 3HB3B 2X38A 3LQZB 5F9AC 3NIGF 2JJSA 5BZDB 1BVNT 4BJLA 3V5DB 5KVGE 5KSVA 1NDTA 3L3GA 2J55A 4Z1PA 2XBTA 3O2WL 4AQOA 1KBGL 2L4OA 4N0UE 3DJZA 5DR5L 2R2HB 4AIXA 4PIBA 4K3DH 5D1XE 2BSRA 4F37K 2VDMH 4HUVA 3MV9E 4L2YA 5EPMA 3B1UA 3DOSA 1FNSL 3QPXL 3ZMNA 5LQBH 2EIEA 2R29A 2DIBA 3APCA 3PAZA 3L4ZA 5JR1H 5KBKA 4R4ND 4WJG3 2OI9B 1L5GB 2MEJB 1ZWIB 3MI6A 1TOXA 4PW3A 4N8PA 4ZPTB 2CBOA 1ZA6B 3HEIB 2BVUA 3H2WA 2WLMA 1AG0A 5DFVD 2VUOA 1UYWL 1FL6A 5ABDE 3ZKQD 2CO7B 3FONB 1F4WL 5FGSA 5LAXA 1AE6L 3HKZA 1MJUH 4YO0B 1N59B 1PLGH 4KGLA 3I9GH 4QKTA 1YEHL 1E2WA 1YPZA 2YQ2A 4JDTL 2ITDB 5PAZA 4P2CG 4OAWA 3ISWA 5K39B 2N4IA 1A9BA 4BE5A 5HI3C 1UH3A 2WKOF 3MRQA 3SKJL 1G87A 3QPQD 4NO2A 4XVSL 2KZWA 3HG0A 4Z7VF 4ZSOA 1MFEL 2QPFA 3CZFB 4F91B 1HXYB 3LEYL 4TXVB 4X8JA 4GAGH 4PR5A 3LH2L 3FQ4A 4HC1L 5EU6A 3ZL4L 3U1PA 3LH9A 4WKZB 4EOWL 5J9PB 4UNUA 2FEJA 3PFQA 4OZGB 3HBQA 4F1SA 3G6JA 2AJ3B 3VFTB 1KG0B 3FN9A 4P3CH 6CGTA 1D9KA 3FQTA 1NDGA 1T4KB 3X2QB 1L9OA 5IVNA 1KGYE 5ID1A 5GGTH 5FDWB 4DPBX 2X7LA 3GSRB 3SKMB 3THML 1XB8A 4DKAA 3IDIA 3OD3A 3SPVA 2YAFA 3ZHNA 4KQ3H 5KSBE 2XXCB 1WFNA 2DI7A 4EN3C 5CN3A 3MRQB 1DP0A 3H56A 4X2UA 1EO8H 4XWOC 5ADOL 3HVNA 4FQ2H 4YGAB 1TJMA 4L48A 4TNWF 2CDGB 1FIGH 2F7QA 2X0VA 4OGZA 4HEPG 3DX2A 5D7LE 5KBNC 1GTFA 2EUZA 3T0WA 1PBYA 2CO7A 3GSXA 4HJGB 5I74C 4G11A 5L4JA 1P6AB 3CFBB 2PPFA 3EGDA 4PLJD 1T03H 3V7AG 2EJ1A 4HX1B 3TCXA 4EVNB 5I15H 3HBPA 4LZKA 3PNWB 4JFED 5IB1B 3GSQA 3BFQG 2VLKA 2XZQH 4Z7UA 2B5IC 1F8TL 3MBEA 5C7XL 4Z8FH 1MREH 2J25A 4L8DA 4U3SB 4ESKA 3ROLB 4M43L 2KYIA 5I9QB 5J6GA 3O81A 3PJNA 4WI9A 1IIKA 1PZCA 1KLFA 3FFCE 5DUPL 1ZSDA 4J23A 3VDAA 3DV4A 1UXSB 4F5CA 4HIJA 4A7VA 4YX2H 5JHAA 1ADQL 1SJXA 3ISRA 3LCYA 4Q56A 5CZRA 3KR3L 5KSVB 3N0PB 3P3YA 4GS7B 2Z31B 4UQIM 1TCRA 3BZ4A 5SX5H 3EKCA 2J4WL 4YHNA 3FAXA 1Q9OB 4XPFL 4AIOA 2CBQA 5HYJE 5KYNA 1KEML 2BOBB 5JQ6H 2EECA 3FTGA 5KVGL 1FVEA 3CTTA 3ECWA 1WZMA 2J7LA 4WW2C 1DQDH 1MJJB 2F54B 1GA2A 1UM6H 2AJYL 3NRFA 4WGKA 3D0VB 1KLFB 2A9MH 5JHMA 3BPNB 1CS6A 1T2JA 1R3HB 2GB2A 4JNXA 1CD8A 2IBBA 2VRQA 4B95C 1TSHA 3QXAA 2C7FA 1UEYA 3DBXA 4IJ3C 4OCWH 4UNTA 4JN2A 5IB3A 2DICA 3BSZL 1ZJAA 4NC2B 4E5XB 1KACB 2F08A 3WL9A 3OKYA 3ZRFC 2R29L 3EO9L 3S88L 4PCYA 2ZNWA 4KRPC 1TQVA 1KXVA 1YEWA 2AVGA 4HMCA 5H37H 4YSEA 4ZYKA 2WIIA 1BXUA 1FNEA 4G9DB 5HI3D 3VX1A 2Z7YA 2UZYA 1O7DE 3FQYA 1NL0H 4X5WB 4L9DA 4MMZA 4Z7VE 3ZTEA 4EZJA 2D7OA 4CL7A 3J27A 4LDCA 1EFQA 1QP1A 1PS3A 3ML8A 1S3RA 4PREA 1YJDL 2ZXWB 4KY1L 2BFGA 3CVHL 2P8MB 3SGDI 5D4HA 4FTDA 4J3SA 4LVHB 5HHVL 1HNFA 2ZT9C 1TF4A 4NPYA 3H7LA 3LHPH 4L29A 3S3PA 1OCCB 3TVMB 2F54D 3E9TA 1J5DA 1CGVA 5FKPB 3NQIA 1P4LA 3H42H 3SKUD 1UXWB 3IE4A 4ACTA 2LAGB 2CGRL 2YUWA 3JUZA 5DMKA 4XH2A 3RWEB 4AQ1C 4GP5B 4OLYH 1GGIH 2X4PB 3CVHH 5GQBA 3EIFA 1N7ML 2YGPA 4CVXA 1JGUL 4H5SA 5DD3L 1CTMA 1NFDF 1QBAA 1T7VA 4OGYL 1N68A 2ICEA 2Z92B 3D3VE 4WSJA 2HJLA 2IADA 3Q6FA 5IESH 2EADA 2G3NA 3EH4B 1CFSA 1RSFA 2BW5A 4YXLH 1M7UA 3K4ZA 4PRHB 2EDOA 5SX5K 3NFPA 3WGVB 1MH5B 1YVLA 1V7MH 2LABA 2WTPA 3C5ZB 3QJRB 2DLGA 4N8VG 1CFQB 1F11B 3CSYB 1DQJB 4Y0GA 1NCHA 3LN5B 4IDJL 3LKSA 1RAMA 3X17A 5I0DA 2FT6A 4NZDA 3PGDA 3ZX1A 2R1YB 4OCWL 2Q0ZX 3I6SA 4HWEL 4M93B 4KH9A 4QJ4B 2VZ3A 3SE9L 2ISDA 2MPAH 4AM0A 4NOBA 3UJIL 1BDYA 1FRGH 3WTUA 3CMOH 2VR6A 2YFNA 4HZLB 5DO8A 1I1AB 3QUML 1ZK9A 2V7NB 2XVLA 4UI2A 1KJ3L 2BDNH 2DKUA 2AQTA 3EGXB 4HV8B 3HRZA 1G43A 2BO0A 5IREA 1YNKL 5DJCA 3IDXL 3SZKC 3CH1B 3E6FA 3MOAL 1NIBA 3V4PB 2Q5BA 4NO3A 4BZ1L 2FHFA 1PNCA 2D7NA 4R4NC 4YOKA 4WUUA 3VFRB 2AW2A 1P4BH 5EU7C 2JQZA 4I85A 3RDTD 2BNQB 4FNLH 2IANB 4I89A 2F18A 5D1ZC 3V0HA 1CQYA 4OF5A 1A5FH 1BV8A 4RETB 5FYLE 2VLKD 5D6DA 3FRPB 3ZE2B 4NCDA 3BAIA 3FC8A 1JGEA 3BWUF 3CSBA 4JQIH 1CF8H 4NN7B 1RY7B 3BUIA 3NJXA 3DTUB 3V6OE 5L88H 3RIFF 1X3DA 2RACA 3W0WA 5FHAH 2VQTA 1ERNA 3S3JA 4FL4C 3BP4B 2GEQA 1TZGL 2Z7UA 4NQEB 5MEPB 4AYMC 2NW2B 2XFGB 1QSVA 2Y2YA 4MAUH 5CR8A 1ADWA 2HRPH 1PMYA 2P8LA 4OT1L 1JPEA 4K3HA 4MJ4A 1OB0A 4OLVH 3ZKSD 3MCKA 4MJ6A 1WAPA 4HF5L 5M95B 2DBLL 2CKNA 1F18A 1ZS8A 4XPBL 5DD5H 3TH4T 3ARZA 1BZDA 2R8SH 1FH2A 5CBAA 2AK4D 5F7DB 3VWJA 2MQ3A 5DC0A 1UUNA 1BQLH 3PRZA 1QSFA 5E99H 5JPNB 1HWGB 4H88H 4LL1A 4Y2OB 2OSWA 3GSUA 4RDQF 3EYFA 4G7QB 3VFGH 1WRFA 2NQDA 3LY6A 4R7NB 2TAAA 1QA9A 3R06B 4L8SB 4LL9A 3VXSD 1AZNA 1T7YA 3F12B 4PH8A 4YSUA 3QIUD 1RK1A 2W8CA 4JE4B 3B2DC 4HA1A 2BSEA 2VDRL 2VNCA 1J1PH 4AEEA 4HWZA 4HS8L 1USZA 2X88A 2WXMA 2EYRB 2YR3A 2SEBB 4Q6IB 2GAZB 3RQ3A 1JYXA 4DN3H 2VLRE 3B9KD 3IKKA 4ZFOB 1KXTB 1JTPA 5ANMB 1WCBB 5HY9A 1L0PA 5IBTH 1JZEA 4CRPA 3CVIL 1WT5C 4NWTH 3G5XB 2XQBL 3CLWA 3VXNA 4NN7C 1YDPA 4XPHL 4XB3A 4OM1L 3UAJA 4JANB 2IWKA 3MLZL 4KKLC 1MRFH 4GS7C 2PYED 1OAUL 3SGDH 2BIQA 3TJEL 2PABA 4FQJH 1TMQA 5MHSD 1OARL 3DX6A 3DOIA 3MV01 5JUEH 1LO0H 4D8OA 4YGVB 1JMZA 3LIUA 3FT0A 4Q6YA 1E50A 5GGVY 5A16B 2WP3O 1Z7JA 2EKSB 2Y06L 1NEZA 3DUUB 5JW3L 1QUNB 4YDVB 5KZCB 3QG7L 1WJ3A 3WO4C 2JB6B 3V0VB 5B39A 2OSYA 3UDWA 2V9QA 4W9CC 5F93C 4F7EA 4UU9A 2XBZA 1FGVH 3RWGA 1W72L 4HU2A 2UWEF 5TD4A 5I5JA 3GMQB 4X6DE 2DQIL 3P54A 5I8OH 4MB4A 1WHOA 4MAYD 3WS3A 1OIOA 2F19H 3K6DA 5KG9B 4NQDD 4UB0H 4IMKA 4K7PX 2CLRA 1V54B 4S1RL 5BRPA 5HHQA 4NM8H 1IM9D 1JTOA 2AJXL 3D4YA 5J06A 1O75A 1JIBA 4IRZL 4HUUA 4HK3N 1MELA 4Y5YB 3CPUA 3VRJB 1NAKH 3PHQB 4AYEC 4G80A 4C56D 4IYKA 3BUQA 3EGSB 1EQWA 4HPHA 2ZPKL 1I8KB 1LLAA 3BH9B 3Q3GB 3JYBA 5AAWA 3T6XA 5IOPA 1LYQA 2MPAL 1WIUA 3CXHK 3N9GL 3FQXB 3P3SA 4FTVB 4J3TA 1NCBH 2I07A 1PD6A 5I1DA 1A6PA 1DQQA 4TQ8A 2VSKB 4O58H 2ITCB 2V3EA 5MENE 3IDGA 3F6IA 3GZPA 3HS0C 1KJVB 1LTXA 1YEEH 2F68X 5I18L 5E7FA 1FFPA 1EHNA 5H37A 3UTSB 3EYOA 5EBWB 4PI2A 1CTOA 1VPOH 3TO2B 4I3GA 5IQMA 3NT0A 3P77A 1OAJA 1Z66A 1HAUA 1IT9L 3MJ7A 3U30B 1AS8A 3RG1C 2EICA 1T22A 4HH9B 4NGHH 3NIFF 4QDGA 2O5YH 1UVQA 2FD6H 2O1AA 4POUB 1LO4L 2NQ3A 4RWHA 1E7VA 3LS4H 1DDHB 1AMXA 1RZFH 2HH0H 3IJHB 3L1EA 4P5KB 1QRND 2CD0A 1IQWH 2JELL 1G7PB 2V5TA 2UY6B 4FFVD 5BRZE 3PL6D 1MHCB 3VXPB 2CCLA 2LLNA 3T04D 4NRXB 1SF5A 2FLRT 1HXKA 2NY2B 2QSTA 3CZNA 1QR1A 3BH8A 4U1HA 3DHMA 1P7QD 1MCKA 1SFDA 1ZE3C 1QEWA 2VTFA 5IK3B 1XF3B 3DGGA 5I17B 1KCRH 2ERJB 4NZUL 1L9NA 2OP4L 4G9FE 4MAUL 2QSCL 3H54A 4WJKB 3SQRA 2QGDA 4EUPA 1DUZA 1JK8B 3ZHLA 2Z31D 5FUOH 4XOCA 5AW9B 5GRVL 2BERA 4Y5XC 2JKLA 4BSJA 3SDCA 2WD0A 4ERSH 3BE1L 4A2FA 3A0OA 4MDJB 4PV8B 1W9XA 1KIQA 1XEUA 1VZIA 4G83A 3W2DL 5DSCA 1KGCD 2YPLB 1ZIBA 3I50H 1IBBA 4YHOH 4B7IA 2F9BT 2KQNA 5EEXA 4HQQH 1BJ1H 3QULA 4HAGA 1INEL 3V52H 1L9RA 4GBXA 2Q9OA 3LN9A 2VN3A 3ZTDC 3EHBB 5KSUB 1U8HB 1DFBH 1KENH 4LSUL 2QPDB 3IJ7A 3KXFB 1UWXH 4LRNL 3HN5A 4NO0B 5JIQA 1PIFA 2OQJA 3EHBD 2BNQA 1ET8A 5F70A 1C1EH 5B1CA 4JPWL 2JJSC 1BQ5A 1YEDB 3OHXC 32C2A 1G6VK 4K8RH 4S1QH 1OHZA 3BDXA 4M7KH 4PJFA 2GUYA 4N6RB 1OSYA 2NUPB 5AVQB 5TGBB 5KVEE 2EXSA 1JI1A 5EF3A 2N0KA 3MUGA 1MW3A 3O8XC 1DUYB 5CCJA 1CXIA 2B15A 2GK0B 3QDME 2W07A 4TUKH 1LO2L 4JFOA 3B9KA 4AV4A 4JLRB 4FQXA 3RFZB 4RMSA 3T77B 3QWOA 4E42B 2WP3T 4NYLA 3P4NA 4NNYA 2N56A 3MLWL 3OL2A 1NMCC 2BSSA 3OZ9L 1Z3GH 4HCIA 3AMLA 1BOGA 4ZOEA 2X1QA 4XGZA 3DECA 1YG9A 5LWYL 2B14A 2YA0A 3IDGB 4KX9A 1DVYA 3P4LA 3UAJD 3F01A 1ZHNA 4RIRA 4ZS6C 4XN7A 3V6FB 4NXSA 5GZNC 4MZ2A 1E4HA 2OAAA 3MUY1 5CJBA 3V0VA 3MZGB 4JDVB 3CFDB 1E8XA 4JO1H 1H5BC 4YE4L 2Y36L 4IKKA 5DFVC 1CN4A 3MJ9H 1ZT7A 3UBXA 5HP5A 2ZSVB 1C5BH 2XNAB 3BFOA 2WWMC 4KXZH 3GFUA 4PRDA 2DWSA 5E2VH 1QPPA 3SDAB 3JYCA 4U6YB 2FWOA 1RJYA 1HH6A 1KOAA 3OMIB 1XCXA 3GSVA 4QXWA 1FCGA 1TYJA 4DKTA 4KZDH 2W0KA 1GAFL 4BRJA 3TURA 2IADB 2YD3A 1DDTA 3HE6C 1UD3A 2ICEB 2Z92A 3ZKXC 3BLKA 2Y7LA 4LMQE 1FH5H 1J87A 4PN6A 2VDQL 5GGRB 3T4AB 5IWLC 1HL8A 3TF7C 4M9PA 1L0QA 4LCWD 3GJFK 1NAMH 4FAAB 3WIIH 3QVAA 4JZJA 4P3DA 5IF0B 3VXTB 2XX1A 5DD5L 4NZTL 2VZOA 4LHJB 5AW6B 1LVEA 1NBZA 2EIJB 1N8ZA 5JNYB 1VFBA 3BZFB 3OPUA 4JZOB 1MNNA 4Y2NA 3FO1A 4P2QB 2GQHA 4I48B 4P4KD 3GNML 1CE1H 1KDIA 5FO2A 4KH2A 3ASOB 4BSVA 1UADC 4TL5A 2PN5A 5EIQA 4HKBA 3IU4L 1AI1L 1NUDA 3ZKMC 3GSUB 4XVUC 4KQ3L 2W60B 2W65A 3QB7C 3TA3A 1HDMB 4GW4B 5KBPA 1RUQL 1OOWA 3F8UB 3REWB 5HVGB 1M7IA 1Z0NA 4G71B 4LLDB 2ZOUA 5F21B 4ZTEA 4HAFA 1G4MA 2GIMA 4CJ1A 5C1MB 3L3JB 3TA3D 1TYRA 1DQTA 3CU7A 3ZL4H 1MY5A 1SHMA 2YUXA 1E9PA 4EXKA 4XP1L 4K8RD 1DBJL 2WZ5A 4BKLA 1VADB 3QDHA 3O41A 2Q3XA 3KBPA 2GAZA 4PJIA 5C7ZA 3SE8H 5HGHB 4LVEA 2B9AA 3D2UD 4NQVA 4ODTH 4PJDE 1A14L 1TR7A 1X9LA 5H35A 5CXPA 1SFHA 4ZD3L 3NTCL 5HHNB 5JUEL 3DBXB 3JWNH 1BIHA 2WUCH 1PLBA 4HWNA 3T3MB 3FCSA 4K3EL 3Q2VA 4Q9CA 1EK3A 3D8MA 4QRPD 3K71A 4KV5E 3EYFB 4M1GL 4JHWL 3V4VB 3NA9L 5JO5B 4P05A 4C56E 3IVKA 3H7BA 3WUWB 3DTDA 4JFYB 3WAKA 2PMZA 3GTTA 2BIMA 3P73A 2VR7A 3LMJH 2VSDA 5IFHH 1BVKA 4FFZH 2CGYA 3VXUD 3IRZA 1FVEB 3NA9H 1CLYL 1RZJC 2JH2A 5EZIL 4QXGH 4ADGA 4YS4A 1TKWB 1ZEAH 5KW9H 2XTLA 1THCA 3RY6C 3UBXG 2JCCB 5C0GA 4CA4A 1M05B 1I85A 4PRBA 3HC3L 3QZWB 5JIPA 1CZ8H 3FTWA 4R7VA 5DUPH 1SHWA 3O3UN 1T1XA 1QYGL 4FQIL 4NHCH 4PW4A 2BSDA 2QHLA 2V7NA 4WHYH 5HGGS 3NJMA 1LILA 2JE8A 1K8DA 3MGOA 4JZNB 4JUSA 4NCC2 1E8YA 3OAUL 4X7SH 3EJQA 3W0WB 3QARA 1F3JA 1KJ2A 2J1WA 5KYWB 2CK0L 4Y19D 1AGBB 1PFCA 3T09A 5K5YA 3CJJA 3IN0A 5CU5A 2Y7QA 4ZX5A 1ETA1 4BD4A 1UM5H 2HPTA 4I3RH 2RAMA 2HFEA 1FDLL 3GK8L 5HHXH 2X10A 1XX9C 2CGRH 3RJQB 1FFNA 2Z65C 4QTIH 3BPCA 3MLZH 4HKXA 4WHCA 3UO1H 3CZLA 2IG2H 2ZUYA 4Y4HA 2AGJH 4X7FC 2JXMA 3E7JA 3IAGC 4BXVA 2SODB 1T1WA 3EUDA 3KPSE 4ZTPH 5K9JH 2VL5B 3ZOAA 5ACLA 5B4MC 3TWCL 3VFOB 5BZWB 3M8OL 5DHYB 1RZQA 5IVZA 2XZAH 2GJJA 2ADIA 3MJWA 4LMQI 4HFUL 3GXDA 2H26B 1NOLA 5JPMC 4KROB 4Z77A 3QIWC 4IMLA 4OW6A 5AD0A 2R1YA 2FX9H 3PGDB 3VFVB 5ICUA 4UIMB 4ZFZA 1S7RA 1SY6L 3MBED 4K94L 4M48H 2W0LA 1AGEB 4AITA 4IRSB 1NGYB 1XTMA 3L3KA 5F7EH 4N0CC 4XAWH 2IGTA 4X80H 1GGTA 2GSGA 3OXRB 2AJSL 2K7PA 5TK2A 4NQQA 5DDHB 2EEAA 4X98A 5EC2B 4PREB 1U3HB 5AAPA 2G75A 3G6AA 3L17A 4HMDA 5I1IL 3BKJH 5C71A 3MKKA 5B7EA 3OAYH 2FJSA 2WO3B 4KVNL 4MNHB 4ZW6A 3WDJA 2QSVA 1BX2B 4ZS7H 3KYKL 4MXVF 3GSNB 4AQZA 1KYOK 3MYZA 3UGUA 1A1MA 3VFUA 2VRKA 4AJYV 1W0WB 3D2UB 1UGNA 3WFDL 4CBZA 4Z78A 5C07E 3ARTA 4EDXA 5DMKB 1ZHBA 2YUZA 3KBEA 2MOQA 3D85B 4L0ZA 3S96A 3AS0A 2FEDD 5DEFA 2Z93B 3AY4A 3O3AB 5I71B 3HAEG 1XCWA 4Z7VA 4Z5RA 4Z7QB 2AZUA 1FFOA 2IV9A 1WSST 2G9HA 3PE9A 5E8PB 1DVUA 1UASA 2CA4A 2VERN 3DXAD 4RGMB 1AKJB 4TPRL 4U1JB 1KYOJ 1O9ZA 4TVSa 2CRIA 3KYOB 1H6FA 3SYQA 4L3ED 3II2A 3QJHA 5TF1L 4MD0B 4BFEA 3HNTH 4HS6A 3LEXA 1QLEB 4S1DC 1Z9MA 4HS3A 5ESAA 4TTDC 4GKOA 5EFIA 1HHKA 4F7MA 4X6FB 4BKSC 5FA3B 1FSKC 1X7QA 3BEWA 4Z3GA 1FVCA 3ARGA 2VM9A 1KPVB 3HZ3A 3QW9A 1XSJA 2GBTA 4DOHE 4JPIA 4BCZA 3K2UH 1NLBH 1PX4A 3LKQA 5BXFB 1JZ3A 5IFAL 2PW1B 1NIAA 3V4PL 4ZXBB 3B9DA 4AI7A 5GJSL 5EF0A 3FJTA 1CPUA 3J7HA 3MRFB 2R9HC 2NR6D 1G7LA 2IPUG 2AABL 1YMMD 1U8OA 3D4ZA 2G9HB 1PYWA 3IEAA 5E8PA 1NGWA 3SGKC 1OCWL 1G7LB 1FBIL 3WFEL 3T0BA 4CDHA 1U0QA 3B5HA 5MEQB 1BBJB 5I73B 3MBEB 2IALA 2JV6A 2F54A 2H3XC 5EO1A 3HTLX 3RKDC 3CGTA 5E0QA 5AW3B 3GEFA 1NFDA 1XF1A 5DK0B 1DO5A 1K3ZA 1KCVL 3ARGB 3G5ZB 43C9A 3GSXB 4HJGA 1NOFA 5FF6A 1LK2B 1GZHA 4GXUM 1AMYA 2X3BA 4UZSA 4OLZL 1GJIA 4Q52A 4K3GA 4M6NL 1NCUA 4K73A 4LPUA 4Z7WA 5HDLA 5CHNA 3ULUL 1QI3A 1OCZB 4I3SL 5CSBA 1E3XA 2APVA 3D30A 4AENB 1TO4A 2OMVB 3LXCA 3DROA 5FYJE 1R1CA 4KKZA 1KB9J 3IDIB 3SPVB 3R18A 1E4JA 5FGRA 2OR8A 5J1SC 5I8EA 1QBLH 4XMXA 3BPOB 5IBUG 1MIMH 1X5GA 3DYPA 3UBGA 2JJVA 4M56A 1FZJB 2IWFA 4RAUB 4S2SA 1MF2H 5IQ9B 1OGPA 2AXWA 4GQRA 4HPYL 1IE4A 2K78A 1DVTA 1ORSB 3RUGF 5HYJD 3EGDB 2C9PA 3CZFA 5I8OL 3CFNA 4XVJH 4ATTA 1KPUA 3NZ8A 4K23H 1A1MB 3WN5C 1BYPA 2D2CC 3CFMA 5GRWA 3WXVH 1WG3A 3NCBB 3KPLA 1BJMA 2AZAA 2I9LA 4NOFA 2ITDA 1BZ8A 2Y07H 4XO8A 2RQEA 1BF8A 2AMGA 1CU4L 3F7KA 5ENWA 1BJ8A 3O3BA 4JB9H 5B4MD 4F8LA 3VG0H 3OAWA 5CEXB 5BJTB 5DD1H 5EF2A 3T0EC 2EEBA 3GKWH 2J6EH 4FQQB 4Y19E 1R0AL 1M57B 3C6LA 5F7NC 1MWAH 2WAHA 2GJ6B 2XG5A 3LKRB 3RP1A 5L4MA 5KVFE 2RH0A 2R1WB 4QRQA 1BZQK 5CCKH 1L4IA 1FG2A 3VI4F 4AGNA 5LXGH 3RB7A 2V0AA 2VCOA 4JEGB 5FO7A 4OCRL 4B5EA 1AGBA 1YEKL 2HUHA 3OWRA 3ZTCC 5B3NA 4K8RC 2VXUH 1I1AD 1NKGA 3T2NL 4EF3A 5J11C 1X9RA 3C5ZC 4I2XB 4NLHA 4RNRB 5C09D 4UQDA 2R2HA 4FERA 5F88B 1SNRA 4K3EH 3DC0A 2QTVA 3OXSB 1ADQH 2MCAA 1FYTB 2NYKA 4MQ7B 5I6XC 2YSTA 1RP9A 2M26A 4N9GA 1T1XB 4OD3H 1T5WA 4H1LB 1T1WB 4YO0A 3SDYL 5C0AB 3IETB 1PL3A 1M7XA 1PEWA 3FQNB 1KZQA 3NZUA 4CU8A 4GUOA 1UOWA 43C9B 4I88A 1UFUA 3OG6B 3FF7A 5TDPA 1IM3A 2GW5A 4OU3A 4JO5A 4HPOH 2ZWNA 3EJUA 4GFTB 4HS8H 4Z3JA 1U8QA 4NNPL 2GT9B 4QEGA 1Q9WB 5AZ2L 5IW1B 5SV4A 1B2WH 4PJ8A 5D1XB 1RFDH 3NPSB 2E76C 1G9MC 1DYZA 4FTVD 2C34A 4PG9B 1NTDA 4AOFA 2AQ2A 4YDJB 5DWUL 4R97C 3LS5H 4P5MA 3BKCL 1OXYA 3FTXA 3NSYA 2K8QA 3SGJA 1J5IA 3BO8A 4Q9QH 4L9LA 5AEAA 3ARQA 4JVPA 3KXFE 5DWUH 1FVDB 3KWXA 3NCXA 1X7QB 3BEWB 4JPKL 4J28A 4MKTA 5DVLA 1BF5A 1DQLL 1QWUA 2HFGL 2ZF9A 5EOTB 1MAMH 4ZAKB 3U6XS 3BQUA 3MX0A 5IEKA 5DD1L 4BCXA 1A7RH 4HEMA 4P23A 3MNZB 1NCGA 2DRUA 2JF1A 5LB1A 2YOAA 1W72B 3ZRSA 2Z4QB 3TBWB 5EO0A 3BVVA 3MOBH 1K5NA 4TSCH 4YAQB 5DMIL 2WXRA 1ES0B 2ESVE 1YNKH 3N50A 4J12A 4KXCA 1YEJH 4P5TC 1SVBA 5GSRA 3K46A 3IJ9A 3UTOA 3QEGH 4AMKL 3FH5A 1WS8A 3N40P 1SVZA 3BGFB 1G7JA 1JPTH 2B59A 2MNJB 3KDMB 3PJSA 4M6ML 2IXQA 2UWEE 3G08B 4B0MB 1BZOA 3GS4A 4GNKB 4OJFL 4S0TD 1AH1A 4D9QE 5GGQL 3I50L 5DUJA 3T0EB 1BW8A 3HB3D 5I19L 1LEIB 3L95B 2AMUA 4F2MB 4CN6A 2WN3A 4PGJA 4R5XA 2J88L 5D4QA 3BE1H 1DJZA 2V2TA 1XFPA 2JVUA 4XTRC 5EN2B 1D5XA 4XODA 1NCOA 3V4UL 1CE6A 2FWOB 4TNVK 2CBPA 5B3JE 1R3IH 1RULL 4IIQA 2ETWA 2WMPA 1V7ML 3CUPB 1NC2B 3UCQA 1BP3B 4H8WC 1I8AA 2KLRA 4Z76B 3L3KB 2DJUA 4QY8B 4B9CA 1NQBA 4QRSA 3BW9B 5DZAA 4BZ2H 3UGEA 2BP0A 3L2MA 1CGXA 3MV7D 4WV1B 5D7SL 5LDSA 1GYCA 3HMXH 2VE6B 1B4TA 1ZHNB 2ADYA 4PJHB 4RRPM 4QUOA 5ICZA 4X7DC 3TZVC 1LP9F 2K3HA 3N44B 2I60H 1N5AB 3U9UA 2YPLD 1RZFL 2HH0L 1AD0A 1CD0A 3MV7A 3BWZA 2YQ3A 3IGAA 1SEQL 3BUYA 4AE1A 5B1KA 2I9TA 3PDGA 5M7QA 3AVEA 4JFOB 2X2YA 2F58H 2N59A 1RURH 2AFNA 2NXZB 1INDL 1RVFL 2ARWA 2PWEA 1H0DB 3WO3B 3PL6A 1AGDA 1EVUA 2HLAA 5JHLA 2E4TA 2X4NB 5TDOB 1SDDB 3K72A 5TE4H 4R0LA 4GKLA 4AYID 1TUPA 1DL7H 5EZOH 2E59A 1S8DB 4FQLL 4LCWA 5BNXD 3FCTA 3AT9A 2CO2A 2DKSA 4JK0D 4KWUA 3ZE0E 3FFCA 1EBPA 4BFIA 5IIEB 4G6KL 3ZGIA 2FIKB 5E8NA 2EDFA 4K3JL 3QG6B 4X4XA 1JGDB 4YHMH 4TUOB 1LWHA 5TDNA 4PY7A 2NDFA 4PJ6A 2V8MA 4FQXB 1W0VB 2FECL 4PRIA 4GRLD 3VU1A 2OL3B 5C0CD 3I6GA 4WEMB 5E2WL 3ATEA 2Q10A 4P2OA 1SYSB 2F2HA 1YNTA 3LV3B 4JDEB 4WW1A 2LU7A 4CDGC 5D8JL 5DZJA 3ECQA 4XBEL 1WT5A 4QRUB 2A74A 1B4LA 1C08A 5JXED 3UFIA 3ZN6A 3VMPA 5IB5B 3TPKA 4LOVA 5HHOA 2ATKA 5FO8A 4KTEH 1I3UA 3RVXC 1AFVL 3EOBA 1ORQA 3TEXA 4S0HA 3PUUA 1CBJA 5D7IA 2VDPH 3AG1B 3FZUD 5EOCL 4UYPA 1Q72L 3S34H 4JGNA 3MACH 4J3OD 3WELA 5DUBA 1HFUA 3QYNA 1NC4D 3GSNH 3IRPX 4WHDA 4CGUB 2ZIDA 1JV5B 1HS6A 4KJPD 4XC1H 3UEZA 1MCDA 1JNHB 1WBXB 4UOW1 4WI2A 1JNJA 1MW0A 3EYOB 3FH7A 4NERA 1LWJA 1Z5LB 5B38G 4N2GA 3NJIA 3WKMH 4UQ2B 3D5OF 5AUMB 3MNDA 1X5JA 3D7PA 2J71A 4XP1H 3CVCA 4WW2B 1ZS2A 4JE0A 4XOAA 4NI6A 5C7XH 4Z8FL 3OMZA 4JPSA 3O2VH 2XWXA 1EBAA 2BXYA 3QI9C 2CZNA 3KE0A 1UG9A 4GAJH 5IB2A 2OTWB 5IWLA 1MHCA 5LXVA 1EFXB 2EO1A 4TLSA 4GP8B 2HKAA 4NQCE 3KYNA 4J1UA 4N25A 4UT6H 3TVMD 5FECB 1SHSA 1IBGH 3TBVA 1KN4L 3D52A 3GMLA 1JNHA 1UJ3C 1WBXA 4DZBB 2DYPD 1TVBA 2YD6A 3HHSA 4IU2A 1E4XI 3GI9H 3H4FA 2AGJL 2E7MA 1DJHA 3K4DA 3EH5B 3UH8A 4Z7QE 3ZK0A 4WEEA 4D0BA 1AO7A 3CVHB 4Y1TA 4R96A 3ZVVA 2DD8H 1A4BA 5D7IB 3UPCA 4LIQL 4IRJD 5I8CA 1RIHL 4LKXB 4N0UA 3WDHA 4U1LB 2DQFA 1IB5A 2OKMA 2K9UA 3LRMA 1EO8L 3NACL 1ZVYA 4KVCL 4TKWA 5ADOH 4PGBB 1PZDA 2HYMA 3U4KA 2WO2B 2VSMB 4O5LH 4WLCA 2CPUA 2PKDA 3F04A 4KX8A 2XLLA 2E9BA 3QUXA 3QUGA 1RZ7L 2EKSA 1WZ1L 4OZHB 1OP5H 4ABWA 4A2MA 1EAPA 1TJIH 2FGZA 2RCSL 4QTHB 1PNDA 3IN2A 2NYZA 1DEDA 4ENED 1E7UA 5HYSG 2ZUTA 3JWNG 2CE6A 4HC1H 4MCNA 3BVNB 2BNUB 1K6QL 5ANHA 3A6BH 5KN5B 4YC2C 1KB5H 1AD0B 3GHBL 3I6KB 4L3EA 2Y1ZA 2BZDA 1LDSA 4NXKA 1FYHB 1LO3L 3FUKA 4G7VH 1HJCA 4AL8L 5D96C 1RIUH 4ALAH 4KBPA 4NRYB 5DS2A 4XX1G 2N7BA 4DQAA 4LLQB 4FZ8L 2ICEC 3ZKXB 1SDAB 3TV3H 3QBTB 5DURD 5FGCE 1XTLA 3QGVA 3QO1A 1CD1B 2AEOA 2IJ0C 4S1DD 3GLDA 1E3FA 2OLDA 5D1XD 3F12A 3DRQA 3O2DH 4WUUD 1S4IA 2P80D 1XIWA 2XWZA 3OX8B 3HKFA 1KYUA 4X7SL 4X83A 4YGVA 5FA4B 4JFHD 2KPNA 4OGXL 2EYSA 3MTXA 3QHFH 1BFVL 2NY6D 1ACZA 3PAUA 4H26A 4FFWD 2FZ3B 2HVBA 1ZV2A 3QULB 3MGTA 2XZCH 4YFLF 4O51A 1BVNP 5B1AB 1A5FL 3W0WD 4M7JH 1MHPL 1QBBA 1G0YR 2HLFC 5DGRA 4FABH 4JM2A 4QPEA 1PJWA 3ILDA 3ZIYA 2B59B 2NX5D 3KDMA 1J48A 5ES4B 5ICZB 3HPLB 4AVJA 4G8GE 4LLWB 4FQPA 3TT1L 3D0LB 2C3XA 3NH7H 4BDVA 1IGIH 3RZCC 3O3EB 2E0PA 3OBAA 4GRLC 3FQWB 1EAOA 1NBYB 3UZEA 2GI7A 1LP9B 4RH4A 2BMKB 5HJ3B 3HC0B 4TULH 1YYLL 2JCWA 3C9NA 2B4CL 3EOBB 1HSBA 3D39A 3FTUA 4XAKE 3VI3E 1OVZA 4IIQB 2OXHA 5BVPL 4OD1H 3OKMA 3WIHL 4Y2OA 5IB5A 2XWTA 1XSIA 4FXGB 1U3HD 4MNGA 3IMBA 3TCLA 2CUIA 3RVVD 1UWYA 1MW2A 4E9LA 2UXTA 2DY2A 4JO3H 4FNQA 2H0PA 4ZAKA 4AC4A 3BAKA 3AB0C 2F5BL 4ZFQA 1KIPB 1LM8V 4E0RB 4JDEA 3CH1A 2R4SH 3G08A 4PGZA 4XVTL 2BM3A 1X5YA 4KROD 4E2OA 4ELME 2O61B 4YXHH 3B2XA 1YZZA 4QYOA 2EXWD 4ZMNA 1AS6A 3E3QE 5JXAH 2EUVA 4WJ5A 5DLLA 3EJCA 1SJHA 1N26A 1EZVX 4JO1L 5IESL 4PG9A 2OX5A 3DURA 4R26L 1ACXA 3B37A 4ZUUA 5IIEA 2I60L 5D9SA 2AABH 2Z4QA 3TBWA 3EO9H 3GNMH 3BUPA 4JFEE 3DIFA 3VWJC 1IBHA 1RUML 1CFMA 3MXVL 4QT5B 5L7XH 4JO3L 3H55A 5C0ND 4BV1A 5AKSA 2X09A 4ZMOA 2DQCH 1OW0C 4G6JL 5IB4B 3Q13A 3SO5A 1SOXA 1CFSB 5IVOA 1P5UC 2J8HA 4NQTA 4DAGL 3FRPG 5J12C 3B2MA 4PJCE 4RGOH 1A3ZA 1H5BB 4YDIL 2BVOB 4FHKA 5HGDA 4KRLB 5CS7A 1H8NA 2J88H 3IGAB 3QFDB 2Y9RT 2LLLA 1MJ8L 1ZVSB 1OANA 1LO5A 2VL4A 5K33A 3TT1H 3UACA 1X7TA 5TFSL 5KJRH 4AM0B 3ULVF 3EFFB 3PGCB 3MA7B 4MD4B 1T1ZA 3JT0A 1CGTA 3UABA 5EUOA 2X4RA 2MNUA 4P9HC 1FG2B 4QNPE 2AEIT 5H94A 3WXWL 3MO1A 4AVKA 4NKOA 2EXYC 2YFOA 2ZXBA 5DC2A 4MDIB 2C5DC 3G6DH 4UT7L 3CZSA 3VFWB 3L48A 2VLJE 4ETYA 1YMMB 3GD1C 4N24A 1QSED 5CSZA 5E6RB 3VXUB 2R59A 2R4RH 1AGFA 1R34A 4FFWC 1ZANL 3IETA 2H1LM 5GGSY 5TE6L 1A4KA 2XZQL 3R7RA 5HDBF 4GOSA 2AANA 2A6JA 2HJLB 5J3HC 3N85H 2NSXA 2OXGA 5EC1A 4AEHH 1XVSA 1LHZA 3VDBA 1AXTH 4ZZKA 1N0LB 4Y8DC 5BOZG 4OCLC 5D7KE 1KPUB 3F58H 5E7BA 4R4BB 1F3DJ 4JFDD 4ACPA 3JV0A 2ZOLB 4JFUA 4OKVA 1S7SA 4FXGC 4LNVA 2FX7L 3JZ7A 1OP4A 1IMHC 1J8KA 4LEEA 1M3JA 1WFTA 2E8ZA 2DQMA 3C08H 3SCMA 5SWZB 4R7DB 3UC2A 1AKJD 4N4YB 3UJTL 1SXAA 4K0OA 2PYFA 2P28B 4DTGH 4OTXL 4YK4B 2YAHA 4Z18A 4KZCA 1MCEA 2A1WH 2ZICA 2RCSH 1B90A 3BMVA 4XNQA 3MLRH 1OB1A 2WY3B 1UENA 3HG2A 1MJJA 4QRTB 2XIIA 1VACB 2ZUQB 4QAMB 3MBXL 1VCAA 3MRCB 4Y88A 1ZGLA 3ESNA 3KPPB 1A7OH 1KCSH 4WENB 4ZUVB 2Z34A 2EP6A 2ORBH 5BRZB 1S9WA 1ECZA 5D70H 4YDKH 4PBXA 5INCB 2WKLA 1F8TH 1JE6A 1XZ0A 1Z9SA 3HS0A 2OA9A 2Z31A 2G5RA 1QR4A 2B9BA 4LSTH 1KCLA 4M8QA 1B88A 2NX5A 1T03L 3VFPB 1F3DH 3M1CA 3FBKA 2R7EB 4WGVB 4F8NA 3N1PC 1H9DA 3GINA 1N12A 4OZFA 1M6OB 4F37F 3WG7B 4G5ZH 1FZKB 3KWWB 1JPGB 3QXUA 1IKNC 4X9HA 3UBHA 3FHEA 3RA7L 1ASPA 3CCHB 4RQQB 4X6CA 3RUGA 2FQGA 2XN9A 3L2NA 2JB5H 3G5YB 1KGUA 5C2BH 5C0AE 3E38A 2CRYA 3RVXD 1KB9K 3GPSA 1L9MA 3QRGL 4Z7WB 1CBVH 1IM3B 1DJSA 1AHWB 2BOBA 1VFMA 2XZCL 4KNUA 2XN9D 3ULUF 2NX5B 1GZQA 1Q9OA 1QRNB 2Z35A 3V4PA 3QDAA 1KY7A 4JB9L 3E3QC 3UTTA 5ESAB 1U4EA 1KCKA 3A4AA 3QORA 5E2TL 3OKOB 4U1IA 2V8LA 4MQXC 3TH3T 1U8PA 1J05A 3J2PA 4E41E 2ZXGA 2X87A 3KPOA 1N64L 2YK1L 3DSFH 3LB6C 3A23A 3MRCA 4CJ0A 3DXAE 4U6TA 1IAKA 3BN9D 1CYGA 1H15A 2AJYH 1UM6L 4PJBA 1TDQA 2WZ0A 3AT0A 2MOVA 4TVPH 1UUSA 1IC4H 3V0EA 1KULA 1P7BA 4GW1B 4X6CB 3CXFA 4H8PA 4OJYA 5CD3B 4EN3D 3RVUC 1MCLA 4WIQA 2Z1KA 4AL8H 4HULB 2NNXA 5F89B 2E9GA 1DVFC 2OJZL 2IBZY 1OF2A 1I1YB 3WKPA 4GUQA 1DQJA 1I1CA 2EDWA 1S7SB 3L3OA 3B9VA 2RBLA 3UXFA 5AYUH 4DCQA 2OULB 3LIZH 4LFHD 2EDTA 1SJMA 4B9FA 1CIUA 1N4XL 4YX2L 4BH8A 4XR8C 3R8BB 5LN4A 1MLBA 5EFIB 2DF3A 3IXAA 5DJ0A 3SBRA 4FFTA 3VDCA 1A0QH 3JWNC 3A21A 3KPTA 3LZFH 1LXMA 5DD6A 1BZEA 2Q87A 2C26A 3BZEB 3TBSA 1JI2A 1T1YB 1KNOA 1R5VA 3O4OB 1G6RH 2C3VB 4LLUB 3GC3A 3NCFB 4IBLT 1Z9NA 4U1JA 4ZSOE 2QGCA 2J8UF 3U9PL 2Y25A 1O9VA 5T1MA 2W91A 4FA7B 2VLRB 3CVDA 5AKTA 4Z95H 4DKEH 2V5RA 5L8KB 1XGYH 5KYXA 3SCMB 5D2LB 1OF2B 2UXVA 3CN3A 1U30A 2AAVA 1ASOA 2XQYA 3BN3B 3M7FB 4J3OF 5D2LA 1CDCA 3NSJA 5AD0B 2NY0B 5AW4B 5F9JA 3NBNA 4HD5A 4ES8A 1YYMH 1VGEH 3MLSL 2R27A 1BVLB 1QWNA 3ZJAA 4CADA 4CSTA 4ZSOB 1U91A 4DPAX 3L3DA 4FS0A 4PAZA 1L7TL 1LO5B 2P46B 3ARBC 3RPIA 4U0RB 4YSSA 4TQHA 3S36L 3A6CH 3BZEA 1QLFB 2F53D 3ZDXB 2VL5A 3WCYA 3PQYE 5EUOF 1I8MA 1WTLA 1QATA 1F2QA 4OQTH 1N5YH 3T6ZA 2H3NB 2IGLA 4CKVX 4ZAKC 2NNAA 5F7UA 1KB5B 3BOVA 3V5HA 1TEGA 1C8QA 2C7UB 5I1KH 4JFDA 2D03H 4NHUB 4XP6L 1JCKA 1SN0A 1XB6A 2XQ0A 3DJTA 1ETJA 3U46B 1QNIA 2WKOA 5F7BA 5MHSE 3WEBA 1MCNA 3NFNA 5EZJB 1Y6NR 3TM6A 4XWGL 1BBJA 5DZ9A 4HUNB 4N22A 1YC8A 3PABB 3KZ8A 1OD7A 2Y4SA 3JSSA 4IMLB 5G2NA 3DOSB 4H25A 3KJ6L 1PQZA 3VVVA 2DW5A 3VXSB 3K5SA 1T1ZB 25C8L 5C0RL 3WD5L 2IOMA 4PJBB 2F1BA 4DP1X 3TGXA 3OZ9H 2WSDA 4LL4A 5C8JB 3MRKB 3KW7A 4RFNB 4KNSA 4OT1H 5DRXA 4LCYA 4JM2D 4NWUH 3U7YL 3U30C 5K1VA 3RILA 3ROOA 1WE5A 4FNSA 1XH1A 4PWIA 4ADIA 4DPCX 4FGMA 3V5DA 2WGXA 4Y1SA 1H5BA 4BK4A 3EYQC 3FTSA 4FQ1L 2P5WA 3HS0B 2VLMD 5EO9A 4X6FA 4PB9L 4ABQA 2B3RA 3GZQA 4HHWA 3ECBB 2JCCA 1Z3GL 3ESUF 4OFPA 5C0GB 4Z7AA 1CXLA 2PW2B 4U6HA 5LQBL 5C0BD 4AEHL 1ND0A 3PIQB 4PV9B 5JHDB 1PU0A 2KT6A 5LJYH 4FXGA 1OB1B 2ZWKA 3QQDB 4KJYA 4D0DB 5EIIB 1NINA 2L7QA 3K71B 3T4YA 2IAMC 4YR6B 3CHSA 2XN9B 1DBML 3O2DA 4PJ7A 3T65B 1ZLSL 1OAXL 5CP7A 5TFSH 5KJRL 3RIFK 2VITA 2VSCA 5MENA 1P9MC 3O8XA 3FB7A 1HQRB 3NCYS 2UY7B 1RUAH 2FATL 2VLKB 4Z7UB 1X5LA 1OAXH 4IGBC 4YWGH 5HHMB 1PG7W 4QYOB 1MCOH 1HOEA 4FQXD 3LDBC 4EDXB 4JRYA 3Q5YA 1B6DA 3VXRB 5I30H 1BBDL 3UAAA 3LKOA 1A6AB 3CC5B 2VJ8A 3RY6A 3S5LA 5GRVK 1TZAA 4NUGH 5D2NE 2DTML 2FDBP 1DSYA 2FBJH 1D5BB 4H26B 3BC9A 4NT6A 4YPGB 2A6JB 1E27B 5I6NA 3DJRA 4X5RA 3IFLL 1D2OA 3NIGB 5CILL 1UOVA 1ID5I 3H7BB 4GMSH 4Q0XH 4D9LH 4FD0A 4P9ML 5CIPB 4LCUB 3SBPA 2A83A 2FJFB 3BKCH 3ZYIA 1CXHA 3C9NB 3BKML 3TU6A 1ACCA 1XGRB 1YCSA 3FHAA 1T4KA 4X6BB 1Z32X 5DVMA 1KEGL 3KXFD 1KG0A 3WOVA 4A7SA 1FE8H 4PWGA 5CWSA 1NBZB 2WK2A 4IU3B 2FL5A 5H2BB 4LSPH 2P80A 2J57A 5GS0H 2LLGA 1CICB 1AZBA 4YDZA 2Y7SA 1DJYA 2V7HA 4Z7IA 4ELMA 1KT2A 4NNXB 4O51B 5F0MB 1PZ5A 5DHYA 1G7IB 3MUUA 3PS6A 3DUSB 3R1GH 1MFEH 3FOMB 4G1EB 1FLRH 3FU9A 5IVXE 3QEQD 1WHPA 4YIQB 3OR6B 1AR2A 3SDYH 3VI4B 2QDVA 1HDMA 4ZFFA 5DJ8A 5KVMC 4AV5A 3OJMB 4Q0XL 4D9LL 2XPZA 1KLGA 2J2ZA 3IKCB 4TOYL 1FG9C 3RTQD 3RIAF 4PS4L 1ADQA 4L4VD 3D3VB 4DK5A 2XNAA 1NC2D 5D1QE 4N8CH 2O5XL 4PJIF 4OFVA 3ALPA 5T8IA 3RAJL 3KLHD 3CDZB 1RL1A 4OLXL 2B3IA 3AU1B 5DA4A 5HYEA 4KMQA 2E9JA 3DIFB 1TQCC 1HINL 3CZGA 3SJVE 5HI5C 4MNQB 2DJMA 3LXBA 3MFFB 1EEZB 2Q2EB 3NUKA 4LPVA 2RFXB 3TEYA 2ICWA 3L3OC 4ZQTA 5JOPE 5C9KA 3UBXI 1SLWA 2JIXD 5EOCJ 4F7KA 2FAUA 2ZWZA 1J0KA 4IRZH 5J13C 5D1ZD 1YA5A 5T5FA 3X3FL 4F20A 2XVGA 3WNKA 3OTTA 3F7VB 3BN9C 4TVPD 3X14A 3UROR 5BV7C 5HGDB 1A3LL 2G2RB 1XXFC 2JIXA 4APQC 4JY4A 1KV7A 4PRAB 1RUKL 3SDAA 1OTSD 4PJFB 3RE0A 1S7QA 3I74A 4IKNA 1C16B 4U49A 4TSAH 4WHTA 3T9WA 2NRDA 2A0LD 5HD8D 4LESA 4FZ8H 5EEUA 3IRCA 4GI6A 3IVKB 1MRFL 3VO0A 2KLTA 4AQEB 4M7LH 4GKNA 4NZ8A 1JYNA 3V6FA 3TA4D 1U41A 1HNYA 3O2DL 3RU8H 2E7HA 1QQDA 2QADB 5GGQH 1NBYA 1TJHH 3F6LA 2E9WA 1JG9A 3WY4A 1RIVL 1UWFA 1X5HA 2WUCL 1ZIAA 3JVGA 3QEGL 3WEMA 1AQ8A 1EJ6A 2GK2A 4XP5L 3GSWB 1KWGA 1OV8A 3WEOA 1FO0B 3N43F 1E9PB 2NTSP 3C5XA 3F5WA 3MLXH 4PJXA 5TGBA 4DKFH 4K94H 4M48L 5F3FA 4JFPA 5IBUB 1MI5A 2NY0C 1D7DA 1P69B 5F6IB 3P4OB 4DFHA 4DOHB 2XXFA 1M7IB 5JYLA 3SYCA 4KHXL 2ZUSA 4HSQA 1F6FB 2W88A 1QR1B 4E36A 2WNGA 4XXWC 4GQ9L 4W70A 4D0CA 2V4LA 4N2HA 2FT7A 1E5ZA 4PJCA 1DVSA 3BVUA 3GMRB 1TNMA 5HJ3A 4LCIL 3NP4A 4R8WH 2OTPA 4TNWK 4DEWA 4XNXH 4F80A 4U1GC 2AQPA 3AITA 1A7NH 4PVBA 4DP7X 2QHRL 3SPGA 1L7TH 1P5VA 4MWFA 3MTRA 4PV8A 4IDLA 3RY5A 4P5RA 4Y9FA 3K2IA 3EBHA 4V1DE 3WFZA 4AQ8C 3VTAA 3R8QA 4GSDH 5KVEL 5K9KA 2FEDC 4HBCH 1OALA 1ZXKA 1FFPB 3T0XA 2H0FA 5IVXB 2OZNA 2BY3A 4LQFH 3OJDB 1FAIL 4LEXH 2YAMA 3US1A 4NNPH 1OGTA 4PJ7F 1ZPUA 4U2YA 1AYRA 4MAZA 5FUCE 1UM4L 2A6DA 5F0PB 2WQUA 2I85A 5HDRA 5EU5A 2P24A 3VQ1C 3D4GA 4AIZA 1G5GA 5FHAL 4HK0A 1MWAA 3OX8A 4HFWA 4KITB 2WLHA 5FLUA 5AG9A 4ANXA 4QRPE 1RUAL 1NMAH 2HVJA 2YQBA 3TT3H 1MCRA 1A6TB 5FGCB 3SKJH 3CAFA 5BRQA 5JW4R 4ZMXA 2ZUUA 4PGBA 4W9DC 4Z0XB 3MLPA 2KC0A 4LSUH 1QKZH 4ODVL 4QF1B 1U8MB 3I6GB 4HJEA 2W0FA 3ZZQA 4N2LA 4U1LA 3MV9B 1FN4A 5JHLH 1Y1DA 2OI9C 3QJFA 4MXVE 4TSBH 4BRVA 3WS3B 1G6RB 1E65A 1ZV9A 5FC9A 4CUCA 3HNVH 4BZ1H 2XOTA 2FGWL 3BEVB 4WSGA 4D0BB 3DMMB 4X7EC 1D7CA 3CQQA 2HT3D 4KKRA 1GOGA 4OCRH 4UWQB 3K2KA 4YN3A 2Y7MA 2UX7A 3HS9A 1P5VB 3DMMD 5C6TL 3FQXA 2E75C 4FTVA 4CBPA 2K45A 4FXLA 3Q3GA 1LD9A 5D6CA 4ANVA 2QQNL 1NC2A 4FKHA 2QLVB 3Q6GL 2YMXH 3B5GA 2M1KA 3CZUB 4M1DL 1VEPA 1A3RL 2R4RL 4DVBB 1Q9LA 1JK9A 2WXIA 2JJTC 4H20H 1ZDSA 4OFQA 3FOMA 2D31B 1QFOA 2RQ8A 3G6DL 3AS1A 2I26N 2Z91B 5JW5A 4LP5A 2R2BA 4K23L 1OAQH 4X0NA 3HOGA 4IBQA 3VD2A 2Q20A 2JKNA 3U9UB 2BVQA 5E1AA 4IOIA 4HETA 1MRDL 2KHAA 3ARGD 5HTSA 5I75B 2XBDA 3ZUCA 1S7VA 1HEJC 1NIFA 2UXFA 1UJ3A 3VX0A 4ODUA 1OPOA 1IX2A 4BGDA 4IJTA 2VR4A 3LYRA 4I0PD 4N20A 1NIEA 5CLXA 1YNLH 2FUQA 2LAAA 3GO1H 4MA1B 5CIPA 1HCZA 4XPTL 4XMPH 5IM7A 2FBJL 2IFFH 3VXMB 5F7AA 1XQ4A 5CJOL 2A9NL 4XPTH 3BAXA 4YHKH 5DEJA 5I30L 3EFOA 3ZYJA 1IL1