3T7IA

Crystal structure of se-met rtt107p (residues 820-1070)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
249
structure length
236
Chain Sequence
TKAEKILARFNELPNYDLKAVCTGCFHDGFNEVDIEILNQLGIKIFDNIKETDKLNCIFAPKILRTEKFLKSLSFEPLKFALKPEFIIDMLKQIHSSQININLFDYEINGINESIISKTKLPTKVFERANIRCINLVNDIPGGVDTIGSVLKAHGIEKINVLRSKKCTFEDIIPNDIFKYVLIVTKASQVKKFTKMINDRDKNETILIVEWNWCVESIFHLNVDFTSKKNVLYQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Regulator of Ty1 transposition protein 107
publication title Structure of C-terminal Tandem BRCT Repeats of Rtt107 Protein Reveals Critical Role in Interaction with Phosphorylated Histone H2A during DNA Damage Repair
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 73
structure length 236
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16770 RTT107_BRCT_5 Regulator of Ty1 transposition protein 107 BRCT domain
A PF16771 RTT107_BRCT_6 Regulator of Ty1 transposition protein 107 BRCT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3t7iA02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3t7iA01
2K7FA 3PXCX 3K05A 2EBWA 3PC8C 1T2VA 2E2WA 2ADOA 1IMOA 3SHVA 3AL2A 2EBUA 2INGX 3PXDA 1T15A 3II6X 3SZMA 3PXBA 3EF1A 3K0KA 4XQ0A 3PC8A 2XNKA 3I0NA 3PC6A 3PXAA 1L7BA 4BU0A 2K6GA 2NTEA 2VXBA 1L0BA 2COUA 1N5OX 3L41A 3FA2A 3QVGA 2L42A 4IFIA 4IGKA 1IN1A 1OQAA 3KTFA 3K0HA 3SHTA 3PD7A 3I0MA 2JW5A 2M2IA 4BMCA 3EF0A 2LE0A 3SQDA 1T2UA 2DUNA 4Y18A 3PC7A 4ID3A 2COEA 3HUFA 3L40A 1KZYC 4N40A 2ETXA 4BMDA 4U4AA 3COJA 1Y98A 3HUEA 3K15A 3PA6A 3T7JA 4BU1A 4XPZA 3JVEA 1T29A 1CDZA 3U3ZA 1WF6A 2EP8A 2D8MA 1JNXX 2R1ZA 3K16A 3PXEA 3T1NA 2COKA 1Z56C 3T7IA 2VXCA 3L46A 3T7KA 4JLUA 2WT8A 3UENA 1GZHB 2XNHA 3AL3A 5ECGC 3QVGB 2HTFA 3OLCX 2AZMA 4OFBA 4Y2GA 3UEOA
chains in the Genus database with same CATH superfamily
3X0DA 5K0LA 3FG9A 4U7WA 1JQLB 1T4CA 1XELA 1Y37A 1ULTA 3K70B 4G4SO 5K20A 3RS3A 3ZE6A 2NNWB 3QU2A 2H4HA 2V3WA 4QZVA 3B9PA 1RRVA 3E18A 1EHIA 1XCGB 3GMDA 4M1EA 3VR4D 1EP2B 1ZJZA 2VNJA 2P91A 3DDOA 1HLFA 4QX6A 1ZAYA 3A11A 2FHSA 2WZDA 4JBWA 1GSAA 1LI4A 3AT1A 1YDGA 4D97A 5KYGA 1BU8A 1T3GA 3CJRA 4BNNA 1LI5A 2EBUA 5SY6A 1EJ6A 3IHKA 4K8OA 2PJRA 1MAAA 4OQYA 4PNHA 3MGCA 3L7KA 3OP4A 4BFUA 5CBPA 5KINB 1KPHA 3MBKA 3ZCSA 5IVHA 4H7FA 2ZPTX 2GBPA 4BRWA 1GSIA 1PEYA 1R15A 3TLMA 4CF3A 5MN6A 2W8BB 2V1UA 4Z4EA 4KXLA 1T6YA 1IXSB 3PXUA 2MIIA 5C5DA 3H1EA 3NRJA 3UJAA 5KC8A 3MLBA 3HCBA 3C3MA 3JQEA 2HWWA 5DLYA 4JJZA 5FFNA 4ZQEA 1XL1A 4XDGA 3M3HA 4RVFA 3DQPA 2UZ1A 1WXFA 1YXMA 1C2TA 1M2NA 1PJ8A 3ET5A 3IE0A 5BSEA 1D5WA 2EARA 5CFRA 2Y1FA 2ZSEA 3MT7A 5DN9A 1J23A 4GBJA 3SJZA 4M38A 3K0HA 3OUUA 4KYUA 1IC6A 1T9GS 4RH1A 3OTGA 1NT4A 2DYKA 3IUJA 3LUHA 2Z9DA 4IH9A 3CUEF 4KP7A 4Z7OB 1LLFA 4Q4JB 1F6BA 2X0IA 1IUPA 1XZQA 4QUAA 4DSOA 4PV7A 5KX5F 1NYLA 4PGMA 1NYTA 2XCSB 2JCXA 1YBFA 4I1YA 5C3MA 3V8MA 2FK7A 4ID3A 2FR8C 3CRZA 3VZBA 2XBLA 3G7NA 3P32A 2FQXA 4GI2A 4O59O 3PXXA 4PICA 4B87A 3AUYA 3G9QA 4CM3A 2ZTSA 3OZVA 5LP6A 1OF1A 3CJTA 3TE6A 4EOGA 1AUOA 3ZWPA 2XCOA 1FJHA 3PKZA 4QSMA 3JS5A 4R51A 3ABOB 3VMFA 1NW6A 2EJCA 3LQ4A 4I6GA 3OZSA 1DC7A 1EK0A 4Z4QA 4GM4A 1O94C 3GRKA 1RBZA 1WDWB 4ICIA 3GRRA 4KO8A 1FYWA 1HG0A 1OI7A 1E2QA 1GLNA 1I2MA 2CJPA 3OE4A 2CHGA 3RYHB 4COKA 5JFOA 4JLSA 4ZVTA 2HLHA 1SOVA 4M99A 1DAMA 2EP8A 4J0IA 1DKOA 4W82A 4BX3A 4QYMA 1RFLA 3I42A 2AR9A 1OHHA 2WUVA 5CLGA 3T1NA 4B84A 4LV6A 3ESQA 1W44A 2CNLA 1CRQA 4A82A 2F00A 1SZJG 2WA1A 2CXNA 1LX7A 2IDKA 1VJCA 2AFIA 3AUKA 3D8HA 4KFUA 1QGUB 4AK9A 4IGIA 3L8CA 2FJPA 2HWUA 2VYFA 4AXBA 4C4OA 1KFJB 3J7AC 1CEXA 5JY6A 4D0SA 3L6CA 3GP8A 1GKUB 1WP9A 3LRXA 4UXHA 3VO8A 3EQ6A 2XD9A 1A8HA 1JG6A 3H8WA 3M4YA 1D3AA 4DLYA 2BGLA 2GBFA 2FA9A 1V6AA 3AEZA 3AETA 4CODB 1A76A 2QK4A 2AI3A 3GJ3A 3L7MA 4MKXA 3ZVNA 1N36B 4IDDA 2VKQA 3K1YA 3LLVA 3R6TA 5I6DA 2I4LA 1EUQA 2F1HA 4QFDA 1ZEMA 4LGVA 3GJ4A 4G5HA 1Z25A 3GXOA 1JU3A 2AXEA 1R6UA 5J9FA 4RL6A 5CXSA 1X7ZA 3MINA 2ZYSA 3T15A 4RTNA 2JJ1D 1BHO1 4DCSA 2KB0A 1Z4PX 5BNWA 3DLBA 1PGOA 1YQGA 3PFGA 2P9JA 1OLXB 2JBWA 3E3NA 1HZZA 2E4AA 4IHKA 1KP3A 1YQEA 3SI7A 5U9CA 1HWYA 3LGAA 3CUTA 4I50B 1MD9A 1ORRA 4OD0A 4CIXA 5KNBH 3QITA 4EO4A 4X1OA 1T8WA 1JKIA 3GLHA 1GP2A 1N5MA 3I28A 3RUPA 4JP1A 5J2TF 5LC1A 1PU2A 1WUYA 2G1KA 2W6NA 3MRTA 2FPKA 1ORIA 5A1TA 3K71B 2HHAA 4C6RA 2NUBA 3NOOA 2P9TA 1FFEA 1SCIA 1T6BY 1TLLA 1UBGA 4GQIA 4WKGA 2VHEA 4Y1EA 3CX4A 1FRVA 1VG1A 4YN3A 4NBLA 5CLFA 4P6VF 3CNHA 2BWJA 2W2KB 3DNFA 1SHTX 3QG1A 1BKYA 3H83A 1TTHA 3CX7A 5AHOA 1DKUA 5A62A 3QX3A 4CEHB 3JQCA 5EG5A 3EZ7A 1Z0ZA 3VZSA 3X43A 3C7CB 2BH9A 1W5FA 4KACA 3R8CA 4ARCA 2GEFA 4KNVA 3K0CA 3TOSA 3ZK9A 1KTIA 4TOIA 4JOQA 3EG5A 1U0FA 4J0GA 3QU7A 1QORA 1GQOA 2VDPB 5ER9A 2IUYA 3UK7A 3KE8A 5ENDA 2AMFA 2R84A 4OA5A 1XA4A 3DKVA 3SFTA 3HXMA 2QY6A 2JBAA 1KC1A 1OI3A 2ZJ2A 3BWBA 3P5BA 2VP0A 4FFBB 3U4CA 1B8OA 1F6WA 4QNMA 2APJA 3MXOA 2D5AA 1MX5A 2O6LA 2AFHE 4L16A 4LPKA 1KDZA 4F3CA 5MN4A 4MVJA 3N0XA 1QVRA 3GLQA 3FHLA 1MN6A 1KY5A 4Q9NA 4N3BA 5LBUA 3A6GA 2F1RA 1T9ZA 4N3GA 2YYZA 4IMRA 2HCJB 3AQIA 4PXSA 5TGTA 4BQEA 1U8EA 5CCXA 1SCUA 1PGPA 1SELA 2B1IA 2GEVA 2MT9A 2P9ZA 3NG1A 4IILA 2OR3A 4CR6A 3G85A 3WAJA 4BVJA 2XCRB 1GVNB 2WWHA 3EHEA 1QRRA 3LE8A 4LHWA 3EZNA 4FDTA 4JN6B 1TUGA 1NMZA 3DDWA 2YIMA 4PHFA 1CY0A 2DRIA 3DHYA 2PGNA 4V1CA 2Q8QA 2Q5FA 1QLWA 2GI4A 3U4DA 3TOVA 3LCVB 1B93A 2JIBA 1EBBA 3F2IA 4KAAA 2WWGA 2V03A 3RUIA 1X8KA 2HJSA 3K9WA 3EMDA 1JP7A 2QM0A 5CFQA 1ZVQA 1AF7A 3SLGA 3VGJA 3PGA1 4MVJP 4ZI7B 1DKLA 2Q3LA 4K9KA 1E0JA 1X1SA 1ZZGA 2BE7A 4OVKA 3ZGZA 1DFIA 4HVAA 3AHDA 7YASA 3DWEX 2JFVA 4UBJA 1HYQA 5TDHA 3ROKA 1ODCA 3C3JA 2Z6QA 1UKBA 4Q7QA 3OX4A 4Z0NA 5HR5A 1AUVA 5HKKA 2ZE6A 1H22A 1RQRA 4FJ0A 3EDRA 4V2UA 1VGRA 1XBTA 5JZMA 1ZUIA 2XB4A 3LX5A 2PUHA 2XNCA 1E1RA 4Q4AB 1D6MA 1N7HA 1T2VA 2JD1A 4Y1FA 4JI7B 1JJAA 4HGQA 4BGIA 3KUUA 1BU5A 2FZLA 4XQGA 4UBLA 4EQ6A 4ZDIA 3P0IA 1XZJA 1XHLA 3COVA 4EPVA 5JCZA 1FQOA 5FBVB 2C9OA 2Y8EA 4M76B 1XVLA 2P4QA 4TS9A 2P2GA 2HJHA 3PQ2A 4CDGA 4ECAA 3PV0A 3RFUA 3VDMA 4BAUA 1NAIA 3CLRD 2VJBA 5A4AA 1YR2A 1OT5A 1Z34A 2OLEA 2DBQA 3CZMA 4Y6QA 5C1DA 1KZ4A 1XFAA 3MUFA 4HAOA 2AKYA 3FOFC 5BW4A 1D4FA 2PL3A 1IFXA 1D2HA 2PM8A 3RSGA 2XGJA 5BR8B 3EC7A 3EJWA 2BM0A 1TW2A 4X6XA 1NDQA 4I4CA 2LKDA 2XQVA 4NS1A 3PWKA 2BFDA 1QANA 5AW5A 4O1HA 2VTKA 2PVCA 4CM1A 3SVZA 1QNLA 4ZRNA 4EEXA 1TD9A 2Q2QA 1BCSA 1LTKA 1MF7A 3LV8A 2O57A 1P4GA 2J0UA 4KMRA 2Z2YA 4ESEA 4CNBA 3NP7A 2ZIZA 4CQNA 4N18A 5JVDA 1ML3A 3E23A 4AZ0B 1AN0A 1C7QA 5EKXA 4NAUA 3P4YA 4R1OA 1L4BA 1JX6A 1HOXA 1W85A 4QA9A 1TGYA 2AN4A 3IUQA 2YVKA 3NP9A 4ENQA 4QQNA 3IBSA 2K2WA 4QGGA 4X1IB 2CMKA 3TUIC 1ES9A 3REOA 4OREX 2UUAB 3PC7A 5F7OA 1T5OA 2B1QA 1U0LA 2PGIA 2VYQA 3KB1A 3P0JA 4RZIA 5DEIA 5ESXA 2ETXA 3KXKA 4BX9A 1RWXA 3M9WA 2HAEA 1NUHA 2BKXA 1YMVA 4KK4A 2WJIA 2R97A 1ICIA 2GASA 2RHCA 3BQ9A 5MFZA 3AGPA 1WUKS 4EVSA 4ENTA 1TVCA 2PE5A 4IJ5A 2VDNB 4M8KA 4TUYF 3NTQA 1Y3DE 1V2GA 1BEUB 3VH4A 1MDBA 2P4HX 3CG0A 4XWWA 4LBYA 2I2WA 3ADBA 4AKEA 4LYEA 1Q1QA 5F7ZA 3HBNA 1U3CA 2BEVA 5AVXA 3FNQA 4N41A 3LRTA 2OSBA 1W4BA 2WU0A 5KNLA 2BTQA 4V0RA 1W93A 3DBHA 2J7PD 3DP9A 1VPVA 4KXVA 4PZAA 3FYHA 1GCOA 1OBCA 3I09A 4YJ2F 2NU9B 1OV6A 1ISMA 5FNVB 4I36A 4WINA 3UH1A 2MYUA 4CCSA 3AFGA 1MIOB 4JJFA 2LBPA 1MRZA 3FLBA 4KDFA 1GUYA 2CE2X 4TMVA 5DBIA 1NN5A 1KFKB 1LLCA 1OFTA 3DKRA 1T25A 2CVQA 4OKNA 3VHXB 4DUGD 4NICA 1KYXA 2F59A 4FBLA 2HRDA 4J0QA 5B4VA 5AOAA 1RHRA 2FSGA 3GLHE 1UH5A 4CM4A 5IHPA 2BMEA 3ED1A 4RTLA 3QTBA 2GN8A 1ADBA 3WIUA 4ESOA 5KS2A 1DIRA 3OCYA 1FJGB 2OAQ1 3F96A 4YJHB 3PUIA 2JJQA 4ER3A 3PVSA 1ANKA 4DT1B 1Z4KA 1Y63A 5LQAA 3BFVA 4XJVA 4MUFA 4XUCA 2UZ0A 4DV5B 4I6JA 2WFZA 5LOVF 3WGOA 3I2GA 3RHSA 4KWTA 3VNRA 2P2LA 1X77A 4XPIB 2W42A 1T34A 3MEQA 3V4OA 4FZ3A 1NR5A 2A1TR 3KK0A 4TXLA 4DJFC 3BEOA 4C7OA 4QT0A 1WMFA 4PYKA 4F6RB 4Z9AA 3AFNA 3O4RA 1EUCA 5K0ZA 2Z04A 2UVDA 3H2GA 3AUJB 1G20A 3CGGA 3TL2A 3VI4B 3OOWA 4N0QA 1PGQA 4M53A 3S3TA 4OAOA 5DO9A 1TTTA 1ZRMA 2NO1A 1QHIA 3NVMB 2JIZD 4LJ5A 1FJXA 2V3CC 3ANTA 4M8SA 3ZTWA 2E6UX 1P7WA 2FRVA 2HF8A 5DYIA 5KUTA 1KU0A 4OLJA 1TYCA 2FW8A 4FYMA 4DLNA 3EDMA 5LUBA 3BIOA 4MVJE 4KTVE 4LX8A 2I55A 1TC1A 1MOSA 2A9JA 1A0OA 4FKZA 3K0FB 1Z5VA 121PA 1MLDA 2BISA 2HFJA 2O06A 3DDHA 4O1MA 2NXJA 3WYGA 5AW8A 2BTEA 1OYYA 1JAZA 4MWEA 3QVSA 1H05A 2QX7A 1QHGA 3L6OO 4I5GA 2AFIB 4LYAA 2IPAB 5CX1A 4P81A 1CULC 1LSSA 1YC5A 3DBIA 5C8VA 5JEDA 3GCGA 3LW7A 1PVOA 1G4HA 1XPUA 1EZZA 3SIWA 4RLHA 1A5BB 3EF0A 4L8FA 5JMPA 2DUNA 2WJ4A 2ZYRA 3KKEA 1HZJA 1BGVA 1I1NA 4YUXA 1ZS9A 1VZ3A 1YA4A 3A04A 3A26A 3HKEA 5B6PA 2NZWA 1EM8B 5TARA 4L7VA 3LY9A 4E6EA 3OBBA 1DO8A 4RKFA 3WYAA 5BRJA 4L28A 4NPAA 1X7ZB 2Y92A 3UKOA 1OW3B 3RASA 3DZ8A 4INOA 2XHZA 3NM5A 4NXMB 3O4JA 3L6RA 4AMBA 5LSAA 4O25A 5HOQA 1SUDA 1QGAA 1R3UA 2QZ4A 4QU0A 2HMTA 3DV9A 5DSZA 3L8FA 1NJSA 2ZSAA 3LVQE 3RK0A 2XIJA 3ZH9B 3ZU6A 2QVZX 1OFUX 2MINA 3L82B 5TJHA 5T4FA 1GNTA 2JARA 3N2NA 4L3VA 2ZRNA 1O8CA 1KI4A 1OU0A 3BRSA 2ID4A 1SA0B 1ZUWA 2FW0A 2Q5CA 3CINA 1R27A 4D1YA 3G0HA 1Q21A 1O96A 1SQGA 1M74A 2H51A 4TWJA 5K3FB 1VGQA 4IDAA 1P1CA 5COQA 1TF2A 2I3ZA 3GRPA 3DB1A 4NH0A 3GMSA 4FLMA 4OJKA 5EP1A 3RHTA 3TQRA 4CL3A 3C45A 1O6FA 3JVDA 2VHQA 5TMBA 3IT0A 5IHXA 4AG5A 4XX1A 2RH4A 5CMLA 3RB8A 1SC9A 1EIWA 4Z86A 3DNMA 2GM5A 3OPXA 5AYVA 3QV2A 1GZ4A 1FP1D 1OPXA 5TVGA 3NWPA 4NR0A 2IUEA 1LF5A 2HT1A 3C48A 3MERA 2QUIA 3NVAA 4PAOA 1L5YA 2IJGX 5DDIP 3S8EA 1VIYA 4C01A 4LRUA 3PHIA 3CBQA 3N2GA 5DNCA 1LV7A 1QRTA 2IUUA 2IP1A 2C3YA 4TV9B 1PBNA 3LI2A 3D4NA 4ZD6A 2PZKA 3CKLA 4AO6A 1PUIA 2MHCA 1AY0A 2OAP1 3A9VA 3E3MA 3KEOA 3TIXB 3KFXA 2ZRQA 5LBTA 5AHRA 1Z3CA 3N70A 2J32A 1I7PA 1M2WA 3B9RA 2OL4A 3OTIA 5EE3A 1NURA 4F1KA 3O2SB 4FYXA 3GP3A 1HQKA 4GMDA 4IYRA 3TBHA 3PXDA 4TL9A 4QE3A 1P3JA 3AVQA 2Z1DA 2JJ2D 2W2QA 4WN9A 4HOYA 3BH0A 1FSZA 3C5CA 3RRXA 3E3OA 1DMSA 2BCEA 4OHRA 2GEJA 3ZDRA 4WFKA 1E0SA 1AA9A 2NU7B 4IR7A 4U3JB 4TLLB 4CIVA 4P4NA 1AKEA 1BHJA 1JDTA 1M2KA 1VPLA 2CFIA 4EGSA 4DM4A 2K5UA 4EHAA 1KO5A 2AUTA 1OA0A 1FP4A 3CRQA 1FW6A 4PFJA 4MV3A 4BNMA 3EPRA 4FW9A 2O0HA 4TRJA 3IKLA 2VRWA 1RSZA 1GY8A 4H7EA 3W8FA 1KI3A 4R6XA 2NPOA 2WIGA 3AR6A 1BXZA 1CUSA 5BY2A 4QBGB 5FLEX 4PNEA 1L4UA 4QLAA 3PUJA 4F4FA 3AVXA 1CR4A 5I9IA 2FX2A 2W98A 3L1HA 4L75A 5BRAA 2Y71A 4HGPA 2FAXA 2C9MA 4C0BA 4UXJA 4DRXB 1N5LA 3L43A 4E7PA 5TXGA 2HK7A 3ZYCA 4JX9A 4UM5A 2FUG1 1ZIYA 3PGXA 1VJTA 3M83A 2QTRA 1TE2A 1C9DB 3GLSA 3TZ6A 4YDSA 2CZQA 3QVVA 4DV0B 1IPFA 2VZLA 3GOHA 3PK0A 2G9NA 3WZLA 1LK0A 1OX5A 5KPDA 1R6TA 2XOEA 1QV6A 2ZUTA 3ROTA 1SUEA 2WOJA 4TYPA 4DQLA 4EUHA 2PGJA 4TMWA 1T6XA 2GLXA 3LPMA 3V2HA 1DWQA 1IUKA 2RK3A 3S6JA 1CZNA 4MV4A 3NH9A 3S27A 2IHJA 4CQMD 2CMFA 3MAGA 4HDAA 2YMQA 3L8ZA 5DHAA 2QLMA 1A9RA 2GR9A 3K1TA 1ONOA 2YMLA 1Z6PA 1GG5A 4RGVA 3FCXA 3TFWA 4PYQA 1QCYA 1USUA 1Z83A 3DZDA 5AVRA 2DJIA 2GSDA 1N0VC 2ZYIA 1N3BA 3U44A 1V5IA 5KCMA 5TEVA 2QVBA 2G09A 5DF1A 3NGXA 4CDRA 1NW5A 1I10A 3C4VA 2ZDGA 4K6FA 1Y42X 1J2EA 1TFUA 2ISQA 2XECA 4WLNA 2ZAOA 3TZCA 2X3YA 1S2MA 3OE7A 4G24A 3TRJA 3LT4A 5H4GA 2ZJ3A 1SU7A 1ZISA 2ACKA 2DKFA 4KN5A 5DW0A 4DZRA 4F3NA 4DCOA 3RGWS 5BV8A 1WJGA 1KMCA 3B89A 3D3EA 2CBZA 1E79D 1SVWA 4H9GA 3CEMA 2PH5A 4LF8B 1MAUA 4WKBA 1Z47A 2QTVA 3EXIA 3TLZA 5K0SA 5DHTA 4O5OA 4I55A 2JH8A 1THGA 4K9NA 4ZEOA 4ZEWA 2IE8A 3OM1A 4IHJF 4YEDA 4D82A 1YUMA 3DEYX 2ZI7A 4RKYA 3Q40A 4RYDA 4O4IF 4QNRA 3EZLA 1JFFA 2C4WA 5B1EA 2AX3A 1CERA 4HDMB 4YJFA 1KOFA 3LZDA 4MINA 3PPYA 3B6KA 1EVLA 3H17A 3ZX5A 1SBTA 1B2RA 2X4GA 2QF7A 3BJEA 4TL7A 1OVGA 5G4LA 3LQ2A 2ADMA 3BZUA 4YRIA 3NWBA 1DSSG 3E9NA 3ND8A 2X0FA 5BQ3A 4CKWA 2C7PA 1ESZA 1AKNA 4UDOA 3UBMA 4AJEA 4ZOEA 4JLKA 1JHRA 2EFHB 1HM5A 2WQ7A 5HEKA 1S02A 3GN1A 5FTNA 3P26A 1BFUA 3PNOA 4H2DA 2HCRA 1UMBB 2NXEA 1ENZA 2Q41A 2ILVA 5BYAA 4V02A 4LZLA 4NABA 5AKLA 2GAOA 2UYGA 2ZBEA 4KPFC 1RPTA 3W8RA 4QGSA 1AOXA 2A5DA 3DS8A 3TSWA 2Q1UA 4X60A 3WL3A 3IVMA 2DERA 3DBHB 3GD5A 3LUJA 2GKSA 2G88A 4HQRA 4PGAA 2P6NA 3F4LA 2L82A 4N6GA 5SICE 2AMLA 2VTBB 1SXGA 1UAYA 2J7PA 1X7DA 2NT4A 3N0TA 1NC3A 1GZDA 2PFSA 1KEEA 3KQMA 1ZMXA 4DMMA 1W1IA 1L5LA 1PD0A 4X97A 3F90A 1NI3A 1V7CA 2IL1A 3EQZA 3BD8A 1OXUA 2R1TA 3FNIA 4A4DA 2J9ZB 4NG4A 4NYMQ 5JCJA 2YV5A 3FN4A 3ZWVA 4CM4B 4DGQA 4EYGA 2QN7A 5BT9A 4DUGA 4LMBA 5DOZA 4CMBA 5KOIA 2HADA 3HP1A 3GRCA 1JALA 3TNLA 2FPLA 5GGYA 4NONA 3I76A 3TRFA 4MQ6A 4OGLA 3OLQA 1Q77A 1VECA 2VZ9A 4FOSA 4L2IB 4M89A 5I5EA 3T3EA 2G6BA 3BQNB 3T99A 1NP7A 1G3IA 2DKOA 3C1OA 4NSNA 2DR2A 1UQTA 1YZLA 3WQBA 1ILWA 3IIIA 1YK0A 2GF0A 5DYNA 2OV1A 4JI2B 5E9JA 1J2YA 2IEZA 1WCWA 4V24A 1POWA 2O8BA 3G8AA 1NM5A 3N8NA 4Q7LA 1GAEO 4WCFA 3OI7A 4RD6A 4DBLC 1RKXA 3FNBA 1B43A 3S1AA 2Q3BA 2FW7A 5JWOA 1Z74A 3JALA 5T64A 4YNBA 1C3XA 4A8PA 2XGGA 3E22A 1N7IA 2R1ZA 2DSNA 3O4IA 4I5DA 2JZOA 3K6KA 3L6UA 3OFJA 3OLYA 4OFXA 4EJMA 1GTSA 1KRXA 1Q16A 3SQOA 4AN0A 4ZGWA 1CUVA 2YWBA 3NPAA 3A1TA 3KU4A 1KJZA 4J16A 1XJWA 3RIXA 1NHWA 1M0TA 1A4RA 2G72A 4IFBA 4D9IA 1XHEA 3EVTA 4Q1FA 4PLYA 5CR9A 3TYXA 2HWYA 4KQHA 4EO9A 2DUMA 1XLTC 4FIDA 3V2IA 3AL3A 2GOYA 3KCQA 1RI4A 1ZN8A 3PHLA 4KOAA 2DOKA 2IPNA 1XMOB 3RKUA 3FUTA 3AJ9A 3G82C 3AEUB 5AUOB 4C87A 5A7HA 3F9RA 3BT7A 1DXOA 1YO6A 4QELA 3RVSA 3RYFB 3TM5A 3M89A 1MQ8B 1UM9B 3LA6A 4R2KA 2HJRA 1LVHA 5GONA 3UQZA 4MWGA 4GZ3A 3K20A 1WPXA 3DTVB 2MTBA 5KYKA 4DV4B 4FEYA 1YD7A 1U8YA 3LTNC 2HRCA 3I2YX 3CXUA 5HJEA 1JG4A 1RKBA 2PXHA 2JZNA 2L19A 2B3TA 1C1DA 3AJDA 3QUQA 4KKVA 4ODIA 4XLLA 5HQTA 5EIXA 3CB4A 1SKQA 5CTJA 4F85A 5JS7A 1OZAA 2BHNA 4IG9A 1CY4A 1DAEA 2XUQA 3SMVA 2H1RA 4RXTA 5DGCA 1QTRA 4DL9A 2D5LA 2Q4TA 2VR1A 1IXRC 1J90A 3RW9A 5E6RA 4WWHA 3TPCA 5KOHA 3FGOA 2HY7A 4LVNA 1Y33E 4Q4LA 2Z09A 1B14A 4QL3A 3HCNA 1GG2A 4DR7B 3RS8A 1JG3A 1OJ7A 2ATXA 3A9UA 4HLNA 1TX4B 4M55A 4Z9FA 1R4NA 3F47A 5KWJA 5JDCA 5KNCD 4RZ2A 5JXWA 2YBEA 1H2HA 1ONBA 1ZMTA 1T0PA 1FUUA 2CYBA 2WTMA 1XXHB 1SNYA 4EGCB 3EVAA 1JDBC 2FPRA 3R8XA 5HCUA 2JCGA 3HR8A 1E2UA 4Q93A 3WGLA 4QOEA 1Y1PA 2CV0A 4K3UA 2NW6A 3RVPA 3I4CA 2R5NA 3JCZA 3CH7A 4JXXA 3BS4A 1C30A 4HNGA 2WHPB 5AXDA 3VR2D 4HI0E 1FS5A 1PTJA 1Q83A 3C8ZA 3LSYA 4UE3S 2YVAA 3DC7A 2W2VA 4MEBA 4PPYA 2WF6A 2JAQA 1W25A 3PFIA 3GRFA 2A3NA 1EX1A 5JD5A 1GRQA 5IBRA 1J8YF 1EQUA 1T9HA 3P96A 5KOJB 1COWA 1YK1A 2UVQA 2QW8A 1WTAA 4EG8A 3LFTA 2YYAA 5JXHA 1KK0A 3OQIA 5KNBA 1NQVA 3RQIA 4F46A 2WWFA 1QV9A 1K98A 2AK2A 2B2XA 2WB4A 5LQJA 2WB2A 3BTSA 1G5HA 2EX1A 3UT5A 3A9CA 5FEUA 2Q5OA 4MDEA 1P91A 1PTKA 1AA6A 2R11A 2ZS8A 1JQBA 1O03A 1F60A 5JXJA 1NVBA 1OV4A 4D4KA 3OU6A 1G1MA 1LNSA 1ILEA 4J3NA 4WLFA 3MTJA 1A9YA 3DDZX 4X44A 2ERXA 3D0OA 5EIHA 3RR2A 3ZW9A 1MT0A 1G60A 1N92A 1YE5A 1BQEA 3OECA 4ZO4A 5C2JB 5IFKA 5BSKA 2D8MA 4G4GA 1QHXA 4ALLA 1QJ4A 1PK9A 2JATA 3DZFA 5A6SB 1KNQA 2PH3A 3WL8A 5AVTA 4MR8A 5GAJA 3EGWA 2EGGA 4Q16A 4J0FA 4HEQA 3LUGA 4LRWA 2WLTA 4HYQA 4RWZA 4X6YA 4CLHA 1FP4B 1JBQA 2PD3A 2PWAA 3CUUA 1SQ6A 4MGHA 3RTEA 3SEQA 3ZY5A 1ZR2A 3ICEA 3LHDA 3H5NA 5H3HA 3ER8A 5C35A 4BECA 4WLOA 4JBYA 3C97A 4UEOA 1V7QA 3QVWA 1DAIA 1EFCA 1JLLA 1KFCB 1A9OA 2IUSA 2JGLA 2PMWB 1SKMA 4F12A 1DWOA 2XJ9A 4NNPA 4JJEA 1JV2B 2GZ3A 2O8NA 3W4KA 4EFKA 1PS9A 1TA0A 5DCLA 3ZLTA 3HLKA 1OASA 4QBIA 3ZHZA 2BFAA 3H87A 1ORVA 2K87A 1S9DA 1ZK1A 4D02A 4G5YA 4YUYA 2IPMA 3BK7A 4HXFB 2JA1A 4YUVA 3K5PA 4X9XA 1W5TA 2XE4A 1G2PA 3B60A 3AESB 1AKRA 2ZYWX 3FR7A 2B1JA 3H2BA 4WBNA 4DSTA 4H7HA 2XWSA 1GGVA 2XAUA 4IDQA 3LL4A 3UXMA 2YJGA 4MPDA 4YREA 4GBMA 1IZ9A 3ZHUA 1QZ3A 1EB9A 1XK7A 4J0KA 2V7XA 2Z5VA 4IYJA 5AI4A 2G40A 1OFHA 3G5UA 5HM8A 3CURA 2FMKA 3Q8MA 1GCIA 5DHQA 2A67A 4YRQA 1Z16A 1SD5A 4UFNA 2UV8A 3MW8A 3V4ZA 1C50A 3R7BA 1XQVA 5KTNA 3AHCA 1X7XA 5JZBA 4CQMA 4XWYA 1WDTA 2LW7A 3E6AA 5ANRB 2VXBA 1V8PA 3T95A 2ZT6A 1QQTA 4WKCA 1CQJB 1LQ2A 1NBME 5F33A 5JAMA 4XOUA 2E6KA 5I5GA 4H18A 3VAZA 4FBMA 3TO5A 2J4DA 5E8RA 3QVGA 1UMKA 4YFYA 3DZGA 2Q62A 4WASA 3JTMA 5CT4A 5HILA 1IJEA 1I14A 4PYOA 4CE6A 3VUEA 4GX1A 1VSUA 1KAHA 3PD7A 2SKDA 2BUBA 4LOLA 4MLZA 3GLFE 4IKEA 2DT8A 1E1LA 1I7NA 1U2TA 5JOQA 1V5FA 1F06A 1QZXA 1N0WA 1T8TA 2HREA 3JSXA 4GOJA 1JHVA 2N47A 2P8JA 3K6JA 4ZOCA 3WB2A 2HBQA 3ZDFA 5K5EA 4X7BA 4Y9RA 2FX3A 2WFAA 3SAJA 4IVRA 4MDHA 4I4NA 2QTMA 2JLWA 3EGEA 4L5YA 1O97C 4R40A 1IG3A 3I0ZA 1F8UA 2VL7A 2PMCA 1B00A 1XQYA 4OMCA 1W7AA 4FONA 3SYLA 3W1VA 1PVVA 3COJA 3QLVA 4I8XA 4D7AA 2AG8A 1DXYA 3AF1A 2ZUEA 3RARA 3ZGNA 3OF2A 2Q4DA 4J94A 3C1TA 4LJ7A 4YJFB 1EVEA 2QN8A 2QD1A 4EG7A 5DLEA 1Y48E 2WHRA 2C2XA 3B20A 4KWHA 4RVHA 2CXHA 4KQ2A 4QPCA 3ZHCA 3IB6A 1UOPA 2AN3A 1M5RA 5KQLA 2EQBA 1RPZA 3B1ZA 3LMKA 3MJDA 4CKWB 4QOSA 4AWXA 1PJLA 1R5OA 3F2VA 3HJCA 4N01A 4PGHA 5C34B 3U4GA 2H07A 4BVFA 2QE6A 621PA 3PQ4A 1CS4C 2V74B 3A3YA 3W2FA 5JCXA 3H9UA 2OZPA 5J43A 5EIWA 2J07A 4UBMA 3L46A 2ZQ5A 3ROGA 5JIBA 4AVYA 2PSSA 2BRUA 4LOIA 2IEYA 4RMIA 1EWKA 3GNSA 1YKGA 3WI7A 4BN5A 4M0PA 1DXHA 4DXHA 4X6UA 2IODA 3EXEA 2D7CA 2ZWOA 3UJCA 1X70A 2WWWA 5EJ5A 2O23A 2GHIA 1YVPA 4W8GA 1TVKB 2WKSA 3B3FA 3KD3A 1Y7TA 3PJEA 2RHRA 1U1FA 3AILA 3I2HA 4KMOA 1VG0B 4LWZA 4XYEA 4Y2XA 3P0EA 2VOEA 4AMVA 4WOBA 3LQFA 3LPNA 1XD9A 1QIGA 4LXXA 2RAFA 1MO3A 1DB3A 5D8DA 2EF0A 4H7IA 2V96A 4EZIA 2QP3A 1ML4A 2W6MA 3I2IA 3DFKA 5BN4A 1DCTA 1G59A 2D1YA 4L76A 2IOYA 5EUQB 1YFKA 4G25A 2CB0A 1UQUA 1MO2A 1ENYA 2DQSA 3A3PA 3AXTA 4BX0A 4YMVA 1U9IA 3M0EA 5ALJA 3WNDA 3H1TA 1J49A 4BATA 4DY6A 4AN4A 3DWGA 3A1DA 1TIPA 3O9ZA 4OQPA 3LY8A 5L3VA 3TNJA 1JR3A 4OYYA 4YDHB 2BP7B 4JI5B 2O8BB 3BICA 5GOZA 1ID8A 1OJLA 3K0EA 1FFYA 3KQTA 4E2XA 3IVRA 4IVQA 5TSDA 1IQUA 3OAAA 3QVXA 3EFOA 2JGIA 4P4SB 4Q00A 3S68A 5KNDH 4BIMA 1G21E 3E22B 1JKJB 4LIPD 2YTZA 1ONPA 3MTIA 3HKDB 5AVOA 1DVRA 2X42A 5DTIA 3ZD6A 2HA5A 1P4RA 4HNRA 1NVXQ 2G04A 2YHSA 4NVRA 3GGGA 5L53A 1M0SA 3JZFA 2REBA 1SEVA 1P9NA 3B1WA 3RVKA 2KM1A 6CHYA 2SCUB 2D8AA 4C88A 5AI6A 1BOOA 3A1WA 1E99A 1S7CA 2R48A 2GILA 2JW5A 3GWZA 3HU2A 4LFAB 1IHXA 3PDHA 4GNRA 4CLXA 5NLLA 4FE4A 4WZ6A 4MYUA 1IM2A 1VIDA 3KXPA 3OT4A 2LE0A 3NHJA 2JVJA 2IZ1A 1MIHA 4RO0A 4UNQA 3DM5A 2EZ4A 2ZJYA 3OPVA 1L4MA 4JYMA 4RQAA 2Q27A 5HGJA 1X7YA 1PT8A 1SXPA 3VDRA 1AS2A 5JW6A 3K1AA 1ETHA 1HYGA 4U2BA 1HSOA 4QAJA 1RPNA 2Y4NA 3OMWA 4I3FA 3T54A 4KX3A 1A8QA 4UW9A 5AJUA 2PD6A 1E1DA 4ZTZB 3TB6A 4N76A 4W6QA 1N1GA 3L4EA 2I22A 4GE0A 3U7GA 2E5LB 3KR1A 2ESRA 4IRUB 3O82A 4U6SA 3UA3A 5JSZA 3OA2A 2J6IA 3ANXA 2P2YA 4NARA 4BV8A 2Y0CA 3IPCA 2X8WA 3ASZA 1NBIA 1XIVA 3BMNA 1YRBA 3DA8A 1QAQA 4IIFA 4BEVA 4WW0A 1TJYA 1GPH1 2ISCA 3IA7A 4L8WB 5BSUA 3SYKA 5K0FA 2ISSD 3AOGA 2YW2A 4FCTA 3KTAA 4PBTA 4RY2A 4D3DA 4EB6B 1P8JA 2I2FA 2XNDD 2OK7A 2F17A 2FWAA 2J3JA 3GUUA 5FOXA 2H57A 2VSOA 3JQGB 4DMHA 5BQFA 1JFVA 5E6RB 3UK6A 3VH3A 4HB4A 4R5HA 1Z73A 3FE2A 3WBFA 4UTOA 5J59A 1V1RA 2OCIA 2X2FA 3M5DA 4ONEA 3H1FA 4KRFA 1ISPA 3LCMA 3EN0A 1GM5A 3S55A 4WVLA 3K9GA 1ZICA 2H7CA 1BMFD 5YASA 3WSWA 3B52X 3N5CA 4AF6A 2WYVA 4KTTE 3R7SA 4DV6B 1DBPA 2RDMA 3ROFA 3QXGA 4PN3A 1PT7A 5KNCA 1IM5A 2ZBFA 3EE6A 3LPLA 5HNKA 4IMPA 4R1MA 3L4KA 4BFVA 1KJ9A 1RWWA 5EJ2A 5FWXA 1E7SA 1Z7GA 3DXZA 3MGAA 3ROXA 5LVAA 2X15A 1XLUA 1L5VA 3M3PA 4PLVA 5LQMA 1QBKC 4TM7A 1L1RA 1X38A 1GIAA 3HBMA 4PZUA 4RETA 5K3OA 4MR7A 1UFRA 4R7GA 1NX6A 1WY7A 1PIWA 4U9UA 5KI6A 4A6EA 3OZ7A 4JLVA 2XIQA 3GFBA 1A9TA 4WJKB 2C07A 4ZAZA 2GA9A 4YCSA 4FPXA 2Y3IA 5L4NA 2YJZA 3K0AA 4Y6GB 2GYYA 3OQIB 4BKUA 2D1QA 2LP4Y 5JD4A 1ADJA 3HBFA 4CMCA 1P73A 1JG1A 3GPCA 3E81A 2XKBA 3MMZA 1PSWA 1D2EA 2ID7A 3MIZA 4KR6A 1MX9A 4UVIA 3SQWA 1XL0A 3MJFA 2GWRA 3AYXB 4KWEA 4WZBA 5F5NA 4E09A 3SXUA 2HYIC 1FNCA 2DFDA 3AEKA 4X92A 1II9A 5B57C 3OZCA 2DT5A 4DV2B 2FCRA 3IP6A 4BTEA 1UT6A 2Q3JA 4LVOA 1TJ3A 3HZRA 4HD8A 4MEJA 5A4KA 4JOSA 2VBIA 2UUCB 3WFJA 4UNNA 4WXMA 3LF1A 5FOTA 1FIUA 3UWMA 1AT1A 1BCRA 5LZ7A 4MDFA 1E2GA 2Q6KA 4Q3DA 3SVTA 4PSUA 4MR8B 3D1LA 3FM9A 4IKPA 3W78A 4NBUA 2QKYA 3AI7A 3ZH2A 4EB8A 1LDMA 1HFWA 1P17A 3O47A 4ED9A 2V7TA 5IJ0B 2XTAA 2Z6UA 3H1GA 3EIXA 5SYAA 3VNAA 1ZP6A 4B6PA 2PK3A 4EAQA 3D6HA 3K92A 4TTAA 1IOVA 3FOEC 2VTVA 4N8SA 4JI8B 3IEXA 3FSEA 3IR7A 1T1SA 4M9RA 1SOMA 2BL4A 4M8IA 2OYCA 3M34A 5CIQA 1MJFA 2JD0A 4EHLA 2RMKA 3BCHA 5K8JB 1K66A 4ARZA 1P60A 1YZGA 4MB6A 3F0TA 4LBZA 2XT6A 1XTVA 5I9BA 1NY6A 4CCAA 1M6VA 4A5OA 2F64A 1NXXA 1W1UA 2I33A 5F2OA 3FXAA 1B42A 2YC2C 3HKBB 3QE3A 1D1SA 1IDN1 3VVLA 3KZNA 1I94B 3AIKA 1C3EA 3KCNA 4X20B 1YA6A 3HFRA 3JVVA 5DPMA 1E6UA 2DQZA 4JEUA 3SSNA 2OZVA 4MXDA 5HP4A 4DDTA 3L02A 5IG2A 4CBVA 2GD1O 4IXWA 1S4MA 3QHAA 3EPJA 4HDRA 1CB0A 1Z5NA 2CB9A 1CY2A 1AVTA 2Y93A 1RYZA 1CTQA 3FYUA 3GJSA 3N75A 3C70A 4E31A 3KJZA 5IYZA 2HH9A 3R4CA 4P4GA 2PKXA 3H9BA 1Z07A 3MLEA 2O7NA 2AG5A 1XDBA 3BGWA 1EBUA 4AX8A 4HVLA 3TIVA 1XEWY 4E2ZA 4C2BA 3PJRA 2CSXA 3BL6A 1YL7A 1KI2A 2Q45A 1TM2A 4OHMA 3ZZ1A 4D92A 4FFRA 1EFTA 2JFFA 3NI2A 1MO5A 5A71A 1CUCA 2WJZB 4HLQB 5JNRA 1WM1A 5JU6A 2GLUA 4N5NA 2P9QA 4XARA 5EWLB 3QVGB 3PX7A 4L73A 4C2AA 2Q4RA 1UAGA 1EK1A 2P6UA 1K7FB 1T5SA 5HZGA 2G9QA 2QBYB 2ZBUA 5BNTA 3LM8A 4FI3C 4IIUA 1KJWA 3W9YA 3VYSB 2VF5X 2ANCA 3OWOA 4P7FA 1K3UB 4EHHA 1P1HA 3RG2A 1M67A 1PFWA 1AC5A 2VJQA 2D2VA 3BRQA 5T3UA 4ROSA 4CMAA 4LTNA 3LW8A 2B4KA 3KHTA 2PUFA 3BXFA 5GM1A 1QF9A 1YA8A 2O1SA 3FOWA 2C2MA 5KTMA 3SS9X 2OM6A 4OYHA 1YDWA 4CU5A 2QD5A 5ALLA 1YONA 2BM8A 5EHQA 1JZQA 5JI3E 1WXDA 3DW1X 2VK4A 2WD7A 3R5SA 1IB0A 1TAHA 3IO3A 4CIAA 3T3NA 3SZMA 6AT1A 1B41A 3EGCA 4PIVA 4QXRA 2ZRBA 5LYYA 1R3DA 1YU6A 1ZRSA 3IUNA 4KUHA 3ZU2A 1RTKA 3QEJA 1JXMA 3D43A 1HX7A 4V2IA 1DEXA 4KN6A 1Z2DA 2QAIA 3R9XA 1IZYA 1KU6A 3EGDB 4A2WA 3CR8A 3RSQA 3MAJA 1RJGA 3GAFA 1DGQA 4CI0B 3JQ9A 2IYQA 2CLEB 2I2DA 5CB4F 2WZCA 3HLTA 4MMZB 3QU9A 4BRSA 1KEVA 4AMUA 1C4OA 3ZV5A 5K6AC 2PGOA 3DUFA 1N6OA 2FY8A 4YJKA 2D74A 2OQIA 5K03A 1PV4A 2QG4A 2FE1A 3H4TA 1L5KA 1Y6ZA 2JIDA 2XA9A 2XUOA 3L4BC 1GN8A 1TUIA 4J2OA 3IKJA 1CZKA 5AKYA 2GNAA 3HZOA 4AQDA 1R74A 4M1TA 4R1PA 5IAGA 1W6UA 3DMTC 3SSMA 4QUGA 4RIEA 1ZJWA 2GXUA 1QU2A 1PUXA 2YHAA 3EXEB 4GOKA 1Y8QA 1YS9A 2YJTD 2GBIA 4Y7CA 1UP7A 4TKUA 5ITVA 1XDUA 2EJWA 5CNMA 4EUNA 1HSZA 4KSBA 4FMCF 1J9ZA 2W22A 4TVSA 1NBAA 1SHLA 3BVPA 1DBSA 4PPGA 1QIEA 3I1FA 3OEYA 1YJ8A 4B6FA 5K8VA 4B35A 1CEYA 3BHIA 3WKAA 5FI5A 1EFAA 4JJAA 2UUPA 4AUEA 3CRVA 4UEJA 1C9KA 5MHTA 4KLRA 1QC5A 5JRDS 1ZJ6A 3DEHA 1JDJA 3UHFA 1XRPA 3WIVA 4N49A 4R5MA 4MWCA 1L1QA 1NF2A 3QWIA 4CMGA 4EVQA 5J23A 3LPCA 1JQAA 2RGGA 4OQZA 3RE1A 1NMEA 1SJ9A 1T29A 1T3TA 2AHOA 2F4NA 2I2BA 2FR8A 4GF5A 1EVYA 2R5WA 3BB1A 2G71A 2EIXA 3U19A 5EWMA 3O8RA 4IPTA 4NOKA 3VV2A 1MJ5A 1C3VA 5THXA 2OA0A 1RHJA 4GAEA 5C7YA 1JQDA 5H3LA 1VLQA 3NX4A 1Z4OA 1ZUNA 3PX3A 1T4MA 1VHLA 3NHZA 1VSTA 2QYOA 3GFQA 1W5AA 3RIHA 3MTQA 3T9EA 2V6GA 3V42A 5JZVA 2CC2A 1X0XA 5F35A 1O94A 2ECKA 3CO0S 3RVRA 4JYBA 4GYWA 3ZXUB 1JFTA 2WFLA 4FQ7A 4E3ZA 2FPMA 3SY8A 1QZTA 1RXUA 1U5BA 2JAPA 1H9BA 2YDYA 1ZOLA 4Q3CA 1PVDA 2RONA 4XDHA 2B61A 2FPWA 3AUFA 4HAYA 2OGWA 5EKDA 4AWAA 1U7TA 3CSDA 2HV9A 3PYXA 4E4YA 1GNRA 3AFMA 4BX2A 4XR9A 2RSLA 3OVMA 1ZWKA 1I4WA 1Y4SA 3I01M 1KYQA 1GV1A 2JLZA 3K5IA 3P2MA 1A27A 3KYIB 3NAMA 3WMXA 5EXTA 1E6MA 1S8OA 5DWQA 2XADA 3DW3X 4LNUB 2PLRA 4AY4A 1VRVA 1X7YB 4ME6A 1J8VA 1XCMA 5F1OA 2VPXA 3R76A 5BQXA 5JPIA 1NUPA 1YDMA 1TA9A 1CIPA 3FSJX 1KZ6A 3H2YA 1P62B 2JF0A 2AV6A 3T3IA 1D6NA 3CLKA 3CS3A 1QQAA 3B53X 3NHAA 1RT9A 1E63A 3OY7A 1DO0A 4JUIA 4WOPA 1ZD3A 2WR8A 2G0AA 3AY7A 8ATCA 2NU6B 1OPRA 4P3XA 4YAIA 2P40A 3JD0A 1LRKA 1GT91 1LWOA 5HZMA 1KEPA 3BMNB 2RI0A 3QE0A 3S2FA 1GTL1 4BNWA 1B8NA 5D7NA 3VJMA 2RBGA 3H84A 1ZK4A 4LY3A 1YZYA 1TK9A 4F8EA 1RXSA 3S81A 1K6JA 1XVUA 2UYYA 4CCWA 2I5PO 1UBCA 3OCJA 2E7ZA 1Z62A 2XNDA 2VHJA 3SFZA 2WFMA 3LRPA 4DCUA 1AGRA 1P7PA 1SKYB 4NCJA 3NDRA 1L5ZA 2ODPA 2XUHA 1IL0A 3ORRA 1FW8A 4G9EA 4OL0A 4ARIA 2ZCJA 3DTVD 4EA9A 3IQDB 4WRRA 5H82A 4B3JA 5B7GA 5BVGA 2ACEA 1T4BA 1T8PA 3C8DA 1EJ2A 1V3VA 4PR0A 4R7ZA 5MDHA 3OE5A 2BZSA 4HDQB 1IXKA 2PVSA 2WLSA 2BT4A 1BMFA 3NU1A 5BVHA 1VHJA 5ILQA 3ADDA 3G0CA 4PLGA 2H1CA 3ELWA 4EDHA 4EG0A 1YIAA 1D1TA 1KYZA 2Y1DA 4PVCA 1ZOIA 2CHVA 3R6LA 1F3OA 2C5SA 3EIUA 2UYOA 3ITNA 4RQBA 5AJZA 1ESEA 3HDTA 2EKZA 4MR7B 3HUEA 2DFNA 3MS2A 5F98A 3ABSB 2B8JA 1DG1G 2N1BA 5KZMB 1ZLYA 1SXQA 2J9XB 3C8UA 1PJCA 2WVJA 3K0AB 1KJJA 3VR0A 1KGDA 3OU7A 2WKRA 1D03A 3W2TA 3ZQ6A 4OH7A 3KYDA 4XWGA 1CFZA 1H93A 4BFXA 4CDNA 4M21A 1UC5B 4K6KA 5FWYB 5TQ2A 2VF8A 1ZZEA 1UBMS 2GTIA 3ESCA 5ICEA 3G68A 1URPA 1FRQA 4RFSA 3ROQA 2WG0A 3R7NA 4HAUA 4D44A 4D6XA 2C7RA 4IO1A 1WHTA 4WZBB 5KTOA 4CGZA 4HPWA 1NN3A 3QQPA 2L2QA 4CG0A 4KIUA 1PJTA 4E15A 4IXTA 2B98A 2E3JA 3GJRA 4HQKA 2XMCA 4L4UA 4C3ZA 1DEAA 2NP7A 1PR3A 2D4AA 5EPEA 3ZZ0A 1AH2A 1G7CA 1VE5A 1OX6A 3HN6A 4DMLA 5AXBA 3I9JA 3BIFA 3DJFA 1TO1E 3BQMB 3DE5X 1FBNA 1GUFA 3EIOA 2WWTA 5JJIA 3ND7A 3Q6IA 4YB8A 1YVEI 2J5KA 5H70A 3U48A 1VJRA 1W8IA 1TM1E 2RJNA 4OGFA 3PFFA 5L6LB 4LBVA 3MS7A 5AW7A 1BE1A 2DWUA 1R0CA 1W36C 2PFGA 1JH8A 3UMFA 1U3UA 3LQQA 2VZ0A 5B6JA 2IX3A 2UU9B 1GG9A 5JYDA 1AGPA 2PUJA 1BHSA 3DMGA 1NVVQ 4RA9B 3SD7A 3PIDA 1FFSA 3FPGA 1E4OA 1L9KA 1P29A 3J7TA 4XD2A 4WMLA 2WZBA 5CVUA 3I83A 5UKDA 1DWPA 2OB1A 2ZUFA 2KBEA 1ODFA 5D3KA 3QFSA 4GEKA 4ARZB 3HLYA 1BXKA 3ZGLA 4MAAA 5JSKA 2B25A 3U26A 3ES9A 4XUGB 5EYPB 2PZLA 4HCJA 4WH0A 3OOYA 2PUWA 2IYFA 1GKYA 3QUBA 2I3GA 1CF2O 1GA1A 2W4IA 3N6XA 1B26A 4O02B 1KS9A 2O0JA 3K0KA 4XI9A 3L0SA 3I5AA 5EZQA 3TQTA 5CFZA 3Q3VA 1P9LA 4HJRA 2YYSA 3SC2A 2NYUA 3ILSA 3D6MA 1L7BA 1KO4A 2QU8A 2P2ZA 1EJBA 1M1NA 1XJ5A 3KZOA 1H6AA 2RK4A 3AF4A 3GVHA 3OCCA 4J2HA 5EKUA 1XZLA 5AHXA 3TKAA 2VYCA 1WMSA 1V0JA 2E82A 4QTUB 1PX0A 3LBFA 3MCTA 2FUKA 4TLCA 4H1WA 3O90A 1R4MB 3FVQA 2NT3A 1WY5A 2OILA 1N8KA 3N8HA 3DHNA 2PN1A 1BD3A 4X85A 2H1OA 3F6YA 1GTZA 1ZMOA 4FOLA 3AERA 2UYCA 4Q3AA 3H6GA 2FV8A 1FNDA 5C8YA 4E2YA 2BEWB 3RVBA 1NVTA 2AA3A 3IP3A 3NPMA 3NOXA 1YB5A 3TZLA 1UIMA 3L9WA 3W8EA 1XRMA 4EB0A 1CR0A 2EAUA 2VJAA 1Y9ZA 3UFXA 2ZRKA 2C9DA 1H42A 1UOOA 1ULZA 1A1SA 4W8HA 1I7DA 1RADA 4IKOA 1P0PA 4ZRDA 2E1RA 3ETDA 5JLJA 5K6RA 3VTAA 1NIJA 5D85A 5THQA 1R37A 1L3IA 221PA 3UWKA 1QE3A 2OKCA 4JYZA 4DKJA 1A1VA 3HJHA 3PEFA 1B0AA 1XK6A 3M1YA 1ZH8A 2KS6A 1XRJA 3BILA 1CRZA 1EK5A 3FUXA 1DUVG 3KAPA 3QKSB 4X24A 1QTNA 1NUAA 2IVFA 3GNQA 4K9SA 3V97A 3RUAA 1BJRE 3B7WA 5IFLA 4MI6A 2C83A 1VP9A 2HCTA 4NJEA 4G5RA 3Q2KA 1XZKA 3LC2O 2G80A 3R2JA 4WFIA 4D8UA 1G17A 4NYIR 1MAWA 3BJMA 5BSWA 2ZM6B 1MH1A 1X8JA 2NO7A 3BXOA 3E27A 1LDEA 1RDFA 4LJKA 4TT8A 4B6JA 3THXA 4MWOA 3LQKA 3ST7A 1TK2A 3CFYA 5EMKA 3RJMA 3RDPA 3A05A 3PDWA 5IC6A 4FXPA 1OD6A 2C2WA 3I5YA 1P0CA 2LV8A 4UM9D 3O0DA 1FUEA 3QPVA 1M34A 2DC1A 2VDMB 2PKEA 2YS6A 4AJLA 3GAAA 5B6IA 5JBNA 5JFGA 2XYRA 1E20A 1FTQA 3A0UA 3IERA 3M82A 2CT8A 3JY6A 2XTNA 3RVOA 4WZAB 2V6IA 3EDCA 5FCDA 5JALA 1U02A 1YJAA 1I0ZA 1VLVA 2H2HA 3JQAA 2AYYA 4QO8A 4TTTS 3PRYA 3TGWA 2VJLA 4IDPA 3ZY6A 5M2QA 4OUDB 3NDJA 3GV0A 1C8VB 3BREA 3PSAA 2WINI 4OB8A 1JAHA 3FB4A 4MKGA 5U4QA 3ZLVA 4WKOA 1L5OA 1ZX1A 1S3FA 4TKUB 3C7TA 3A3NA 3F5SA 3NKFA 3W6ZA 5CYPA 4KW7A 3WMGA 3I5UA 3ZCXA 1AUXA 3FCYA 4NZYA 3ZV6A 3NTUA 1V8ZA 4YQZA 2YASA 3WLQA 4EGAA 1UXGA 4XWOA 2VSYA 4IINA 2H1VA 4WKNA 3ZJUA 4UTPA 4RS4A 4UBKA 5CITA 4KCGA 3GXBA 4ES6A 2B4AA 4OOEA 3W04A 1CZRA 2YQZA 2JAUA 3EQ2A 3PC6A 1JWBB 3FKQA 2XKJE 3QOWA 4B44A 3DBLB 3F7MA 1EEXB 3H18A 4K9DA 4LTDA 2YIVX 4QTZA 5J63A 3UXEA 3W5HA 4EY4A 3O2QB 1KQOA 1H2WA 1R0LA 1TLTA 3NJ4A 4G85A 4FW8A 5EWMB 5JUWA 4TTRA 4DMGA 4EFNA 4M1YA 1ISSA 1OIVA 4IJUA 1JXOA 3EIQA 3T4UA 2OAEA 3CKKA 2H0AA 1Z5GA 1DTWA 1UKEA 1N2SA 1YZUA 1BQ4A 1H1TA 1NUTA 4XQ9A 5K45A 1RC8A 2MSDB 4QYIB 4GPAA 1U4SA 5AK0A 1A7UA 1D07A 1VM6A 1NZFA 1B6SA 4BWFB 1IHPA 2IYLD 3NT4A 2QLBA 4JP5A 1XG5A 2WWXA 1NJGA 3ZIUA 3PUXA 4TROA 3VPXA 3STHA 2X9GA 1WABA 4Y67A 3E7FA 4DB4A 8ABPA 1OXKB 1XDDA 2FFAA 1H23A 1F4LA 1JT2A 3OIFA 3UTDA 2O2SA 2QPOA 3M2TA 4AF7A 2FZVA 4TLAA 1L4NA 1DPFA 2VRCD 1FF9A 3OOEA 2SICE 4BO5A 1S8FA 2NVOA 1JEOA 2PJDA 4LZOA 2P9YA 1NONA 5BRNA 2R44A 3PFBA 4AIRA 4O2BF 1YUBA 4MVCA 2W70A 1F14A 1R5BA 1RP1A 3CX3A 4LYGA 3F71A 2Q0QA 1DKQA 2CLIB 1W0JD 5J4LA 1YCDA 3L1KA 1Z12A 4V3BA 2BI7A 3B1XA 2BGJA 3BGOS 4XIYA 3W9BA 1GU0A 1N8NA 2I67A 1DC3A 3DAPA 4NZNA 4QXAA 5HMLA 3VTZA 3TLYA 4UOEA 3SJAA 5EVJA 1CJSA 3KDSE 1NNEA 4FILA 5KNDA 1FS6A 2NYRA 1ZD4A 5L7TA 1TL7C 2O8DA 1XQXA 1PJRA 1UWKA 3F49S 4QXMA 4DMUB 2R7NA 5CIYA 3MUNA 1EI9A 2RBKA 2XXAA 2UXBB 1O5OA 1DCFA 4YUAA 4J9UE 4M8LA 3PUKA 1E3TA 2VWPA 3DGEC 4DNXA 5HCIA 1RZRA 4MUKA 4RBNA 1JJFA 1HFKA 2QP4A 1MHPA 2CUNA 4RCVA 4WDQA 1UBFA 2I7TA 5KJFA 1KJIA 3GT4A 3NRBA 3AOEC 3P4XA 3R6WA 1CF9A 4C4SA 5HKBA 4G0UA 3RFTA 1N57A 4MGEA 1Y7HA 3RTDA 4CIBA 3Q1LA 3SSAA 2GK3A 3OICA 2PKQP 1MB9A 1NVMB 4C4AA 3UAXA 4OFBA 4QDJA 2JIQA 1T8SA 1ZRHA 4R31A 3FDZA 3ZGXA 2Z2IA 2IIVA 5LJLA 1G4AE 1NDUA 3BF7A 4MQBA 4WGGA 4XLZA 5BUSA 3IVAA 2G8NA 3BDIA 2OFWA 2WT9A 4CQJA 4CIYA 1TYBE 1AHNA 5HS4A 5DJ5A 3JPWA 4TYMA 4XYGA 3ADKA 3QK7A 4J43A 3L0DA 4LC0A 2RHJA 3NNDA 1SIOA 4F6CA 1ODSA 2VXOA 5DIZA 3WTBA 1TVMA 2FEMA 2PX0A 4Q37A 4TMKA 1AQ6A 4ZN6A 4JLBA 4RIIA 4MPPA 4LVUA 3OQOA 1L2TA 4A73A 3G0DA 4BLRA 4US1R 5I7WA 3UB2A 2R751 2VQFB 3GELA 2P7IA 1J70A 3D6JA 1PFGA 3KJQA 5JLAA 3SXPA 3V1MA 3KQKA 1N3IA 4N5HX 3T5PA 1EVJA 4G26A 1DRKA 1LBSA 2G36A 5DYTA 1E1KA 1GFWA 5JS2A 4M86A 4RDCA 5IX8A 2ZROA 2NO6A 1YGPA 3PPWA 1KAEA 1Y8RA 4URYR 3WO0A 2CUTA 2CFCA 1V45E 1NFRA 3ZY3A 3SF8A 4NJMB 4V39A 3Q0IA 1JMKC 1P7YA 1T0UA 4IXMA 4HEHA 3KKNA 2NTEA 4M7RA 5TQ2B 2XMPA 3S7ZA 4JYCA 5IAJA 5L45A 1GGMA 1F48A 3LWNA 5EHZA 2I4TA 3JD1A 4IDFA 1CR1A 3GLGA 4OQNA 1RM5A 2XGMA 2LDBA 3GJXC 3R5JA 2QMUA 2MYPA 4IFIA 5GADl 4IGKA 4RTMA 4YI3A 5K3BA 1IJKA 4K26A 2NPFA 2YWDA 1BH2A 1Q14A 4V0OA 2M9MA 3GL9A 4H35A 1VI6A 4PSDA 3DAHA 3JR3A 1K5HA 3KJNA 3NHLA 3S2ZA 1NWCA 1FYFA 3L1IA 3QTTA 2NX2A 1ISGA 4MPRA 4BV3A 4HZGA 5J4VA 1QRUA 4LOHA 3IEVA 1T6ZA 3HNOA 4IIVA 3ZBUA 1Z2CA 3RS9A 4Z1OA 5AVYA 1Y1RA 3I9OA 5DBGA 5DTEA 2PUEA 1AKWA 2EKLA 4I4LA 2P78A 3DL4A 4EHJA 5KYUB 1N8TA 2ZBGA 3SWWA 2ZT8A 1HI9A 1TZ2A 3LUBA 3LYLA 4GMFA 1H3NA 3HDVA 2VDUE 3GZTB 4LDPA 4G6ZA 4LYDA 1QPGA 2EP5A 1PSZA 2ZCUA 1H0RA 2YXPX 4R9NA 5FF9A 2NSHA 4N65A 4A16A 3UG7A 3Q1KA 3V4FA 3EGOA 2O07A 2HBZA 5TS2A 1GGJA 3ZNNA 5EMHA 1HRKA 5JCPA 1MA3A 2AOTB 1T3LA 4KKXB 2I4RA 4CEIA 3MHPA 1XCBA 4BE7B 4FGUA 2C1ZA 4JLNA 4K87A 3WLNA 2VF4X 3DBRA 4Z4IA 1RC1A 1Y3HA 1AQUA 3NYWA 4JCCA 4OJMX 1T6NA 3VPFA 3VU1A 1EVZA 1ZNQO 4UE6A 4PTLA 1S2OA 3R24A 3KR0A 2DUWA 4ZU1X 4D9EA 4UTVA 3FPAA 3HKCA 2PX5A 3JZAA 4G4IA 2Z9CA 2R6AA 1SFRA 1M76A 3EUAA 4QBHA 1CY1A 2ASVA 4KXUA 4QICA 1YWGO 3I61A 2VNKA 3JW8A 2V1XA 1RCTE 3ORSA 5H68A 2B1GA 1SAYA 3PEVA 1H6CA 5BOSA 5CPFA 5K01A 2OZLA 2J3MA 1RKQA 3AERB 3N5KA 2YN4A 3JASA 4WERA 5DH9A 4AULA 2K7FA 5JSHA 4B5KA 1CEQA 5ERGB 1WKCA 2J9RA 3UK1A 3WYNA 4CT4B 7GPBA 1VA4A 2BHRA 4JT8A 4Y2RA 3I05A 4RLFA 3UMYA 2J6CA 3B3JA 1WD5A 1V96A 2QP9X 3TKYA 2ARKA 1U9YA 4OHXA 5KTPA 2NSYA 4IMJB 4MV0A 1XCLA 1C41A 1IB6A 2W90A 5K0GA 4HDKA 4NX2A 2ZYUX 4DA7A 1Y4DE 1AHIA 2A8YA 3LT2A 5E6UA 2DHQA 2FSVC 3EVEA 2IYOA 5KIAA 3N0WA 4DG8A 5C5EA 2ORWA 1YBMA 4OJTA 4RWEA 3U2QA 1UPTA 3QY9A 2TRSB 1M1YA 2B4QA 4W7SA 2Q5QA 1OUMA 1W0KA 1KZHA 1C1XB 3WLPA 1L7OA 3M6IA 4ZYWA 2C4KA 2POCA 3AF5A 5K3CA 3T5DA 2D2XA 1WO8A 4J6EA 4F71A 1GLGA 2WHQA 3A1UA 4Z4HA 4RPGA 3GAMA 4S1NA 3P9SA 1F12A 4JQCA 1PYGA 4RORA 3ZS8A 1XVTA 2GQ0A 1LPNA 1VA5A 3KXDA 2BDUA 5ALFA 3C4JA 4M88A 3WWDA 2C58A 1ZK0A 2VEDA 3SPXA 3U17A 3WGNA 4EPXA 1OKKD 4YJ3A 1E0KA 4HMQA 1A7JA 1WLYA 3WSTA 4D4JA 2ZU0C 4I50F 1D5CA 4M9XA 3MMNA 2JKYA 3QFCA 4U2GA 3U61B 2GFQA 4MA5A 4HYTA 5F73A 3OJWA 3ILVA 1ZHFA 4TLBA 3AHHA 4OBEA 2G5TA 2VDOB 3BD9A 2DH6A 2W71A 3D7RA 3EVZA 2WAMA 1E5QA 3VOBA 3GRZA 3QBDA 3EDQA 3SS8A 5H8WA 3THSA 1Y7LA 2XUKA 3EWAA 1OOEA 1QGOA 2FJ0A 4LXHA 2FE4A 1VDMA 3G6WA 3L7LA 2CLDX 3QPDA 4ESHA 2P6RA 4EL5A 2AZXA 5LLSA 4ZJUA 4N82A 4XX0A 1JDVA 4IMIB 1EG7A 1OILA 1YUNA 2IXTA 3C41J 3D6NB 3LBHA 3Q41A 3KQHA 3LP5A 4KYVA 3WA6A 3X1WA 1FFXA 2WUWE 2ZG6A 1GL6A 4ARVA 4RSGA 1A5TA 1ECCA 5EIBD 2QRLA 2D1FA 1NIPA 4GNKA 5KAMA 1RZVA 1DBIA 3QPAA 4CETA 2OE2A 3R0JA 4F72A 1SY7A 2RCYA 2ZM5A 3NDBB 1ZI8A 3E1SA 3KPUA 2X2PA 4URUR 1C7FA 3PPVA 4XIGS 5HIMA 3SHQA 1USKA 1UZLA 1GPWB 1PGNA 1VE1A 5HRAA 5KVVA 5CD1A 4N12A 1DIGA 5H83A 1RWMA 3AR9A 3EARA 5CM2Z 4RVNA 3UJ3X 5EJ4A 1KMNA 4D9BA 1S2LA 1FY2A 2ZITA 3ETCA 4BKMA 3VO2A 4BO7A 1N6KA 4FTWA 4XCXA 4RK5A 3S2GA 1TZBA 1N5IA 1WU8A 1HEIA 1DTWB 1NLUA 1LV8A 2XQFA 2OHOA 2PIAA 3S70A 1D4AA 3L0ZA 5AQ1A 3INNA 2DECA 2GJ4A 1H5QA 1TZMA 2QTGA 2XZPA 4FR2A 5FA6A 3R7AA 821PA 3HU5A 1NG9A 1PEAA 3IGFA 4R2WA 3Q72A 3GPLA 3K8ZA 4NV0A 4UEWA 3U9TA 1M2VA 4EUFA 1GGEA 1J99A 1EFUA 3ENKA 4N0MA 5E4TA 1BHQ1 2WD9A 2ZT5A 4GPD1 2HBRA 2Y76A 3ENWA 4BNFA 2NUAB 4WL0A 3MYYA 5JWRA 1XXHE 2QMZA 3IUBA 1OFIA 2BDTA 2GN9A 3NT5A 4FP9A 4ZT2A 3VDXA 3EPKA 2HV8A 5IVDA 3ZNQA 3O38A 5DM0A 2VRCA 5FI0B 2XQIA 4MP8A 2B8NA 2A0YA 1KJQA 4LWPA 1RM3A 1XAJA 3DNPA 3UOAB 3JD4A 3TOXA 1E6KA 3AIMA 5GIPE 2GSWA 1LA2A 1W0JA 4BNIA 2DFLA 1H3FA 5K3DA 5LU9A 4KAJA 4BVHA 3EPLA 2FFBA 4DIUA 2FPXA 4ARUA 1RMQA 2EQAA 2NYAA 4K86A 4LCEA 1QO0D 3OUTA 2OGSA 4G5XA 4JR1A 5FI1B 2O8DB 1W19A 4YCCA 3QVOA 4FJ2A 1SHJA 4QNNA 3P9RA 4GS5A 5AKZA 2COUA 2VP2A 1QP7A 3I73A 1GL7A 1M5TA 4ZOLF 4D9FA 1IQRA 5CX4A 4LZJA 3LCCA 4WXEA 5CXXA 1S0UA 4II3A 2WG1A 1V43A 3FWHA 1HLDA 4H7DA 3AR3A 3AKEA 4PSKA 3MOSA 1GZ5A 2I8CA 1RACA 4Q5IA 3QW4B 2FMHA 2CVFA 3TIFA 2XCTB 1K4YA 3RC2A 4JR0A 1L7AA 1JXAA 3I3OA 4Q3OA 3FNHA 5CW2A 1U0SY 4LRYA 3MWGA 2YWEA 2M2IA 4D99A 3PIRA 3ZK8A 2GDZA 3Q0EA 3IEIA 1NJ2A 2WMDA 2I6SA 3DMYA 4OIFA 4ND6A 1X80A 4F4JA 4RIFA 3W79A 3JWJA 4CHGA 2ZS7A 4L7QA 4WIAA 3ZWXA 1J1IA 1WCXA 3CO5A 3ZD7A 2G17A 1ORDA 3B12A 3ILHA 5EPUA 3AONB 3ZWAA 2IUTA 4G5OA 3Q3GE 5BURA 4EJ2A 3OZDA 1IWBB 4PHHA 2GCOB 3TLBA 2OZEA 3KQWA 1JLMA 4WZZA 1QM5A 3SC4A 3TSZA 4ZA2A 3TGPA 2X7JA 2VHXA 3KQLA 3KE9A 1JYEA 4RABA 3NTOA 1AQNA 2Y05A 4DILA 4C1NA 1G42A 2C9CA 3FI0A 5COAA 2FG6C 2GF2A 4NE7A 4MHTA 3U4HA 1GR0A 4Y30A 2PBZA 5C5CA 1CUGA 2AR0A 2YS7A 3G2PA 3ONVA 3R09A 3HBAA 4IIBA 3IVCA 3QEOA 3A6KA 5TEWA 3KZ1E 1EAYA 1KP2A 1U80A 2PZGA 3BD7A 1XMIA 2HF9A 1JG7A 1Z0AA 3EY9A 4YHBA 3TDMA 4AKIA 1DWUA 1VYTA 3L0YA 1ZM9A 1V41E 3MWLA 4YMHA 3VR6H 2IW3A 2F43B 5ABPA 1GRRA 1I6MA 1EA5A 3V7NA 3AJEA 4R1TA 1KYVA 1QIJA 5SYNA 3ZDYB 4EYEA 1H4VB 2F8MA 2HDHA 4Y2YA 5HJ2A 2Q9UA 2OV3A 4J1SA 3MCUA 1IEXA 1JUDA 4UUQA 4HGOA 3CPEA 4NYJR 4Y6OA 4Y2JA 1RYMA 4XE5A 5ALSA 2SKEA 3WRYC 4IDGA 1XAHA 1P1BA 2QDXA 2R79A 1RYDA 5JAHA 5KDLA 5E3HA 1OY1A 2B9EA 4MJ3A 5CA0B 4OAPA 5AVSA 1N78A 3JQ6A 4BOYA 1I5RA 2X2EA 3EQ8A 4ZO7A 4QUEA 1TAQA 3F7NA 4M4SA 4MLCA 3IHTA 5BN1A 3QBJA 2ZE7A 2D00A 1GTJ1 1PZMA 1FX1A 3J81A 2D0IA 2BLNA 2FP3A 2Z83A 3CEJA 4JBNA 1YI1A 4FHCA 3Q5DA 4FK8A 1U90A 2R4TA 2VAMA 3D1VA 4ZI5A 2FSPA 4ZTBA 5DHSA 5FNVF 3S8YA 2JGNA 2O8EB 2PKWA 1QF7A 4KXNA 3VYRB 3WP1B 5BUCA 5HQ3A 5K3EA 4NK4A 3O8CA 1E58A 2FEKA 1X7WA 4RS3A 2C04A 3O7MA 5FBLB 3RJZA 3PBKA 1OTHA 3K09C 4FX5A 1M8JA 1TCUA 1QFMA 1Z0KA 1E69A 2D1TA 2PKCA 3O6VA 3ORHA 4Q7MB 4Y6LA 3K9BA 4TYYA 1QF6A 4DBVO 2G9RA 2OXIA 5L4LA 3OFSA 4MQUA 2PANA 3H2KA 3PJGA 4E4RA 1GKIA 5AIBA 3M6AA 5AKJA 2C8JA 4RCYA 3S5UA 2P7HA 4G4SP 3WNZA 3SKXA 1C3JA 5LD2C 2R6HA 2DWPA 4UQOA 4IUBS 1J21A 1QP4A 5IN4A 3DYBA 2AYXA 1NE7A 1DINA 2GRJA 4EJSC 4ZO8A 1K8RA 1GKLA 1ZQ1A 1RNLA 4E5MA 1W4RA 3DBRB 5ICGA 3B6EA 3AM3A 1UXJA 3WWOA 5LA6A 5CB8A 2H85A 2JHAA 1HRDA 2DF8A 1DV1A 5HE9A 5AKEA 1DL5A 1F38A 4IAOA 4C7VA 2EJVA 1NRJB 4H27A 1SIBE 4GYYA 1PK7A 1IWPB 2X8JA 3HKCB 3I0MA 4OXQA 1N4DA 3TSAA 3NHBA 3K4PA 4F96A 3TTTA 3WDSA 4DBZA 2CHEA 2JFGA 4NFLA 1GU7A 1TF7A 3V8PA 3W5BA 5A05A 2ZR0A 4U7DA 1FDTA 4YXWD 2BHTA 1GFSA 2OC4A 3W5SA 2I4MA 1HE2A 1WB5A 3VDQA 3JASB 2QTWB 3N86A 4JEHA 4OXKA 5FX2A 2Y6UA 2FPIA 1WKVA 3N58A 3HPQA 2P65A 5DBFA 4PO3X 4RJ2A 3N2KA 5K8IA 2HMVA 2IHNA 2A94A 3E3LA 3EXG1 4RSHA 4DG5A 3NHFA 1NJFA 1ESDA 1TAGA 1XPJA 2CYAA 1NVGA 3WSVA 3RBZA 4MWBA 4BNDA 1JE1A 5A02A 2I34A 2AMYA 4OKSA 3HC7A 1I5EA 5CNKA 1O54A 2JHGA 5CW1A 2ZJ6A 2GPSA 1IATA 3GRVA 3MCAA 5EEGA 3W6PA 3A2NA 4HDKB 3PNMA 2XVYA 1UIRA 3BGIA 3IQEA 4E5SA 5IWAB 1G63A 1J00A 3KYCA 3LSTA 3ZUPA 3GJQA 4X84A 4IRMA 2HIMA 4F9EA 2Q21A 2A0KA 4K8RB 4EAAA 1V26A 1WPGA 3IE1A 6NULA 1FUIA 1QGZA 4R8RA 2WHXA 5IUKC 4NEHB 3RYCB 3RBAA 3AVPA 4GPZA 2V6MA 2J8ZA 3ZVRA 1BRTA 1NBWB 2C03A 1WQ4A 4TKZA 1L8QA 3BA1A 4YP6A 3RS2A 1Y4ZA 5LZ2A 3CVWA 3L7YA 4B2LA 3ETHA 1IBLB 3UK2A 5IUNC 4I3GA 3KJEA 1I36A 3IR5A 1RCFA 5LN1A 1S89A 3PUHA 4O1IA 5H9VA 5TVKA 3ZHSA 1DQPA 1Y9AA 4JBIA 2BKUA 1ULUA 4LAFA 4P3NA 1U7UA 5JG7A 1AQJA 4G8DA 4G0NA 2AF3C 1X6VA 3K0CC 4N6NA 5P8WA 4BO3A 1GCUA 4X0EA 5FORA 3MXTA 5K4AA 3WFZA 5GOTA 4TMFA 2B82A 3VR5D 3MK31 2P4EA 1ORTA 4IX1A 4PFQA 3O4HA 4BLOA 4C0AC 8MHTA 2VQEB 1INLA 3IUSA 3I92A 3ITKA 3MJHA 4XWTA 2Y2UA 1V9LA 1ZH0A 1MGPA 1IMOA 4KMMA 1D2NA 1K9SA 3KUDA 3I9V1 2QD3A 3AEQA 1PRYA 5ALNA 4N48A 1ZU4A 5FO0A 3D6AA 1RJ9B 3EXFB 2IH2A 3OQPA 1KZ9A 4HXEB 1WBJB 1ZC3A 2R68A 1MW9X 3TTYA 5JNVA 1OMOA 3PDIA 1Y5NA 2X9VA 2CNOA 1JEAA 2ZYTX 3ILXA 1XCPA 5CH8A 2ZEJA 3OMXA 5FUYA 1SUWA 5BSTA 3ZWDA 4BO6A 1AKQA 4L6AA 1ECGA 1FFXB 1KAMA 2JK0A 2FMXA 2IPXA 2ZGVA 3ZVLA 2ZETA 4FN5A 4MW5A 1QVWA 1RAEA 1LPPA 5A9TA 4EA6A 3MJSA 3O75A 3C6YA 3IAXA 1SCDA 4TV9F 3BSFA 4AU1A 1ZD2P 4LQDA 1WCV1 2YR0A 1N9GB 4GSLA 2C9YA 3LVFO 2YY6A 3LT0A 4QUIA 5FOQA 5HRCA 1S1MA 3C7DB 2OGTA 3AM5A 4QWMA 3G2OA 3IALA 1SUCA 4XVHA 1Q91A 2HF2A 1CJTC 3CNBA 2GM4A 2NUPA 3OEHD 3D64A 2W6QA 4NCAA 3AB8A 2CF6A 3WLJA 2AE2A 2W6PA 3GOQA 5DCUA 3OZTA 4CRWB 3HXPA 4E5KA 2ST1A 5C7LO 5CA1A 2EDAA 3HHEA 3KKKA 4KPUA 4BMDA 1UZMA 1JHQA 1WXHA 4PVDA 2QX8A 1QZUA 5J3JA 1JN0A 1NMYA 3PNKA 1NZJA 2GAIA 2SKCA 1CD5A 1ZD5A 3I9NA 3N7TA 2H2DA 1M33A 5BQ5A 2FF7A 3DF7A 3R3UA 4DFDA 1IJFA 3WGYA 4D3XA 3VX4A 3U6KA 3C5WP 1BKDR 2C88A 2FFHA 1V48A 3B1FA 2BPOA 3MWEA 1O95C 4BGDA 4KXYA 3TW8B 1ULBA 2BBSA 3O8BA 3A6JA 1RE0A 2MMGA 1C9MA 2D06A 3K32A 4QG3A 1QQBA 5MF6A 4BUCA 1F9EA 5CFNA 1VTKA 4YAOA 4G3XA 1UF9A 1L8OA 1CUUA 5E7IA 1G0OA 1OC4A 4DA8A 3AJAA 1C9JA 2D62A 2ICAA 4ENWA 4FDVA 3LH5A 3FLMA 3B51X 4FCVA 2ZB7A 1E7MA 1SRQA 3VHQA 3BC1A 3IBFA 4X8MA 1J0EA 3PR2B 2AOUB 5D84A 3N2EA 3CNLA 2EFEB 4C20A 3ZDBA 1KYYA 1OH5A 2HPHA 2LZ0A 1QO0A 2VIIA 3PRKE 4A8JC 4DW8A 4MKHA 1FMJA 2J1LA 3GAZA 4R0NA 3ETEA 4TYWA 3AEXA 4TTQA 2IITA 4WDRA 4Q15A 5FFFA 5BQPA 3MQ4A 1NSYA 2IEGA 2VK1A 4FDAA 4OCZA 4PLPA 4G1BA 4TYQA 2QRJA 1R66A 2W48A 3MRVA 4XFJA 4L57A 4AWBA 1YE3A 5IWCA 2B94A 3KD2A 2PUAA 5CGZA 4DCPA 4E11A 3IMKA 4YROA 1J06A 4HQ6A 1MCZA 1QYXA 1QX3A 1J97A 1P7ZA 3CWCA 4PG4A 4PWZA 4QVIA 4M8NE 2J4CA 1UK8A 4EVRA 4PCLA 4YMIA 3IAUA 4O4JA 4R54A 5HUQA 1Z4IA 3DAYA 1X80B 1FU8A 3ICWA 4BKOA 3K4QA 1P81A 2R8RA 1HE3A 5ESDA 1M10A 1MC1A 2Q0HA 4FZ5A 8OHMA 4DR6B 1L6RA 1X94A 4EUEA 4KL8S 3V8VA 1Z6TA 3H13A 2BJVA 3E7DA 4FT4A 3PUZA 5GMOA 1KXZA 1YOBA 3LKVA 3ZX4A 2VSNA 2FSHA 1XNJA 4MUXA 1YF3A 4ZKDA 2AWOA 3W5CA 2BUCA 4F5ZA 4X91A 3EF1A 3VPAA 5B3JC 1PZXA 1ULHA 2ZBQA 4I9UA 4QBKA 1P1RA 4QDUA 1H4SA 3USES 3NEAA 3BWCA 3WJ1A 4ZAYA 2X0EA 3WK4A 3QZUA 1G18A 3LC1O 4OHCA 2QGZA 4TV8A 2RAVA 3OQMA 3O26A 2VNAA 5FBKA 4ZZ2A 5BV1A 5AVUA 2DB3A 3ZE0B 1Y9DA 3SR0A 2BKLA 1NGSA 2ZRGA 5CEFA 4HFRA 2BMAA 4TKMA 4QIHA 1YJQA 2XUJA 5BMOA 5KYWA 3FA2A 1OZGA 3S2IA 4AQ7A 1BDHA 1ZPDA 2HJ9A 5REQB 4MCJA 4RE6A 4KBGA 3SHTA 3HGMA 4S0XA 4H6WA 1ZVJA 3A36A 4D5GA 1RMTA 2JFQA 2MCFA 3DCIA 3KB6A 1E1CA 3AVVA 1A04A 1X0VA 3MFQA 4I19A 3FDIA 1PR6A 2XE8A 2FYTA 2XWQA 3N0RA 5IXJA 1T2UA 4PG6A 3U7QB 1W36D 3E61A 4K05A 1Z2NX 3WQQA 3QFTA 1A2KC 3H42B 4L0DA 1O6GA 5GJBA 1M9NA 1BMQA 2WYHA 3WRWA 1E2IA 2Y1EA 4WK4B 1CE8A 5B12A 1U6KA 1D2MA 1NMSA 1V8OA 3FIJA 3T9CA 4WEQA 3U1TA 4BO9A 4ZFNA 1CV2A 1K27A 2EFGA 5HIAA 5EUMA 1SOWA 1OWPA 2I4OA 1I13A 2PX2A 4WLEA 3TEFA 1Z29A 1U81A 2YJ5A 3VR6D 1YR7A 4V03A 5LB4A 1PJBA 1T4DA 2IYZA 3FMFA 2PXXA 3C74A 3RSHA 2BFCA 3RRYA 4ZVMA 4EFMA 1XP8A 4YGYA 4ZXPA 5CURA 4NECA 4QKQA 5CYFA 1GGNA 1LBHA 1WF6A 3CV3A 3KT3A 1K7EB 1B6TA 1G8HA 5D1NA 4MZXA 2GO1A 4C5BA 3NBZC 2I65A 1K06A 2WPNA 3R3XA 4OM8A 2Q5HA 2QI9C 1GQRA 2M98A 3E2MA 4AZ3B 4LYYA 2PWPA 1I7QB 1Z3IX 2O3UA 4B2IA 3R7LA 2HT6A 2HA2A 2GEUA 2Z56A 4GLOA 3WGUA 2CMHA 2PTHA 4JVNA 2XNHA 1RJWA 1OXTA 2RGNC 5KTYA 3ACCA 1YULA 1I80A 1EUDA 2HIAA 3U9SA 3X2FA 5LZ4A 3P2JA 4J49A 2MJLA 1AU9A 4A2QA 1Y8CA 3RUHA 4DDKA 4ZU3A 1Q57A 3A9SA 4EF4A 4NMMA 1QHHA 4BBZA 1HE8B 3A06A 5G3ZA 2HK8A 5L7WA 2X8JB 3F5DA 1ZM2A 3MJTA 1N5JA 4H3SA 2Q1YA 2DX7A 4NYMR 3U3DA 4CF7A 1ODLA 2AGVA 3O2JA 3IVGA 3O3MB 3STVA 3UK0A 5JS8A 2Q9AA 1ABEA 3B5EA 3RS5A 5K0JA 1ZOPA 2QLTA 4QHTA 4ZO6A 4HUQA 4KQWA 4U1RA 4M0KA 3L6DA 2PY6A 5CEJA 1TK3A 4ZARA 1J22A 3HCOA 3ZXSA 4YXWA 2G4LA 2PUBA 5DB4A 4R05A 1UK7A 2SNIE 4AZSA 1OLUA 1QSGA 1XZFA 2PUGA 3N2KB 2X7XA 3WY9A 2ONJA 4YRJA 3U81A 1K08A 3IIEA 1ZHOA 1QRAA 3HWX1 3HVKA 4H6PA 3TCXB 1ZC4A 3RIMA 3MUOA 1A97A 3T7TA 5JH7A 2Y0DA 2YV1A 3UO8B 1P1JA 1KI1A 4TWRA 1APBA 1H66A 1ZGGA 4OGWA 1TJNA 2AXNA 3UZUA 5HBRA 2AF4C 2KI5A 4UQLA 5I7EA 1PL6A 2C5GA 3TQCA 5KWIA 3KYCB 3KOXA 4ZVOA 3ZKAA 1WX1A 4FMBB 7REQB 4GQAA 5EKSA 5MGNA 1EAMA 2VZEA 3R0IA 4PFKA 1U3WA 1Y6FA 2TMGA 1YL6A 4W5TA 3HUUA 4JUAA 2ZRAA 2Z58A 1YMUA 1H2YA 3M5CA 1DE0A 2CWDA 2WKWA 2ZSUA 5CNJA 1JRLA 1CYDA 1NLYA 4QASA 3QOFA 2Q4EA 3FPHA 2OPBA 4B43A 4NOLA 3C0KA 2JFZA 2XOKD 3ACDA 4JI3B 2G83A 3T3MB 3W8NA 3WKCA 2HHJA 4CL0A 4I66A 1YR3A 2ERCA 3E48A 3TQSA 5K6AA 2IHBA 2QX4A 5LWQA 4RH0A 4MW1A 5KDDA 4AY2A 2Q6OA 4OQEA 4R0VA 4LF5B 3LA8A 1N1DA 2P69A 1LZKA 3D5TA 3DZHA 3JAWB 3T9AA 4EZEA 3U3XA 3IURA 3L4BA 1USIA 1GPMA 1UPXA 4WBXC 4LV8B 5FPHA 5CXQA 2XE6A 4JGIA 1XRSB 3JQ7A 4B6GA 4CM5A 5D3MA 4UU1A 3FYTA 3T52A 1O6CA 3DMTA 1XE3A 1JEYB 3GBSA 3VR5A 1NF3A 1I2CA 1EVQA 3FROA 4F2GA 3LWDA 3L7BA 4B3RB 3E8MA 1GGKA 1OGIA 1YNOA 5JTUA 1SB8A 3P9NA 5TX7A 5FFMA 1ADFA 1E7WA 4H60A 1RM0A 5FWDA 1N7JA 1AO3A 1P6QA 2NO0A 4N8EA 2ZJ8A 2G8LA 1P31A 4QOJA 2YMMA 1CYEA 3QFHA 3OCWA 4RD1A 4CCYB 4ETIA 3CX6A 4QPNA 2ZDQA 4PO1A 2HUPA 1GG8A 1EDBA 3PDIB 4UC0A 5JCOC 2WSIA 2C7BA 2SHKA 4LF4B 5ERXA 1DDGA 3ENNA 2HD4A 2H1FA 4Q4DA 4XOIA 9LDBA 1MH9A 1L3CA 3CF2A 3GLIB 1NSFA 4QLOA 1UXOA 4MQFA 2GDJA 3ASUA 3GF4A 2EKBA 2OO7A 5IPFA 4INJA 1TD1A