3T7RA

Crystal structure of apo bvu_3255, a methyltransferase from bacteroides vulgatus atcc 8482
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
248
structure length
248
Chain Sequence
FDVNLICDFFLNTERQGPGSPEVTLKALSFIDNLTNKSLIADLGCGTGGQTMILAQHVPGKITGIDFFPGFIERFNKNAEKLNLQNRVKGIVGSMDDLSFEKDSLDLIWSEGAIYNIGFERGLKEWRNYLKPGGYLAVSESVWFTDQRPAEIHDFWMSAYTEIDTVPNKVAQIQKAGYIPVATFILPENCWIEHYFAPQAKAEEIFRRKHAGSRIVEELITSNHHEAELYSKYKAYYGYAFFICKKGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of BVU_3255, a methyltransferase from human intestine antibiotic resistant pathogen Bacteroides vulgatus
pubmed doi rcsb
source organism Bacteroides vulgatus
molecule tags Transferase
molecule keywords Putative methyltransferase
total genus 84
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3t7rA00
3P2KA 1SUIA 2B78A 1IM8A 3A7EA 3PX2A 2IDKA 3A26A 5HEKA 1JTFA 4P7GA 4E30A 2AR0A 5P8WA 4EKIA 1NBIA 5F2NA 1P1BA 2EFJA 3BKXA 2PX5A 3R24A 4PCLA 4AX8A 1MHTA 3ERCA 4RVHA 5EHIA 2OY0A 4MWZA 4RVFA 5H02A 3P71T 3PFGA 5B1SA 3LHDA 3OU6A 2AN4A 2PT6A 3MQ2A 2IPXA 3DXZA 1R8YA 3HCBA 2BM8A 5DLYA 3KR0A 1NV9A 2WK1A 5EHGA 3EVBA 3TPZA 5DTRA 2ZWAA 1YZHA 1OR8A 2O57A 3LECA 3P8ZA 4YUVA 3DULA 3EPPA 3EEYA 3HP7A 3DMFA 3OFKA 3I5UA 1I9GA 3CKKA 3UZUA 3V8VA 3ER9A 4P7KA 9MHTA 4FP9A 4Z2YA 1N7JA 2B25A 3ELUA 4L7VA 5DSXA 3SR4A 3UA3A 4GQBA 4EQZA 2I9KA 5DX1A 3M70A 5EEHA 3AXSA 2AVDA 3NMUF 3GRZA 3DLCA 3RW9A 3HVHA 4RX1A 4R8RA 3KR9A 5E1MA 5MHTA 3OPNA 1Q0SA 3THRA 4LG1A 5GIOE 4PYLA 4ISCA 2ZW9A 1D2CA 4CKBA 5K0EA 2QY6A 4GEKA 4H0NA 2KW5A 1G8SA 4Y30A 4QQNA 4YMHA 4WXHA 1R18A 1O54A 2EG5A 5K8VA 3TKAA 3GIWA 2PVCA 5K0CA 3HCDA 5FWAA 1B42A 1YZ3A 4QQKA 3LCVB 5HIIA 5LQJA 3PB3A 3EVFA 3FTCA 4FZVA 2PXCA 1KPGA 4PYQA 4DF3A 3HA3A 2GAFA 2PY6A 5LQRA 4DZRA 1KPIA 3R9XB 3TKYA 2WA1A 1JG1A 3X0DA 5K0BA 2GB4A 4BP3A 3BXOA 1XVAA 1MJFA 2P3OA 4YV2A 1DL5A 3SMQA 1G60A 2YX1A 1IY9A 4GC9A 3Q87B 3K6RA 5LQCA 4ER3A 1I4WA 3GRVA 1NW6A 2AOXA 4RTOA 1SQGA 1FPQA 4PYMA 5T64A 7MHTA 1KPHA 2PWYA 3M4XA 4HH4A 3B5IA 3C3YA 5DRYA 1IXKA 2CWWA 2HNKA 5HIMA 2XYVA 4DCGA 4LECA 4XCXA 5FULA 4CXMA 4E2WA 2O07A 4MQ4A 2DPMA 3NVMB 4JXJA 2AOVA 5G02A 3CJRA 5EPEA 4GC5A 4ER7A 3JWIA 5F2OA 4CKCA 5ICCA 2ZBQA 2YTZA 3FUXA 3OZRA 4AZWA 1FJXA 2NYUA 3WSTA 1NW8A 2IH5A 2XBMA 3CJTA 3OZSA 5LQAA 4YV0A 1N2XA 3G2QA 3AXTA 2O0LA 3UJAA 10MHA 1YB2A 3HA5A 1QAMA 3PT9A 3BUSA 3AY0A 4QDJA 1VE3A 4YMGA 3LPMA 1R74A 5GOZA 2ERCA 3MHTA 1F3LA 3UJDA 4PYKA 5D1NA 4FT4A 2ZVJA 3FUVA 2I62A 4BP1A 5F2KA 4GUAA 4AZVA 3C3PA 3F4KA 1P1CA 2AN5A 1JTEA 3CJQA 3GWZA 2ZULA 2ZSUA 2AOUA 2BR5A 3ANXA 2YUIA 3LCUA 3E7PA 4F84A 5C9ZA 4GOOD 2IGTA 1UFKA 4POOA 3R3HA 2I7CA 3L8DA 2NXJA 3MAGA 5EIWA 3TLJA 2G71A 1X1DA 4E70A 3T7TA 3G2MA 5DT2A 5BXYA 2EJUA 3FZGA 4IWNA 2QRVA 1X1BA 5DX8A 3PVCA 5LSAA 4MHTA 3G8AA 4P7FA 3LCCA 3EGIA 2FHPA 3EVZA 1ORIA 5CVVA 4KDCA 4X63A 1INLA 1ORHA 4GF5A 4AUKA 4LWPA 4BLUA 4HC4A 5DXAA 1RI5A 3KQTA 3KQOA 4GOLD 4PGHA 1HNNA 3G5TA 5D1HA 4XUEA 4E2ZA 1JQ3A 2XYQA 4U7TB 3VC1A 2PWPA 1R6AA 5ERGB 1KHHA 3SX0A 2BH2A 1WXXA 3FTEA 3LBFA 2ORED 3BZBA 5E8RA 2ADMA 2QRVB 1XJ5A 5FQOA 3BKWA 3NJRA 3PFHA 3FPHA 4O29A 3BGDA 3JWGA 3HCCA 4R05A 3OE5A 5CM2Z 5HFJA 3C6KA 3GRRA 3I9FA 3P9CA 5CVDA 2FRXA 1G55A 5E1OA 4QTTB 2YXEA 2Z6QA 4NECA 3TM5A 2P3QA 3BWBA 3PTAA 1D2GA 1SUSA 1TW3A 2ZBPA 3QOXA 2P40A 4FR0A 4C08A 4RTLA 4RTQA 3HTXA 4MIKA 5HOQA 3UJCA 1XCJA 2HWKA 3LSTA 3Q7EA 4M36A 5KVAA 8MHTA 3ELDA 2IIPA 4M38A 3SM3A 3UFBA 3SGLA 3AJDA 2G72A 1JG3A 1X1AA 3KR2A 3FYCA 2C7RA 3PLAE 2VS1A 2VP3A 4KIFA 5FHQA 3ER8A 3G89A 4DQ0A 3DMGA 3NWBA 4AZSA 3BWYA 1VP3A 4X41A 5EC8A 3O4FA 3DUWA 3ORHA 4BLWA 3KQSA 1NW7A 2VDVE 1P91A 3GO4A 4PYOA 5FA8A 5LQUA 5EMLA 4OX9Y 4E31A 3FRIA 4FSXA 2JHCA 2NXCA 4GOMD 4AZTA 2V7EA 3NTVA 3DOUA 4CKEA 5BP7A 1Y8CA 4P58A 3P2EA 2JJQA 2CMHA 3KKZA 1TW2A 1V39A 5GWXA 2XVAA 1ZKDA 4HGZA 4KW7A 3LGAA 2CKDA 5EZQA 5GP1A 2CMGA 5E2BA 4E32A 3GNLA 4OBXA 2B2CA 3GJYA 5EVJA 4PCAA 2FK7A 3KPWA 1WS6A 3S68A 5DM2A 3MGGA 4RVGA 1L3IA 5HILA 2NP7A 3EVAA 1WY7A 2ZCJA 3E23A 3P97A 4KDRA 5EEGA 3A27A 3HA7A 3OCJA 2CL5A 3U81A 4QVKA 1RJDA 2FPOA 3A7DA 5CUQA 1BOOA 1NT2A 2EJTA 3M6WA 2HTEA 4EK9A 2OB2A 3BWCA 3BWMA 2YXLA 3G8BA 3B89A 3B3JA 3KQWA 2JG3A 4C04A 2WA2A 1NBHA 2IP2A 3TQSA 5FWDA 5DM0A 3HCFA 4OQEA 2OYRA 3CBGA 3DMHA 3LKDA 3M6VA 3O7WA 3DXXA 4PYNA 3SSMA 2FCAA 3SXJA 1P39A 4HRAA 3OU2A 3DLIA 1DUSA 3CC8A 3QV2A 2QM3A 5M5BA 1YFLA 2UYHA 3NVKI 2OZVA 2AOTA 5LQKA 2P41A 2PBFA 5CVEA 4V0QA 2AOWA 3KR1A 2AZTA 4PYIA 5CVJA 1DCTA 5K0NA 1PJZA 3LKZA 2ZZNA 3VSEA 2AOTB 4OQDA 2H11A 4HTFB 4M7RA 3TR6A 3B3GA 1Z3CA 2R6ZA 3IHTA 1L3BA 2V74B 4IKPA 2IBTA 1VQ1A 2ZIEA 1XCLA 3IYLW 4PIPA 1WG8A 1VBFA 4FSDA 4K6MA 4RTKA 3KQYA 2B9EA 3HCAA 1WZNA 3FRHA 3G2OA 3PS9A 4PINA 5KS2A 3GCZA 3LL7A 4HSGA 1R8XA 1QAOA 2IBSA 1RI2A 3MERA 1M6YA 1UWVA 5FHRA 1QANA 2R3SA 3CVOA 1ZGAA 4LWOA 4PNEA 3EMDA 3FPJA 4RTMA 3E05A 2XVMA 3TOSA 5K03A 2BR3A 5EG5A 1FP1D 5FTWA 5C0OE 5DTMA 3M6UA 2AVNA 1BHJA 2ZTHA 5U4XA 3SVZA 5GINE 5JR3A 1EQAA 2ZBRA 4X60A 3M33A 1RI1A 2JH8A 4R8SA 2PGXA 4RSRA 3R6TA 2OPBA 5KQSA 1KYWA 2YVLA 2HV9A 5K0FA 1NV8A 5KQRA 2C7QA 1L3CA 1ZG3A 3P9IA 3DR5A 1KYZA 2NP6A 2E5WA 3VC2A 4PYJA 3FTFA 5CCBA 3LBYA 5E9WA 3T7SA 5BW5A 1Q0TA 2B3TA 2Y1WA 1ZQ9A 3OE4A 4KIGA 2IFTA 4QDKA 1JR4A 1KP9A 3NDJA 3UA4A 1AV6A 3OZTA 5EMMA 2Z6UA 3UJ7A 4PIMA 2PX8A 1T43A 4E33A 3EVDA 3HEMA 5DWQA 3UJ9A 3KPJA 4P7JA 1NKVA 1VIDA 3IV6A 3FPFA 2NXEA 4CWAA 3KQVA 3NWEA 2HMYB 5IKMA 2XYRA 4ER0A 4YUYA 1ZGJA 1JQEA 3KPUA 2IDJA 3MTEA 1SQFA 2P7HA 1HMYA 1VL5A 2AOUB 2PXXA 4ER5A 5FADA 3CGGA 4HTFA 2C7OA 3P2IA 1RI4A 2GH1A 4KWCA 5DTQA 1YFJA 1M0EA 4U7PB 3KQMA 2K4MA 3KQQA 4C07A 3I64A 4WVLA 3E8SA 5GM1A 4EKGA 2PXAA 3M6XA 2IH2A 1XDUA 5BW4A 1R00A 1YUBA 2BZGA 1EJ0A 1JG2A 3V97A 3P9KA 2ZWVA 3BT7A 2FK8A 3DXYA 3FYDA 3MCZA 4FS8A 4DCMA 2BM9A 2Z6AA 4A6DA 1VP9A 3HM2A 4YUXA 2ONYA 3IEIA 2O06A 1JG4A 2OO3A 5CIYA 1AQIA 2JH9A 3JWHA 4Y2HA 1G8AA 5K09A 2PX2A 4A6EA 4C03A 3EVEA 5IH3A 4BY9E 1O9GA 2DULA 2ZFUA 1SG9A 2BR4A 2I6GA 3FUWA 4KRGA 1O9HA 4FGZA 4QPNA 1JSXA 3KPVA 5CVUA 4F85A 1G6Q1 4HG2A 1WXWA 3O31A 4DA4A 2PX4A 3FPGA 3EMBA 3REOA 3ELYA 5DSTA 2UZ4A 3TMAA 3UJBA 3TFWA 3QOWA 3KQPA 4QPPA 5EMKA 3GDHA 5ICFA 4RTSA 5EGSA 1H1DA 2ESRA 3DP7A 3FUTA 2ONZA 3NDIA 4G56A 4MTLA 1L1EA 3G5LA 4OA5A 1U2ZA 3H2BA 5FCDA 2ZIFA 5C1IA 3UJ8A 1EG2A 5EZSA 2F8LA 5FUBA 2HR1A 3A4TA 3LX6A 2JHAA 3EVCA 5EIFA 4ATNA 3EGVA 5E8JA 2OXTA 3UWPA 2P8JA 4YUZA 5E9JA 4E2XA 3R0QA 4XUCA 5DX0A 1JSZA 2G70A 5FQNA 3LDUA 4F86A 2PV0A 4C06A 4V0RA 2AS0A 2LD4A 3T0IA 2AN3A 1XDSA 2VDWA 4QVGA 3P9NA 1XTPA 1RJEA 4ZTBA 4EVIA 3GRYA 2G1PA 1L9KA 4RV9A 5DRTA 4EMSA 4OA8A 2PSSA 2P1DA 4PWYA 1QZZA 1NE2A 2P3LA 3SSNA 4OBWA 2H1RA 4X61A 5DM1A 2ZZMA 3DTNA 3FPEA 2ZLBA 1FP2A 1YF3A 3KHKA 5T67A 4GOND 3FTDA 4C4AA 2GS9A 4YUWA 1SVUA 4IV8A 2YQZA 5K0LA 1G38A 1EAMA 3EVGA 5K05A 2NNWB 3D2LA 2G8NA 3KPYA 1FBNA 1PRYA 4BLVA 4RTPA 3HCEA 3NW9A 1ZHFA 3EEOA 3LDFA 3DH0A 2GA9A 1JQDA 4XUDA 5DM4A 1SKMA 2JHPA 4ER6A 3BGVA 2IH4A 4X1OA 1BKYA 2PJDA 2A14A 3B3FA 3HVKA 1NW5A 3TRKA 5E9QA 2QYOA 1D2HA 2QE6A 3UJ6A 5E2AA 2OBFA 2N47A 4FT2A 5EKUA 5T6BA 3JWJA 3SSOA 3CCFA 4IV0A 5EKXA 5CCXA 3C6MA 3KU1A 3MTIA 3VYWA 4QTUB 5LQNA 1RI3A 4CTKA 4CTJA 3C0KA 3EGEA 1EIZA 1VLMA 3BGIA 5FA5A 3G88A 1X1CA 3GGDA 3GXOA 5HIJA 3OFJA 3G7UA 3ID6C 4GBED 2GPYA 3RODA 1UIRA 2Y1XA 3K0BA 1AQJA 4C05A 3PX3A 5ICEA 5E1BA 5K01A 5KYGA 4DKJA 1RJGA 1VPTA 1KIAA 3AWIA 4UOEA 2ZIGA 1I1NA 2EX4A 3RIEA 4DM3A 3GRUA 2VZ9A 3T7RA 3LDGA 1KXZA 5HZMA 2UYCA 3G2PA 2ZZKA 4R6WA 3MCTA 4RTRA 5K0JA 3I53A 2Q41A 3HVIA 5CD1A 1TPYA 4DMGA 1EJ6A 2OB1A 5ICGA 1QAQA 5GM2A 4RTJA 1F38A 5EQJB 2PT9A 4PONA 2YR0A 3FUUA 1N7IA 5EOVA 5JUWA 2YXDA 1RJFA 1AF7A 2C7PA 2H00A 1QYRA 3UBTA 4RTNA 1XXLA 5HIKA 2P35A 4PGGA 3HVJA 2O05A 3I58A 2OKCA 4RYLA 4YV1A 2PKWA 3B7PA 2GLUA 5DXJA 2PLWA 3TM4A 3ME5A 3A25A 4RWZA 4HGYA 1KR5A 2VDUE 4KVZA 3GU3A 5K0GA 3HNRA 3MB5A 4E2YA 4B17A 1X19A 1NW3A 5EMJA 2UYQA 4R6XA 5LR6A 1BC5A 5DPMA 2P7IA 4M37A 5GIPE 2NXNA 3ELWA 1XDZA 4RVDA 5E1DA 3THSA 2UYOA 3OU7A 1M6EX 2FYTA
chains in the Genus database with same CATH superfamily
1SK8A 1HFWA 2JATA 2NPIA 2FZEA 4N4AA 3RCBA 3B38A 3CXUA 4BMNA 4CKEB 4FBMA 2V7PA 3C3WA 2D2XA 2D62A 1C3OB 2BFCA 4K3UA 4L3WA 4RVFA 4UBJA 5LZ7A 3ZIDA 4EPRA 5B1SA 4G5OA 4EOGA 4CEIA 2IZ0A 3DDZX 1UKEA 4L8VA 4URFA 4YAGA 1T1RA 3EC2A 1WMEA 4PC1A 5KB3A 3UT5A 1WW8A 2WK1A 1VMIA 3AYXB 3T3MB 4JI0B 1FUKA 4MGKR 4ZANA 4ZYVA 4Q48A 3K9BA 4IIDA 4KV7A 3ROPA 3N2KA 2FEWB 4CN9A 3DP9A 1NDUA 3OFKA 3SHVA 1DRWA 4V0OA 1HOXA 3F47A 1N7JA 3SR4A 3GLQA 5HTOA 4MR7B 3CEMA 5AKEA 4FZ3A 5KQGA 4GW3A 2ZIZA 3JARB 2C83A 1KE1A 1ENPA 4DKXA 1Y6FA 3JR7A 1OKKD 1BZYA 3H5IA 4KQ9A 2J9ZB 4HMQA 1KRWA 2NAFA 3ICWA 1G7SA 2HLDD 1FTQA 3MM4A 4Y2JA 1KO4A 2OLEA 4CM8B 4CV3A 1ATIA 1HSOA 3BD8A 1KVRA 3IEXA 3D8RA 1EJBA 1Y1PA 3LUJA 3BBLA 3AETA 4IDBA 3BILA 4JFRA 4AURA 2ZAOA 3KC2A 1XP5A 4J0IA 4YP1A 4G2TA 4YJ2B 4KXMA 3PB3A 1YA6A 2WYOA 1TD9A 4QOEA 4WADA 2PGAA 2KI5A 1NW4A 3F7MA 4TROA 5BSRA 1IXYA 1YB1A 3GJ3A 4ZXPA 1DO2A 4K8RB 5L3SA 1KQOA 1J00A 1JT9A 3K8YA 3EDCA 3LUKA 4RF3A 5FTMA 4LZJA 3NH9A 2DPGA 2D4HA 1E2DA 1MJNA 3V5NA 5B12A 3Q7IA 3N39C 4MQ6A 1QUFA 3K1AB 5K3FB 1F4PA 4C2AA 4CIWA 3MJFA 4QASA 4UZEA 4Q82A 1O6FA 1A8HA 4MW0A 3PHLA 1IIBA 2EARA 1Z45A 4X8OA 1U2SA 3VSBA 1VB5A 1KQ3A 4LXXA 3F2VA 4RJTA 2R1TA 3TTVA 4ZI2A 1Q7EA 3BREA 4R71A 3TW4A 4D8VA 3FYUB 4UBNA 5E95A 1GTRA 2G1KA 1WZEA 2WIGA 5F77A 4KR3A 3F49S 4BNUA 1ZH8A 4CCYB 2V0NA 3C3KA 2AOVA 2CFTA 1JXOA 2HPHA 2UUPA 3E3NA 4JBIA 1JKFA 4FNGA 4UUOA 4XLTA 5AHOA 4X44A 3FSGD 5K3SA 1IQ0A 5LC1A 5AYVA 1IZ9A 2W37A 3DC2A 2C5AA 1P5JA 1T4BA 2M2IA 3GFRA 4N6GA 3ZZMA 4D9GA 3DHNA 4WZAB 3G2QA 1ZRSA 1ONSA 1N3IA 4B44A 3WK7A 3ZU2A 2JLYA 1S4QA 1UBKS 2IUEA 4KLNA 3LPMA 2W2KB 2ZAGA 3VVBA 3MHTA 3RBVA 2O48X 4PYKA 3GCGA 4LZOA 4FT4A 2NADA 1RXSA 2W9XA 2FX3A 3RWBA 4KQEA 3FW1A 2WTAA 2PGJA 4OHOA 4AZVA 3WLRA 2ZS8A 4FN5A 4N5LA 3UHPA 2JLXA 2ID4A 3J7TA 1TB4A 1ADYA 4JI3B 1NY5A 5DKFA 3RFUA 2ENWA 5JE8A 2BJHA 3E7PA 3OM8A 4JJIA 4FDUA 3REFA 4E21A 4P86A 1DIAA 3ECCA 3PTZA 3PUVA 1T1IA 4IJUA 2JEZA 1N7GA 1M2HA 4CF4A 1LV8A 5LYYA 4M1YA 3DMRA 1T0UA 2EZ9A 4BN5A 1R0CA 5BOSB 5JZVA 3OEED 5I9TA 2W2LD 3I2YX 1L5KA 1C9NA 1CUEA 4KDCA 4FYVA 1LWNA 3R23A 3BXPA 4GF5A 4YB8A 5TMEA 3R9WA 3JVVA 3GJ8A 2ZT6A 3DE3X 1SR8A 5DP1A 1E2LA 2CK3D 3TUJC 5JMOA 3KDPA 3QUTA 2XCTB 2HYDA 3KJNA 1M5UA 2PWPA 3GJQA 5KHOC 1KHHA 2EP8A 2GBPA 2QRJA 4MDEA 4WDQA 3BZWA 2AF4C 1NNI1 4D8YA 1DC3A 3UMSA 1NG9A 1GG2A 2JRCA 4GMKA 3B1VA 4ZO7A 3RRFA 3KG2A 1SBCA 1XJ5A 3GJRA 5EUCA 3ZD7A 2ZDHA 2M6LA 3SKYA 4INAA 4ZEXA 4WZZA 4B2PA 1EHYA 3I09A 4AMZA 3C1AA 1E2MA 3OE5A 1UKAA 3WKDA 1CFZA 1PDWA 2DBRA 2HQOA 3UG6A 2J3MA 3IP3A 3ZBUA 4DG8A 5LUAA 4DIMA 2BCJQ 2P4HX 2Z6QA 1WU7A 1E5VA 1W76A 4LPSA 4B34A 4DLAA 4RTQA 3IV7A 3L01A 4Y9UA 3AF4A 3FXAA 1GDTA 3CN7A 4RU1A 2ZROA 4HNGA 5LKAA 4DCNA 3UFBA 3EBPA 2J32A 2Q45A 2XZTA 4J4HA 3GLUA 4RCZA 4ITVA 2EQ5A 1ISIA 3AOGA 4G8CA 4YR9A 2C7RA 4K6OA 2VP3A 5GY7A 4NYJR 5A03A 5JZOA 5DCUA 3V7YA 1VLLA 2QYSA 3B9BA 4O3MA 3FD8A 4J16C 4ZVNA 3BSYA 3MWGA 3NYQA 4YRSA 1J70A 1ESNA 1G20A 4UD6A 4IM7A 3JQCA 1H2BA 4Y8VA 4BQEA 3PUHA 1E2IA 1B8OA 3OCWA 2R48A 4I8XA 2NACA 1G1MA 5HHTA 3JATB 1HE2A 5G3ZA 2R6R1 2L0XA 3EUFA 3V1MA 4PC7A 4NNJA 1RCTE 2ZI7A 3BA6A 2JIZD 1IHPA 1QV6A 4ZAZA 3WGYA 4CTNA 4PANA 3D0OA 3EE6A 3PJEA 5HDQA 1XB2A 4KW7A 5DNEA 3OPVA 5EY5B 2XADA 1ZNWA 2VKTA 4QEZA 2H1SA 3VU0A 2P27A 2IQ5A 3AR8A 3KOWA 1MPTA 4KMRA 4PCAA 4QJ5A 5KVCA 1VCNA 3A4MA 2P62A 1TVCA 1EFTA 3L6CA 2LP4Y 1YZGA 2OGZA 1MXFA 1NI3A 1R88A 4KN6A 1A69A 3IRVA 4CUJA 1BOOA 2EJTA 2WJWA 2HTEA 2OP0A 4GMXA 4GRAA 5HRAA 5IZ4A 5JXIA 4M7WA 2WINI 1Y5MA 4I55A 4QEDA 2YXLA 1YQWA 2RGEA 1NXOA 3ILXA 1CJKC 2H57A 2W71A 5TRTA 1IK6A 3ZW7A 1G21B 2VDRB 1T3HA 4HK4A 4KU4A 1ZH6A 3SSAA 3TX6A 2IXEA 3Q8LA 2XT6A 5BWOA 1WPRA 4ID9A 3BK7A 3HRIA 1VJ5A 1WV0A 3BB1A 4FK8A 2I78A 4PRKA 1NVUQ 1AD2A 4HOYA 4UTXA 1I7NA 5D7BA 1HM5A 4LTNA 3FROA 3H04A 4IJ5A 5DLDA 3WDKA 1R3UA 1J42A 3ZLUA 5HYVA 3KUKA 2X8WA 3DPUA 4YRQA 3BL5A 1LS6A 2H11A 5BWMA 4EG4A 5GVSA 4H7EA 3VA7A 1DAHA 3VR4H 4AJ4A 4GLLA 4ZU3A 3RFXA 3W5UA 2PLNA 4LC1A 4BGEA 1AG9A 4ZO4A 1VI5A 1AGYA 1X7YA 4C6TA 5C4MA 3HB9A 2C5FA 2I4OA 4TS9A 3RKSA 3IX7A 3NTOA 1NJ8A 1G5TA 2FMUA 2P75A 3LY5A 5CLQA 3I9V6 4REQA 2C3YA 4WCFC 3I32A 4JCCA 3ZJ4A 4A0HA 5C1DA 4OIFA 4YECA 4O4IF 1BD3A 4MWDA 4Q05A 1HXHA 4UUAA 1EQAA 1FDVA 2F3RA 5H5JA 3TTTA 3U9LA 1AUQA 2UXCB 2X9LA 1CJBA 3QLJA 3PWZA 4Q16A 2NV2B 1X42A 2OPBA 2QUBA 2WUWE 3V8PA 2HV9A 4HDMB 4LK3A 2GDJA 4KQMA 2X8AA 4PSUA 3SLRA 3P9IA 5AK0A 4BOYA 5U9CA 2RSLA 4NU8X 3GDWA 4UPVA 3LQKA 2AZDA 4UM7A 4XWAA 3VBEA 4M0KA 2P2SA 5E9WA 1QKJA 5HS4A 1OBFO 2PZBA 1ZCFA 2YV3A 5BW5A 4QWMA 1NWCA 5KU7A 1DTWA 5A6SA 1CZNA 3L02A 1BE8A 3QF4A 2O3UA 3IJ5A 4KTTE 3ESYA 5BNFA 3BQNB 2G7MC 3Q7TA 3UMVA 1TJ3A 2RIPA 3CFYA 4M7PA 3RBAA 2HMYB 1AC5A 4G41A 4CPDA 3A6PC 3KPUA 4M0CA 3E7WA 4JP3A 4E4TA 2CV2A 1UK8A 1SC9A 1FDTA 2ZYAA 3AHGA 5C8XA 4KWCA 4KK4A 3EDYA 2G04A 4AKGA 4M8SA 3TSZA 1IM2A 2FN3A 2K4MA 2VJPA 5GM1A 1AA6A 3EZLA 3VX3A 4TYNA 4LGYA 2C03A 1H8HD 1N9GA 1LNZA 1S2GA 2WF9A 4RF5A 2NUTA 3STUA 3VSDA 3WL4A 2IITA 4G8BA 1GSHA 5CFRA 4BEWA 4IOKA 2K2QB 5LXTF 2QN6A 5CJ2A 3EARA 5BWNA 5IUJC 1JIIA 5CIYA 3QFTA 2F8TA 1ES9A 3OT4A 2NXWA 4IDDA 5LCXA 2H2FA 3ZK9A 4C03A 4G1VA 2DULA 2BI4A 1TIKA 3N7AA 4UASA 8GPBA 5KMGA 1N1GA 4QZVA 2Q29A 4HG2A 5IXSA 2UXDB 1SU7A 3OEHD 4QAJA 3QHPA 5JSZB 1GQFA 1Z8FA 4TL7A 2L82A 2R4TA 3A06A 1K7XB 2FE4A 2J87A 4KGXA 2QY9A 3GGSA 3W6NA 4A0GA 1OZ0A 3DBLB 1E66A 1KY3A 1RABA 4HVAA 4I2VA 5I01A 2OVFA 5LOVB 1IPFA 3BTVA 3D6NB 2ESRA 1ZK3A 3AIOA 3OBBA 3OM1A 4UDYX 5TJ9A 4E5UA 1JWBB 5FCDA 2BFMA 2AG8A 2F8LA 4KO3S 5CW1A 4FMDF 2XLCA 3U26A 1NMXA 3TTYA 3M83A 1QHXA 4MJ7A 1JMKC 1J2TA 3CH6A 4E2XA 4GI3A 5BN4B 4XDZA 2XWJI 3HMKA 4Z6KA 2VP6A 4GP6A 1HF3A 1ZUNB 4HNTA 1N4DA 3ZOKA 1JXMA 2IX3A 1Q1QA 5DI9A 3W9YA 1IM5A 1RP7A 1CULC 1D3AA 3GRYA 1QH9A 4TSRA 3P0RA 4MR7A 4ZT2A 4CIXA 4KKVA 2WU0A 5LU9A 3ZDCA 4RQAA 3BYZA 4RZSA 1OFUX 3RT7A 3G7SA 5E6SA 3WA7A 3VJMA 2IXGA 4ZFNA 3VTKA 3BG5A 1PJRA 1K4KA 2J9XB 5B4TA 1YF3A 1EEXB 1V8PA 1SMKA 4L2IA 3SXUB 2FFBA 5K6RA 4JP1A 2TECE 4ZJZA 4GKKB 1T9DA 3HY6A 3H75A 3PVSA 4UUBA 1U5CA 2IZ6A 2W4IA 1QX3A 2DFPA 3EVGA 1QIJA 4ZCSA 2IY9A 3KPYA 5JNLA 1FBNA 3CO0S 5FTLA 5JDIA 4WESB 1ZHFA 5JROA 2QQFA 1X7XA 5DGXA 4AS1A 4DDWA 2A5LA 2WD8A 4A8JB 1BKYA 1QFXA 4KXVA 4F92B 1PJAA 4Q4AB 2H63A 3L0SA 3WGLA 1OXXK 1M34A 1U0JA 3I9V1 4KCGA 1U7HA 3FYSA 1JBKA 3LNCA 4HUQB 5G0UA 3SSOA 3FPKA 3CH4B 2GCPA 3ZIAD 2HLHA 1J5XA 1BVYF 2PSJA 3GLFE 1I7SB 1JR3E 2SBTA 3OSZA 4OQNA 3VMMA 4GOJA 2GF0A 3FOBA 3OLXA 3OCUA 4LZWA 4NJMB 4MVJP 5G2OA 4EHIA 4UVDA 4E12A 4EUHA 4EUEA 1KSFX 4YMLA 5COAA 4BCCA 3WMFA 2BEUA 4J0DA 1A5TA 4UZFA 1WBJB 2R1VA 2BL4A 1F60A 5JLJA 1JNYA 3AI3A 3F6RA 3PX3A 4C05A 1QOQB 4UKDA 4D8XA 3KAQA 2FUKA 4YRKA 1LI7A 3ESDA 4CMIB 4TYWA 3F97A 1CR2A 2P1ZA 2GAAA 1IATA 2GM5A 1OOEA 4NK4A 3VU3A 1XCMA 4MVJD 4KWHA 3R7DA 2RHLA 4F4HA 1CQWA 5FOQA 5BSFA 4D9BA 2WMNB 2AC4A 5JANA 3L3BA 4PONA 3I30X 3SD7A 5KYNA 2CYCA 1GITA 1Q0RA 3DKRA 1S8AA 3SQLA 4BIIA 3P5BA 1AF7A 3FJ1A 4RMIA 1WXIA 5CP8A 3PNPA 4CR6A 2V0GA 5ED0A 2PRIA 3FCXA 4MKRA 3WQHA 3PHBE 4RFLA 1SHZA 1U5BB 2ID7A 2OFXA 1LVUA 1Y1LA 4JDUA 3MBIA 3KKNA 3TF5A 1VI2A 3AVQA 2IPLA 2XGGA 4FYJA 4BAGA 4C01A 1JR3A 1YMUA 2CLKB 3AW9A 4HGYA 2DTDA 1U5BA 3UJPA 3O8CA 4GDMA 2XQJA 5PNTA 3VDNB 5AHXA 4UBLA 1TK3A 3OLYA 1X19A 5EWMA 2AZ4A 4A8HA 2RAFA 2P9BA 3RC8A 3IT2A 3WRYC 5BVHB 2FAXA 4XD7A 1I51A 2PGDA 1WIWA 3OIYA 3OU7A 1SXHA 2FSUA 1YR3A 3UC9A 2OCAA 5JMWA 1UIMA 1Z6TA 3GZNA 3LVBA 3A26A 3QFCA 3VYTB 4Z4EA 4LOIA 3DFKA 1DLIA 2A1TR 2XECA 3JSXA 1LRLA 4OMDA 4M0UA 4BFUA 2EF0A 1MHTA 4X62B 3P9YA 3L7AA 4BBZA 5H02A 2TYSB 2C9CA 4KN8A 1GKUB 3ENKA 5F21A 4RZIA 3W79A 3KJIA 3O2NA 2A3NA 3JQEA 3KR0A 5F1KA 4NENB 1K5HA 2FPLA 3PEUA 5DTRA 4DYHA 4O4JF 1F8UA 1WE2A 4D97A 3RV3A 5HK9A 2NO5A 1QPZA 4EGQA 3VR2A 5CR9A 3CCBA 1GPWB 2HPAA 1RU3A 1E2BA 2II6A 3DMFA 4XW2A 1JE0A 4P7KA 5LL6P 2AL7A 2C4TA 2QD5A 4IG9A 4C4PA 1JFVA 3A9CA 4GQBA 1BWQA 3AXSA 3GPIA 1O6BA 4Z0HO 1PV4A 4LAFA 4L15A 2G6TA 2E4XA 3PBKA 4MV5A 3KO8A 2HHCA 1D2CA 3NHLA 3LYUA 4KJZA 3GDGA 1E2JA 4RLQA 1DDGA 3R0ZA 1Y0BA 1URPA 2YJ6A 3ON5A 2JLZA 2C3UA 2PUGA 3F73A 4M9RA 1VHTA 3HCDA 4TS4A 4N76A 2ZPUA 5DMHA 1VGVA 1RD4A 3OCZA 3AP3A 2HCTA 2Q6TA 1Y63A 3S1AB 4UBIA 3GL9A 5ALOA 2ZXUA 3CNBA 1ZJZA 2QE7A 2NZYA 2PY6A 4L76A 3ZXYA 1XDWA 2XKKA 4CKZA 4JR0A 3ZD6A 4QYIA 1Z5NA 3TKYA 3WLMA 3PHIA 1C8BA 4QICA 1I7LA 4GDFA 3AUTA 4KUEA 2H4WA 2XGMA 4OJYA 4RZUA 2HMVA 1H1TA 4GC9A 4IIUA 4PFQA 1ZUNA 1V1MB 1A27A 4MW5A 4MICA 1QG0A 2CF6A 2V45A 3R41A 4HQRA 1M1NA 2PLRA 2JLWA 3GVPA 2X9GA 3CNOA 1RXYA 3G8DA 4M0EA 2PKQP 3DNPA 2QLLA 2FPRA 2H1HA 4IFTA 1H0RA 4L4ZA 2FTKE 3PLAE 6ABPA 1OWMA 2PPLA 3TW0A 3CU5A 5FULA 3WYNA 5BN3A 1USVA 2VG8A 3I5MA 1Y3CE 3O8QA 2B2NA 2QGFA 1WF3A 4M88A 3MLAA 3JWIA 4CKCA 4YAWA 3H5VA 2YTZA 6YASA 1SM4A 2FUEA 4MI1A 5L4LA 2D2EA 2XX3A 5BNZA 3NP9A 1N2GA 1PZMA 4PNZA 5LKRA 3AL3A 4PR0A 1A96A 1YC5A 1EVIA 3H05A 3HJCA 3TBKA 4DR4B 4TMZA 3GLTA 1D1SA 2H65A 4QUIA 5MFPA 1SXIA 3Q3CA 1AUOA 1E62A 5ALWA 5IBPA 2O8VA 1JEJA 4GUAA 1KARA 3T7KA 3WIVA 1JRLA 4V2UA 2AN5A 1HLGA 2FEAA 2ZATA 4HJRA 4RK6A 3ZXUB 4ND5A 4WE3A 5AW3A 3CZ4A 1G64A 4GGPA 1Z0IA 4RHXA 4XYMA 1GPMA 1KEPA 1ORDA 2JIOA 3ZGOA 4LNUA 1LK7A 1MAHA 3AKDA 3TIGA 3NAQA 3TQHA 2MT9A 2HWYA 3CO5A 4G4SO 3BSWA 3G9XA 3WADA 1QZXA 2CDRA 1MQSA 1BN6A 1D4FA 3JQ8A 4PVDA 5KQMA 5JAIA 4O4HB 3UKDA 1QLJA 4F5ZA 3A1NA 4TL8A 2ZSIA 4B73A 2IYOA 4E14A 1V4NA 4LDPA 4O5AA 4E5DA 3SYLA 3UXEA 4YYEA 1E3MA 1CD5A 1TJYA 5JADA 4LWPA 5KTRA 2BGGA 4C14A 2UVPA 3ZHYA 1VMAA 3HKEB 1PSWA 3QWAA 2G5GX 4TL9A 1RWWA 5AWFC 4ENWA 2O8CA 5K8TA 4Y2UA 1BFDA 3T35A 2AI1A 5CT4A 1DV1A 3VC1A 5IAGA 3CPHA 4TRMA 1WXXA 1EK2A 4X6XA 4CR7A 1GTL1 1X70A 2PH3A 3KLMX 5E8RA 3AQ4A 1BCRA 1F06A 1P77A 1PWXA 1T29A 3DMTC 3EFOA 3OMXA 3QXHA 4GKBA 4LOAA 3PFHA 3CWCA 1SXJD 1U4OA 4OQQA 2EKPA 5HSGA 4XGKA 1T8RA 3BZUA 1EFVB 1X7WA 4RY8A 3PNKA 2X3UA 4WK2B 5CVDA 5DCWA 3UEOA 2LCIA 4K87A 1FBTA 3ZHXA 2QTCA 1P33A 1HE1C 2VQ3A 1FDUA 1NI4A 4FOTA 2E1PA 4FZRA 3LX4A 2YOFA 1XNGA 3I3OA 4K9KA 3KXKA 5BSGA 1QYXA 4DUZB 2ZYIA 1K3TA 4UNNA 3A4LA 3MJSA 4IYRA 4ZMBA 5HE9A 1K0UA 1E94E 2JFPA 2XE8A 4OXIA 2BMDA 1EP3B 4U7HA 5C31A 4CEIB 4YQEA 4TV9F 4EIWA 2Q1YA 3N0TA 1H8EA 2C7BA 3I9LA 3WYCA 1N2OA 1LB1B 5DI3B 1CEYA 3ZTWA 5FV7A 3KUDA 5T4EA 2Z43A 1IB6A 5TMBA 3W8FA 4OKIA 1IIRA 5C80A 4JLJA 1E5LA 5JQGF 1XHLA 4LQLA 4AW9A 2J5KA 5FOTA 1E64A 3GNQA 3OOEA 5CFPA 2OE2A 3V7NA 1BDIA 1GKYA 2B8NA 3PC8C 2ZJ6A 4MZDA 1KI7A 5C8YB 3R5SA 1ZN7A 3O0TA 5FFFA 3H8SA 5I7SA 4XSVA 1YCGA 4UCWA 3KVOA 3BFJA 4DIUA 5FWNA 3O9MA 5ISMA 1S2OA 1V2GA 2FOXA 3QYFA 5AESA 1VDZA 2C59A 5KWSA 4DR5B 2VPZA 4B80A 5J4VA 2B2CA 3GJYA 2FMXA 5JFOA 2X19A 3AVPA 5AXAA 1QDLB 1Z88A 1Y9EA 1WP4A 3K5HA 1N6PA 3OPYA 3OCJA 4C7BA 2QRNA 1UMDA 2VF8A 1NSYA 1T4CA 1P3JA 1T6NA 4FPXA 2YINC 3EH1A 2B37A 3ZZUA 4Y6QA 3BERA 1C9YA 4LMAA 4BQIA 2B1RA 3C3BA 4P08A 1S9HA 1I7PA 5HFAA 3EIQA 4ADSG 1GPUA 2IXTA 2DERA 2GZRA 1O5TA 2JD1A 2TMKA 4JBWA 2P90A 1KAMA 3R5FA 1XMSA 5EL0A 2IHKA 4LXGA 4MARA 4M83A 2QZ9A 1ZL2A 3CS3A 5I4IA 1DPFA 1O4WA 2I1QA 3HCFA 4NMMA 1GILA 1QRUA 1XZNA 4KXLA 4JI7B 4HLCA 2I91A 5L45A 2COEA 4LISA 2CUTA 4BO4A 3ZCVA 1PJSA 1N7HA 1Z7BA 3G68A 3IP5A 3P4UA 5CEFA 2CNWA 2PTHA 3PQ6A 1S6YA 1Y48E 2Z2XA 4W1PA 4CMEC 1LUAA 4W5TA 1W93A 3DZHA 4MV3A 4PRZA 4PYIA 2CBZA 5EWJA 3ZU6A 2VQEB 3PFWO 3JYNA 2IHBA 3VZSA 3UOWA 5CH3A 1RWQA 1YB7A 2H16A 2YIVX 2OXIA 1E2EA 1HDGO 2I2XB 2YJ4A 3AB8A 4FQ5A 4L9SA 3V4ZA 1R27A 4NI5A 4PX2A 1R8QA 3F96A 3IYLW 4NDAA 1RVDA 5ALYA 1J23A 4DEYA 3FTNA 3KKKA 2REBA 4R9UC 1EESA 4WZBE 3RJ5A 4KKXB 3FB4A 1UZNA 2WZBA 2AIRA 5BMOA 3TLBA 1RKXA 2R3SA 3DZIA 3OOYA 3TSYA 1A50B 2J4DA 4WK6A 1JEYA 4R5MA 1Y4SA 5KSPA 3EODA 3T5PA 5FL7A 4IDPA 1XC7A 1VTKA 4U9HS 3OQOA 4JOCA 2AUTA 1L9XA 1CEXA 3OQ1A 3SVZA 5CH5A 1U3DA 4R1LA 2XBLA 3C3MA 1UMBB 1BGWA 1XCBA 1R12A 2CNWD 1TQ2A 1WB5A 1IHOA 1TUGA 3JS5A 4YLGA 4Y0AA 4YJ2F 1JU3A 1HZZA 2HB6A 4RE6A 2DG2A 1QCCA 3FZEA 1ZSVA 5MDHA 2GX6A 2C4UA 5HFNA 2GWHA 3R3XA 5FOVA 4ARUA 1LDEA 2C3OA 3RJMA 4AN1A 1TAUA 3NEPX 3WGVA 2K2WA 3DGEC 3VC2A 4S1WA 5DH9A 2PD3A 3NHUA 2M9MA 4ZAWA 1XN4A 2Q5JA 4K9SA 4BMSA 3RIMA 1IUNA 2HBRA 4EUFA 1N0VC 5EMMA 4WUTA 1PEDA 2BUBA 2HMWA 4E33A 5HP4A 5DGIA 4G0YA 2VK8A 2AYYA 4CCAA 2XVZA 2YS7A 1NBMD 5AVJA 3OZEA 2CCJA 2YNMD 3AHCA 4JYCA 4ER0A 2EZUA 4KTVE 5EJEA 2YWEA 1MRSA 2IV3A 1L4LA 1HYBA 2AOUB 4EEXA 3FE2A 4OJMX 4XOUA 4UEJA 3D8UA 1DB3A 2BELA 1JJIA 1QIKA 3IIEA 4NZNA 4EHFA 1Z38A 3A05A 5EA2A 3H65A 4MVJM 4RPCA 4HWTA 2ZQZA 4RHFA 4M54A 1NUSA 3I64A 1PQUA 2AEMA 4BLPA 4YY3B 4G0WA 1I4OA 1L1QA 1LJLA 3BQMB 3NAGA 1XNQB 4EGFA 1IY1A 1IAVA 4YP7A 4EJSA 3MGAA 5DCLA 1SK9A 4G1EB 2AFRA 3U3KA 4B7CA 3BJEA 1FFDA 1PTJA 2FWIA 4FYHA 1CZKA 1GWNA 1TRHA 1WXGA 1XZAA 2IZ7A 3KVVA 1Z8HA 3PKZA 4GU5A 4UNPA 5K3AA 4EQ6B 4YUXA 5K5EA 3H1PA 3PG5A 2P5SA 3DAYA 4DC9A 2H0AA 3PXAA 3IQDB 5CA1F 2C98A 5IWCA 1U0NA 4LXIA 2ZFUA 4GPD1 5TGZA 2ZWOA 3ZLTA 3MMXA 4LGVA 3ZI0A 2ZI4A 1EP9A 1BDJA 1XF1A 1WXWA 2QL9A 3C3CA 2GD1O 1JV2B 3M3HA 3R3YA 4H6VA 4N0DA 4QXRA 4Y2VA 1QOPB 2WTEA 2CNLA 4BP9A 1S9DA 3R44A 3GLGA 3PGLA 1ZN8A 4DB2A 1P1RA 3ZDYB 2EW2A 3Q6IA 1JA9A 1WXEA 2QTBA 5E4FA 1RLTA 2WICA 5EQFA 1WDLA 2GZDA 3FUTA 5LP6C 2Q7DA 1U2ZA 2R00A 1TKCA 3L05A 1CR1A 2GAJA 1QP7A 4RZHA 3ZWBA 3MUNA 1Z5UA 2FEXA 1W88B 4WFKA 3UWPA 2Q8QA 1GCOA 1DIBA 1HC7A 3LDUA 3WGIA 4AWXA 1TCVA 2P4QA 5BVHA 4WECA 3KBBA 3AGPA 3ETEA 3COWA 2PO5A 1VG9B 3HR4A 5ITZA 1JFSA 2VT7A 4L0MA 2OT3B 4C20A 1M74A 2I3ZA 2P4UA 5DRTA 5SY4A 1SA0B 3NHFA 5LZ9A 1PL8A 4E03A 3KTDA 4HZIA 4LBVA 5FNVA 1AMOA 4XPIB 4TKZA 3NM5A 4CL0A 4E22A 2QM7A 3ABZA 3DFIA 3H3FA 3N74A 4DJDC 3QFFA 3G9QA 1ZS9A 3FTDA 2WJ3A 2D5LA 2HUNA 3BMCA 3GLKA 3VPCA 2XHEA 2G9RA 3AUKA 4HP8A 4X1YA 5JAZA 3ZDZB 4BLVA 4RTPA 2XMBA 4NMXB 2F1OA 5DM4A 1NXSA 2NU8A 4HGQA 3CPSA 5JG7A 1ZRNA 2VC2B 3RVKA 2YXPX 3B70A 4CKWB 3KFXA 5LDDC 5CXUA 3RIGA 4EFNA 1QG6A 3GP8A 1WDWB 4TXMA 1Y3IA 3D8BA 4TX1A 4WZBA 1K6IA 2YHUA 2GD0A 1I2ZA 1HKUA 4UNQA 3ZR4B 4CYMA 1UAAA 4ACBA 3OF5A 4NZPA 5DTJA 3VI3B 3W9UA 2WRZA 4WJKB 3ZTYA 1ONOA 3BXXA 5SV2A 2Z8YM 5INTA 2XNHA 3SBXA 2QLTA 3CNNA 4PTLA 2VH1A 2IVFA 1SRRA 2V7UA 3DT9A 3FGPA 5IAOA 1OU0A 5HIJA 2QTMA 4N5MA 2QLFA 3LYHA 3IBSA 1XHEA 2YFKA 1K2WA 4NE2A 4WERA 4IDHA 1CKEA 1E3WA 3KM0A 1IBMB 1WZ2A 3L8MA 1Z0UA 3BJIC 3HKCB 4YAJA 2G9QA 5ES3A 3TUZC 3HJAA 5I3CA 8AT1A 5K0ZA 5IBQA 1QU3A 5KTKA 5EXXA 2CUNA 1IBCA 3L6UA 5GONB 2A4KA 4BS9A 5HGXA 1JAZA 3LDGA 4GM1A 4DN6A 3NDRA 3IE0A 3U6KA 1DBQA 1DC5A 1TMGE 1NJ1A 3AY7A 4PS1A 2PMEA 5K0JA 2CLIB 3NYRA 3UXMA 1VL1A 3ZIUA 1E63A 1OROA 1IVNA 4A4DA 2Q5CA 5I7AA 5TXGA 4OHYA 3LA6A 5LWQA 3MC1A 3NT2A 4JEUA 2K87A 4O2BB 3M1AA 3O9VA 1P5HA 3QJ5A 4DVJA 1HWYA 1M2OB 4XGNA 3L7KA 2IYYA 4KI0A 1PFUA 1QG2A 2OBBA 4N6NA 4YDHB 3M81A 3T7CA 3PEFA 4RKRA 1LLQA 1ND5A 2FSVA 2O05A 2IQIA 3C6ZA 4I1UA 4MYCA 5AKHA 4KOEC 3W9BA 1UEXC 2B4RO 2UZ1B 4XAQA 4V3CA 3BIWA 4CG1A 2WWIA 3EZGA 3QBJA 4G0ZA 2E1RA 3KVRA 4RQUA 1L2TA 2FPGA 4B8WA 4NICA 3GGJA 4HB3A 2YNMC 3H6KA 3WL5A 1DFIA 3WMEA 8ATCA 1FP7A 2GFIA 4OHRA 4PGMA 3R4VA 2JKVA 1KH3A 3T7EA 1FRZA 1GZVA 2PH5A 4EPXA 2QT9A 1BRMA 3ROQA 3ONNA 4E11A 5GPBA 1L5OA 3LM8A 1E6EA 3DW1X 3OFNA 1TZCA 1I2MA 3E58A 3M4NA 1RIIA 1OH7A 2AHRA 2FSHA 3I9MA 4LFCB 3VDQA 4C1NA 4QM7A 1XO1A 3ESCA 3OFSA 2NSLA 2PDAA 2AQKA 1IPHA 3R24A 4YROA 3A6HA 5EHIA 5BUCA 1XTZA 1BD4A 1TE2A 2C5GA 5KOHA 3PL5A 1PK8A 2XUZA 2CV0A 3P4YA 3CCCA 1NV9A 5KJ1A 3EVBA 3E9DA 2QTAA 1IXRC 2ZIUB 1Q2UA 1T6YA 4GMHA 3X44A 4B79A 5ALXA 4GXTA 5FKJA 2YY6A 1I1QB 4K2AA 4WBSA 3X1YA 5BMVA 3QBDA 2ORYA 1RAFA 5B58T 3PLNA 1I9GA 4XFKA 1KAEA 1GQYA 2MMCA 1J5EB 3NBKA 2FOLA 3UA3A 1XEWX 3JAKA 3WWYA 2RK6A 3GHYA 3M70A 5FRDA 1G7TA 2ZE8A 3AKYA 1MAWA 2YCLA 3C43A 1KI6B 5F4BA 1E99A 3KR9A 2J0UA 2O2CA 4DC0A 4EF5A 9LDBA 1Q1NA 1KY4A 2RHOA 4LHVA 3E81A 2F7SA 1U9IA 2R4QA 3TD6A 1Y81A 1G8SA 2WIJA 3N1UA 2A0XA 3PUKA 4K9LA 4ARZA 4EH1A 1U0EA 3EIXA 2Q1XA 3I04M 4PLTA 4YMHA 4MV6A 1UDXA 2IVZA 3L5KA 4AUEA 1SXGA 4D81A 4ZMRA 5E38A 4ECAA 3BJRA 4S1PA 2ZVQX 5FD8A 5J23A 5AVQA 3KOMA 2IDZA 4BNKA 3B8HA 3EVFA 5HBRA 1KPGA 3F3MA 2PCJA 5T4HA 1IN6A 2XXAA 4TXNA 1BWRA 1U98A 3G3EA 4MHSA 4RD3A 4XE5A 1G16A 3RBZA 5LQRA 3E48A 1N36B 3NWOA 4LYEA 1WW2A 2F62A 3D4NA 2AEEA 3HGTA 3X1JA 4WWHA 3K7EA 3TE7A 5C37A 1KDPA 4E08A 2FG7C 1ISHA 2CEAA 2IU3A 3RABA 4YV2A 5LPNA 3HFRA 1SHTX 3RTEA 1KJQA 4W5NA 2JGNA 3RBXA 1PG5A 1EFUA 1NVMB 2VSXA 3N8NA 3PQEA 4RPKA 3H1FA 3EPKA 3AINA 3GROA 5I4CA 3OD5A 4FEYA 2XGJA 5T64A 1B0ZA 2O3RA 1GM5A 1UPUA 2PWYA 1HE8B 4HH4A 4U2KA 2ZCUA 5AKYA 3B5IA 2ZBEA 5DBFA 1SOWA 1DJLA 1JHYA 3CV3A 3K0AA 5DI3A 3SE0A 1P0QA 3VM6A 1K7SN 5LXTB 3ZJVA 2C2YA 2C2ZA 2X1VA 3ICQB 1U80A 4XSHA 1A8SA 2VF4X 3GUVA 4KIWA 3TAUA 4B5LA 4D02A 5A4FS 2JFNA 1WXHA 2EKZA 3G1TA 4KGDA 4J2HA 4KLAA 5D00A 5F2OA 3VU8A 1U2EA 2VA9A 3ILHA 2ZVDA 5BUZA 3CJTA 2H4YA 1T6BY 5LQAA 4FDTA 4QAQA 4XKJA 4P38A 4J1TC 2VT6A 1B1AA 3BUSA 1CY2A 4P84A 3AF5A 3TOCA 1G5FA 1LFDB 2W6PA 2ZAIA 4E7PA 1E3TA 4G0UA 2Z1DA 1UDRA 1XTVA 2GM9A 3DLPX 4L73A 1YZFA 5FWXB 3HL4A 4AMGA 1R37A 1B23P 1OZGA 4PZEA 4Q01A 4K8OA 4BEJA 4QTYA 1MMFB 1MDBA 2ECFA 1QHEA 3E2IA 3P9RA 4M87A 3HBNA 5C5EA 4CM3A 4GECA 2EDCA 2H92A 3GD7A 3O8LA 5KMGB 2A9OA 3RTBA 1YUNA 3MWEA 1ZJ4A 4LDRA 1YHNA 1TT7A 4F12A 3R3UA 4I6EA 3TMKA 1PS0A 2CFRA 4ZCLA 2HRBA 5DZSA 1VHLA 3WLOA 4IX1A 1IHXA 3I0ZA 4ZXFA 3BWEA 5BSUA 4INPA 2GKGA 4Q3CA 1HK7A 2HNBA 5AJYA 4IWNA 2AJ8A 3MBOA 4DJTA 1NLUA 1PSDA 1ORIA 1EX9A 4B3HA 1JBEA 5JD3A 4NMLA 2E48A 4GOLD 3DEAA 4E2ZA 5LP1A 4XUEA 5ESWA 3NV9A 4JBLA 1LY1A 3BHNA 1N6RA 4NLLA 3SX0A 4LYDA 3LBFA 4HNUA 1CZUA 2Y77A 2C7VA 3FUCA 2B94A 5A06A 2QRVB 2YMPA 2UZIR 1RQGA 4HX2A 3SK0A 1EDDA 1J09A 1MGPA 1TA4A 1ZOLA 4KMSA 5CM2Z 4YALA 1BHSA 1ZM9A 2VP5A 2BT4A 2C78A 2PNFA 2WDZA 1E7QA 5L3VA 1T3GA 4K9OA 3X1XA 2FZKA 1WMFA 4UU7A 1BHO1 3C4VA 3PTAA 1T34A 1SUSA 4JUCA 4Q03A 2X7HA 3MRXA 4QFBA 4Y9DA 4CR8A 1XG5A 3ELDA 4RJ2A 3NEYA 3G02A 4JKYA 1UXOA 2F43A 2OWEA 2Z09A 3F7TA 2K7FA 3NKLA 1O57A 1XXHE 4W1SA 2WVJA 1BXRA 2HA4A 3OZVA 5G1OA 1UC5B 1ODKA 3HDGA 3QVXA 3LBHA 2H7XA 2VDLB 3K8ZA 3L5OA 2CXXA 3QNWA 5ECDA 1D1TA 3F98A 5IAJA 3WIBA 3KETA 2PUDA 2NU6B 5K3OA 2Y27A 3R3VA 4M1ZA 2GVDC 2DQZA 4O6VA 5IJ0A 4MLZA 1W2WB 3TZHA 3V4LA 3LUAA 3GLSA 3ND8A 5HBGA 3GO4A 1OIWA 3K53A 5ICMA 2GI4A 1DSSG 4C0WA 4W5RA 4Q93A 2YJNA 2D3TA 3OPYB 4Q4AA 1FW8A 1S01A 2WWFA 2ZTLA 3NTVA 5DHPA 3KCNA 4CF7A 4HGNA 4BLSA 5D51S 1X92A 1G98A 2YH2A 3DL7A 4DCCA 3QX9A 3VKFA 5GWXA 4OU4A 5A9SA 5C7OO 5I9BA 3H8VA 4M53A 3H11A 3P5SA 1QE0A 2PQ0A 1WSDA 2N1BA 4X84A 1Q2XA 4MI3A 3CRVA 1WCWA 3HYTA 1G19A 4WINA 4WBXC 2OHHA 4B3CA 5DM2A 3WL7A 1J0CA 1R0KA 3EGWA 4EYEA 5AVZA 3NKVA 1WRBA 3DZGA 4JN6B 4RM2A 4WCFA 3IEUA 4GR9A 3VO1A 2DFKB 2OVBA 1EFPA 3ND6A 3A11A 3PFNA 4W5WA 4XEHA 4BO2A 2G80A 1QU2A 4K5QA 1ADCA 1O2DA 1K6XA 3SJBA 2C77A 3DDUA 2BCEA 3KXIA 1JAIA 4D0NA 5HQ3A 2W6MA 2BHRA 4TM7A 5BSHA 8LDHA 2JJ2D 1FMLA 1WLYA 2PA3A 2QQ5A 4OGGA 4R40A 6NULA 2V9CA 2C31A 1V96A 4LVUA 3VR3D 1LDNA 4L51A 3AR5A 4CRWB 3LV8A 1MIOA 4FFMA 4XIYA 2YYYA 2WTUA 2V7TA 5EYPA 2VQFB 5J5AA 5JY1A 1WD7A 2X5XA 4MJXA 5DM0A 3FDIA 4D8UA 1SCAA 3K70C 1CJSA 4L7QA 5F5NA 4DQDA 1ILEA 2W48A 3HM9A 4DQUA 4F93B 4J16A 1XD8A 4H6WA 4A1OA 3PUXA 3PSHA 1JDBB 3B1ZA 2QOEA 1DKMA 1GLVA 1SC3A 3L2OB 1W87A 2P41A 4E5VA 3FBTA 1EP2B 1MX1A 3PIIA 5CVJA 5CLFA 3K1TA 4MWSA 4Z7JA 2H2HA 4QJIA 1JYSA 3VSEA 2OORA 1ZBDA 3FRJA 5DYGA 1TYCA 1ZO8A 5FA6A 5CDFA 3VNQA 3N2YA 4RDIA 5KAMA 4D9EA 2DPYA 3BTOA 3TIFA 3IHTA 4B1FA 4JI4B 3PDWA 2B1JA 4WUVA 4P5DA 1XCLA 2R7MA 4Q7QA 3N0RA 1V6AA 1WOYA 3L06A 4Q4LA 4S12A 4DV5B 1SEVA 2PYIA 1SCNE 3AIMA 3LC2O 2FW9A 4QHSA 4FOPA 2W7TA 1IHUA 3L6RA 5BY2A 3UWOA 1F9AA 2WPNA 1NC3A 1U04A 3O0DA 5FHRA 4NBLA 4QLAA 2IOFK 5TQ2A 4BB0A 1FP6A 2DY0A 3EMDA 3I61A 1T0BA 2H52A 2BPOA 4KWIA 5GONF 4R2KA 4HVLA 5JZ9A 4JBGA 4XLLA 4OG2A 1MFPA 2Q50A 3GGCA 1YZTA 1A8IA 2OM6A 1HG0A 2VLIA 3BWVA 1F1JA 5HM8A 1SOVA 5DM70 1RI1A 2FQWA 4YNBA 4BQPA 4KNYA 1FE8A 3R6TA 3JPYA 2RH5A 2BN4A 5KQSA 4JLKA 2UUOA 3IOBA 3VVCA 1HFJA 4FLFA 1C2YA 2RCNA 2MR6A 3JYLA 1M73E 3MMPA 4RKQA 5CT6A 4ZHQB 1ZHOA 1IUOA 1IFXA 4GEGA 2Q8NA 2B5VA 4TN5A 2IW3A 4DZTA 1FW6A 1FMTA 3DMYA 4JA0A 4A2WA 1P2UA 2E5WA 3L7DA 2PFSA 4XVRA 4AJJA 4URVR 1IN5A 3M49A 4ZQFA 4EX6A 1NBOA 4E1AA 3DDHA 2C57A 2NO9A 2AJBA 1UAGA 1Z3IX 4ALNA 4AMBA 3EVDA 1PD1A 4LE0A 4NNOA 1UJBA 2BFDA 2AW5A 4QUHA 4F6RB 5BQXA 3EF1A 1XD2B 1O87A 4LGCA 4Q7JB 4YAFA 4EARA 4QDXA 2Z83A 5L3QA 3FWYA 1ZAKA 4PIVA 3HEBA 4CTOA 1H4QA 2EQAA 1RRFA 3GJZA 3B7WA 3N2EA 2WNIA 3NVDA 1GCUA 1HA3A 4HNSA 3JQBC 4BVHA 3TQOA 3LRTA 3K09A 2QEQA 4OJQA 5J58A 2C7OA 1ZCJA 2W8BA 2X13A 3CRRA 3E7FA 3OOJA 2O3TA 3BHJA 4QQFA 1NVWQ 3CNHA 4HB2A 1U99A 4NYJQ 1F1BA 4QPZA 3KQMA 4DA8A 3KQQA 4D74A 2OHGA 5FF9A 4TKVA 4BO3A 2LDBA 1W581 1PQWA 2G25A 3DVLA 4RDHA 4R83A 3SEFA 2FLVA 2ZBFA 1QTIA 2CUZA 2D13A 2UZ3A 1Q0QA 2JGDA 4NBWA 2R25B 4ZOAA 4ZVPA 2ZYSA 4WPGA 2LCQA 1XL1A 2W0MA 4FEGA 4MWBA 4CFYA 4PSVA 4TV8B 4UTZA 3BCUA 2ZPAA 1XZQA 2O4CA 3AHHA 2EFYA 2X7XA 3FGNA 2QK4A 4M86A 1FVXA 4KN5A 4MGZR 4TTQA 1P0MA 3T6KA 2J9FA 1XQXA 1P72A 4OYLA 2CXTA 4F1JA 1XL0A 1XLTC 2VHUA 3NBFA 4B7AA 4R0MA 3TLZA 4MDYA 3OUUA 4BYMA 2DHEA 3E0XA 3IIMA 2Q2OA 2H0QA 4U4AA 3IKLA 3L1UA 2F1JA 3MAJA 3DV0B 3BJZA 1NQXA 4HDQB 5I7HA 2NU6A 4DTCA 3TEFA 3TEMA 4CG0A 5K8UA 1VBKA 3CIOA 3LZCA 3I9NA 4R8LA 1UMKA 1E0KA 4PLGA 2VZLA 3K9NA 4N3CA 2HHLA 3L0YA 2W70A 1KP3A 3S27A 3C4QA 3VR5D 3W5SA 4EECA 4NOLA 3N2IA 2ZJOA 1Y1KE 3G8CA 1ZWKA 3IKTA 3EB9A 4O4IA 1RXWA 3Q9NA 1LD3A 1NUAA 4YP9A 1N6LA 4S35A 3WMXA 4MRAA 4ROTA 1G21A 3VPDA 1LWOA 2P8JA 4ZI7F 2WJAA 3R0QA 1N6OA 3ETLA 3ZWNA 4F86A 4JKIA 3I5XA 1EQUA 1SVOA 4J9UE 2AN1A 1XAIA 4F4DA 1P2DA 4KFCA 4GVXA 3UAYA 1D09A 3B5EA 4IUDS 4HX5A 3WGMA 3ADOA 1J4AA 2XOXA 2PKQO 3P9NA 4BJ1A 5IMBA 2NZJA 1FDWA 3B9QA 3B52X 2QYHA 3GJXC 3RS2A 1CF9A 3AR3A 2L2QA 5FUWA 4WZBB 4L5CA 3GB9A 4QA9A 5DGCA 5AVXA 4OHCA 3FETA 5AW4A 5DJ5A 3AU9A 5CVCA 5LQMA 1VKOA 2GT1A 3H3JA 4XWGA 1F9EA 1PUXA 3GLVA 3H4MA 4LXUA 3WK6A 1DX6A 1W36D 4DSAA 2EYQA 4DMUB 4MHOA 1PQYA 1GU0A 1QQ6A 2R751 2NWQA 1CUWA 1U2QA 5EIOA 7ABPA 4WEQA 4LRSB 2A1TS 1YV9A 5J4HA 1P6UA 2XNSA 4PTYA 5IP5A 1RM4A 3L7YA 3M4ZA 2HM7A 2CNDA 1EDZA 4BKQA 2A92A 3H1EA 4ZYTA 1DXOA 2QI9F 1G20B 1EDBA 2DH6A 3KU1A 4X93A 4F3KA 4LXYA 2AMYA 3EG9B 3IAEA 3KZKA 3PNBA 4CLEA 3E7XA 1YMQA 4OY3A 3N59A 1WDKA 3ID6C 1H1LB 1YZKA 1Q3KA 4WZ6A 1X1EA 1ZOOA 3EG9A 3QU4A 4ZVKA 3HLYA 5ALTA 4BN0A 2Y1XA 1SXJC 3CB4A 3OCCA 1BQ4A 4K88A 4KRFA 1MORA 3A4NA 3C98A 6LDHA 4YRFA 5K3EA 2C3PA 2NSHA 2QAGA 1COZA 4D4MA 2XBUA 2ON6A 3D0KA 4DCTA 2EX4A 3L7NA 4TVSA 1Z82A 3HY4A 4B33A 4ARIA 4JYZA 1B1CA 3K2IA 1QMGA 1KVQA 1K8RA 4I50A 4RTRA 4HY3A 3V4RA 1Q1BA 2ZWIA 1M10A 4EVSA 1N6IA 5GM2A 4AO8A 1I2CA 5BRJA 1QRAA 1OUMA 1Z0DA 1RQLA 3UWDA 4Q00A 5AW2A 3I52A 4W5JA 1W85A 2PKXA 4I1IA 1U90A 3LCMA 4ALLA 5C8VA 4OATA 2JAPA 2FSVC 1VZ3A 1A9QA 4ZEVA 2B0JA 3QI7A 5BPHA 3AVYA 3QWFA 3KHUA 1PKXA 5HQTA 1D0IA 2Z95A 5AM0A 2PLWA 3RR2A 1FFXA 3FCAA 3W7VA 4F2WA 3I62A 3C5HA 4HUQA 5HF6A 4BFXA 4K6FA 4KVZA 3T12A 3Q3GE 1LX6A 3UTCA 3H16A 1R5OA 4MKHA 4BNVA 4WLFA 1CY0A 3AFHA 1OBVA 3R0IA 4YASA 5I9IA 1W5BA 1L5YA 2B21A 2HSEA 4EVRA 2NXNA 1U28C 3ELWA 3QUAA 2ACEA 4LY3A 5E1DA 1KDRA 1CQZA 3T3DA 5IDQA 3HRKA 4FFBB 4TLDA 2MWMA 2QMHA 5LMCA 1P4SA 1V11B 4KQJA 1E1YA 4RLFA 2QR5A 2EFJA 3EDMA 2H2AA 3DB2A 1MV8A 5T8KA 2C8JA 1WXDA 2VJMB 5LA6A 1T13A 4IIVA 5LDGA 2GD2A 1EG7A 4IVNA 4HYQA 4CLDA 3K8QA 3HCBA 4RGYA 4R3NA 3C3AA 4Q6WA 3KHSA 4X1IB 4ETNA 4KHPB 1Y7LA 1ONPA 4TVKA 4HB4A 2GOYA 1XV5A 1RRKA 1JHRA 1RWVA 5BR7A 3AJ9A 3W2TA 1JJVA 1FDRA 1N0HA 3B3AA 2E89A 5KVQA 4BWYA 1VIVA 1SB9A 4LHYA 4ZV4A 2IC5A 3ER9A 2PVSA 1QH1A 2Q07A 1AGNA 3B5JA 3D3EA 3P0IA 4L7VA 4OO3A 4UEKA 4C3VA 1UZLA 2O2HA 4H59A 4J91A 2AVDA 4DUPA 2ZSEA 5AW7A 1C7ZA 4TTIA 1LBIA 2AR7A 5BSTA 1R64A 2H06A 4TMXA 6ADHA 5AXDA 2GBIA 4NH4A 3COPA 3JASA 2ENUA 2KW5A 3B1KA 3LY7A 3PR1A 4L8GA 5CA0F 1KMNA 3A2MA 3QKSA 1CDZA 4JBNA 2J3EA 5THXA 2DPHA 3A6LA 5K0CA 2WIBA 1T9AA 1YZ3A 2Y92A 4Y1FA 2D1QA 1QCZA 1QJCA 1T9ZA 1W5FA 1HDCA 3GT4A 4FZVA 1AKQA 3FDZA 5LZ2A 1A7JA 3NOQA 3FZQA 1SUEA 3CEAA 3T1NA 1ODFA 2Q4RA 1C41A 2BMVA 4GYJA 2JLCA 3X0DA 2C4VA 1E7WA 2WC1A 2GB4A 2HRQA 4IH4A 3Q5GA 4FWIB 4ZA2A 4N3NA 3VR6H 1JFLA 1XVAA 3ZH9B 3LQYA 5KUTA 2XITA 1KJNA 4A0RA 5CG1A 3ZCQA 1KJ8A 3K6RA 2RAUA 4AP6A 2XSZA 2M6RA 2BBWA 4UMDA 4B3TB 1MB9A 1OCEA 1AS3A 3HDYA 3P2JA 5A2QA 2IV2X 4JA2A 2CXNA 5A4IS 3TLKA 5IYZB 1SC4A 3M4XA 4W99A 3O3NB 3NEAA 2WUDA 3C3YA 3R76A 1IQRA 1Z4LA 4F8EA 5EJMA 2AA3A 2ZJBA 2CFSA 4MRRA 3E7DA 3NHKA 5KYUB 3BE4A 1GCIA 5EJ5A 4RK4A 2C20A 3OKAA 4AICA 5EPEA 4QE3A 1YJ5A 3CVYA 5G0SA 1EGHA 1ZISA 3RUDA 3AJRA 4TMVA 2GXQA 5AUQA 1O8BA 4DSOA 1CT9A 4M0MA 4NCBA 4PLCA 1O96B 1W46A 3EIEA 3O93A 5JPCA 1PNVA 3CR8A 4RFSA 3L6EA 3ZGYA 5I7FA 4LF7B 5CBPA 1MHPA 2DWPA 5KYTA 2GPSA 3PXCX 3AY0A 1SZPA 3IVRA 3KTFA 3VNSA 2ZK7A 2RHTA 2YOHA 5CYFA 5C46F 4Q66C 1V9CA 3C3PA 1P1CA 3CJQA 3BB3A 1O89A 3KOXA 3S1AA 2P9JA 5CLHA 1PT7A 5ARBA 1N4AA 4KZKA 4R16A 4KPYA 2HEIA 3STXA 5EJ6A 2XGSA 4GOOD 3D6FA 5MN5A 1C7EA 2QP9X 3UAVA 1USUA 1NXQA 1PFGA 1US8B 3MTDA 5EIWA 1WJGA 4ZCQA 2AKEA 1YDFA 4QGAA 4CKYA 3G2MA 3OLWA 2D6FA 3WWEA 2ZUFA 2RMKA 3ICPA 3W5IA 2QXUA 1ZD3A 4XD7D 1Z37A 1PCXA 2PXHA 4RELA 4NNPA 1GAQA 1ML4A 3PVCA 4IVRA 3ZCSA 3CZ9A 4OM8A 4D4KA 4M60A 3LCCA 5EJAA 3IV9A 4NR0A 3UKOA 4F9GA 1R6BX 4G4JA 4HN9A 2VHZA 1B0UA 2IYPA 3RPEA 1QBGA 2B5WA 4FDLA 1C9EA 1ZR2A 1M2JA 3ZDRA 1JQ3A 3OSUA 3FF1A 3Q0IA 4YN3A 4EGJA 3QVSA 3NTQA 5G0VA 2RHBA 2BFOA 3T9FA 1L7MA 3VDXA 1BDMA 2QPLA 2WG2A 1MB4A 3QQPA 3ITDA 3TLCA 3VR6A 4LHXA 4RH1A 4JJ6A 2NZWA 5J63A 1ZNZA 1E3SA 3LQQA 2I55A 5L9AA 1SA0A 3K9QO 3OT1B 5JHGB 1L7NA 2DLCX 4FW8A 2VJDA 5KNDH 1JILA 1NURA 1Q84A 4UDXX 4YV7A 4WL0A 4L4YA 4TWZA 1DUVG 2DC1A 2FRXA 3G2NA 4IG4A 1KDVA 5K1ZA 1PL6A 4JI5B 2Q3HA 3LWZA 4G3XA 5DF1A 5E0KB 3PQ2A 5DWDA 2ZBPA 4BNWA 4DUYB 1DFHA 1AU9A 3HXLA 1B3RA 4MIKA 3WJ7A 1TCCA 4UUQA 1GTMA 2OCDA 4DJAA 1PJLA 2D06A 5JALA 4ZOBA 4A1FA 4Y2QA 1QGUA 1RM0A 2CJWB 2GBLC 1QV9A 2IODA 4I1SA 1UBSB 3CUKA 3DSRA 4KLCA 1QJ4A 4FHCA 4AZ3B 4DQLA 4GL2A 3FYHA 4QYTA 4REOA 1NW9B 1GR1A 3G89A 5FLYA 3HADA 4HWPA 1BX0A 2FB9A 2RKOA 5EKDA 1NP3A 4P3YA 1MOSA 1VP3A 3EJ6A 3JQPA 5AI9A 3U7IA 1UADA 2VO1A 3H4VA 4M8LA 1TEXA 3WZLA 4LMPA 3EBOA 1DC8A 2IXFA 2X0KA 2V55B 3QXJA 3WOVA 4AJOA 4Q7KA 1NZJA 2UVPB 1BHQ1 4YPOA 1EA7A 3CLKA 1D2AA 1RIFA 4ZHSA 1AE1A 2JLUA 2MYPA 2CMHA 1AGXA 2F67A 1VG8A 1LK5A 1Y4UA 3D7RA 1AQUA 4WACA 3HACA 1SHUX 3EQ2A 3ORRA 3L4JA 1XMQB 4NBUA 1QV7A 1Z39A 4BZWA 3FY4A 3NALA 3FMPB 3GNLA 3A9UA 4F71A 5KINB 1UINA 5JJKA 4B9AA 4Q3AA 3EN0A 4IRXA 1J8VA 3TVYA 1AGRA 1QVVA 1ZMOA 5IXJA 1T8TA 3JATA 2IS1A 3OQIB 3WRXC 3U81A 4HEHA 4KE8A 4CQNA 3H9JA 3N87A 1SCUB 2VHJA 3VNVA 4N01A 1SU4A 4GKVA 1KZHA 1YNSA 4EK9A 3GEIA 3AEQA 4TRJA 3IMCA 3THWA 2QZSA 1T5SA 2VDWB 3HH8A 4U3JA 3U44B 3BWCA 1NJFA 3O8OA 4MWOA 4MUNA 4KXUA 2PV7A 3R74A 3T99A 2CJPA 4IXWA 4FUQA 5HNKA 4BAUA 2HUPA 3FPCA 3CKYA 2WA2A 1HDZA 4DMFA 4AQYB 3T5BA 4G63A 3CBGA 2FCRA 3HU3A 3AL2A 2BEWA 1E1CB 2HU7A 2QIPA 2Z4RA 3A8TA 4C0JA 5E6UB 4EFLA 1P81A 5AUOB 3K1ZA 3TKLA 5AK5A 1VJGA 2NTJA 2QW8A 2ISSD 2OZVA 3C6YA 3HYRA 3EGXA 5KYWA 3D3NA 6CHYA 3PJGA 4LF4B 3EZFA 2YVUA 1T8SA 2CHGA 5FI5A 5EUQB 5DNYB 1NVBA 4HTFB 1NNUA 2CCGA 3TJZA 4RIGA 3V2UA 3NGMA 4UHKA 3A28A 1JMYA 1BH6A 2AI2A 2XKAA 3THYA 3L1VA 1JFTA 1U7WA 2Z1MA 4HSGA 4QTXA 4ENQA 1ZP6A 3MERA 4U0KA 4RS4A 3HXQA 5K3CA 4HLQB 1NDHA 1X7ZA 4LWOA 2WSYB 1ZGAA 4M99A 3TVTA 3TFOA 5KNCD 4CNQA 4ZPJA 4KX3A 1W25A 4I3HA 5AR1A 4RVCA 1W9MA 5FTWA 1XPRA 5DTMA 4MUAA 1BHJA 2ZTHA 1WDTA 4I9NA 4D6YA 2FFRA 1D0SA 1M6WA 1S8NA 1YL5A 2C1XA 4N9QA 4PG6A 4X60A 2HH9A 3JD4A 3QPWA 4YQFA 4D3FA 5A9SB 4XX0B 1GDDA 1RKQA 1CDOA 3VKUA 1KZ4A 1EWQA 2WM2A 1KI6A 1BWPA 2B20A 1OJ7A 4QSHA 1I30A 3TGLA 1PN3A 2WE7A 3WL6A 1MF7A 3GOQA 3VSAA 1J97A 3BPSA 1PX0A 4LJSA 2BEJA 2XCSB 3FMVA 2AI3A 3PFBA 1CUAA 2PX0A 4P54A 1B2RA 1XHFA 4DMMA 1VRCA 2P79A 4LXQA 5CBKA 1RQ7A 4QO7A 1ECJA 3HA2A 3OMWA 1X8XA 3PXBA 5D87A 2ZJ5A 3QMVA 4KK3A 5T41A 2BFEA 4BLRA 4F3CA 1GGJA 4PIMA 1T43A 2PKRA 2V5AA 1RKUA 4IGIA 2DQYA 3OLVA 4GLJA 4RD0A 2HOQA 3U17A 5B64A 3WBBA 4YR7A 4ALJA 3IV6A 3S81A 5LP6A 3IUSA 2NXEA 4QOFA 1AN0A 2JVKA 1TEZA 1JIKA 3T4UA 3RVPA 3NWEA 2ATVA 5MGBA 3MN1A 4FR2A 1YBFA 2Q6IA 2Z4SA 2J9GA 1N34B 2VF5X 5L4NA 1ORVA 2BFNA 2WOOA 3KSRA 3EZYA 1XYVA 1JFRA 2IYRA 5FWYB 5HUHA 2ZSDA 4IMPA 5AJXA 4U7PB 2DBVO 7MDHA 1Y8QB 3WLHA 2EBFX 3OA2A 3HJUA 1SG0A 3PC2A 5DYWA 1E9RA 2IUSA 2X0JA 3ZKAA 1G59A 1DG3A 4ND2A 2FPGB 3QIAA 1V3UA 2AZMA 2Q3JA 4HO1X 3T8YA 4KFTA 5LMNB 2OAP1 3M5CA 4CIDA 4GZMA 2AGVA 2AK2A 3CRW1 1H0SA 2CVHA 1R7RA 2Q46A 1PW7A 3GBVA 3IS3A 2RIRA 2Z9BA 3B6KA 3HM2A 4QNRA 4JQYA 2X5NA 4CM8A 3B51X 4JQSA 3HZHA 4K6HA 1I13A 2FFHA 3OG9A 5ILOA 4ODIA 1ITZA 1V5EA 3LQRA 3JQ7B 2QYTA 1A0OA 1Z13A 2HFKA 3OOHA 4KBYA 4EG5A 3ZHZA 3BMQB 2HF2A 1P45A 2QN8A 3F5QA 2BM1A 4HX9A 4MP6A 1GRCA 4XQ0A 4DHWA 1A1VA 2OAGA 4BUCA 2R8YA 3ZQKA 1BKSB 1P2FA 2Z5GA 1O1YA 1AUVA 2O1XA 5H3CA 4M49A 4LFAB 4NU6A 5EGSA 5SZKB 3RRZA 4BNYA 4DCUA 4QTZA 1IN8A 5IAAA 4IDQA 1L1EA 5C1IA 2QW0X 4KACA 2VDMB 5EZSA 4NAHA 3LKVA 1P18A 3IPXA 3EQ6A 5DIFA 4QBIA 4KO4S 3ZUGA 4YCNA 5E9JA 5T8KC 3QTBA 1E6LA 2VXCA 1DX9A 5FQNA 1ZGGA 4WVFA 2IGBA 1PVDA 2IHUA 3NBZC 1PHRA 1PNOA 4V0RA 3SZRA 4RGQA 3NS7A 2AN3A 2CHUA 4WEOA 4D79A 4PAOA 1HE3A 4CCSA 1CUIA 1ORTA 2AX3A 2P8SA 4BX2A 2HL6A 2BE7A 2AJLI 3H6HA 4FGUA 2D74A 4L50A 3SVTA 5A1JA 2ZIAA 4OBWA 4K9QA 1PJ3A 2QM8A 3BC1A 2GEFA 5I9LA 3VRHA 2FZCA 4UJ3A 1UBUS 1G6KA 1B2LA 1WVIA 5FBRB 5TS3A 3VI4B 2W6CX 4LNHA 4ENRA 4A6XA 1PU2A 2ODBA 3FNQA 2RCYA 2F3UA 1GQ2A 1QR2A 1U3CA 4QIHA 2A0WA 1KOLA 4AB1A 3CNEA 5IVPA 5JZBA 3IE1A 1VYVA 2GA9A 5E4JA 4KGVA 2JHPA 1YKSA 2WKWA 4EHNA 4D9CA 4UTVA 2AW3A 1EM6A 1NW5A 3FKQA 4G67A 3A0RB 4ZO8A 4UEWA 1L4UA 1THMA 1TLTA 5FAKA 5KTPA 2EOAA 3HI4A 2O59A 2OBFA 1NPYA 3ANLA 1AX9A 3L0OA 5DN6A 3RSSA 1E58A 3KEGA 3G59A 3CH5A 5ENDA 3O94A 1H2ZA 2IZ5A 3C6MA 3WYAA 3C87A 3SF0A 2Z9CA 3RT1A 3SJAA 4TLAA 1Z4QA 1EIZA 2ERYA 3O8OB 2PQ6A 4JDPA 2PJUA 1H23A 2VOJA 3TOVA 4LJ5A 1GL3A 2PD6A 1PZHA 1WPGA 2VBGA 2Y93A 1S2NA 2B98A 5FUXA 5IUKC 3PPWA 4P81A 4ETWA 5LIPA 4BIMA 2R6HA 5JNTA 1UOPA 5E1BA 3B12A 4MGHA 4DY6A 3DZFA 1C3XA 1YDGA 2IIQA 1GVHA 1DEXA 2XUOA 3C8MA 4PU0A 3U7JA 3WY9A 2M98A 3MCVA 2BDEA 4YDQA 1DKQA 3F4LA 1MUUA 2FJPA 1MJHA 1XR3A 2VZ9A 1JHOA 3PYMA 4FHEA 4Y2TA 5HZMA 3GDFA 1SBYA 2WNHA 1PZGA 3QW4B 4DV2B 2NU8B 5ALUA 1J8DA 1DPGA 3SAJA 3WGGA 1UJNA 5AFSA 5ICGA 2XZOA 3M34A 4D9FA 4C3UA 5B58C 5I7VA 5JUWA 3BIFA 2YXDA 3CLSC 2GJ8A 2GVZC 2H7VA 2ODAA 2VHXA 2W83A 1YR9A 3KKPA 4R2MA 2IL1A 1X7GA 1O4VA 4Q3OA 2A67A 1VHQA 2R8ZA 5H9WA 5SYNA 5K0TA 1KDOA 3EPJA 2OUKA 4EBBA 5TPZD 3ROTA 1TEHA 2GPTA 3A3NA 3DFFA 2DJ5A 3TK1A 3LT0A 3V8QA 1U6JA 3ZJUA 5DULA 1KTIA 6Q21A 4KE7A 4W1QA 4RK0A 4U2FA 1ISRA 3B48A 1XZJA 1RHKA 1W1UA 1XROA 2V1XA 1KU0A 4U7JA 3PD7A 4EJSB 3NO4A 1Z6QA 4EHDA 1EX6A 5K0GA 3CF6R 3OCXA 4R6XA 3JR3A 3PRYA 4QL3A 3MT8A 1S1CA 2H17A 4H6PA 2HF7A 3EYWA 2P7IA 1MO4A 3T3HA 1RAEA 2WU3A 2IHJA 1CUSA 2OQ2A 4LBYA 3THSA 4B2LA 4IUCS 4JGIA 4EQ6A 3FNHA 1M6EX 3TZLA 2ZQYA 3NXKA 3ZWMA 1SUIA 2FN4A 1IM8A 2QWXA 4IBOA 1I32A 4NATA 3TXAA 4CT4B 2XNDA 3O8QB 2GYUA 2G40A 1JTFA 3U48A 3B53X 2HDNB 3LF2A 3U3DA 1EIWA 4V03A 4KSYA 3RH0A 1II8B 1AZTA 4C2UA 4JXZA 1SVNA 1DC7A 4LDQA 4MW9A 2VHVA 3ZHSA 3WA6A 1B15A 3OIWA 4MI6A 4BNDA 5KWIA 2RK4A 1G291 1H2XA 3ZLJA 1UOOA 1PFYA 3W5BA 1OR8A 3IJPA 5G3YA 5FTNA 1H6BA 3A9RA 4YMVA 4O3FA 4C6RA 2ZJ7A 1CZRA 1IBRA 1MG5A 3C3DA 3WI7A 1R8JA 3PZRA 4G65A 4MJLA 3ODGA 4D4JA 4G86A 2WM3A 1GNRA 1YFKA 2N75A 4X90A 3U80A 3GJ6A 1XZMA 3ONDA 1DIGA 4PEVA 3EYAA 4RKEA 4RLHA 3I12A 1P1KA 3T34A 1IBLB 3THRA 4DNOA 1Z68A 1PZNA 5GIOE 4LPKA 3DFMA 3IAUA 4L8LA 1EYZA 1KMHA 5ETJA 1Z06A 2X5OA 2BKVA 3MJHA 1JG7A 3D6UA 2G63A 3NORA 3QMPA 2HO4A 4JVLA 1NKSA 1QM5A 3PQFA 3DHYA 3K2BA 3WL8A 1YNOA 4H3HB 1CYEA 3OJFA 3PHHA 1L7AA 3HN2A 3H2IA 4BFVA 4RETA 1FDSA 3RWMB 4DV4B 1NAHA 3D7LA 5AJWA 3RJ9A 1R4MB 4MX8A 4DSZA 3H11B 1F2UB 2HX1A 2JCXA 3JTEA 4FKBA 1ESEA 1R10A 4E88A 2XNKA 3DZ8A 3PNLA 3TO5A 3O82A 3N2GB 4EBFA 1WB4A 4YT8A 4H2DA 1RFGE 1KH1A 3GA0A 3HE3A 4AUMA 2VBIA 2KSQA 2W6JD 5LQCA 4EZEA 1I4WA 4ZK2A 5ALVA 4R2LA 2AXNA 4RAQA 3AG5A 621PA 3PC6A 1EFVA 2ZITA 3T7AA 3ABOB 3HR7A 3UN1A 4QBGB 1FU8A 1PJ2A 1WA5A 4E6EA 5JS7A 2IYSA 1OQAA 1CS4C 5FO1A 5K2MA 4CQMB 1V26A 1A2KC 5K51A 1FYFA 1QGYA 5CCDA 4XCXA 3STTA 4ENUA 5AW6A 1PE0A 3VV2A 2IZZA 2AEJA 3GUHA 3NVMB 4GOXA 1EZ1A 3IAM6 3VR5A 4NC9A 4BMOB 4UCQA 3KQUA 3QE2A 4GC5A 2FR1A 4LYGA 4WZAA 3T5CA 1Z8NA 1UJCA 2I4RA 1M6HA 3C1TA 3MBKA 3PNVA 4G4GA 3VFDA 5EHXA 3ACDA 4WJZA 5K3DA 3UICA 3U5ZB 1N2XA 2R47A 4BTLA 2HJWA 10MHA 3HN7A 2FNAA 1OHHA 4YMGA 1TMOA 3GJ0A 4KQHA 1ODLA 4YO8A 4LRTB 4C7XA 1XKTA 4QNNA 3E9CA 3ED1A 4W1RA 5H70A 2ZRNA 4Z1OA 3PC3A 4JBHA 5K45A 2PMKA 3FMOB 1CE8B 3O26A 1SBTA 4NQZA 4AUNA 1JXQA 3AEUA 3HG7A 4LY9A 3WK5A 4Q1VA 1JW9B 4DRYA 2RGXA 2IZ1A 1W36B 5AVVA 2GAOA 4MVCA 4AG5A 2OK8A 3D6HA 3JYHA 3R9IA 5F4ZA 3QEOA 4DNQA 4E70A 5EJ7A 4LF6B 2NZ8A 1Z6AA 4AC9A 2J5QA 1OA1A 2NV6A 3OC0A 3P4XA 4YAKA 3U7RA 1K6JA 4MAAA 4UHFA 2VR1A 5AO9A 3DLAA 5C8YA 2VWPA 2BLLA 1PFWA 2FPSA 5DX8A 4YAIA 5LSAA 2ZSJA 4S1VA 1JFFB 5TT1A 2Q0HA 3E4DA 2JAHA 1U9CA 1ZMXA 4ZOEA 4XYLA 1UANA 3AZOA 1IWBB 2H1IA 3FHOA 2ZUEA 5G4KA 3OZXA 3F6CA 1JEQA 2CXUA 3EOAI 3BTSA 4RD1A 4PGHA 4TLEA 3TOSA 4DIBA 3II6X 1YQUA 4GUDA 2Z08A 3CVJA 3FWPA 2DRIA 2PFGA 1VRVA 2ZE5A 4B3RB 3KDSE 4Z3KA 3RSCA 3ZY2A 1K1EA 4HAYA 5E2IA 1P9OA 4K6KA 1P4RA 4LXTA 4I8IA 2N9UA 1AS2A 1UBEA 3EW9A 5AW8A 3IAAA<