3T7IA

Crystal structure of se-met rtt107p (residues 820-1070)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
249
structure length
236
Chain Sequence
TKAEKILARFNELPNYDLKAVCTGCFHDGFNEVDIEILNQLGIKIFDNIKETDKLNCIFAPKILRTEKFLKSLSFEPLKFALKPEFIIDMLKQIHSSQININLFDYEINGINESIISKTKLPTKVFERANIRCINLVNDIPGGVDTIGSVLKAHGIEKINVLRSKKCTFEDIIPNDIFKYVLIVTKASQVKKFTKMINDRDKNETILIVEWNWCVESIFHLNVDFTSKKNVLYQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Regulator of Ty1 transposition protein 107
publication title Structure of C-terminal Tandem BRCT Repeats of Rtt107 Protein Reveals Critical Role in Interaction with Phosphorylated Histone H2A during DNA Damage Repair
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 73
structure length 236
sequence length 249
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16770 RTT107_BRCT_5 Regulator of Ty1 transposition protein 107 BRCT domain
A PF16771 RTT107_BRCT_6 Regulator of Ty1 transposition protein 107 BRCT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3t7iA02
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3t7iA01
4Y18A 2EP8A 4U4AA 2COEA 1T15A 4BU1A 2VXBA 3L40A 2XNHA 4IFIA 2R1ZA 2COUA 2EBUA 2L42A 2D8MA 2COKA 3PXEA 3JVEA 1T2VA 5ECGC 2WT8A 3PC8C 1Z56C 2ADOA 3COJA 1JNXX 3PC7A 4XQ0A 3PC8A 3I0MA 4OFBA 1GZHB 4BMDA 3II6X 3K05A 4BMCA 2LE0A 2EBWA 2INGX 1T2UA 3UENA 4N40A 3AL2A 3I0NA 2K7FA 3EF1A 3PXBA 3SQDA 3EF0A 1WF6A 1IMOA 3K16A 3OLCX 4ID3A 3UEOA 2HTFA 3QVGB 4XPZA 3U3ZA 2NTEA 1OQAA 3SZMA 3T7KA 2AZMA 1CDZA 3PXCX 1N5OX 3L46A 1L7BA 3K15A 3T7IA 3T1NA 4IGKA 2ETXA 3L41A 3PXAA 3KTFA 3PC6A 1T29A 3PXDA 1IN1A 2K6GA 1KZYC 3T7JA 2DUNA 2M2IA 3PD7A 2VXCA 3K0HA 3PA6A 4JLUA 2E2WA 3SHTA 1L0BA 3HUFA 4Y2GA 2XNKA 3SHVA 3FA2A 3QVGA 3K0KA 3AL3A 3HUEA 4BU0A 1Y98A 2JW5A
chains in the Genus database with same CATH superfamily
1CB0A 3IP7A 4Y2RA 1GPNA 4PSDA 3STTA 4Y1RA 5CPBA 1YBFA 2EP8A 3ZKAA 2VTVA 1Y7LA 2Q8NA 4Q3NA 1KYTA 3HN7A 1NR7A 3IGFA 3QGMA 3UJ9A 1VC2A 4O4JF 3DE3X 2Z3WA 2JCBA 3RHTA 1DIBA 4ZGGA 1DX6A 1ND5A 5JXWA 2VJBA 5F7XA 1Q3TA 3QA3E 2O20A 4J0JA 1AQNA 5KVCA 2VXOA 1QYWA 4N0MA 5KSPA 5A3SA 2G0TA 1Y7PA 2VAWA 1KARA 4E7PA 3ECAA 3IBTA 1YUNA 4GRDA 2FMIA 3EF3A 2V54A 3MCWA 4IRMA 5LOVF 3GJ5A 1A96A 3FGOA 4EK9A 1U1CA 4CMHA 1KVQA 2IYNA 3IOMA 1N78A 4C30A 3IP8A 1R1DA 4DCVA 3PYXA 4HBGA 4R8SA 3ROMA 1DGQA 2QROA 3UWDA 4A0HA 4RVDA 4QSMA 4RTOA 4DM3A 1WZUA 3FTQA 4WA7A 1KOJA 2L69A 2PKCA 3VR6D 5CM8B 4DJDC 1UZAA 3HKCB 2W00A 4EG3A 4K26A 4MO9A 1S1MA 1O4VA 3ACDA 3UVEA 2X3FA 1KKLA 2OXEA 3HDVA 1AMUA 3KU1A 3K32A 2EERA 4XLLA 5DH9A 3W3ZB 2GXQA 4LF8B 2LTAA 2MINB 4IHQA 4MIOA 1TYEB 2QVBA 1N2BA 4IBOA 4KQEA 3V2IA 3A58B 3LXMA 5EZYB 3CR3C 3F47A 4XLTA 3KV3O 1QMPA 5ITVA 4FHGA 4I5GA 4YMHA 2J9RA 4KDFA 4Q03A 4OX9B 5KTTA 2QUJA 1VKRA 3BEOA 4RE5A 4BO0A 4M8KA 1MX5A 4L8FA 4HDSA 1UH5A 1W93A 4Q82A 1BXKA 1TPYA 1Y8ZA 1O94A 2WYVA 3WBJA 3ZWVA 2AV6A 4OFZA 5HRCA 1VG0B 5M29A 5JG7A 3SOPA 1GRCA 5HVNA 3UOGA 1RFGE 2X9VA 4IP0A 1D0IA 3T7CA 5HGXA 2QY9A 3MZ0A 3N59A 3QW4B 2O2EA 3LXRA 3SR3A 1KXJA 4J0GA 2FETA 4WJLA 2G88A 3I5MA 4PFJA 3KS9A 1J2JA 5J23A 3E1SA 3RUCA 2WC1A 2P6PA 3TLGA 2GF0A 2HWWA 2KWIA 1BGXT 2WBLC 2E4YA 3G02A 3IB6A 1RWKA 1ZD1A 4IX1A 4QG7A 4YJ3A 5GOTA 2OXIA 3WG9A 3H97A 5C7IO 5IM4F 2FX2A 3BIJA 5K3FA 2VUTA 1WXFA 4C7MA 5C5DA 1OF1A 5JO0A 2AOTB 2MSNA 4HX9A 5F33A 1BNCA 5A0FA 1N1EA 1NASA 2K6GA 1POWA 4ZV4A 4PG4A 3A14A 1H5NA 4UNIA 1L5VA 2PT7A 4RSGA 2HUPA 4WN9B 4LFAB 3TVYA 1GOTA 1IHPA 3N8HA 1H3NA 4ETNA 1WCIB 3GJ4A 3Q1KA 3LC2O 5TY0A 5KDOA 5EIAA 1K5DA 4I50A 2ECOA 3HMQA 4DUPA 2H2FA 4P1ZA 5A2GA 2P62A 1RQ2A 2CJPA 2RHOA 4MVJP 1KP3A 2XNDD 4UHDA 3WLMA 1NJ1A 3KKQA 2VJLA 2VRCA 2ZJ3A 2W83A 3NAGA 4XYBA 5I4KA 2ZIWB 4JMPA 4KGVA 1ZH8A 1JHRA 1FYEA 4ZAFA 4RD2A 3AHIA 3OQMA 5L3QA 2FPMA 2X5NA 1LDNA 3LH5A 3M1AA 2PQ0A 1Q95A 1YJXA 2JHFA 3F9CA 1YB1A 4V0ME 1EVJA 4FFLA 5I7WA 4U6QA 3TTWA 3ZW9A 3N87A 4IKOA 4UM9D 3ETNA 4Q18A 3V42A 4Z7JA 1ETUA 4EZIA 1ZNYA 1UBRS 2C04A 2CNWA 2IEIA 1UF9A 1AK2A 3VZDA 1N6IA 2IV2X 1QJCA 2EF1A 4RD3A 3WTCA 4DIUA 4EO4A 1NLYA 1FX0B 2VTDA 5GONA 2CUZA 1SBHA 1QBKC 3LC1O 1FTWA 1VTKA 5LN1A 4F2HA 4GAEA 2CV1A 5EQJB 3HZZA 3GGSA 3W2HA 3VR4H 1LBIA 4BNDA 1QO0D 1YDMA 2MCFA 3ZK9A 1R3DA 3KJEA 2FPGA 3OE5A 1NBEA 1NFQA 1NJ5A 1QC5A 2VZ0A 4X85A 3KHUA 4OOFA 3TX6A 3PX2A 1G2QA 3PC7A 4L2IB 5L51A 5ECWA 3EMVA 3NMUF 2W2TA 4A1FA 5AM1A 3WLKX 4FEAA 2V03A 2A5JA 2CLEB 4G26A 3IC5A 5FNVB 4CHGA 4L4ZA 4A2WA 1TMKA 2JFUA 3K1AA 2B99A 1LI5A 3BRQA 2EWMA 4XJXA 3VMFA 1IUOA 1MIOB 3I01A 5AVXA 4GPAA 4BNYA 4KQWA 3B5JA 2HJGA 3GZ4A 5ER9A 1J20A 1DDGA 1D9XA 3EEQA 2WQ6A 1SM4A 4IMJB 4MUXA 3H9BA 4CF5A 2HKIA 3W9UA 4TTVA 5JXGA 4KJZA 4N8DA 3B13B 4ABYA 2EYQA 5BXYA 1TK2A 2I6FA 1Z2CA 5B2ZA 1LBHA 1K66A 4BO5A 4X8MA 3PYLA 2XI4A 3G2HA 1UPAA 4Q3KA 4ZODA 1E3SA 2YIDA 2D0OB 1Q0ZA 3UJCA 1CF4A 3HKBB 4JZYA 1ZWKA 3L7KA 1X7ZA 1NUPA 3S3TA 4RPLA 4OL0A 3OKAA 3WSTA 4IIDA 3ZHTA 3F8WA 4ZQCB 1LWNA 5LD2C 4LNUB 1PIWA 2DYKA 1ZW1A 2AG8A 2GDZA 4G89A 1ISFA 2JHCA 4H6VA 2AUTA 4J2OA 2X2PA 4UTXA 4WOJA 5AICA 3BT7A 3BH7A 4DDVA 2H8GA 2AJTA 4ZAXA 3NYRA 4L6CA 4QQNA 4RJIA 3KKKA 4QO8A 4GOJA 3T52A 1XQ1A 1Z06A 4K8OA 3TCKA 1K92A 1AXGA 4HEQA 1LJ8A 2RI0A 4MTCA 4V39A 3WLOA 2VNAA 1JFRA 1N6NA 2NU6B 4R6WA 2YNMA 3IHLA 3BF8A 1NXWA 3KTOA 3CJRA 1MJGM 1CR2A 3JATB 3RHSA 1E1CB 4UPEA 1K9SA 3OCYA 4V0RA 2CJWB 1IAVA 3H9EO 3USCS 1XCGB 1O2DA 3AVYA 3JQPA 5KREA 2IUSA 3ZOKA 3OX3A 3I04A 2RHMA 4OM8A 4U0KA 4YCMA 3PP8A 1P2VA 1PLLA 1EINA 1VOTA 2AKAB 2BUBA 4R5MA 5IYZB 2AXEA 2WP0A 2XQFA 3OCWA 3W04A 1JPUA 3BILA 4E1AA 5IKOA 4LTDA 5IARA 1M75A 2G1JA 4JNKA 1ITZA 3B9QA 5EXXA 5TDHA 2W37A 1JKJA 1ZD5A 3N76A 3WL6A 4DXDA 1JDSA 1FU7A 3AHJA 2VSOA 4QYTA 5KOYA 1TEVA 1NUUA 5CTAA 3TCXB 5AR1A 1A4UA 1ZW6A 1F8XA 1RKBA 3V5NA 2DMRA 2WHPA 3REFA 4EVRA 3UXYA 3RI3A 1RLMA 4YRCA 3QY0A 2G1UA 1LLFA 2XPCA 4XFKA 4DLWA 3VKWA 3Q7TA 3RYHB 1XELA 3L7BA 3JRNA 1TJ4A 1XDDA 4N1AA 4RQAA 1T25A 2R1ZA 4OXQA 3TLZA 2O3QA 2CEKA 4MMZB 2KLHA 2NZ2A 2YXDA 2EKQA 1S6YA 2G80A 4RV5A 5CIWA 4YP7A 4HAUA 3WGLA 4LGMA 1NQUA 1UWKA 1VYTA 1CZLA 1LVGA 1NVDA 1FRNA 1QFYA 1I3LA 1WS6A 1QIMA 1XQYA 3ITKA 5E2IA 1YJ8A 5H1YA 2WT8A 4YRKA 1H9CA 2XCRB 4ETWA 3OZAA 3IPCA 3MOIA 5GVRA 4ESEA 3NWEA 3GPLA 3L4KA 1K9VF 3COWA 3OFJA 1OV6A 2YOFA 1NRXA 5BWCA 4KR7A 2BGLA 3DONA 4MLPA 1E2EA 3RAJA 4L3VA 4XEUA 5EHZA 3H2SA 2IXFA 1CRLA 1XTKA 6REQA 3RNLA 3VNVA 2YXEA 3OJWA 2HIGA 5B1DA 3R6TA 1ILEA 1PDOA 3G7UA 1BKSB 3WGVA 1XQ6A 4TM7A 2GEJA 1DJOA 1NBAA 1UP6A 4G0PA 2UU9B 3FKSA 3GARA 2YJ3A 3MUFA 3LSYA 4ZALA 1BMQA 3R0XA 3SZGA 5J3JA 3D4LA 1EE2A 1I1NA 4DL9A 3V8VA 5A5DA 2ZRHA 2JIZA 2FDXA 5EN4A 2RHJA 2X0JA 4Q3AA 1BFUA 2GX6A 4I2NA 4DC0A 2P90A 1YULA 3O9ZA 4M98A 3OFNA 2ERCA 3NJRA 2CXXA 4R1MA 3U7EB 1PT8A 3RDPA 3TW4A 5CITA 1MBZA 2M6SA 1YUBA 3H4MA 1VRWA 3MXOA 5EC8A 4MV5A 1CWUA 2P6UA 4IO0A 3EJ6A 1NF9A 1QS0A 4GQAA 3BWMA 5IKXA 1C1HA 5DLQC 3DFIA 3CRRA 3ILXA 5AVZA 1H2ZA 1BVUA 4UCFA 1VE1A 3C5CA 5HFJA 3TINA 4DA0A 5A1TA 4MEBA 4D41A 2C88A 5FLEX 1EIZA 2VNJA 1F06A 1G5HA 4DIOA 1JKIA 1VPEA 1E2LA 3DYVA 1O6GA 2X0IA 1F9AA 2APJA 5CA1B 5HIAA 3IAS6 3ZVLA 3OURA 3EEOA 3AEUA 3T6KA 3HA2A 1O6ZA 4L73A 1ZD8A 4IXWA 5IVHA 3LK7A 1V37A 3I9JA 4HP8A 1Z8DA 2RH4A 3DAPA 3GY0A 1CR4A 3BZUA 3H3FA 5D5HA 3L0BA 3U39A 1H6DA 1MB4A 4Y7DA 3NJ4A 1VZ3A 4YJ2A 1BO6A 5L3RA 4JP2A 4BPRA 1P0MA 3ZDBA 1HOTA 4ZT6A 2QWXA 4G5QA 2OV4A 1IOLA 1Q1BA 1FPQA 4K6CA 1EMDA 1GL6A 2JGDB 3STVA 5JUWA 3UB3A 2VJNA 4E03A 2O0MA 1YZFA 2VA9A 1RYEA 1DQYA 3PF9A 1QCCA 4HQ0A 4M86A 4A5OA 3FOZA 5TVGA 5FB3A 3SD7A 3ILYA 3FTPA 4JZKA 1SVWA 3FMOB 4R54A 4RVOA 4DLNA 2J5BA 4N7BA 5CVUA 4G85A 3R7NA 5A4KA 1USKA 4MH0R 3WNBA 2BVNA 3RJ5A 3LZDA 1H1DA 2FSGA 1PGOA 1ZWLA 2B8WA 5KAPA 1Q6ZA 3P96A 4QX6A 4A6DA 2H1OA 1VL1A 1CEEA 1RM3A 2JLAA 1RCFA 4Y6OA 2YY6A 1PTJA 1BXRB 3NTLA 2QTMA 3B1WA 3N5CA 2TMGA 3WSVA 5C1DA 3K9CA 4WBXC 4KPYA 3JV7A 4ZTBA 4CVNA 4F1JA 1RQRA 2KW5A 1IN7A 1NI4A 2RHRA 2D4HA 1PQYA 1CC1S 5FPTA 4C76A 3Q8LA 4L4UA 2CB9A 3OLYA 1ZNWA 1NOJA 3A11A 1HNWB 1Y5NA 2BI8A 3NX4A 1O8CA 3PUJA 4EUNA 5KNLA 3D2BA 2QRZA 2ZRDA 2CHQA 3NHWA 4OBEA 3AB8A 1NJ2A 1QHFA 1U3DA 4PBTA 1KH3A 1PG5A 3AY6A 2HWUA 4JYCA 3LL4A 4I5EA 5EPEA 3RC7A 3B3FA 1WBDA 1FYWA 1MEEA 3EUEA 3ORYA 1M8JA 4OAOA 5I7OA 5KB3A 4O4IF 4NE7A 1DKLA 2B20A 3WLJA 4PGAA 1U4NA 1VXRA 2HBQA 2QSZA 1OFTA 1ULZA 1Y6ZA 1HEIA 1DAKA 5FPYA 2BCGY 4RA6B 3WYDA 4MLCA 1QAMA 2WNIA 2JIBA 2NZYA 5ITSA 3K09A 3PNLA 4CKWB 5C35A 1H4VB 3N5KA 2AKEA 4MVJE 2O59A 2HNAA 3I09A 4GWLA 5CFRA 3WWYA 2MSEB 5E6RB 4XR4A 4UCQA 2BTOA 1BX0A 5C8XA 1RI3A 4JSTA 5DCLA 1KBQA 4WD3A 1RQPA 5HJ2A 1O9BA 3GAAA 5BURA 2NTEA 3HJFA 4MAMA 3N1UA 4EELA 1LXCA 3L01A 2PA3A 5L6MB 1OZFA 4FCCA 2HWXA 3UB2A 3AV3A 4LXXA 5J4YA 3C4VA 4XZ3A 2BKEA 3VRHA 1L4NA 2H17A 2WJHA 2Z0MA 3WWOA 5CDSA 3RE1A 4F2WA 4CMBA 2VDWB 4PLTA 3FTCA 1QANA 4FE7A 4R9UC 2A9QA 3HKCA 3CZQA 1IG3A 2AEEA 1JQ3A 3GRZA 2VSYA 1UPCA 3GLQA 2HLHA 2H7VA 3GGJA 3HI4A 3QEKA 3ZE9A 3PL1A 4UE3S 4A0FA 5LQUA 4I6GA 4CMGA 2JRCA 4K40A 4JU8A 2HR1A 2MINA 1SZDA 1Z0IA 3EEYA 2IY9A 2O06A 4N9QA 1RPZA 1CR1A 1FS6A 1ZUD1 4IXMA 4ZREA 1MW9X 5E95A 4FJ2A 1S1CA 5EZYA 4DQVA 1IOZA 1PLJA 3D7RA 5DM0A 3WMRA 1O87A 2ZBUA 1Z9BA 3I2JA 4D8TA 4EHJA 2HLDD 5J4LA 1XVLA 3WNVA 1ZMOA 2VJOA 3OKPA 5FLXA 3ZVKA 5D87A 2X22A 2WIBA 4J3JA 3SYMA 3SFZA 2A14A 2YX1A 3ETHA 4H16A 2B1RA 3OM9A 1KY2A 4AO8A 2QA5A 1K7CA 3CZ4A 1IVNA 1TGYA 4A15A 2V6IA 4TSFD 2XZTA 4M0CA 2FFBA 2I4TA 1SK9A 2RHBA 4KV9A 3ZI0A 3ZY3A 2XCTB 1B73A 4BO1A 4FLFA 3PC4A 3LM8A 3JQ6A 2YIJA 4TL8A 2Z3VA 1A4XA 1SQFA 1CF2O 2YZNA 1HYQA 4MUEA 3A6GA 1KEUA 5A71A 4EY5A 3QWBA 4Q6WA 2PUHA 4YJFB 3H9GA 3IILA 5CT8A 1E3DA 3UANA 4LBWA 1CULC 2AOTA 2H0RA 4ONEA 2O1XA 2PZFA 1F2VA 1MO4A 1X80A 4F72A 1E3WA 3U7IA 5BT8A 1G8FA 3OQ1A 4NH0A 3PS9A 3JSAA 4S1OA 4WN9A 4AU1A 4GVXA 4WGFA 1N5MA 5LUBA 1H2XA 2QVLA 4NNJA 3W79A 2HT1A 1AJEA 2Y66A 1F2UB 2NLOA 3GGGA 1WCIA 2IUEA 3PEUA 4Y2XA 3PNYA 3VVMA 5K8UA 3JQ7B 3F3KA 1FVXA 4K28A 1J2RA 5IBCA 1EVYA 1O03A 5K01A 3DT8A 1QPZA 1KDZA 4CETA 3F71A 3U17A 1OREA 3KYDB 1SBYA 3TE7A 1WY7A 4EHDA 3KVYA 4DOMA 4IJVA 5K3EA 1PQUA 2PGJA 2VEOA 1ZVVA 5EYPB 3R8XA 3VU9A 4I4IA 4PO3X 3ZC3A 2ZWOA 5LM3A 3L9XA 4QU5A 1AXEA 3DLAA 3AYZB 1GAWA 1H23A 4DRXB 3EQ8A 4A82A 3E7FA 3G6KA 1I24A 1Y8QB 2LKDA 1P9WA 2HMVA 5J63A 3UG7A 4XYMA 3RVNA 3O2SB 4DMHA 3BTOA 1XE3A 3T35A 4BMVA 4QDOA 4IIJB 4J0CA 1ISMA 3KELA 3MLEA 3DG9A 3DEAA 1M2FA 1PP4A 3F6CA 1MOSA 2P9BA 1BHJA 3PKIA 1FX0A 2HA7A 2AN1A 1J21A 3RFCA 1SCIA 1CY6A 2A9FA 3T0GA 4JN6B 2DPHA 1PK7A 3NWBA 2ZVQX 3K0EA 3TLYA 3K7EA 1SKUA 3PUZA 4NYJQ 1TAHA 1L6RA 2Y0DA 4ESVA 5HMMA 4REQB 4UBOA 3E9NA 5CDFA 1OAAA 1ZM9A 4NE2A 3ZY5A 2HMWA 3KE8A 4KIWA 2FFAA 4R81A 5LBIA 3WK9A 4L2IA 1S3IA 4KQXA 4F7WA 3LC0A 2JJ2D 2YL2A 3ZLVA 1MJHA 5JRJA 2PV7A 4HG2A 1ENZA 3LU1A 4KQ9A 3ICCA 4P4NA 4ZANA 1G1MA 3HBFA 5FNVA 2ILTA 3NGXA 3H2ZA 1MIOA 3VZRA 4G5GA 3CKYA 3I64A 3B1ZA 3AMVA 3MPUA 2ZUDA 3MBIA 4V2IA 2JKVA 4YAJA 2QD2A 3KTDA 5A3VA 1X39A 2P0EA 3B8HA 3MB8A 4RO0A 4RZ2A 4NX2A 4S3MA 2R66A 1N36B 5HS6A 1E2NA 1JVNA 1KIFA 4XOIA 1XD2A 2FRDC 3EWSA 2B3TA 3H8SA 2YN2A 2EFHB 2V45A 3BRCA 3O9MA 2EKLA 4I8XA 2CK3A 2BBOA 1YRLA 1O95D 4GL2A 3UJBA 4RJJA 5JFTA 2QP4A 4RL4A 1Z5VA 3HKBA 4P35A 1C3LA 2Q7OE 4F11A 2QM7A 1JEEA 3RJTA 2REBA 3ID6C 4I46A 4E6PA 1IQ0A 4LNUA 4EJSC 4UOQA 5JYBA 4II7A 4E32A 1HDZA 2V97A 1RTKA 4B2PA 5KHLB 4E5YA 2R8ZA 3L0PA 3AIKA 3WQQA 5DXAA 2I3GA 4EZBA 3B7PA 3WDMA 3NI2A 2F3PA 5DV9A 3R6WA 1PFKA 4MZXA 1YJQA 1QV7A 5AJHA 5B3JA 4BVBA 1X9GA 3URKA 4Y9SA 1KQGA 2NU6A 2R48A 3E9MA 3E23A 5HE9A 4UJ5A 3SEFA 1RAFA 1U0RA 1A72A 4D81A 2IXDA 5P8WA 4TZ6A 2DFKB 3KPYA 2IE0A 4K6OA 3NEJA 1GAEO 3VOTA 3WE7A 4Y6GB 2GQ0A 2H31A 3IELA 1E1CA 3KFXA 3REOA 3FWZA 3TBHA 5HWSA 2XB9A 4QXAA 1NGSA 5KYNA 4MI1A 1W1UA 3PXEA 1BOOA 2IU4A 1Q1QA 2H54A 1QOQB 2PY6A 2B0CA 4FFWA 3RFXA 1EXWA 3UOWA 1N6LA 5HKAA 1FFWA 2XLCA 3EZ6A 3TJMA 3ZCXA 3ZD6A 2ADOA 3LWBA 3H6HA 5IYZA 4IUYA 3D0KA 4X7RA 3TX2A 4LYHA 2JFVA 1QDLB 2C7QA 2XJ4A 3HNRA 2XOKA 3K4HA 3QNUA 1IFXA 3TE6A 3KLBA 4I6JA 1DMRA 4YDHB 1KZHA 5FUQA 3S1SA 1FNCA 1O58A 1JX6A 1P1FA 1VCNA 2ZI4A 4IGFA 4M87A 4LKOA 4G0XA 3ZU4A 4X90A 1MDBA 3P32A 3CUEF 3QE3A 5CLHA 3AWDA 4Q15A 5FTMA 3X1YA 4XVHA 2ORWA 3FPLA 1C1DA 4WHMA 3RS9A 5E7MA 4GVPA 4GEGA 2I4OA 4S2EA 2PAFA 3RYHA 2RCNA 2W2LD 3R5JA 1T8PA 3UW1A 5I01A 5JD3A 3N70A 3PKZA 4UFOA 3ZHRA 3FVQA 5BWMA 3FPFA 4QLBA 3BHIA 1U28A 1RLOA 4KU4A 2X0DA 3AQ4A 2YKGA 4J0IA 2MYNA 3PKJA 4FR2A 2XEDA 1MTZA 3FJOA 4OV6B 4BGDA 1GT91 1XZFA 3VKVA 5JCOC 1XCJA 1S2IA 1ZGGA 4AIIA 5D85A 4JI8B 1GILA 3HN2A 3P1JA 3OOYA 1V9LA 1ADGA 2HBYA 3GN2A 5FHQA 3WMXA 5B58C 5JSZB 1NI3A 4ABTA 3K70B 4MQ5A 2GPYA 4KQJA 3G1WA 1BZYA 1L1EA 2IX9A 4D9GA 4S0XA 1YU6A 4YRPA 2RH9B 4IQGA 3LVFO 3QITA 3TMYA 4DA7A 3KWFA 3IV7A 4OBXA 2C5HA 1GCUA 3KOUA 2CSUA 5K4HA 3E1GA 4LOIA 1OFVA 4LJSA 1WDWB 2AFRA 2O8CB 1NT4A 1IUNA 3FBWA 3OEWA 4HS9A 1NVMB 1PU2A 3L8EA 3ME5A 1V6AA 3UKJA 3CW2A 4LPSA 2CJYA 3H16A 4PHGA 3GLHE 3QM1A 4TQAA 5AT1A 5ES4B 4DQ0A 2ZT5A 3VAAA 3OQVA 2JB9A 1Y80A 2BEVB 2BD0A 2GBLC 2JCYA 1FOEB 3LYUA 4PLPA 1T9ZA 1N4DA 5DI3B 1KH2A 1RXUA 2E1RA 3DZHA 2B9EA 1VIVA 1JI3A 1DFGA 4WEOA 1BH6A 3HLKA 4UM9B 1JU9A 3GT4A 2D00A 2QTZA 3CNBA 4RZXA 4V0QA 4DMFA 1PDVA 2YIVX 1JKXA 4CV0A 2ANCA 4ZTZB 4MQEB 4FOTA 1NVTA 4M53A 3T1QA 1W5SA 2XADA 1ANKA 3RFFA 1W49A 1T5SA 1SWVA 1NKVA 4XD7A 2YYAA 4OIMA 2WKSA 2HRBA 2ZDQA 1N9ZA 3LQ1A 3QJGA 4FN4A 4PE5B 4XUGB 2NUBA 4DDHA 2I7DA 4F96A 1BKDR 1ZH4A 1E9BA 1EE9A 1PNQA 2H4HA 3TQQA 5CA1A 5IG2A 3REGA 1SIUA 4HL6A 5AM5A 1TJ5A 2B8JA 3DWGA 2ORIA 4UAVA 3BGOS 1M8KA 4A2CA 4YT2A 2OCXA 2GS9A 3VO9A 1LZLA 4PCLA 4Y0AA 2IXEA 2VYVA 4JLWA 4B87A 3I04M 5JZBA 1EM8B 1MNQA 2E0IA 2PZJA 1WU7A 5CVTA 3E7XA 4PAMA 3LLCA 5CW1A 5EMNA 2PMKA 1NC1A 3IUNA 2IRWA 1HDCA 2ZJYA 3ENKA 4DGQA 4DV7B 4DFDA 2JGDA 1JVSA 2XAAA 1QORA 1XHFA 4NQRA 4M36A 4L5IA 4LYJA 2IKQA 2DHEA 5JO9A 5IXYA 4JXXA 3WYGA 4X6UA 2ZIAA 3G0HA 3PD0A 3I32A 3L8CA 1P2FA 3PI6A 4GZ3A 5LL6P 2ZDHA 2PL3A 1U0TA 3JS5A 1L4MA 4R8MA 1QMGA 1ZUIA 3WNQA 4UNRA 1CJMA 2YHBA 3ZHCA 2JJQA 2QXTA 3EF1A 3H1EA 5I6DA 5ADVA 1BXRA 1P7WA 2ODWA 3BB3A 2H9AA 2I3AA 2ZIGA 1EG2A 4R1SA 2VRWA 2BEWB 1FUYB 3L06A 4AKEA 3N2EA 2FOLA 4QNRA 5LKRA 2PUEA 3RS5A 1GXSB 3O2NA 3AV0B 3DOIA 3N6VA 1RKQA 2WVGA 1OILA 4IVNA 4GU5A 3QOWA 2QDKA 5JATA 1DWPA 1JDNA 2F1KA 2UKDA 5K8CA 1GWNA 1KK0A 4EYGA 1X9IA 1G5IA 5FOXA 2P2YA 1N32B 2GNPA 3KWLA 4G4SO 4LQDA 3HDTA 3CX4A 3RAPR 3I1YA 4UZEA 2J0UB 3K15A 3EGXB 4LBVA 4EGJA 1GUAA 2J09A 3BFPA 4HHEA 3PSHA 3O95A 1P9OA 4DLTA 2C5SA 2HU8A 3BGIA 4HX2A 4BCCA 1U99A 3RVDA 2FG5A 3QPAA 4U8GA 3V7FA 1UC4B 3IAEA 4WA8A 2NXCA 1JLHA 4RA6A 2EGUA 3LX5A 1J2UA 4UHFA 4FEYA 5TPZD 4PTZA 1LQTA 2HOQA 3EB9A 2EJTA 4JIMA 4K3UA 3PBKA 4Q1AA 4CKWA 2RCYA 1SZJG 1QTIA 1R9JA 4DV5B 2DQKA 5ES3A 2QQ5A 1NX6A 2PZAA 2PFGA 2ZSKA 3CZCA 3FR8A 2WWVD 3KSZO 5E6RA 3I6IA 2NUTB 3S2YA 1D6SA 1C80A 2G1KA 3SYTA 4AX4A 1P73A 4Z7NB 5AW5A 5C46F 3AL0C 1MEOA 2BUAA 3K1JA 1B8OA 3LX6A 2FPXA 1NKSA 2FZVA 1OGJA 2IGTA 1DC7A 1MVOA 1Z16A 2IVZA 5DB4A 3NR2A 3P2MA 1VE6A 2XCUA 1M5UA 3OF2A 4AUNA 2WWTA 1W5EA 3ZD7A 4ZVLA 2L82A 4KYIB 5JALA 2DEUA 1OU0A 4OAQA 6PFKA 1KI1A 1PEAA 4G0MA 2VDWA 3CB4A 4XM0A 1PZXA 1FRQA 2YY7A 3NZEA 4IH9A 4PQEA 2H1IA 4YRIA 1QGAA 2V7WA 2ZJ8A 4HTAA 2EC5A 4Y0NA 2HYIC 2J6HA 3LTEA 3A1TA 2VWQA 2HV8A 1TVCA 3BXZA 3MUOA 4LSGA 4Q37A 1P75A 3S2ZA 4QBGB 2I8AA 4PC6A 3IS3A 5EIHA 1WMDA 3BGWA 4ZTUB 3Q5GA 1BOFA 1PZFA 1ZMXA 3T9DA 2Y05A 4X24A 4CT4B 1PFYA 1W30A 3F4KA 3OETA 4LMAA 5C32A 4CIBA 3EEIA 5TJHA 3KJFA 5BXQC 1JFSA 1KOFA 3OO0A 1DKMA 3W5UA 4A1OA 5JV5A 5EI5A 4ZHSA 1JL3A 5FBZA 4OKNA 3MAJA 3MJ4A 3V9PA 5BOVA 4AJEA 5K6TA 5FUMA 4JS0A 5HR5A 2JFFA 2M6RA 1Y8RB 2IP4A 1KR2A 4HADA 3IBGA 1B26A 4P36A 5LKAA 2PX3A 4YPOA 5ITZB 1NAHA 4IHJF 3K5PA 3U3XA 4RMNA 1DHRA 2Q6TA 3O6VA 1AA9A 1T4DA 3RM3A 5E4FA 1KEWA 4B4VA 1U2DC 1HNZB 3UMFA 1SKBA 4WZBE 3EZXA 4H1TA 3EFBA 4B6RA 2HJVA 4UTOA 1Q20A 2RB4A 1TZJA 2J1LA 4N40A 4NBUA 4D3FA 4D3YA 3B9RA 3INTA 3KD2A 3OT4A 5CM9C 4UMDA 1AUQA 2IXTA 2K7ZA 1KKMA 3G8YA 2OUIA 4GP9A 2ERYA 5TVKA 2OQVA 3TTUA 5GIPE 4P4GA 4B7XA 3ONEA 2R7KA 4IDGA 4TXNA 3Q88A 2REOA 3GHYA 3OOHA 3JZFA 2PLWA 3NM5A 4LCEA 1JJAA 3DZIA 3ZK7A 2DBVO 3Q0TA 4YP6A 1GYRA 1KI7A 4YRLA 3R44A 1F2UA 1XXHE 1ZGBA 3BXPA 1T9AA 4I19A 4YBRA 2AWNA 3JQ7A 3WQHA 3ND8A 4WV3A 1EUZA 4UJ3A 4FDUA 5C18A 2DC1A 5HM6A 2H1LA 2E55A 4R5HA 2RARA 1MT0A 3KYDA 4Y3UA 2VDOB 3UMCA 2OFXA 3C6BA 3INYA 1EGHA 4PZCA 1P0PA 3L0OA 2WSSD 4L5AA 1NUTA 4YTEA 4O2RA 1NRJB 1CHNA 4XJVA 2TMYA 4G0OA 4ALIA 1DFIA 2HI0A 2NM0A 1E62A 4PRZA 5HF6A 3AUFA 1JQEA 5D3KA 1P4HA 4ZAZA 4X94A 1HE3A 2F1RA 1TCAA 1AZSC 4DRXA 2YMMA 4U0JA 3F2IA 1UBHS 2ZYDA 2X3UA 4IRUB 4WQMA 5ULLA 2ZB2A 4ATNA 1Y8QA 1NE7A 4Y7CA 2VXYA 1TNDA 2QYOA 4HI0E 1FDWA 3RAGA 3I2GA 4MV6A 1O57A 1Z37A 4B9EA 1SUBA 1RACA 1SVIA 2FPUA 4X3OA 4IUCS 2C92A 5KYTA 3IEIA 3M82A 2WWFA 2Y68A 4IIJA 1V7QA 3TXXA 2VUIB 3OKFA 1CY2A 2GSWA 3L3BA 4ND3A 1L6IA 2B8TA 4RFLA 5CU7A 4I99A 1Z45A 1G8JA 4RD6A 3ZOZA 5FH9A 4AIRA 3MK31 2H1WA 5BORA 4DCOA 1OH5A 2XB6A 4L76A 3Q40A 4QVKA 2GCEA 4C07A 1XNRB 5CFPA 1XX6A 1K2WA 4REQA 3W5CA 1M0WA 1VBNA 3B82A 4L9SA 5HZHA 4HH0A 5AQ1A 4EQZA 2ROQA 3L8DA 4KBGA 1DO2A 4AG3A 1M6EX 1X0XA 4EPXA 3U1TA 2OV8A 2PZKA 3IRVA 2Z58A 3P9KA 1G5FA 3TWOA 1AS2A 2C42A 3LFHA 4J3FA 4PPNA 1VB3A 1SG6A 4MQFB 4E5NA 1KZ4A 1FMFA 1N2ZA 1IOVA 1AZTA 4M89A 4ZVRA 2NMVA 1I94B 4TS4A 1KDVA 1AS0A 4GI1A 3VDQA 4B34A 2GWHA 1BMFA 4INAA 4WOPA 4I1UA 2BMDA 3LL7A 4BVAA 3ON5A 3IBFA 4L8VA 2JFQA 1NJFA 1PR1A 2P9QA 3C15C 2QIPA 3D4BA 3OJFA 4BGEA 1H5UA 3KB2A 2EBHX 4B0PA 4B6GA 5LQRA 2IDKA 2IIBA 1P5JA 1NVFA 1TI7A 2EGHA 2ZI6A 3KAKA 4BDTA 3Q98A 2GAAA 3PWSA 4C0WA 5JT1A 2W0SA 4GMHA 5FBLB 2HNKA 2NG1A 3OWXA 3PL5A 2EEZA 1OWLA 1ORIA 4HAXA 4DDKA 1SU4A 2QTRA 4MX8A 4F3RA 5JH7B 4V0MA 5LVAA 2GNAA 1QAQA 1DVRA 3E84A 1JIKA 2OQ2A 3TOCA 1PLKA 3JQ9C 1UUFA 2NO7A 2JFPA 2IFTA 5AMXA 2JGEA 4DZZA 4KBFA 2GCOB 4YROA 1GPAA 5BV0A 4GMXA 4L4YA 5H3HA 5KZMB 3TMAA 5G4KB 3E2PA 1EQAA 4H4EA 3PQ4A 4I5FA 5GM2A 3R6GA 2FI1A 2NT3A 5J9FA 5LYJB 3A0UA 1Z5NA 4PYOA 2RGRA 2VHTA 3IRUA 3REQB 5HNKA 3EA4A 3L7YA 2ST1A 2Y1XA 1R0BA 3HUTA 3CTMA 4LXGA 4MWEA 2GKGA 1XALA 1NVWQ 2JLQA 3EQ2A 4B81A 3SIXA 5HTKA 3TJRA 3WGJA 4DBLC 1BD3A 3FPCA 3AGQA 4QEDA 1E1RD 2JJMA 3GG2A 4MVJG 2PT6A 2H2IA 1RRFA 1LSUA 1MAWA 3BWCA 1ODTC 4ALNA 3WSWA 2XECA 1RYZA 2X9NA 2CUKA 4WACA 1MHTA 1KC3A 2HIMA 3TLJA 3EVGA 1P7VA 4DSTA 5CLLA 2AQIA 3F96A 3AESB 5E1DA 4FB4A 3KHKA 2D5BA 4E5UA 1NP6A 3Q9SA 3LHSA 2OOSA 3CF0A 4HN9A 3EK2A 1IN1A 5BR4A 9LDBA 1GZ7A 2HWKA 2OP0A 4C0XA 3E8SA 4LRQA 2AYZA 5FXMA 3E2MA 2IOFK 3K0HA 3NORA 4P4LA 4Y6PA 3UGQA 2CJXA 4LF5B 4XB1A 2OOKA 5I9BA 1Q2XA 3ZBUA 1QXSA 3RFTA 1W73A 3MC1A 3DBOB 1J5PA 2ZJZA 2VYND 4M76B 4C4YA 1D4OA 1P5HA 5I7EA 4B71A 4FHEA 4JYPA 3NPMA 5B3AA 2YY5A 4UOZA 5CCXA 3HJAA 1D2EA 4YCCA 5TMDA 3TO5A 3GK3A 3R7WB 4XQEA 1UEJA 2QLNA 3CC8A 5I8WA 2OVBA 1EK5A 1DLJA 2E4WA 1PFVA 4X6XA 4EYOA 4ZVMA 3VU8A 2P77A 1Q14A 4PG8A 3CX3A 4YRNA 1ESNA 2XZOA 1T5DX 4RTPA 2PWPA 3FKJA 4HPXB 2CHFA 2TSYB 3AHHA 4P4TA 5ELXA 2JI9A 1Z34A 3GFBA 4MOWA 3AHDA 3FNRA 3AW8A 1UBOS 3CH5A 1V1RA 1WSBA 3I6ZA 3I9FA 1JSXA 4FFMA 5CAEB 3NEPX 2OCDA 2CSXA 1E9DA 5C1IA 2BZSA 2G71A 5CH5A 1TL7C 3PPWA 3C3XA 2P35A 2O8CA 2AOUB 4O2AB 1QYRA 4GBED 2VRNA 1CZRA 1HTTA 2EX1A 2ZSHA 1FQJA 2FEKA 3HEBA 3K5HA 3QXCA 3AZQA 3W2TA 3DCIA 5JARA 4X66B 3CZ9A 3HGQA 3M1LA 3AVVA 4RF3A 1Y5RA 4J1QA 4FMBB 4D25A 1L8QA 4YCAA 4AJ9A 3FTEA 2BSXA 3OUUA 2BEVA 4HO1X 1M2VB 1LZKA 2A94A 3C3CA 1ZICA 2OQRA 5B30A 5DN9A 4QGSA 4HAZA 3LOQA 1IPFA 1OLXB 2BM8A 2IYXA 3OQIB 4Q1FA 1A2QA 1BN7A 5DHQA 1EDEA 1MG0A 1GARA 1Z2AA 4FJ1A 1NN5A 4HYEA 4C01A 2M6KA 1BJRE 2WIFA 3HADA 2OM2A 3ZY6A 1XMXA 5AESA 3OEHD 3BKXA 4MQEA 2HHLA 2QJFA 4Z0HO 4BBZA 3UUWA 2QSUA 5C3MA 4U00A 2FRVA 3KZMA 4LXQA 4GKVA 4EA8A 1YFZA 4BZWA 4J16C 4WXHA 1TJNA 2F3QA 1J23A 4GEKA 3OUTA 4OHWA 3SQDA 4B4UA 1QO0A 2J0SA 2H3EA 4MK4A 1QGZA 2FGJA 2B92A 2W4MA 5CNMA 4IHKA 1B8NA 1ZI9A 1QE3A 3LMKA 4FYKA 4OLJA 1E8DA 3HDYA 4I3GA 3A1WA 3D5EA 4G0YA 4KGDA 2AOWA 2ZBGA 4C87A 4NMMA 3NIBA 4F6RB 2WM3A 4PHFA 5AKHA 2GARA 4GZ5A 3K4PA 4YQEA 3HZRA 3EVZA 2AXQA 1TM5E 5DMXA 4GC9A 1EFKA 2DQZA 3DZBA 5K0CA 1EM8A 2FQXA 2GO7A 2F64A 5FBKA 1QNFA 3T7IA 3R8CA 4ZJPA 3EGDB 3WB0A 1YA4A 3RLIA 4PWZA 4O1IA 1YDGA 4NU0A 5F7OA 1A9OA 1HDYA 5E9WA 4WNIA 1GPJA 4NNPA 3VNSA 5TXGA 1E2HA 1H9BA 2GA9A 4H7FA 1RWVA 3MQFA 3WYEA 2C2WA 1L5RA 2H5IA 3TQRA 1O97C 2I67A 2ZXEA 5H83A 1SQGA 4MWBA 1XHEA 4KVFA 4DNFA 5HKKD 3THXB 5LU9A 2WM2A 4LJ7A 4O4HB 5EUBA 3PQ3A 2B7BA 3GLHB 5IULC 5ALLA 4GX0A 2HRDA 4ARBA 2CNNA 1E7YA 4QVIA 1JR6A 3TUZC 4BGVA 4QASA 3AILA 4ZV9A 2PKQO 2QTHA 3VC3A 1X38A 1I0IA 4NDAA 1M66A 1RNLA 3FPSA 5T4HA 4H7DA 2G9NA 5JC8A 1JH8A 2BEWA 3DV2A 4KW7A 2ZTLA 3L7MA 4MAAA 4F46A 2Q5LA 2R65A 4F91B 2N1MA 1GXSA 2HO5A 4B74A 1C8LA 4GGOA 5DTMA 2C97A 3R3YA 4Q5IA 2GRAA 2EL7A 4LYDA 1SQ6A 2NZJA 4JBIA 3GBSA 1JZQA 2IHZA 2H9YA 1QVWA 1T15A 4UBKA 3K2QA 4F38A 5KQLA 4XARA 4QDKA 2J0UA 1RT9A 1X7HA 3ICVA 3SLGA 2P4HX 6AT1A 1BROA 1JDVA 3EGXA 3OJXA 5IDQA 4CQNA 1K88A 3Q1LA 3ZDDA 1N7JA 3E27A 4UAUA 2YJGA 3AVWA 1HE8B 3T9AA 4JEMA 1GGKA 1QG6A 3T5AA 4FTWA 4BQIA 1II0A 2KBEA 4XUDA 3R24A 4RLSA 4F12A 4ENWA 1YL7A 2FX3A 1CY8A 4UEKA 3OKCA 2YHSA 2P68A 1A95A 3WFIA 2J87A 1TPZA 1XVTA 3T3DA 1J99A 4KYUA 3G2OA 1E6UA 4G9BA 2HRQA 4TVOA 3SKXA 2EQ5A 1C8VB 3HSYA 2B30A 3OOEA 3L0IB 3UXHA 2OE2A 1FP4B 2EV9A 4G5FA 3TZBA 3VZSA 2IX3A 4CG2A 4RHTA 3IA7A 3KLMX 3IHTA 3TXAA 1W87A 3JSXA 1IONA 1FFXA 2NUTA 2PFSA 2F1OA 1OFIA 2VK4A 5DYIA 4LF4B 3P27A 3U1BA 3GGPA 5LNK6 1SEVA 2X6TA 3MJDA 3OCCA 2ZZKA 1XDWA 4ACBA 4R0MA 3HJGA 4Y9TA 5LXTF 1KJ8A 1V5EA 2B0JA 1HK7A 3DCJA 3ET4A 3OMXA 4OYLA 2B98A 4RXTA 3KE9A 1VB5A 5B36A 1ZN9A 1DAPA 1QIGA 1W4BA 2PIDA 3HDQA 4NFHA 3I61A 3V8BA 4YA6A 1OAKA 1Q3HA 2V4ZA 2WUFA 2WTEA 4YJHB 3NFRA 3IVXA 4MO2A 3WJAA 1ZRSA 3P9SA 4ZKEA 4PW0A 4NH4A 3RUIA 2IYRA 4IJMA 4MS3B 1UZMA 3DMTC 2R7AA 4L9RA 1ZGZA 1NP7A 2QQFA 3LIPA 1U7ZA 2NGRA 5AK6A 1R0RE 1EHCA 1Y34E 3R5XA 5DW0A 3DKPA 3IAAA 4JAVC 1DQZA 2Z4RA 4V0NA 1G1AA 1LPNA 1TVEA 1W52X 1NQVA 3DTVD 4IQ0A 3EXHA 4TX1A 3PGLA 1V7ZA 2WJ6A 4R98A 4UPDA 1T0PA 4GO1A 5DT2A 4NPCA 2YJNA 1UZLA 3SZMA 4BWFB 3I2IA 3OT1B 1A5TA 1UC5B 4AECA 1Q0LA 3FYSA 3L46A 1SHLA 1Y8RA 2TRSB 5A4IS 2JLYA 1JIVA 1GNLA 5ITZA 4JJFA 3BEDA 4JBLA 2GF2A 2QPLA 3HDHA 4LGYA 4ZPXA 5KOJB 2OLJA 4J3NA 2BLNA 4B6SA 2QY6A 2DJ5A 3AUTA 1DQPA 4MJ7A 2JFNA 1YFLA 1OMOA 2AN4A 4EO9A 3IR5A 3R5KA 4CNBA 1OC2A 5JWOA 1BVHA 1JKFA 1SR8A 3V8PA 3D81A 1CZOA 4RVHA 4MVJA 3RF6A 2ZATA 2VDPB 2BSQA 1Z63A 1NA5A 3P9XA 5K0SA 4WCFB 1EZ4A 4GPD1 3DC7A 2FMKA 3TM5A 3ZHBA 5CEJA 2BMEA 4OQDA 2F43B 5BY2A 5TEWA 3W2FA 2ZRMA 4OQMA 4ZQHA 5GAJA 3C3WA 1WABA 4ZCPA 3SXUB 2BKAA 4WXYB 3V8QA 1R6XA 5LPNA 1XWFA 4XH9B 1Z5WA 1THMA 5GV8A 1M76A 2Q1YA 4UVEA 3H7AA 1HT3A 4GP6A 1O7JA 4DCCA 1V11B 1IL0A 2IIQA 4EB3A 4MDFA 1CY7A 1TRHA 5GPBA 4ZOBA 3HKEB 1M3SA 5AOAA 2LDXA 1NW6A 4N0QA 3RWMB 5AKXA 1W0JD 2BISA 4IXNA 3GZJA 2Q4OA 3GP5A 4FDAA 2Y2UA 3V7NA 2YOGA 4J1TA 1A71A 3LA6A 1YKSA 3IA2A 4KLCA 4QIHA 4G3XA 5CNJA 3SDBA 1ZM3A 2QX4A 4DMGA 5ADUS 4HFNA 5JAHA 1U2DA 4QG3A 2PJDA 3VR4A 1BD4A 4AY2A 4KN9S 1P2TA 2BEUB 3GJ6A 4LXHA 3BMXA 3X1XA 3UJHA 1VI5A 4CLXA 2FZKA 1JLKA 1EZZA 3IMEA 3R0IA 3IAM1 4G0NA 5JVDA 3WAJA 2C8JA 5A4MS 4L75A 1CVLA 3IXMA 3FLAA 4H3VA 3ZZ0A 3RVRA 2R1TB 4OHKA 1RXWA 1X7DA 4B6OA 3K6JA 1R5JA 1WR8A 4QJIA 5LZ9A 1E2UA 1DC3A 3EIEA 4HMQA 1XLTA 3VDRA 4CQMD 2J5QA 5FHRA 4CCYB 1JEAA 1G5PA 3C3PA 3E61A 3VJLA 4XKJA 3C6QA 4D46A 1FA9A 3UH0A 4NFYA 4OJKA 2CFIA 3ZIUA 1W4ZA 1U9IA 4M60A 4PM4A 3SIWA 3U9LA 4XIJA 4PYJA 1X77A 1EGAA 5FOTA 1KU6A 1EJ6A 2GKOA 3JW8A 4RMJA 4D3DA 1J70A 1SXGA 2LW7A 5HE8A 1Z7YA 5C5EA 4BY9E 4CPDA 1O08A 1Y3HA 2HSZA 3T5DA 1OVMA 1TM3E 3UENA 2ZYUX 3X43A 3ZD9A 3SR0A 1NBHA 3CRW1 2PUGA 1PJTA 3GUVA 4AB1A 1H2FA 2VT2A 4DAEA 5JQGF 5IW8A 3GGCA 4JB3A 4WH0A 1KPIA 1XZBA 1WB6A 4BS9A 4HQNA 3TNLA 1FDVA 3R74A 3QVUA 1L5QA 2VC2B 3TN7A 5KYXB 3RVKA 1P4GA 3AVTA 1XXHB 4MV4A 1OSNA 1TK3A 2PH1A 1QO7A 1EK1A 2C1EA 4IDQA 2W90A 4HH4A 3FJYA 1QG2A 2V55B 1G18A 2A7XA 1WVMA 2FFJA 4IDBA 1OA1A 4AZTA 2V74B 1ZVMA 3DDSA 4LV8B 4ML3A 4B32A 3QX7A 2UYYA 1M8FA 2H85A 5DI9A 3FRHA 2XKKA 1RQ7A 2QRPA 2XWPA 3CG0A 3EYAA 3MS4A 2OEPA 2ORED 2I6TA 1PKXA 1DMSA 1JR3D 1PR3A 5BYBA 3DEFA 5JH7A 2I1QA 1V1JA 2HJ9A 1W5FA 2LCFA 4JQZA 1QQ7A 2CLKB 3E9ZA 2V7TA 4CL3A 5B4UA 4FILA 4DV2B 4DB2A 4L8LA 1Q19A 2X0EA 2WWYA 1FFGA 2QD4A 3UZUA 4EL5A 2HMSA 1UBGA 2CNLA 4M0LA 2GCOA 3GEGA 4Q1DA 2R86A 4RHFA 3CZ5A 2VYCA 5JZMA 2OLEA 3SC2B 5ALWA 4OLBA 5G4KA 1I51A 5JJKA 2EZ9A 5LYJA 1F6DA 4E5KA 3UHOA 3DDHA 1GZ4A 2C96A 3SJUA 4P93A 1PJRA 1ZKMA 4AJIA 1CSEE 1C7IA 1BW9B 1VIMA 5G53C 1JEOA 2P4EA 3VR3D 4PVCA 2CLIB 4RTNA 4V1CI 1RRMA 2PQ2A 3B20A 1FZTA 1OX5A 1ZN8A 4A92A 1KSFX 2V7XA 3OPNA 1AKNA 3QG1A 1IBKB 2X0RA 2OP1A 2P69A 1IM8A 5I45A 2AEJA 3F3YA 2WF6A 3BB4A 3IALA 3K96A 4GWKA 2YDYA 3ZHVA 3I9KA 3RSGA 1Y6QA 1XPOA 3AESA 2XT6A 3IO5A 1C8KA 3DLCA 2BI7A 1SUPA 2LUOA 3D8BA 3ZZNA 2OB1A 4NOKA 4C4RA 1LPOA 1NW9B 1X42A 2HLDA 3F7TA 1N3YA 3GZTB 3KZXA 3TK1A 1GNPA 1Y5LA 1LDEA 3NEAA 4MROA 4JL6A 1E5DA 2ZKIA 5A9TA 5T3UA 3FVTA 3ZBPA 5HQJA 4R16A 4A2PA 3EX7C 1LPBB 5JIBA 1H0SA 3C74A 3QOXA 4GVLA 4L95C 3WNDA 1Y3AA 4G6ZA 3OTOB 2CMHA 2ORVA 1KRWA 3RARA 1UFOA 1XL0A 3KUXA 1U02A 1CUYA 3HP4A 4L5BA 2V0NA 4B9AA 2WF9A 2F67A 1V5IA 3G8DA 3LUFA 3PIRA 1JYEA 3R7WA 4B3BA 1NVXQ 1KEKA 1H4TA 1H0RA 1LLQA 4MWTA 4MIYA 2QU8A 3T95A 2BM1A 1Z0FA 2Q3CA 3HG7A 4FS3A 4FW8A 2GUWA 1BQ4A 4LE1A 2FSPA 4N76A 5HOEA 2YFQA 3S55A 3G0IA 5DMHA 3NAZA 4G4JA 1GYQA 1B76A 2HSWA 1VLQA 1KY3A 3A6JA 5CAEA 1P3Y1 2O2ZA 3O90A 4G81A 4GM0A 4BHTA 1DIOB 3EF0A 4HTFB 3SDZA 2HCBA 4NU5A 4PZPA 4EY3A 2FXIA 5DNWA 5LLSA 2AOUA 4O2AA 4UHJA 4CLRB 2JL1A 1E1DA 4UULA 4BRUA 2C07A 1G6KA 4FNMA 4MLZA 4OQXA 2C7OA 1G3QA 1MG5A 1X0VA 2AJBA 4MRPA 1TEZA 1PWHA 2ODAA 2XWJI 4TSKA 2ZUVA 3ZJUA 2ZRFA 5GWXA 4FMDF 4AWXA 1YVDA 3LCUA 1JR3E 4WK6A 1M2VA 2AZDA 4RFVA 4U2EA 1FDIA 5I4IA 3QQ5A 1UK6A 4HGZA 5JRZA 3FDXA 4I3HA 1E2DA 3DEHA 1OXUA 1OLXA 2I8CA 2QIOA 1TQDA 2XVXA 3GPDG 3OQIA 3OZGA 5EIOA 3ABSB 1UODA 2JAPA 5FWDA 1JAYA 2ZI5A 3DDZX 4WXEA 1U5BB 1V4VA 1QTRA 3NNDA 3KNZA 5HKOA 2G83A 5G41A 1ZXXA 4HWTA 3W5BA 4ZC1A 5CA0F 4IQ4A 3RC3A 3VTKA 1J9EA 3EARA 4KN5A 1ISSA 4W5TA 1QNLA 1T9DA 3N7UA 4AC9A 1UM8A 2Q3JA 2R85A 3N2NA 4IV8A 4MI3A 4Y2SA 4IGAA 3IKTA 1UL1X 2HFJA 1LBQA 3LYHA 3TQHA 3G0GA 3GRAA 1P4JA 4WK4B 1ST2A 5DOZA 1V7CA 3RT1A 4F6RA 3AEQB 1WB4A 2JJ2A 1X3SA 4RQBA 1UANA 2PS3A 5J2UB 3RK1A 3LHFA 3ZJVA 1UQUA 3B53X 2ZBFA 4O25A 1NM5A 1TUIA 3AR6A 4ZEOA 1VG8A 1OTYA 3KLOA 3IVAA 1TUBB 1W5TA 4U63A 4CGZA 1DBPA 2AIRA 2QE7A 4C43A 2EFYA 2XF8A 4UUMA 4DR5B 1PFQA 2YZMA 4O2BF 4EB0A 2XE4A 4TTQA 1TM4E 3GEHA 2J3LA 1YONA 4BV8A 4M37A 3BQMB 1RWOA 3U80A 5BV7A 2FX5A 1QCDA 3THXA 1O95A 2PUTA 4NCXA 5AUQA 2YN0A 3ROKA 4MITA 2YJ6A 4O4HA 3IT0A 4NXMB 2C9DA 3RSSA 3GLHA 1HH4A 4JT8A 4KB5A 4PINA 1L5KA 1ZD3A 1ADJA 4ZCLA 1PQPA 3NHKA 4FYWA 2Z6UA 1C9MA 1ENYA 3UAWA 4EG0A 4BB0A 2QXUA 1SHJA 2C4TA 2OYRA 3B52X 4D56A 1JIQA 1TIKA 4XGIA 3T3EA 1W96A 2JI7A 1MOPA 2VQFB 1PD1A 1NLZA 5K0NA 3W2IA 2GN6A 1MUUA 3O4JA 4NBRA 1D8TA 1FYDA 3LK6A 2IQ5A 1S8AA 2O4CA 2WIDA 2NSHA 4K9DA 4KXVA 4YP5A 1DRKA 1PRYA 3DVSX 5TARA 5D8DA 4D1YA 3PVSA 4D0SA 3EBPA 2I78A 1GLNA 3FROA 1OFGA 3PGA1 4HGPA 3S2GA 1NG9A 2G07A 5IDYA 2Y27A 1SG0A 1VBKA 2W6JD 1DUIA 4PGGA 4AN4A 3A6ZA 2FEMA 2CXTA 3C8ZA 4ZO6A 2CFTA 5IM5A 3UXMA 1VYHA 3HACA 1KORA 4TMTA 4HLUA 5SYAA 1N9GB 3HY3A 1RADA 4LNHA 4FGJA 5BPFA 4FGZA 2AW5A 3KOMA 1QG4A 4R1PA 3OQBA 1ZMTA 3RC9A 4B48A 1U3CA 2JGIA 5LYYA 1PFWA 5FJJA 4R1UA 3ZBQA 4MP3A 3SICE 5LQCA 3JWIA 3NCTA 1E0AA 2ZI7A 2RD2A 3T3NA 1FDRA 3GDFA 4TTSA 2FDCA 1ZL2A 1IY2A 2JJYA 1L4YA 1E1LA 2Y1LA 1FP4A 4C0KA 2QVCA 1U98A 4A8JC 4O4JB 4TT8A 3WK8A 3ZE7A 2O50A 2GTIA 2CXRA 2ZW9A 1OLOA 3UICA 5KHOC 1L9XA 1T8TA 4JP3A 4MUMA 5L7TA 5AKZA 2QBYA 2I6GA 2VBGA 4DG8A 4ANFA 4N18A 3CX8A 1KI3A 3OOJA 2BCJQ 4O2LA 4H2DA 4IOKA 1FYFA 1W48A 4IR7A 5LOVB 1SKQA 2IEBA 4EG5A 1UAAA 2IHKA 3VC7A 4KKXB 2YZGA 3EIUA 4X1IB 4LRUA 2DUNA 2R87A 2YS7A 4RDCA 1A27A 4EAAA 1PV2A 1MQ9A 5FP0A 5KKAA 5JBIA 1I1QB 2CMFA 4PG6A 1FQOA 1TGVA 1TF7A 2YXBA 2VZ8A 5LQNA 4N48A 4YJHA 2ZB4A 3W5AA 1MW8X 1SD5A 1XZGA 4GP7A 4JQYA 5IKPA 4X92A 3ZVNA 4LFBB 2P9ZA 3G13A 1R74A 3C2QA 4MS3A 4RY2A 1UMDB 2BJWA 1P0QA 3AOEA 3L6CA 2FW6A 2HUNA 4EI9A 2WJGA 1CQWA 2PPLA 2GEKA 4JC8A 4IKEA 3PSAA 4RHEA 3DOFA 2JEZA 2PAAA 3SYKA 3X1KA 1D1PA 2WFZA 3FPEA 3HTXA 1OROA 2V6MA 2EJBA 3IAFA 3VZCA 3IEPA 3HU1A 2BAGA 2GK4A 4D4KA 3D6FA 5GADl 3TSOA 1TIBA 1JN0A 5K2OA 4XUEA 1QZZA 3OT1A 2Q4EA 3BICA 1RJDA 2VH2A 4BAUA 2H1CA 1NNLA 4K8RB 5KUTA 2FK7A 1L7OA 2ODTX 2PVSA 3K1TA 4HLQB 4EDFA 1XWIA 5KOJA 2PCLA 1YRYE 2GEDA 5KS2A 1EXVA 2PRZA 2W42A 4JYMA 2J3KA 3FPAA 1DADA 1U8FO 3IP6A 1U8EA 4IINA 2IHVA 2FPLA 4NIMA 1ZM2A 4ZU3A 1CR0A 1I14A 5KWSA 3R6DA 5IZ4A 2ZAOA 2ZKLA 3M5CA 4E12A 4FI3F 4JYAB 3E3AA 1T2VA 2R00C 3HZHA 3LCJA 3OZIA 1YASA 2CD7A 4F1WA 3G7NA 4P0QB 2ZUEA 2ENUA 1SCUB 3GAZA 4XWTA 4KUHA 4WCFA 3HJCA 4PO8A 3F5QA 1YKFA 3QVWA 2F43A 3TG2A 10MHA 3PLAE 2IEZA 1A7JA 4G9EA 4RQTA 2JI4A 3HBLA 4M0FA 5FWXB 3X44A 1KDPA 1M2GA 1YBMA 5K6AA 4JC0A 4MJ3A 1US8B 4PC2A 1XBTA 3HCRA 1UBJS 3MSCA 5KWVA 5IBPA 2C5LA 2Z5VA 4HS4A 2GVZC 4DV6B 3HKEA 4G67A 2X1VA 4FM9A 4DS3A 3X0DA 4EATA 5JCPA 2I80A 421PA 5ICGA 3EDMA 2HH9A 5PGMA 5BV8A 2QXYA 2NPOA 1P1JA 3OQJA 3ENZA 5J2TB 2NIPA 2QB5A 4Z4IA 3RSCA 1EBFA 4BECA 3FSGD 3KKLA 4FMDB 1JG7A 1TEXA 5B1HA 5H8WA 3CSDA 1KJJA 1NBME 1SC6A 1U0NA 4WBSA 4QHTA 5DHTA 4OLAA 1AHNA 2BEUA 4PBSA 4Q3EA 3ZHUA 4CR8A 1DIGA 2FCRA 3D4NA 5CB6A 2JCXA 1E4VA 1SJ9A 2J46A 4N54A 3PLRA 1GEEA 4GX5A 4HB0A 1ULBA 1Q1NA 1GU0A 2O2HA 1OYOA 3GYBA 2R1TA 3SQMA 2HLPA 4LWOA 3OPYI 2J9GA 3I4CA 4B6PA 1QVZA 2QVXX 4CCYA 4KR9A 3ORSA 3ZKWB 1RMTA 5U4QA 2C7RA 4HPJB 3WIVA 4YYZA 1W34A 4WZBA 1SPXA 2CZQA 5ITWA 2YYZA 1YJBA 3FCCA 2P2GA 2VWGA 3QVVA 4JT2A 3DXXA 2M2IA 4ZHQF 5CFOA 2O0KA 1T3TA 2NUAB 1SURA 4RY0A 1R8XA 2QRQA 4ESOA 2GKSA 3VYVA 3D0QA 3MOGA 3VKGA 3AUXA 5L3VA 3OTQA 3KTAB 1EVEA 4KXYA 4W8GA 3K9BA 3HHEA 5KYXA 1NC3A 3CZMA 1HZJA 3S28A 2YASA 2FMXA 1XXHA 3N6RA 3EMKA 4QO7A 1G4AE 3EC2A 2I8LA 1HLFA 3ND9A 1GG5A 1P45A 1Z0KA 3IIJA 1MC5A 3LQQA 2IYYA 5E4JA 4GYYA 1N2XA 4PZUA 1JJ7A 1WXIA 3N28A 2SCUB 3A4VA 4BWYA 1KYXA 2NZVG 4Q7EA 4HZUB 2FWAA 2ZRPA 3ENNA 4LGCA 4D9FA 1TYBE 4HNGA 4TL9A 3HB0A 3S2UA 3D2AA 2WW8A 2I2DA 4QQFA 5DHUA 1ORHA 1H6CA 4EY4A 2Q3DA 5TPZA 1AUVA 1BXZA 3EDYA 3CWQA 3LW7A 4BEBA 4EOGA 1MIHA 1LQUA 1XA3A 1ZMBA 2GK6A 3I6QA 4FDLA 4BX9A 2DH6A 1PAUA 4HR7A 1AMNA 2AF3C 1I4WA 2FMTA 1WDTA 4URYR 2YCLA 3L1IA 4NCKA 5DLEA 4ADSG 4H0FA 1E5LA 1JLSA 5EVJA 3TD6A 2JH9A 3FDIA 2D2VA 5L53A 1DE0A 4MGZR 4BNVA 1FNMA 2YV5A 5DXFA 1PT7A 1HPLA 1PW5A 3SC2A 1AXRA 4UREA 1AKVA 5BSWA 3THYB 3G2IA 5H16A 1M72A 2C3UA 2WZQA 1DAEA 2GD0A 2BEJA 2O14A 3H2HA 4XR9A 1KYIA 3V6LA 5AVYA 2JFWA 3AJRA 1Z4OA 1B4DA 2O48X 1Y7TA 2BKVA 1BW9A 4PCAA 1E9CA 3TH5A 1S01A 4KAJA 3Q8XB 5AJWA 4QEKA 4DJAA 5HW0A 4BFTA 5IDXA 5JR3A 1DEHA 1WVGA 2A9VA 1NPYA 4OBWA 2C2OA 2AMVA 4DJ5X 1ACJA 3RC2A 2W2QA 5L7YA 1LPAB 3DLIA 2O2SA 4FQ7A 3RRBA 4J1SA 1J1ZA 5IVIA 3U6BA 1E3IA 3IV9A 4K9MA 5L3SB 4KR2A 3L8GA 5EXDA 2C84A 3H84A 3LPDA 3QUAA 1VKOA 1U1EA 3DTVB 3P2YA 5C8VA 1FDTA 4BMPB 1PG2A 1Q0PA 4ZVUA 2JAOA 4BWVA 1IMOA 1B7GO 4CG0A 3TF5A 2VYQA 5IDWA 5TIIA 3ZWQA 1AKUA 4EIWA 4BJ6A 1CIVA 1FEZA 3PNBA 3RNOA 4R8RA 4MW1A 1HYBA 1Z0AA 1JVBA 3RVMA 1FTQA 1G8KA 2WZDA 4E07A 4DXHA 5KNCD 2R1VB 4L8YA 5JDCC 2Q41A 1GQRA 4Z9BA 1ZG3A 4RKEA 3QMWA 4GOOD 3ZDQA 5JD6A 2J3JA 2P2ZA 3KSMA 3RTBA 3MJFA 3WLIA 1IB0A 5ICCA 4GWGA 4LJ8A 4MPJA 2IS6A 4JHXA 1MB0A 1RM5A 3C7TA 1MLDA 3MFQA 1RP1A 3I62A 1CXZA 2PPVA 2ZSBA 4MUHA 3WP0A 4D99A 3PUHA 1G38A 1HEYA 1HQKA 1SUCA 2E5FA 4NDNE 2R44A 3TDNA 1YIDA 1X1TA 4NJEB 3SVLA 4XASA 1F14A 1DEXA 3PXXA 5CVEA 3B6ZA 4PV7A 2HN9A 2WYOA 1XZNA 3ESQA 3M5DA 1T3LA 1HLDA 3M34A 1DTEA 1NQAO 2FE1A 1C3OA 3OZFA 1V4NA 1RI5A 4FB5A 2WT9A 5C7OO 5BMVF 4ARIA 3NHYA 4V0LA 3NASA 4WKOA 3RH0A 3ADCA 2UZIR 1NBOA 3EMBA 3PC2A 1GGNA 1KFKB 4RV9A 4J6FA 5C1PA 1Q92A 4LF7B 2RG7A 3BMQB 3UC9A 8AT1A 1ISRA 4HTFA 2HMUA 5TNXA 2H1RA 4ZI7F 4A73A 4XEHA 3U0BA 3VH2A 2B35A 4NBKA 2YJ5A 3ER8A 2WMOB 4BV2A 4EX7A 4WKNA 1QO9A 3KPVA 1CDOA 3QIAA 4EW3A 3V4PB 5L6LB 1IZ0A 1YF3A 3QBTA 3FHTA 1HG1A 3LQFA 3AT1A 1KKUA 1YO6A 3DWEX 4CLRA 4O3MA 4INPA 5LCXA 2OBXA 4QQ8A 1XRJA 3RS7A 4F6CA 2OYCA 1EFAA 3K9HA 4HLNA 3SNKA 2NXEA 2WSSA 4HMOA 4M8NE 5BYJA 3STUA 3FHCB 4BN5A 2FN7A 4BYMA 5AVVA 2IYWA 3QEAZ 2B8EA 2Y0PA 4QOJA 4I1YA 3UBMA 3CLRD 4KE9A 3W8RA 3WXMA 5IC6A 2OL4A 2NYAA 1NRWA 3QXSA 3SYNA 3EOBI 3D6AA 4II2A 1ZD2P 4GM4A 5BNFA 2AC7A 2XLBA 4O4LB 3V2GA 3NWOA 4Y2JA 2Q45A 2X8LA 3PJFA 1U5BA 4TRMA 5BR8B 1N2GA 3WICA 3VV3A 4TWBA 1YDFA 4EKNB 1L7VC 2WM9B 2AZTA 4RLQA 5CPFA 3QA9A 2Q4RA 5F5NA 1LX7A 3TLEA 1JBQA 2F48A 1RI4A 2VHYA 3QVMA 4CQMB 3MINA 4XWOA 5IRCD 4F3KA 1AA6A 1T8SA 2RONA 1J0CA 1I0LA 1Z82A 1M6WA 1IYZA 1E2IA 2WUWE 3IJ5A 4I4NA 1NZFA 3E9DA 4LC0A 4A91A 4KRFA 2I22A 4RU1A 1ZFNA 2EQBA 3N8GA 4JB0A 3BFXA 3R2JA 4K1XA 3V2UA 1U1DA 3AEQA 4WIAA 2D7JA 2A3RA 5J2UA 1NTOA 1QH1B 1R4NA 1DC4A 1UKEA 2QKYA 3NXKA 4LDAA 1IULA 1PS9A 4HGQA 1Z18A 3Q72A 4RHCA 5HIKA 4PX9A 5JTUA 5LA6B 1M5RA 4YQYA 5KYYB 3R76A 2BCEA 4HFMA 1KZ9A 4WECA 1TUBA 2JLBA 2PGLA 4MVWA 1PG0A 4JEUA 4PHHA 5E38A 2YS6A 4MUKA 3VI4B 4EB8A 3QE2A 5LC1A 1WXDA 1T6YA 3QUCA 2WTXA 2A58A 2EU8A 3OCZA 4LI3X 2VJKA 1R6BX 1GD1O 2WWGA 1V8DA 2BT4A 2XDYA 4DW8A 3GGOA 3GEDA 3CUYA 4RC9A 3S7TA 3OIYA 3HBNA 4DDTA 3LP6A 1JZSA 1WLYA 3DYBA 3LPMA 4K2HA 4A10A 2KLBA 3GFGA 3H1TA 3OP1A 2HCFA 4J0KA 1M0EA 2F2TA 1UBKS 3I3OA 3I6YA 3T3MB 2GLXA 3H4VA 1P0FA 2PA0A 3H5VA 1GQSA 1FTYA 1AKWA 1XP8A 1JAIA 3GJZA 3I9LA 3NGMA 4L1KA 1XVIA 4XOUA 5DM2A 1OYVA 1CUFA 2V7QA 3H3JA 4FCTA 4K7JA 4PBRA 1QV6A 4AYTA 1E2GA 5K09A 1V39A 1K06A 1QKIA 2CF6A 2VDQB 1TVKB 1LW7A 3DEYX 4R2JA 3PVZA 4OQPA 2VSQA 2R751 2QZ9A 2X8WA 4R0NA 2QTAA 5I3CA 2ZAGA 2AYYA 1TM1E 2F7SA 3H17A 3OIDA 2FFHA 1L1QA 4MYTA 4QGHA 3EQ7A 3L8HA 4PZEA 5FUWA 1L5NA 1RRCA 1N1GA 2CNOA 3ROFA 5EFOA 3U3JA 2C00A 3P9RA 4RZQA 3RVJA 3FOAA 3H9JA 1ZBDA 2D1FA 4UVIA 5A3RA 4Z4FA 2GD2A 3FOFC 3T7DA 3IT1A 4I6EA 1DXQA 4KQMA 2I7CA 2IPAB 4NJMA 1E6CA 3LRTA 1PX2A 2J08A 1F4VA 3ZWPA 4FWBA 1JJIA 4C0AC 4FI3C 1Q7RA 3TOZA 3ZDFA 4ZOLF 3RFUA 2FW7A 8GPBA 3AJAA 3CA8A 3QHQA 4IUDS 4O4IB 4B80A 5AM3A 3NC0C 4L8WB 2AD1A 3U56A 1MQAA 1RW4A 2N1BA 2ZIEA 4J0DA 5EOVA 4BU0A 5JPCA 2QG6A 3GDOA 2FSSA 3WISA 1EESA 2WJYA 5C3UA 5AW7A 1SU6A 4F6LA 4Y8VA 4BQEA 3IP5A 1SY7A 1KJ9A 5KYUB 4O4JA 3UJDA 2V5VA 5E3HA 3W6ZA 1KC1A 2VXBA 5A1JA 4JLPA 2FF7A 2WSYB 1AUXA 4YCJA 3CNLA 1TCBA 2ZSUA 2NTYC 4QBHA 2O3UA 4C4OA 5EINA 4UE6A 1GZDA 1Z6PA 4Q16A 1JFVA 1G20E 2O2DA 3JVDA 3QMVA 2Z43A 5LOVA 4FLEA 5F3RA 1OX6A 3WIOA 4CU5A 4X1IA 1X1BA 3E3OA 4WLNA 5HBGA 1A88A 1WD5A 2ZXUA 1SNYA 4DA4A 1MT3A 4LVOA 4Z2AA 3I5AA 4WUVA 2QLLA 1LB1B 1R10A 3S27A 5T5QA 2Z5GA 1JIXA 3G17A 3PDWA 1KAEA 5DN6A 5FQNA 4HNTA 3D1LA 1X1CA 2BDTA 4ECAA 1T1RA 1Z6YA 1UMDA 4A5SA 5HQ3A 3BD7A 2JJ1A 3K4QA 1QGYA 4BEJA 5TQ0B 2XUDA 3V32A 721PA 3NUGA 1EFPB 1DKQA 2ZBPA 4ZYXA 1QVRA 2IZOA 1IK6A 4JX8A 5M34A 4B17A 4RULA 3RV4A 1BX3A 1DHTA 3J7AC 3IMKA 1OBFO 2ZE5A 4UDOA 3JQBC 5DEOA 4W9NA 3UV7A 4V0SA 3JRWA 3GR6A 3RUEA 1NU6A 1VPDA 4K46A 2VTKA 3G0OA 3RWBA 3UB4A 1XTUA 2VHZA 4ND8A 2DUUA 2LP4Y 4NONA 5CMLA 5FOSA 4EJ0A 4RA9A 5KX5F 1I33A 3F5DA 1HL3A 3LRPA 5AVUA 4DAOA 3ZEIA 1T6BY 2YQ5A 6CHYA 1INLA 3V4ZA 3V1NA 4MRNA 1EA7A 4YMSA 5ICSA 2D74A 3DSRA 3ZXIA 3DZ8A 2I7VA 2IIPA 4G23A 5LJLA 1LCIA 1Y9EA 3Q10A 1MENA 4WNCA 1GTSA 2J6BA 1EP3B 1RIFA 1SCUA 4X6LA 3NV7A 5FBQB 5K51A 3FYUB 1B16A 1ZJZA 4EVIA 3JQQA 3NBKA 3AB3A 3R3ZA 1UBFA 1HDRA 2QJOA 1RMYA 3WL8A 2JFYA 1B00A 4PQFA 4X41A 2WAYA 3GPBA 1OIVA 1Q7CA 4X7PA 4RMIA 3UPUA 2HX1A 5BSEA 1PZMA 4BLTA 4XYGA 4AROA 5FWXA 3SIRA 4CM6A 1JTEA 2AG1A 4WTOA 4YAIA 1US8A 2RAFA 2P2LA 4NNOA 5EE1A 1WNTA 4OSEA 3PGKA 1GSIA 1N8TA 4PTLA 2VCEA 4D43A 3LWZA 2WJ4A 5FPSA 2IYUA 2UZ4A 1EFTA 3URMA 4C20A 4M9QA 2NV0A 2C9MA 4KFTA 3UJ8A 3UYKA 4R8LA 2A86A 3WGUA 2HF7A 4ZZ0A 2PBLA 2EJWA 1Z5ZA 4FYJA 1KS2A 5JSQA 5J2TA 5L40A 1VPTA 5EP2A 4ZYUA 5FX2A 2Q21A 2MWMA 2AK2A 3IHKA 3FYDA 4Q02A 2YXPX 3Q15C 1R8QA 2OFWA 5EJ8A 2C5AA 3E9EA 3BTUA 1AT1A 3PK0A 3QYAA 4KX5A 3A3OA 3R3WA 1YCDA 4FGSA 5LBTA 2PWAA 1WOYA 5FO0A 5GGYA 1OGIA 4Q7LA 2YJZA 4BP9A 4XYLA 2VHEA 3AUAA 2PEZA 2FWIA 4XE5A 5CX1B 2I65A 4E33A 5EPOA 5HKKA 3FZGA 3B7WA 2W6CX 2LBPA 2PD6A 3G5UA 5LZ7A 3RU2A 1QFJA 3W8FA 3ZKWA 1KHHA 3NHPA 3OBBA 2JZNA 2R84A 1NLUA 4CM3A 3WHKA 2ODPA 3FYCA 3ZWWA 3PHIA 3ITDA 2D0DA 4D2IA 5LBUA 2BGWA 1VI2A 1QIKA 2G09A 1IN4A 1M74A 1RWXA 2CYBA 1WZCA 2LXNA 2NUAA 2Q5QA 1Z2PX 3C16C 4G5OA 3G79A 3M6MD 2GZSA 3FNFA 4Q01A 4RVUA 4RXMA 3LKZA 3DE7X 2A1TS 1NIJA 3DF7A 3TKYA 4DSUA 3A6PC 4TLEA 2UVQA 1XEFA 2XUHA 2V5AA 5NULA 3KTAA 1UFQA 4AMGA 3WRWA 4U5QA 2VQDA 3JD0A 2B5WA 1T6XA 3CZPA 3NLLA 5H3CA 4AG5A 1WAMA 5LMCA 2D13A 1XAIA 2ZJ1A 3G5MA 3BKWA 3WIUA 3KFVA 1ZI6A 4B35A 2K87A 4ZICA 4PCUA 2OGSA 3SYLA 4MA0A 3FLEA 3FTDA 4HZUA 5ELMA 1GQFA 1I2BA 4QXQA 3RU9A 1E4OA 3W9YA 3HEAA 4D97A 4KFUA 2ACVA 4WGGA 1Y8CA 3DXZA 1W44A 2D0PB 2QE6A 3A9RA 2FN3A 1CPYA 3JVUA 3PWTA 4KTTE 5CH3A 5AJXA 3UMSA 2VF8A 1EKXA 3KDSE 5EXEA 2A4MA 4N5MA 3TZCA 2XWQA 3QHPA 4IG9A 4RVSA 1DCKA 1JSLA 2QLTA 1YB6A 5E9QA 1K6XA 2ZE7A 3EQZA 3KR0A 3BE8A 4R31A 4AX8A 3U3MA 3RT9A 4C0BA 2KM1A 1JFTA 2WZBA 3IEXA 4H7KA 4D3ZA 4CTNA 4RTQA 3EPKA 1EUCB 2I34A 3VJKA 1EPUA 2ACEA 3GMTA 4J7AA 4AZ3B 1EB8A 1NVUQ 3U2QA 1RAEA 3O73A 1TEHA 5JAQA 4DKJA 3RYCA 3V80A 4IYRA 4CG3A 4FQ5A 2I91A 1R3UA 5EXSA 4JD5A 3S0JA 4ENPA 3QYJA 4UM5A 5EJ4A 5CDTA 3E9QA 4CEJB 2GERA 1K7EB 3COSA 4M46A 3WA6A 4DN6A 4YRAA 2HV9A 4OI1A 1F0NA 2QAGC 2QD3A 1CRZA 1KETA 3K8OE 1HDEA 3HXTA 4RE6A 1WQ4A 4D5GA 4W5OA 1YMQA 4EAQA 5JAUA 1RFLA 1L5YA 3PNKA 1PBNA 2W98A 4PRYA 5H7XA 4E88A 1VSTA 3PQFA 1EM6A 1LVUA 5G1OA 3P20A 4JY7A 2CXOA 5J1SB 1ZCBA 1N2OA 3AXTA 5L3SA 1U8ZA 3VSEA 1FRZA 2C9OA 3BULA 3T8YA 1X2BA 3DTVA 1BU5A 1BDMA 2OGWA 2WV9A 3VU0A 1YB2A 4UOEA 3UMRA 1EUQA 2PGXA 4RMHA 1WXQA 2AG0A 2H65A 2Y8EA 2JIMA 2QGFA 1G6Q1 4AJLA 1UWLA 3C4QA 3WWZA 5IFLA 3LUBA 2DQYA 1XHLA 1KVTA 4EHHA 2Q6IA 2JGAA 1VL6A 5HZMA 1UM9B 1IWPB 2R1VA 2FFRA 1GRNA 2FPWA 3FB4A 3LT5A 2HSGA 2YDXA 3PT9A 4GT1A 4EJ2A 3D31A 5JSZA 3DVQX 1Q0SA 4NS1A 4RD0A 4YBZA 1EK0A 1KAHA 1O94D 3D7SA 1XYGA 4J0QA 5CT6A 1Z17A 2IYAA 1SFRA 3CINA 4ZOQI 1ECJA 1WUKS 3KJQA 1V8BA 2RC5A 1G2OA 3DDUA 5CGZA 4NYIQ 2TECE 1KQNA 5K0BA 1IXYA 2BC9A 2ZJ6A 4NRDA 5EL0A 5JAOA 4NJEA 4URXR 1YD7A 3DE6X 4QA9A 1YA8A 1GPDG 1NAIA 4QVGA 1XKXA 1QRAA 2PZBA 4EG7A 2CT8A 2VJMA 3L0DA 2OV6A 5FI5A 4DCJA 2X0FA 4FOSA 4CKCB 1D6JA 2R8RA 2FHSA 3BMQA 1GEGA 1I4LD 4E5MA 4QPZA 4Q4JB 3WHLA 5ALDA 4KI7A 4ZV7A 2A5YB 2K2WA 4JR1A 4JP8A 4PLFA 4RORA 3SR4A 4QFDA 4M8SA 4DJTA 1TTTA 3TQFA 4D0GA 3OX1A 1P7YA 3UAZA 2Y0EA 4BNJA 4PO1A 4YQFA 3DWFA 4MDHA 4GNKA 4RSMA 2PIAA 4YH1A 3A2MA 4Q05A 5BYAA 3FFBA 1MRSA 3GRRA 2XT0A 2AMLA 1P6QA 4UD2A 1XZMA 2C2KA 4L0QA 4D7AA 1GN8A 2WI8A 3L2OB 3LWDA 2XZPA 5E7JA 4BFCA 2MR6A 3U4CA 3FMIA 5IUNC 2X2EA 2XQKA 2IEYA 3KL2A 5T7BA 5K8LA 3P2EA 1L5GB 3VTAA 3K8QA 2W4QA 1O3YA 2H6EA 2W2OA 1GFWA 4MV3A 4O4LA 2W8BB 5F73A 5JAPA 4Q47A 2NUPB 3W8NA 1RZVA 2JK1A 4IEEA 4N5NA 1ACLA 4KH1A 4RIIA 5EQTA 2OSVA 2BGJA 2VH5R 4CQMA 1DWQA 2JLRA 4KZPA 4Y1FA 4C4XA 1QTNA 4NYJR 2OHFA 3R3HA 4RYLA 3F6BX 3ADPA 3T0FA 4J76A 1HE4A 2G06A 1L7BA 2HA5A 2WILA 2AZ4A 2XMDA 2Z2KA 3KXIA 3SEAA 4C7KA 4YV7A 2X4DA 1MCZA 1TU0A 2XDQB 4KE6A 1KFBB 1J5XA 1QH1A 1U3VA 3AEZA 1APBA 2VAPA 4N6GA 1NZDA 3KB1A 3FI9A 1OFHA 4JJ7A 5B7QA 4QJBA 4BZPA 3R7LA 2VIIA 2OV1A 5LA6A 3ZWXA 3UWKA 5KYYA 1CS0A 2H08A 2A2ZA 2BBWA 2WFMA 3A1UA 4P82A 3ADDA 2UVDA 1WPXA 3MTEA 1A2OA 2GN2A 2BFFB 2OO5C 2X15A 3KP1A 5CB8A 4XIFA 2FQQA 2GTPA 2E2WA 4LZNA 4DJJA 4BCBA 4JT9A 1GP2A 5JS6A 3W7BA 3I0ZA 4UBLA 1PS0A 1BXGB 4KO8A 4PLCA 4W99A 5IXJA 3ZGLA 3GEIA 4B33A 1CUDA 2OAEA 4DLKA 4TS1A 3ANXA 2OILA 3CIOA 4IOMA 5AK5A 4DZTA 4E5VA 3AOGA 4C7BA 1Z3CA 2WNHA 3KQVA 2Z5FA 3DE0X 1JR3A 4TV9F 3AFNA 2W6MA 1JYSA 1TX4B 1WPQA 2X9QA 3PHBE 3Q5EA 3WI7A 4AM8A 2QX9A 2XTAA 2TMKA 3O8OB 1PZNA 3RREA 4LWQA 4WFJA 4OA5A 4EHBA 2VPIA 2Q3MA 1XB2A 3GEMA 3NVKI 1I4EB 3BTVA 1D6MA 3SXPA 1T6ZA 1ZVKA 4LJYA 1JMYA 4JJKA 1SIOA 4PRKA 2L42A 2R5WA 2Z2XA 3LQKA 1XPRA 3QLTA 2YNMD 2ZVDA 4YRSA 1PR6A 3A6FA 4EW2A 4PCVA 2TYSB 4G1CA 2IHJA 2P9FA 2P3LA 4LYGA 3D6MA 4MR9B 3RS8A 4YASA 3QE9Y 1FNNA 1LI7A 1W2GA 1O96B 3IDOA 5BV2P 1NR1A 3LBYA 3WGGA 1U6KA 4TQ9A 3T7EA 2BWJA 4BB6A 1U2GA 4AQYB 1L7MA 2IQIA 4LN1A 1DARA 5AHXA 2AFVA 3SKVA 4BFLA 5M2QA 4FYPA 4HUQB 4O4IA 4DUZB 2WV7A 1GRRA 2IITA 3G2QA 1FNDA 5B1EA 3FR7A 1QLHA 3I4LA 4H3HB 4DTCA 1YS2X 2RJOA 1UDWA 2OK7A 4MQ6A 3GNQA 4B4OA 1H2HA 4EJMA 3GI1A 3WADA 2WWRA 2HPHA 1UPTA 1SUWA 4Q6BA 4DC1A 3F97A 2QRLA 5KYUA 4E09A 4UVHA 2FWPA 3ZDCA 1UDXA 1AQLA 1UOEA 2XJ9A 1QH0A 5AHRA 2ZUTA 4Q1CA 1P5FA 4Q4AB 2OPBA 2Z8YA 1E7QA 1AQUA 5KYWB 1B6RA 3G5AA 1OH6A 3GQBB 4ETMA 3EH2A 1AHPA 3ER9A 2FLKA 2P9TA 1Y3DE 5LWQA 2PSSA 1G16A 2I76A 4GZ6A 2HZBA 3JPYA 5EWMB 1AQIA 1J97A 2C77A 5CDHA 1R0CA 2XODA 1N6KA 5J4HA 1B2LA 2YVLA 3CLRC 3HLTA 4N7RA 3HWRA 4WW0A 5FNZA 1ZJ4A 3TLAA 1UPBA 1OKKD 1FS5A 1I8TA 1A9PA 3H7IA 3FF1A 5HF8A 1RVDA 2AH5A 2FR8A 4D9HA 4W9MC 1EUDA 1D6NA 1H8EA 3D02A 3HBMA 1QAOA 3C45A 1KNXA 4RZUA 3MJSA 3T4PA 4HVLA 2WTBA 4YQZA 4G2NA 1B3BA 3A28A 3T99A 1C7RA 3N05A 4EMBA 4E08A 3IULA 4WK0B 5TQ2B 2YJ4A 4PSVA 4RKQA 4XCQA 2GEFA 5KHAA 1KFCB 1RHRA 1T3SA 2IHUA 5F1KA 3RASA 4G0VA 4NCAA 1XDSA 5T8KC 1WCWA 5DASA 4U2BA 4K9QA 5UKDA 1W5AA 4RJKA 4ISBA 4EFDA 4OEHA 2H06A 1SOVA 2IP1A 2YV1A 1YTLA 2FP4B 3BWEA 3KXPA 3NS7A 4GI2A 2HHCA 4IHJB 8OHMA 4OI0A 3QU7A 1VCHA 3FA2A 1C1XB 3ZI4A 4RETA 2QTTA 3NB0A 2Q4TA 2ONYA 1OI7A 1T0BA 2QP3A 3ML1A 5JCXA 1NATA 2V58A 2JIZD 4QUAA 3V2HA 3KB8A 2JA2A 3BGDA 3WY9A 3H4IA 2AT1A 4F4DA 3IUMA 2FKAA 3FYUA 1WXWA 4YJ3F 5G0TA 4ZCIA 1SXJE 2A5FA 2RGWA 2BMFA 4GPZA 2P11A 5BSUA 2O7RA 1D2GA 1V48A 2V4UA 1G20B 3JXEA 2P0YA 1HEUA 5J1TB 3GLVA 3PDJA 1NNUA 3QI7A