3T7SA

Crystal structure of complex of sam and bvu_3255, a methyltransferase from bacteroides vulgatus atcc 8482
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
246
structure length
246
Chain Sequence
NLICDFFLNTERQGPGSPEVTLKALSFIDNLTNKSLIADLGCGTGGQTMILAQHVPGKITGIDFFPGFIERFNKNAEKLNLQNRVKGIVGSMDDLSFEKDSLDLIWSEGAIYNIGFERGLKEWRNYLKPGGYLAVSESVWFTDQRPAEIHDFWMSAYTEIDTVPNKVAQIQKAGYIPVATFILPENCWIEHYFAPQAKAEEIFRRKHAGSRIVEELITSNHHEAELYSKYKAYYGYAFFICKKGFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of BVU_3255, a methyltransferase from human intestine antibiotic resistant pathogen Bacteroides vulgatus
pubmed doi rcsb
source organism Bacteroides vulgatus
molecule tags Transferase
molecule keywords Putative methyltransferase
total genus 83
structure length 246
sequence length 246
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3t7sA00
3JWGA 5E2BA 3MTIA 3V97A 4Y30A 1ORIA 2PLWA 3B5IA 5EMLA 3G7UA 2VDWA 4C07A 3DXYA 3FTFA 4PONA 3G88A 2EFJA 5FWDA 1R8YA 1VIDA 2FK7A 5CD1A 3MCZA 1P39A 2YTZA 3DR5A 2P35A 3EVCA 5EVJA 4YUVA 2OYRA 2ZZMA 3GO4A 1F3LA 4IWNA 4GQBA 4RX1A 4RTQA 2FPOA 3AWIA 4FT2A 2EJTA 3EVEA 4RVGA 2PBFA 5KQRA 3AXSA 1NBHA 3GIWA 2Y1WA 4CKBA 4RVHA 5E1BA 1N7JA 3FYDA 5CUQA 5H02A 5K0CA 2BH2A 3OU7A 5BXYA 3E05A 4PCLA 4PYMA 5EIFA 1N2XA 2NP6A 1X19A 2OZVA 3VC2A 3KKZA 4PIPA 4HRAA 3E7PA 2P3OA 3R3HA 4DM3A 1MJFA 5LQUA 1G38A 5DM4A 3K0BA 2G71A 4OX9Y 2AN5A 4AZSA 1NW3A 1AV6A 4KVZA 4NECA 4Z2YA 2VDUE 3KPYA 2PT6A 5E1OA 1FJXA 3E8SA 3CJQA 5EG5A 4C08A 3TRKA 3M4XA 4RVFA 4DF3A 1EQAA 2Z6UA 4DCMA 1VBFA 1VP9A 3PT9A 2AOTB 2FRXA 1BC5A 3A26A 3SR4A 3ER8A 1L3BA 2P8JA 3UJCA 3EVFA 2G8NA 3CGGA 4B17A 4ISCA 5C0OE 1SUIA 4O29A 2P40A 3DLCA 5FADA 3DMGA 2JHCA 5EMJA 3NWBA 2ZBQA 5HOQA 3AY0A 3O4FA 4E2WA 2IPXA 2IDKA 2YQZA 5HIKA 2YR0A 3G5LA 3HVIA 1RI4A 4XUEA 3P97A 1RJFA 5T67A 1AQJA 5T6BA 2Z6AA 5GM1A 2NXCA 3GRUA 4U7PB 3CVOA 3EGIA 2JHPA 3MGGA 3OZRA 3FPHA 5IKMA 1DL5A 3HCFA 4YUYA 1JR4A 3D2LA 3NDIA 2GPYA 2KW5A 4M36A 4AZWA 4OQEA 3HCAA 3PB3A 4X60A 2YXDA 5FCDA 3AXTA 5CIYA 4E2ZA 5BW4A 3BKXA 2ZIGA 3KR2A 3KPWA 2HNKA 5EEGA 1IY9A 2P1DA 2ZZKA 5EHGA 2ZTHA 2FYTA 3FRIA 3NWEA 3SGLA 4AZVA 4E70A 1D2GA 3OZTA 3GRRA 3PS9A 4MIKA 5FQNA 5GP1A 4PYQA 5CVDA 3M6WA 3SSOA 2PWPA 4RTJA 4KIGA 2H11A 1KXZA 2ZCJA 1NE2A 2YUIA 3DULA 4P58A 3GXOA 1QAQA 1VPTA 1RI5A 1ZG3A 1F38A 2O05A 3OU6A 4HG2A 4KIFA 3CJTA 5FQOA 4G56A 5FUBA 4AUKA 4ER3A 4X41A 3HNRA 4RWZA 4OBWA 1G8AA 3ANXA 4FGZA 4GF5A 2LD4A 3FUVA 3PFGA 2UYCA 5K0NA 5FA8A 2OO3A 3P2IA 3KQMA 3B7PA 4GOND 1X1BA 5B1SA 5CVUA 2ZSUA 5CVJA 4R05A 4EKIA 5LQAA 3IEIA 4RTMA 5P8WA 4EVIA 4QVKA 5EIWA 1NT2A 4POOA 1ZGJA 4HSGA 4YUXA 4DMGA 3LDGA 1D2HA 3UJDA 1UFKA 2B2CA 3KQVA 3MAGA 3OFJA 5DM1A 3T0IA 5FHQA 4H0NA 3I53A 3V8VA 2BR3A 5ICCA 2QRVB 2UYOA 2YXEA 3TLJA 3KU1A 1EJ0A 3NJRA 5HIMA 4CXMA 5D1HA 2ESRA 5EEHA 3DLIA 5EKXA 5DTMA 4KRGA 3LCVB 1RI3A 3U81A 3GNLA 5GIPE 5U4XA 2C7PA 2ZIFA 4F85A 3CC8A 2E5WA 3LSTA 1WY7A 1DUSA 3GU3A 4EMSA 3PFHA 3LX6A 5DX1A 4DCGA 5EMKA 3UBTA 3OFKA 2CMHA 1M6YA 4FS8A 5CVVA 2IH4A 1VE3A 2PGXA 4E2YA 4E2XA 3G8BA 5K8VA 5DX0A 2ZBPA 2BR4A 3FRHA 2AS0A 5E9QA 5CCXA 3EEYA 2EJUA 1T43A 5E9JA 5GM2A 4YMHA 1Y8CA 1NW6A 1SVUA 3KQYA 3AJDA 3FTCA 3OU2A 3KPVA 3THRA 3NDJA 1ZHFA 3KQPA 4R8SA 2GB4A 1XVAA 2O0LA 1YZ3A 1O9GA 4OQDA 3TOSA 3LKZA 4YUWA 1JQDA 2NNWB 2ZBRA 1NW7A 2A14A 5K0FA 1KHHA 5EZSA 4IKPA 4YV0A 1I1NA 2F8LA 3X0DA 2IBTA 4RTLA 3UJAA 1JG3A 5HZMA 5HILA 2IIPA 3GGDA 4HTFB 4DA4A 4XCXA 3MCTA 5LR6A 1TPYA 4M7RA 2YXLA 3B89A 2K4MA 3T7SA 3ME5A 4FR0A 4DKJA 2NP7A 2UZ4A 2I6GA 2ZW9A 3A7DA 3P71T 1VLMA 2R6ZA 5DRTA 3RODA 5LSAA 1G60A 3G2QA 3G8AA 3BGIA 3EVAA 3GRYA 4GEKA 3SX0A 2HV9A 2DULA 4CTKA 4BP1A 5ICFA 3ELYA 2ADMA 1BHJA 3DUWA 1FP2A 3A27A 3LECA 4PCAA 5EPEA 5JUWA 4RTSA 3ER9A 3LDFA 4QPPA 1ZGAA 3LBFA 3GDHA 2O07A 2PV0A 3KQQA 5E1MA 5K0LA 3FYCA 3C6MA 4KDCA 2AR0A 3SSNA 1KPIA 1SG9A 4ER5A 1RJDA 1JQEA 2HR1A 9MHTA 3FTEA 5ICGA 2NXEA 4OA5A 2OXTA 3TR6A 4GBED 2WA2A 5DTRA 1BKYA 2CKDA 3P2KA 1ZQ9A 3QOXA 1RI2A 3RW9A 2AZTA 4K6MA 1L3CA 3SXJA 1M6EX 1PJZA 1XTPA 4X63A 5DLYA 4DQ0A 3I58A 2HWKA 3TQSA 1RI1A 2IBSA 4HGZA 2AOVA 2XYVA 1U2ZA 3DXXA 4PGGA 1OR8A 3SSMA 5E9WA 4FT4A 3HP7A 3BWCA 4GOLD 2C7QA 2JG3A 1QYRA 3HA3A 1X1AA 3K6RA 3KQOA 4RTNA 8MHTA 1AQIA 1NBIA 4BLWA 1UWVA 4R6XA 1VP3A 2ZLBA 1MHTA 2AOWA 4LECA 4QPNA 3A25A 4L7VA 5ICEA 3BUSA 1JSXA 5E1DA 4EQZA 2IFTA 4RTOA 3C3YA 3NVMB 5EQJB 2I9KA 3ERCA 5DTQA 4LG1A 4RYLA 2YX1A 5KYGA 2P7IA 1G6Q1 1HNNA 1SQFA 2G70A 1NW8A 3E23A 3GWZA 3JWIA 4V0QA 4KW7A 4XUCA 4C04A 3M6UA 1EIZA 2ZFUA 2B78A 2PXXA 2PWYA 3HVKA 5DRYA 2C7OA 1SKMA 2PVCA 3MHTA 2Z6QA 4CWAA 1PRYA 3UA3A 3PX2A 2QE6A 5DX8A 3UJ7A 4P7GA 3UJBA 3HA7A 2ZWAA 1AF7A 2AOUA 3HVHA 5LQKA 4XUDA 4ATNA 4YV2A 2FHPA 2PT9A 4E30A 1NW5A 1O54A 3KR1A 4BLVA 7MHTA 1X1DA 1NV8A 1B42A 4PYOA 5DM2A 3SMQA 3TKAA 5HFJA 5DM0A 3A4TA 3FTDA 2AVNA 3KQSA 1XDZA 4PYIA 3LCCA 1KP9A 2ONZA 1QZZA 3DMFA 2PX2A 3JWJA 4EK9A 3I64A 2C7RA 5HEKA 2VS1A 2WK1A 3BKWA 2IP2A 1ZKDA 2P3LA 4Y2HA 5K09A 2GS9A 1NKVA 4CKEA 4RSRA 1P1BA 5CCBA 1D2CA 2HMYB 2NXJA 4LWPA 1EJ6A 3FPGA 5FHRA 1R8XA 2B3TA 1TW3A 2NXNA 4X61A 2XYQA 4BP3A 5C9ZA 2AVDA 5EZQA 1N7IA 4ER0A 1L3IA 3Q87B 3FUXA 5LQRA 1EAMA 5DXAA 2H00A 1WS6A 5DXJA 3LHDA 5K01A 5DPMA 5JR3A 2ONYA 1G55A 1WXWA 1WG8A 3CBGA 3F4KA 2CMGA 3ELDA 3HEMA 3KPJA 4PYKA 1YB2A 2PX5A 5KQSA 2OB2A 3HCEA 3GRZA 3O7WA 4QQNA 3S68A 3UJ9A 3HCCA 3P9KA 3OZSA 4ER6A 4R6WA 3HA5A 2BM8A 2JH8A 4GC5A 3M33A 4QTUB 4CTJA 3H2BA 3NMUF 1SQGA 1I4WA 4QQKA 1WZNA 2Y1XA 4AZTA 2ZWVA 3UA4A 2IH5A 2XVAA 3OE5A 4M37A 4X1OA 5EGSA 3VC1A 3PLAE 4RVDA 3LGAA 3ORHA 3CJRA 5EHIA 3ELWA 1RJEA 4AX8A 1I9GA 3EGVA 1R74A 3UWPA 4CKCA 10MHA 2EX4A 1BOOA 2VDVE 4LWOA 3T7RA 5E8JA 3FUUA 3I5UA 1JTEA 1M0EA 2GH1A 4PINA 5K0EA 3G89A 2FCAA 5EMMA 3EMBA 3BGVA 5KS2A 3O31A 1JSZA 3FPFA 3R9XB 3QV2A 2GAFA 3B3GA 3P8ZA 5LQCA 2O06A 2ERCA 3KQTA 3VSEA 3SVZA 2AN4A 2IH2A 4GUAA 1XDUA 2V74B 1R6AA 2V7EA 1DCTA 4C4AA 2XYRA 5DWQA 4E32A 3R0QA 2XBMA 4V0RA 3DOUA 3C3PA 4A6EA 3CKKA 3JWHA 3HCBA 4PYNA 5M5BA 3B3FA 1XDSA 1KPHA 5KVAA 3BT7A 3FPEA 3UJ6A 4C05A 3G5TA 3LL7A 3TFWA 2ZVJA 1QANA 2G1PA 2UYQA 2JH9A 3BWYA 5EKUA 1YUBA 3EVGA 3RIEA 4MTLA 2AOUB 4EKGA 5F2NA 4HTFA 1KYWA 5GOZA 1Q0SA 2B9EA 3ELUA 4HGYA 2VP3A 3TPZA 5DSXA 4YV1A 5D1NA 4E31A 4YUZA 3HCDA 5BW5A 3HVJA 4P7KA 3FPJA 1YZHA 3BGDA 2PSSA 3IHTA 3GRVA 5FWAA 5IH3A 1V39A 3DH0A 3L8DA 3QOWA 1KYZA 1JG4A 1G8SA 5EOVA 1IM8A 1YFLA 4MHTA 2XVMA 4KDRA 3T7TA 4UOEA 3BWBA 2OB1A 2PX8A 3DXZA 1P91A 2DPMA 5BP7A 1NV9A 2NYUA 3P9IA 2OY0A 3LCUA 3P9CA 1VL5A 3PVCA 5FTWA 1JG2A 3MERA 4IV0A 4U7TB 3SM3A 2ZZNA 3IYLW 1XJ5A 3LDUA 2JHAA 1R00A 1JG1A 2N47A 3ID6C 2OBFA 3WSTA 3LKDA 5K05A 4RTRA 5LQNA 3G2MA 4RTPA 1WXXA 4QTTB 2R3SA 2PX4A 3LBYA 2IDJA 4KWCA 3EPPA 5FULA 1QAMA 4GC9A 3A7EA 4M38A 3TKYA 2UYHA 2ZULA 3R6TA 2CWWA 3EVZA 1Q0TA 5T64A 4PYLA 4F86A 1FP1D 4IV8A 4BY9E 1FBNA 4QDJA 4YMGA 2PKWA 3NW9A 1X1CA 3OE4A 4PWYA 3M6XA 4ER7A 4P7FA 1JTFA 2FK8A 2IGTA 3FZGA 1HMYA 1FPQA 3NVKI 3KQWA 3I9FA 5EC8A 1P1CA 5GWXA 3LPMA 5HIJA 2PJDA 2OKCA 3BWMA 3G2OA 2P41A 3TMAA 2EG5A 3EMDA 4C03A 4RTKA 2AOXA 4QDKA 3PTAA 3EGEA 4ZTBA 4PNEA 5E2AA 3UJ8A 4A6DA 5CM2Z 5K03A 2I7CA 5LQJA 3MB5A 4OBXA 4P7JA 4F84A 1XCLA 2HTEA 3VYWA 3EEOA 1L9KA 1QAOA 3CCFA 3G2PA 3KR0A 2WA1A 4GOMD 4WVLA 3FUWA 5DT2A 5GIOE 2AN3A 4FSDA 3NTVA 3PX3A 3FUTA 4JXJA 1RJGA 3B3JA 3THSA 5K0BA 2QM3A 1JQ3A 2I62A 4FSXA 1VQ1A 4WXHA 3GJYA 5FA5A 3BXOA 4E33A 4MQ4A 3EVBA 1EG2A 1ORHA 3OPNA 5E8RA 1H1DA 1R18A 1XCJA 4GOOD 4R8RA 2PY6A 2H1RA 5ERGB 3TM5A 2BZGA 3REOA 4MWZA 1L1EA 3TM4A 3UZUA 5F2OA 5HIIA 5GINE 1IXKA 2ORED 2BM9A 3DMHA 3EVDA 2Q41A 2O57A 3KPUA 2GLUA 1SUSA 3IV6A 2QY6A 2QYOA 5CVEA 4BLUA 4FP9A 1KR5A 1YFJA 5K0GA 2BR5A 1KIAA 3HTXA 2PXCA 1TW2A 1XXLA 2CL5A 3KR9A 4HH4A 1YF3A 2VZ9A 2P3QA 1Z3CA 2ZIEA 3BZBA 3MTEA 2B25A 5MHTA 1KPGA 4FZVA 3KHKA 2P7HA 4PYJA 3M70A 3DP7A 5C1IA 4PGHA 3OCJA 2GA9A 3C0KA 3DTNA 3P9NA 2PXAA 3UFBA 4C06A 2YVLA 4OA8A 3Q7EA 1UIRA 5DSTA 3P2EA 3HM2A 4PIMA 5K0JA 3R24A 5F2KA 2OPBA 2G72A 3MQ2A 4RV9A 1INLA 2JJQA 4HC4A 1O9HA 4QVGA 5G02A 2QRVA 3C6KA 3GCZA 4DZRA 3M6VA 2AOTA
chains in the Genus database with same CATH superfamily
3MTIA 5FBWB 3BBPA 3BWXA 3IJ5A 4LOIA 4A6XA 5L3QA 2P9FA 2WI8A 1H1LB 3GOHA 3VR2D 3JQBA 2C83A 3DXYA 4OHFA 2GEBA 3FE2A 4QA9A 2EFJA 3L7BA 1R8YA 4PXAA 1FB5A 4TXHA 3W3AD 2NVOA 5LDDC 2I6XA 3HH8A 3DR5A 2QN8A 1QH8A 5BYJA 5CP8A 1N3LA 5EWJB 4BNJA 4FHEA 4F7DA 2B0JA 2YZ7A 2ZYHA 1L4BA 2O2XA 4I9FA 3OF2A 4RHEA 2QD4A 3TZHA 1EU1A 4WXPA 4PBSA 4EGSA 3SQWA 1G4HA 2G80A 2GQ0A 4G4IA 5JDIA 5EIFA 2XVYA 3RSHA 5FOWA 1J2YA 2EGHA 3WLKX 1PZEA 1V5EA 2COKA 4RPHA 5AP9A 5FPYA 3TIFA 3UT6A 1HT0A 4CFSA 1T2UA 3Q1LA 4FEGA 4KXNA 3CLRC 3QWAA 4RF4A 1TUBA 2YJ5A 4FHDA 4BC0A 2I6SA 1ZM9A 1K2VN 1NJ6A 5DP2A 4MRMA 3EMVA 4P53A 5LXTB 3MMZA 1FMFA 3KL4A 3SHOA 1AM4D 5MFZA 4M9SA 3TRKA 1Y1QA 4DR7B 4C29A 3PT9A 2FOXA 3NAGA 4HNVA 1NKTA 4ZEMA 2FWPA 3DB1A 3KL2A 4FUTA 4K0KB 1QS0A 4DWOA 1M6WA 4HXEB 5H16A 4NNJA 5IKPA 4Q3NA 4K5QA 2HLHA 1LZLA 5CT5A 4A8JB 1ZD4A 1COWA 2RC6A 2XZPA 1NJ2A 3BFXA 4CF5A 2D3WA 4H27A 3KSZO 1SXJB 2M6LA 3O3CA 5TQ0A 1L8OA 5DBOA 4NKRA 4MROA 3EEBA 4CUKA 2NXCA 3KG2A 3CVOA 5CDGA 4MRPA 5DNCA 1R4MA 1MHPA 4NJMA 2NU7A 3ACBA 1FYDA 3GLGA 3J7AC 1UPUA 1W1UA 2FN9A 4WNIA 4AKTA 2CGEA 5FP0A 2XCIA 4L0MA 2PUVA 5IJ0A 3H3XA 3COJA 5AI9A 2YV2A 1PJ2A 2WWYA 1BCSB 5FCDA 1GGFA 3PPWA 1GQFA 3VNRA 1Z6PA 1XJ0A 2OCBA 2WSIA 4FIDA 3ICWA 3A14A 1QYDA 2P2ZA 1H6AA 4PNPA 3RK4A 3T0GA 1ATIA 1QRRA 2QR3A 2P3SA 2QD5A 2GVNA 3ADPA 2Q6IA 4QWWA 5ETJA 4WUVA 3RSFA 4LMRA 5A9SB 5KJCA 2ZCJA 2BBSA 4I19A 3RF7A 2ZJBA 5DGIA 5ITVA 1U1IA 3TZ6A 1EWVA 1JR3E 1R10A 1KAGA 3K6JA 1MMFB 2H7YA 2DF8A 1VMKA 4O5AA 5F2EA 4HAVA 1EXNA 1Q84A 1VI5A 5MF6A 3TAUA 4I4IA 2PNFA 4D3YA 2E5LB 1MZVA 1PJ3A 3OLWA 1ZOSA 1N3YA 3N0RA 3UAYA 4C88A 3ZI0A 5BYAA 2ZSUA 5HCUA 3TLGA 3RS3A 2RGUA 3GEEA 3GPCA 2BMJA 4M7PA 2H2WA 3R3UA 2CHQA 3NHPA 4POAA 3OKAA 2EBHX 3BXHA 4CHGA 4KUHA 4FGSA 1ZGJA 3RTCA 3PPYA 2B20A 4BNDB 3RFUA 1FRFS 2W8BB 4K7JA 1ZHOA 4CRWB 2P1ZA 4RACA 4HRVA 1GQOA 1FVHA 3HC7A 1UR5A 3VU0A 3TD6A 1DRWA 1GLVA 3IT2A 3F6YA 2NPIA 3T7DA 2PH1A 2EZ8A 2IUEA 4KBYA 4KE6A 1J9ZA 1EVQA 4FW8A 1X94A 4G5FA 1PLLA 2B4AA 5DBFA 3FMFA 4EZBA 3RAEC 1A8IA 3AEYA 3K8YA 2H1HA 4B7ZA 3DO5A 2D06A 2P27A 1JFFB 1H6CA 4KSYA 2I7XA 1U5BA 1PGQA 2B6HA 1LVUA 1BW9B 2RONA 3E9RA 4L75A 2ZT5A 5G0SA 3AHJA 1ODIA 1XI2A 3D6JA 2KLBA 3LHKA 4X3OA 1Y6JA 5J4YA 3F5SA 3EIXA 1N36B 3KJNA 3L7AA 3SJ7A 2XUAA 4MJ3A 2Q7XA 2VP2A 2X6QA 3HJGA 1J4AA 4XPIA 1JNXX 6REQA 2L42A 2EJVA 4TM8A 1XJQA 1R0CA 4RGBA 4Z49A 3M6AA 2ZBPA 2BR4A 1IQRA 3O1HB 2QSUA 3E9QA 1BX0A 2JCVA 2EJUA 1T43A 4KRYA 3CN7A 3JD2A 4V0SA 1T91A 1PJBA 2QYHA 1DP4A 3TGWA 3MJDA 1P1RA 2CSXA 3FTCA 2WYHA 3PXDA 3RG2A 1CDDA 1ZHFA 3CB2A 3X1ZA 1WHTA 1E79D 5EIAA 1NIJA 2I4OA 1TAGA 3DVSX 2EW2A 1K1EA 2X9LA 3KZCA 1ZN8A 4D4GA 1TK2A 1XEAA 2WTMA 5MN6A 3TI9A 4E08A 1L5FA 2REQA 4E13A 2J4DA 2B9VA 2EQBA 2HAEA 4WH0A 5JI2E 2W2XA 4HTFB 2G0TA 1NVAA 3ZTTA 1Q74A 4J2OA 4FNGA 4E14A 4PPQA 5JQGF 1U3UA 3K8OE 5A6SA 4C7XA 4ZO7A 2UZ4A 1DX6A 2Q0QA 2R4TA 1LQ2A 2QAGA 1QOQB 2Z2IA 2B4TO 5A4MS 4CQMD 1F8YA 1U94A 4QQFA 3SX0A 3EVAA 5JUWA 6ABPA 3ZV7A 1XHFA 2NVWA 1D5WA 3STHA 4G41A 1YQEA 2IY7A 4UULA 3ZU6A 1PUXA 2VWQA 2GFHA 1AHHA 2DJIA 3I45A 3ROXA 3ZR4B 4YJ3A 1TYEB 2O07A 2ZWIA 1L8XA 4AY6A 4B4DA 4RK0A 2G5GX 4ER5A 2C4WA 1NBEA 4ZU6X 1CR4A 2VA9A 5ADUS 5A0TA 4GI7A 2VZ8A 1A3CA 4BX0A 3TD2A 2QJOA 4C89A 4ZC8A 1GVHA 1XUOA 2OHGA 3HR4A 3JAWB 3C45A 3UTCA 1VKOA 3OKPA 1XTPA 4U4AA 2H4FA 3L07A 4AY5A 1UBFA 2PUWA 5DF1A 1Z4KA 3X1KA 2PZMA 3QVLA 3ZYZA 3G2HA 4KVFA 2AOVA 1JMYA 2VJMB 2NSLA 2OWDA 3HR7A 2MCFA 4FT4A 3S99A 2OK7A 3JQ8A 4MVJI 5DOZA 1WZ2A 2CEAA 1F9AA 4X1IA 2Y93A 2ZBGA 3DZBA 3RSQA 1J97A 2RAUA 2PQ0A 1J8QA 4XFDA 2Y0DA 1GCOA 4KMOA 3AHIA 3T4XA 3BIWA 3LQFA 4E6EA 3AUAA 1P9NA 2O7SA 1NDHA 1WEKA 2FKAA 2PH5A 4CL0A 2Q2WA 3WZ2A 1QJ4A 4WX2B 3ZU2A 5BVHA 1E2LA 1TZJA 2JCSA 1TM7E 2W83A 3BRWD 1VTKA 1JEEA 1AUOA 2BPOA 3C6ZA 1PRYA 4X44A 2Y1DA 3OIYA 5TX7A 1OX5A 1X2EA 1DQRA 4DBZA 2XRFA 4IP0A 4HATA 4JEHA 4L4SA 3W2EA 4EHJA 4W1RA 5DGDA 3U80A 1AZWA 1TAHA 2PZJA 2VTKA 4B47A 5C4GB 4ATNA 3SOZA 4F11A 4NHEA 1NW5A 3AF1A 5CK4A 2AB0A 3NUQA 2PUCA 1D04A 3AL0C 5HKBA 3BJEA 3UK2A 1IXYA 1KZGB 1A69A 2RMKA 1YJBA 2Z4SA 1WZCA 4FDMA 5DEOA 4BDTA 2VAVA 3ZWMA 4UTPA 3KQUA 1EM8B 2IYWA 5LKAA 4LJ5A 3KT8A 1KP9A 2DC1A 4P7BA 3VKHA 4DVJA 2R7MA 3CS3A 2QUBA 1HC7A 3ZVRA 2VJOA 1E2UA 3CH6A 3I64A 5J5VA 3AQ4A 5LMNB 1X0XA 3Q2KA 1S2GA 2C57A 3R3SA 3HCOA 3PL1A 4JU8A 2I3GA 1O8BA 5CYPA 1U1FA 1P1IA 3ZY4A 3R9XA 3QU9A 2HMYB 2P11A 5FHRA 2FMIA 3FUCA 4A03A 2A67A 5A0FA 5KOJB 3TVTA 3WG9A 1ORTA 2IY9A 3NU1A 3GEBA 2RHOA 3WK7A 5ESXA 3E5NA 2ZRNA 4A9AA 3HVUA 1UBSB 5AM2A 1EXDA 1CJCA 1Q7GA 2XB9A 3K35A 1QF6A 2VIIA 2QRGA 4ZKEA 2QMQA 1H4SA 1IULA 2WSBA 2JLYA 1BE0A 1IUKA 1MLDA 2NV6A 3BIOA 3F4KA 4Y9UA 1T5LA 2YFKA 1DIBA 4RPJA 3SR0A 3P9KA 1JSCA 1W73A 3A3YA 4R6WA 5ER6A 2FR8C 1AKNA 1ECGA 5F77A 1IDOA 1X92A 3MK31 4GWGA 1TEXA 5JV5A 2A9JA 1AGRA 4CUZA 1TC1A 1WZNA 2TSYB 4XASA 3T1YB 4O08A 1UK9A 3LUAA 3FWPA 3F0TA 3KXPA 5LZ2A 4C4ZA 2RGCA 5G3ZA 4BATA 1H3NA 1BOOA 2E87A 5K8IA 4L27A 3HJAA 4UVGA 4MQFA 4UU1A 1DS6A 1EFPB 1DWUA 1XJWA 2COUA 2GUWA 2VH1A 5K0EA 3P45A 3UEOA 4GMHA 1SVWA 2BSXA 4IDQA 3QV2A 4ML3A 4XGKA 4C0BA 4LA4A 2F48A 3V32A 3C87A 2QP4A 3CEHA 3EQ6A 1Z5ZA 2ZB2A 1QPGA 2QLJA 2VT2A 5E7QA 1ODSA 2A78A 1R7RA 2OHHA 3IP5A 3RYIA 2GCOA 3VZDA 3WLNA 4YJ3B 1GTJ1 5CDUA 4DV6B 4HQKA 4C3OB 2XB2A 1UIMA 4E46A 3SF0A 2QQ0A 5TF4A 5EJ6A 4MQMA 4QO8A 1Z8NA 3COVA 4LHZA 4NZYA 5AKXA 1O6ZA 2GN4A 4ZV9A 3U5ZB 4XM2A 1ZP6A 3JQDA 5KWEA 3O9VA 4EJMA 1ORVA 2I5PO 3HDTA 1N57A 1DXQA 2QAGB 4M0CA 1QANA 1F2DA 2W2VA 5CX1A 4W5NA 3ZHSA 1EWQA 3IIMA 1R9GA 1SKYE 4MTLA 1ZCBA 2BKUA 2V0GA 2CE7A 1T1JA 4HTFA 1KYWA 4ODIA 2WOJA 2YHIA 4IF6A 2GBGA 2J9FB 4ZVMA 2Z56A 1RHQA 2X1HA 3L0YA 4JXKA 4M3NA 4BN0A 2Z2KA 4H16A 4E09A 1C3VA 1HZZA 1L5VA 2YFYA 2WAYA 3MCAA 4H60A 2FFAA 1V39A 2GERA 2HHLA 2Q2OA 3DH0A 4LXGA 3BB3A 4MRVA 3AI1A 2QR2A 2IHNA 2I71A 2B5VA 4UOEA 1GFSA 1B41A 3BWBA 1P91A 3GEHA 1K7FB 5BP7A 1WVMA 1P5JA 3E9ZA 3HDYA 3BSYA 1BEUB 2FOIA 3KAQA 3LHFA 1VG0B 2RH9B 1QE5A 1XRNA 4FONA 5SZJA 3SEZA 2ZZNA 4O0LA 4J4HA 3TL3A 2Q0HA 4DEVA 3PICA 4KACA 1G9XA 2FB9A 1EVKA 4U7JA 4BKUA 3V6MA 2YVUA 5FJJA 3ILSA 2QDXA 4B6JA 5KPJA 2DQYA 1IOLA 2IDJA 3LW7A 3ETLA 2H63A 2CJPA 4M38A 2WUGA 5CH3A 1B73A 2LP4Y 4AU1A 4ZODA 3FW1A 4EO9A 4WKBA 1ULBA 2QEQA 3NNSA 1K3FA 1ZKMA 1KWKA 4AWAA 3F8TA 3KV1A 1D2MA 4ZCLA 4LDNA 4RD3A 3FZGA 2B8JA 1DRJA 4RQAA 3T3NA 4QT4A 1XROA 3JATA 1C4XA 4J4BA 2D59A 5HE8A 2ZIZA 4DYVA 4W99A 2CCJA 3TTWA 2G7MC 2VPXA 5C52B 1QK3A 2GZAA 2PZAA 4IF4A 4NZMA 2HIAA 2EIHA 2VDLB 2VJBA 3GBSA 5JG7A 5KCZA 2FVYA 4US1R 2NU6B 5ARDA 4XEHA 5IBRA 2P9TA 2W8BA 4JP2A 1A04A 3WBFA 4GO1A 3WBJA 3ZZMA 3RAFC 3KXLA 3UJ3X 1L5OA 4PNEA 3CKYA 5KO2A 3AVVA 3UMFA 2YIDA 3D1JA 2KE5A 1FSZA 2XTJA 3TPFA 1PQPA 1JBEA 2GPNA 2Z9BA 3GFQA 5ITWA 4YB8A 4HZIA 1JALA 1M3SA 2VNJA 4N01A 3H9CA 4INAA 3WNBA 4ETMA 1CYEA 5E4JA 1UK7A 2QM3A 3W8DA 2XUFA 4D9FA 1VQ1A 1OB5A 4WXHA 1J8MF 4HWOA 3Q88A 2XWQA 1IQ0A 1FP7A 3EXHC 2F4VB 4II7A 2WVJA 2JAUA 4YRFA 2X7JA 3VPFA 4HCJA 2AZDA 1XCJA 2I2DA 3K94A 3R9KA 4BVAA 4F3NA 5BQFA 4FWBA 5HQ3B 4JUCA 3W2GA 2X0RA 3NYIA 3RGWS 2HU5A 2OKGA 3UV6A 3CG4A 2FP4B 1OXXK 3CMCO 1FQWA 1JEJA 1XIVA 4MP3A 3W2TA 1YDHA 2HIGA 4EUNA 5AI0A 3WHIA 3EIEA 1JLLA 1RIIA 2C3OA 4Q05A 4D6PA 3H1BA 3GH1A 3BMCA 1Q7TA 5IYZB 4WY8A 1GPKA 1TECE 3CN9A 3QLUA 1M6VA 3KSBC 5JQGA 2VKTA 3ASZA 4RW0A 3QUBA 3QJ5A 1HO3A 2P2CA 2P6OA 3ILVA 2VN8A 3DLBA 1PI3A 1HXHA 4FCWA 1E3TA 3MMSA 4OA8A 2R84A 4WN9B 3K70D 3L8CA 4G4GA 2ZSKA 4LISA 4A8JA 4L0CA 3HM2A 3DO8A 3NBAA 3RJTA 4S0ZA 2FWJA 1Z88A 1SCJA 4RKEA 4WY5A 3PG5A 1BKDR 1EK1A 1DTSA 3S6JA 2V5AA 3MS7A 5TS3A 1KARA 4NL4H 1RQGA 4H6WA 1TCVA 3M6MD 1B14A 1PFVA 4BFCA 2P6UA 1XAGA 2WFLB 2JIDA 5FWDA 5LXTA 3UIEA 3L2OB 1MIOB 3CT6A 4FHGA 5A4AA 1ZJ5A 4Q7EA 2P35A 1NFQA 1Y8QA 3OH8A 1GCIA 4MYRA 3MUEA 3QENA 4LJRA 1Q22A 4RTQA 4V3BA 3AWIA 2Q8NA 4JVNA 1T8SA 2VPYA 2GBFA 4Q9JA 3OZGA 2ZI9A 3PXGA 3NCHA 1TO6A 2BH2A 3NWJA 3GGJA 1EXVA 1HMPA 2XA9A 2DUNA 4KQ9A 3PXXA 4LSZA 4M6WA 2ILVA 4ZYXA 2BEWA 1RC1A 2IYAA 2QGZA 3B5EA 3FSEA 4HRAA 2PMDA 4Y1GA 3VTAA 2D1FA 1YMQA 1W9MA 5IS2A 1L5QA 1TB4A 1YMVA 4DIBA 2PUDA 3K9QO 1NP6A 2EYUA 5ALNA 3KQLA 1GCAA 1QH8B 5H0IA 3RRBA 1F17A 1I0ZA 1PWZA 1QTQA 1A98A 4NYMQ 1Q0ZA 1W93A 1Y5RA 3E8SA 4Z9XA 1H1LA 2BI4A 4RVFA 2NZ8A 1OLXB 4NJOA 2XCUA 2QM7A 3WB9A 2Y4OA 1LRJA 3MG9A 4PIVA 3QE3A 3PQ3A 1QNFA 2ADOA 5INTA 4NCKA 4CMCA 2P8JA 2XUIA 3PNSA 2Y66A 3OWHA 1E69A 4OGGA 5JS8A 1XZQA 2WE7A 1N5KA 2CDBA 1UBGA 2NQTA 1ATZA 1U4SA 1ODTC 4UXIA 1O0CA 4DLTA 1YKGA 3OUTA 1K06A 1YI0A 3EFHA 4XSGA 2HO5A 1X7XA 1PZXA 5EE1A 1M2VB 3ORYA 1PGNA 1FVFA 2FPMA 1E1DA 2VLBA 4AWXA 1XGKA 1F7UA 4RY0A 2QK4A 3OFNA 4LDRA 4OXIA 2OLJA 3NEYA 3PHGA 5D5PA 5HJEA 1CUAA 4XE5A 4QRHA 2OHJA 2X0EA 3PYMA 3DEFA 2LXNA 3E5RA 5BNFA 3L7DA 4GEGA 2PJUA 1CHDA 1OLXA 4JI0B 4BZQA 3SS8A 1PR9A 4RHTA 4J6EA 1JI0A 2HNKA 3BRCA 4HDKB 2PFSA 2ZTHA 1CUZA 4LX8A 5KVSA 1H9BA 3NBYC 4PAGA 2PWPA 3UWMA 3E1KA 2PFGA 1RWNA 2QTAA 2GRJA 4FFPA 3FNFA 1T5OA 1SOAA 2GO1A 3BE6A 3GXOA 3H2JA 1N2ZA 1UBKS 1X0VA 2JGFA 4FDVA 4JJIA 4N9WA 4QXMA 4P32A 5KHAA 3RADC 4YRMA 1Z0AA 2VJAA 1PT7A 4I3HA 3IKVA 3LFTA 2V6GA 4WLOA 4ABTA 5KPDA 2VYQA 4NU6A 2V45A 3AF4A 4WV3A 1ZZEA 1WMSA 2EP5A 3OO0A 4LHSA 3FTNA 5I4CA 4JASB 3ZU5A 4HSGA 1B0UA 1MIOA 2ZRAA 1REQA 1CEYA 3W5CA 1PFWA 3OOYA 3VFDA 2B2CA 4V02A 1DBIA 1M83A 2OLEA 4H0NA 3H5RA 4Q3LA 1WSDA 1S3FA 2XPCA 2ZRPA 4N0PA 4BDSA 1F2TA 1GIAA 1DIHA 1KYTA 2CUKA 4R0NA 3WQRA 4AN1A 1UXOA 3RYHB 3U7JA 4RIHA 3C8MA 2RSLA 5JNRA 4KRGA 3U81A 1KA9H 2IVZA 1QORA 4TSFD 4AY4A 5CXXA 2OGSA 2FSVC 1KI3A 3PUZA 3PVZA 1FFBA 4TLEA 1KFBB 2WAOA 3H0CA 4KFUA 3W6ZA 4HAZA 5JQGB 2OENG 1HUQA 1CV2A 1IH8A 4JC4A 5G0UA 1J9EA 1E7MA 3JQ6A 5KDDA 5F3WB 1TMKA 4IDCA 5L9AA 2DHEA 1EDZA 1EFHA 1TMYA 3G8BA 4BBPA 4Q39A 4IINA 5TNXA 1LZKA 1JLLB 4NCIA 1E2IA 3EEYA 5AVZA 5K3DA 1V2HE 5JJCA 3T5PA 1S7GA 3MGCA 2JFBA 4CJXA 4DMRA 2FP4A 1VRVA 4MKIA 4RXUA 1P2BA 1DC8A 3LYLA 1YB5A 3BMNA 1MEOA 3K73O 4PICA 4KX3A 5KCMA 3QVOA 5M7EA 2NTYC 4HYQA 4I5DA 3P2JA 4HLNA 2IZ6A 1N4AA 2O1XA 2DECA 2OOKA 3DBIA 2FAXA 821PA 1JDUA 3RVNA 5F1PA 3LGSA 1TC2A 2IEIA 2TECE 1Q50A 2BDEA 1PKEA 2XE8A 3H8SA 1X1SA 3M5CA 1F0YA 1P62B 3E22B 3PQ5A 5G0TA 5FAKA 5HKKA 4MR7B 4DA4A 2AMLA 3H4VA 1KMHB 1NR1A 3PENA 3WLIA 3BXGA 3ZDEA 4BFZA 2E9SA 3ZZ0A 1W49A 1CY4A 2XWBF 4Y2TA 4MUEA 4N3GA 5B5SA 2DULA 4OQ4A 2ECPA 2V7VA 4J1SA 1RBZA 4FOOA 3IUQA 2G9NA 1S6YA 3BHMA 1XTTA 4PLYA 3SLKA 2DWPA 4WVFA 3TLBA 2Z1NA 5J2UA 1M34E 4MR8A 1ZH2A 1NKSA 3EZ7A 3ITKA 1IG3A 3RS4A 1NMEA 3HB5X 3S55A 1WZEA 5LP1A 1YZLA 1DAKA 1NSTA 5I7AA 4E2WA 2ZXEA 3ZWCA 3QKSB 3PUXA 3GJ0A 4JROA 1QUFA 4EGQA 5HCIA 4C0AC 2W6NA 3F6EX 2QJTA 1XQWA 2PT7A 4OA5A 3HDVA 1B6RA 3P2KA 1Z7YA 2WJVA 4L76A 1CRWG 4P0QB 4ZOLF 4LRUA 4H7PA 1FE8A 4UKDA 4FOPA 3AEKB 1KC1A 2Q1TA 3O92A 4DQ0A 4HLUC 3FOBA 3JVIA 1DEOA 4Q00A 4HGZA 3M5PA 4TUYB 4XM0A 3DXXA 5JXGA 4ASUD 5KNBD 1CUDA 3HB9A 1Z5UA 3BD8A 4RQUA 2PK3A 2R66A 3BWCA 1I4TD 4FHZA 1I1OA 4KYIB 4JR0A 4FN4A 1JXMA 2DPLA 3U7FB 4NK4A 2I67A 2IWRA 4BLWA 4PE5B 4D0NA 5JRJA 5KKNB 1MHTA 4EW1A 1YONA 3K1YA 2DR0A 1QQ5A 3DCIA 3P0RA 2IYSA 3ZOKA 3BXZA 4P82A 4EA7A 5K6TA 1QB8A 4Q82A 4O2AA 4TTRA 1EFRD 1EG7A 1QIEA 2W6ID 4QDTA 3WFIA 2DTDA 1RJ9A 1ZIOA 1GGKA 1HGXA 2EW1A 2AH5A 2P7IA 4GYJA 4RKYA 3EZFA 4X20B 4TVOA 1MQ8B 3PNKA 2FEXA 4C20A 1DE0A 2AV6A 3M9LA 2ZFUA 2KJQA 1V8PA 2CWDA 3VOBA 5JCPA 3AVYA 2J9FA 2LV8A 2MJLA 3RTAA 4EHNA 3H4MA 4YHHB 1E5LA 3VZPA 1PFGA 3BRQA 2C58A 5LZ7A 5FBVB 1BH6A 5KHOC 2Q9BA 2YCBA 3ECAA 3Q11A 5GOTA 5JFGA 3YASA 4PG8A 4DNOA 3GEMA 1Q5PA 3P2YA 4K6HA 4NZPA 3D0OA 4JXXA 3PX7A 5CX1B 1CR2A 1CG6A 3C8UA 1GU7A 5CT9A 1T9ZA 1TCBA 3VR6D 1V5IA 4Z4FA 4M86A 1H2YA 5HFJA 2OBNA 1LDNA 2DFKB 3K2EA 4BC1A 5IFKA 1PX0A 3QI7A 1PR4A 3WIVA 1GDTA 3VVLA 1QHFA 3LCCA 2JGJA 3GGSA 3LP5A 4QHYA 4OAPA 4GZMA 1QX4A 2ABWA 4UUQA 3PFKA 4QVIA 4N3CA 1P72A 1Y8RB 3AEZA 4PLTA 3THYB 4JVMA 3BYZA 1YE5A 2GR9A 3WY9A 3ZWVA 1UBHS 2Q0SA 3EXEB 2NXJA 4MW1A 3U4HA 1EFPA 1R8XA 3D7SA 1TQHA 3MRTA 3WMWA 3L8GA 3ZE1B 1SULA 1IQUA 2AVDA 5ALIA 4GLJA 4ZREA 3T9CA 2Z2JA 3KOYA 3ROEA 4YXWD 2D2EA 3R8XA 3S2ZA 2VK8A 1A9QA 3TG8A 3UC5A 1DBPA 2C96A 4C7VA 3WK6A 4TV8B 3AETB 5I51A 1SCUB 1JJBA 4RF3A 2P5TB 2QPTA 2GPJA 3O74A 4CETA 1LPSA 4Z6KA 1V8ZA 3C85A 3NORA 3HXQA 4JITA 3O7WA 5H4HA 3RYCB 3HXMA 1T3TA 1PV4A 3G5UA 3ZWNA 4II2A 1TJPB 1QRUA 2XUGA 1T0IA 1ETUA 3GPDG 3PLNA 2VTEA 3FNBA 5HP4A 1TTTA 3NMUF 1TF2A 5F98A 3NDPA 2EERA 3UY4A 4CZ2A 4E22A 2DJ5A 3GW8A 3NATA 3IAFA 5C5DA 2HFJA 4JD5A 4ND1A 1HL3A 3N86A 2PG3A 4B7UA 2O8CA 4U2KA 1GCUA 1WXFA 5JNUA 1W88B 4UEWA 3RNLA 5I7VA 5FPQA 4CIDA 3EFOB 4ZICA 4FM9A 2HNBA 2Q21A 1G17A 4EFKA 4O6VA 2Z4RA 5KOJA 3GVHA 4NBWA 2P5YA 5CA1F 3UATA 4K87A 3G89A 1JZTA 1OKKA 1OROA 3EMBA 3N2EA 4JNKA 3R9XB 1JDSA 2GAFA 3KHTA 3L41A 3P8ZA 2LCFA 4R5HA 3WYEA 5CX4A 4DNQA 4ZDJA 3FROA 3WXMA 5ILGA 2C4TA 3PR2B 3C70A 5E4TA 4C4AA 1DCTA 2L17A 4B35A 4EUKA 3RUAA 5JSUA 2CVHA 5KEIA 1EM8A 3F73A 3B20A 1R27A 1N9ZA 2FNAA 1SZDA 3HL4A 4HYEA 1Z82A 3QJYA 4J7AA 3PFWO 1EUCB 3UJ6A 2ZSHA 2A94A 2IPMA 1F2UA 4UU0A 1NJ1A 2ZVJA 2CHEA 2XRMA 5DNEA 1UJ4A 5IJ9B 2HIHA 2HREA 1QUEA 1Z56C 4Q3DA 1JXQA 3WWEA 4EL5A 1I4EB 1YU9A 4H4DA 4P1ZA 3QOYA 4PG4A 3SNKA 1TFRA 2DU8A 3K8ZA 4UPDA 2VEOA 3LLCA 4NEHB 5CLGA 1WUJS 3I8OA 1N1DA 2PUTA 3BGDA 4NG5A 5AWFC 5BVHB 2FI1A 4LE1A 4HAOA 2C9DA 1VZ2A 3QNMA 4UE2A 1KJJA 4G81A 4MKRA 1A0OA 2A9VA 1CB7A 3MMNA 1J1UA 5KB3A 5JH7A 5B3KA 3N5CA 5JNSA 1QMGA 1VJTA 3DQZA 4ETNA 3EY9A 1QYIA 3OJOA 1EWTA 2B7BA 1WZIA 5L53A 2HBRA 3ROPA 1EQUA 1YVDA 4KI7A 4WMLA 4OI1A 4YEDA 4RTRA 4PRLA 1JEYA 2IA5A 5C1BA 1NVMB 3HY4A 3A04A 4FE4A 5FULA 2VJMA 4R8LA 2GJSA 3EIFA 2XF2A 4JR1A 4KLZA 3R6TA 2HZ7A 1NF9A 1WULS 2EX1A 1C9MA 3TVYA 3DD5A 1IONA 1TUEA 3AR2A 4IV8A 2XWJI 2AQ8A 2C3PA 3NW9A 1PG5A 3R20A 3ETJA 1JR3A 2GZDA 1LU9A 3G13A 5ALXA 4DE5A 2HNAA 1NJ5A 2R6CA 4MV6A 1KVQA 4MUJA 6YASA 3BK7A 4X6LA 3OT1A 5B4TA 5KNDD 3K4HA 4J0DA 2G1JA 1GG8A 1JG7A 3M1AA 3RAGA 3L46A 2NU8A 1BMDA 3EGCA 3AVXA 2QRZA 1DBWA 4S3MA 3RS7A 2AOXA 5GY7A 1E0DA 2VT6A 4KTTE 2P90A 1WPGA 3OX3A 5CM2Z 4EX6A 3ZWQA 2I7CA 1FMLA 3H6KA 2BI8A 3NNDA 4CIYA 5LNK1 1LPAB 3GJ5A 3H5LA 3ORQA 1O3YA 2UZ3A 2W6JA 2XWPA 3GLKA 4B5LA 1PR2A 5A6SB 3D3KA 3MGBA 4DQXA 2WFAA 1ZOOA 2Q1WA 3B82A 4G97A 4HQ0A 4PQFA 5F5XA 3ENZA 4ZXFA 2EKBA 3LLUA 5U1PA 1JQ3A 3CXRA 3INNA 2F9MA 4EF4A 2A5YB 2REQB 3BXOA 4JI6B 2A0XA 1JHOA 2QN6A 2H85A 3ONFA 4JKIA 4EY6A 4N82A 5KJFA 2W2LD 1VLJA 2J0EA 3EOAI 1WHTB 4I1PA 3JD0A 1LV8A 1BDBA 3LYHA 3QKUA 4TMZA 3U1TA 1I51A 1OI7A 1XP8A 1G8KA 3EVDA 4ZU3A 2Q41A 2XMQA 4AX4A 3RLIA 1H8ED 1W30A 1NE7A 2EATA 3GPIA 2OCLA 3IV6A 4G4JA 4IV5A 5C4MA 5KWJA 1W46A 1XKLA 1W1IA 4LXIA 1IOVA 1U80A 5JW6A 1ZWLA 1JF8A 2EW8A 3L7OA 1D6MA 3LRPA 2WHQA 5K0GA 1UDAA 2IXGA 1LC3A 2J9ZB 1Y9JA 1ZUD1 2EHDA 4YO8A 3VR6H 2R8OA 1IYZA 5B64A 4DZTA 4PG6A 2Q4TA 3CRQA 3E35A 4WJKB 2JATA 1MNAA 3OUZA 1JSLA 3JYHA 1BW9A 3REQA 4K9OA 1U5BB 3IVMA 2FSIA 3P19A 1Z63A 2VHCA 1Z0ZA 1Z0DA 3D1VA 1ZUNB 3T7AA 3TNFA 5HUJA 3ODGA 3R24A 4N7BA 1JJ7A 3H4IA 1QCZA 3VNSA 2OCXA 2ZTVA 5K8CA 3EG5A 4U39A 5E2BA 1I13A 3R6DA 1C80A 1Q44A 5SYAA 5CU7A 4MWBA 1OFGA 3CNOA 2ZSJA 2LIPA 2HRBA 2A8YA 3MWLA 4DIUA 1RFGE 3AVTA 4AYXA 5CD1A 2HTFA 2VF2A 3I09A 3I2KA 3TYXA 5JD3A 2HYIC 4YUVA 3T9DA 3AFOA 3E5HA 7REQB 2VTDA 1L7AA 4J94A 1MUUA 4QNNA 2PBFA 1SUWA 2NPOA 1KEUA 4EELA 3DWFA 4Y6QA 5KTYA 3WJ1A 2VKQA 1OE0A 1E63A 1SBZA 3E53A 1MB4A 3TCXB 1CRPA 3W5HA 1VCNA 2JVJA 4KXMA 3KKZA 1JKXA 2YN4A 2J3IA 3X1WA 5ALRA 1PJ8A 2X9QA 2FFRA 3DVAB 1LPNA 1MJFA 4JB0A 4BIIA 5CMLA 4ZMBA 2PH3A 2OFFA 3HO6A 1RWQA 3PA8A 3T7JA 4CV3A 2FLVA 4BMDA 5L45A 4OMFG 2PT6A 1XD8A 1OFIA 4IY1A 1FYFA 1BCSA 1ESCA 2IY8A 4YK7A 1E1KA 2QMYA 3PI7A 3H9UA 3AUXA 3EGXB 4OBEA 5IJ0B 4BE9A 1TVCA 2FPIB 1I14A 2PAFA 1YTUA 1PEDA 3VO8A 4HGOA 2OXCA 3ICPA 1U0EA 3I83A 2GYWA 5COQA 3PXEA 2QB5A 2JG3A 3KHUA 2A3NA 3EG9B 3OSZA 1G1MA 2J5RA 4GM1A 5FADA 5LJLA 2JHCA 3GPLA 5IMBA 2IOQA 5I9IA 1N1MA 1K92A 4LC9A 3NTRA 1SXJA 2QLNA 2PYDA 4XUEA 1P0FA 4C0HA 3SVLA 1V16A 1YRBA 3ZYCA 3VH3A 1YD7A 3PQ7A 5FTNA 4KXUA 2YJ4A 3PE6A 4EUFA 1SY7A 1N1GA 2JHPA 5JO9A 3DMTC 2ATCA 1YGPA 3MGGA 3EDOA 4P92A 3RH0A 3TSOA 3G0DA 4E15A 3R8FA 4TMWA 1K88A 3TEFA 1ZSVA 1JPUA 5JFTA 1FOEB 2PUHA 4FFOA 3TTYA 1Y81A 2YJZA 3CEJA 2LTAA 4UTRA 5ALSA 1QVVA 3QEJA 3FKQA 4D0GA 3PUKA 3HR8A 5SYMA 5BXQC 5KYUB 3INYA 1BSVA 4WADA 1BWQA 1Z7WA 2ZZKA 3PXCX 2OO5C 2FYTA 3WLFA 3C3JA 4AO6A 2J0VA 3FGPA 3N8NA 2QXTA 2OHFA 2QX6A 5ADHA 5JHHB 3OFVA 4P58A 3UB3A 1J7KA 1FRQA 1YK0A 5FLYA 3DVLA 4DLLA 1CY8A 3CJTA 4AUKA 2GWHA 3ZUGA 1NNI1 3GJSA 4MA0A 3ZQKA 4P5DA 3P9PA 5BRJA 1I10A 3CT4A 4RY8A 5IKEA 4KC0A 5KWSA 3EUAA 2O8FA 3JZMA 4YDRA 1JH9A 3QFFA 1CZNA 5ANRB 5B1SA 4BQSA 4C14A 1QVZA 2J6HA 2G1AA 3DW1X 5JS6A 5EWJA 3F7OA 2Y67A 2AUTA 5FI1B 1ZMRA 1IU9A 1U9IA 1OU4A 4QGAA 4W7IA 4CTOA 4C0LA 4YCMA 4D92A 1DPGA 5IH7A 2YV1A 2ZRCA 1D2HA 2CYCA 5FOVA 5IHXA 1WB9A 3A1FA 4E5UA 3VDNB 5L3QB 2PMWB 3WB0A 4WCFA 2EFHB 3JRNA 4DUYB 1KY2A 3IBSA 4MKXA 2YZ2A 3GJQA 2QRVB 3ZIAA 1C2TA 1EJ0A 1PDOA 1QCYA 1HG1A 1GUBA 1X9HA 2C88A 2IP1A 1VHJA 2A4MA 2AG0A 3QK7A 3QV1A 4O0MA 5CW2A 5AXDA 3BJZA 4GL4A 4NWIA 1MDFA 2A30A 5DTMA 5DYWA 2VJQA 2Z9CA 2I34A 1XXHB 2BM0A 4RPGA 2C7PA 3NKLA 4IFIA 1MOZA 1R0YA 1X1EA 4CEHA 4LMPA 1PFUA 3RS2A 2H06A 3O95A 2MWMA 4FKMA 4UPEA 1DWPA 1LKZA 4AZ0B 3ETCA 4ZI2A 4EJSB 3QXCA 4EHFA 1QGAA 4JP1A 2FXIA 3R8CA 1E6WA 1KH1A 4K2HA 1ECPA 4ALIA 2ZGVA 5I7FA 3ORFA 4B82A 2POCA 5F73A 3WIBA 1NHWA 3KUDA 5DX0A 1MW8X 3SQXA 3DTYA 2H92A 4NJEA 1B00A 4CKWA 5KSOA 3FR7A 4RMNA 4JI4B 3S27A 2HPZA 3ANLA 4W5RA 3EC7A 4NZZA 3KQYA 1ARZA 4K88A 2KB0A 1EK2A 2XQVA 4GKVA 4U3JA 3V8MA 1LFAA 2I55A 2WPDD 3RTGA 1TNDA 1XPJA 1LNZA 2AFIA 2P30A 2RE8A 4R4JA 3WYCA 2G04A 4FMDF 1NFFA 4NLLA 3U40A 3ZZUA 2NNWB 1J2EA 3K1ZA 4OHVA 1LTQA 2A14A 2A5GA 4R3WA 1RE0A 1H2EA 1W1WA 1NI4A 2PYZA 3H16A 3WO0A 5EJ4A 2F8LA 1OYYA 4FEAA 1TM2A 4MVYA 3AEXA 1ECFA 1UJNA 5AKEA 4YAGA 2K4MA 2BJHA 3EXHB 1EE9A 3ROQA 1R1DA 2F8TA 2NP7A 1DKUA 1JR6A 3QVGB 1QIMA 1ZGBA 1V26A 3AY3A 4G5XA 1O6BA 3GRYA 4RH3A 3O3OB 3WSVA 2OAQ1 2Z1MA 4IMIB 4LIPD 1PIWA 3OQ1A 2NUTA 3NHSA 3WRWA 1YR9A 4XRGA 4IYRA 2PRKA 4AF6A 1BHJA 1EP1B 1VYTA 2JFNA 4PCAA 4Q18A 1A76A 4YXFA 2EZUA 3K8QA 1P33A 1TZMA 1WHSA 3L8HA 4YRCA 4EA6A 3JARA 1LX6A 3D8TA 2EAUA 4PSAA 1T9AA 2PV0A 3A3KA 1PZGA 2WIGA 4HH0A 5DI3B 2O7VA 3THXA 4IILA 1NQAO 4Y2JA 1T8TA 3T5BA 3V1KA 3RS5A 3SSNA 2AX3A 2ODAA 3IP7A 2HEGA 2YY7A 1NP3A 4GX1A 4KZKA 3SMVA 2WTEA 3ZHXA 2DH6A 4YMTA 3PDHA 2FMHA 2FX2A 1YO6A 4UFNA 1JDZA 2JJ2A 3GD7A 3QKIA 1ZD9A 3K0FA 3LO5A 5WRFA 3WLJA 3NB0A 5C46F 4YYZA 1CUHA 5J4VA 1J6UA 2Y0EA 4KZPA 2IELA 1BA3A 4DDUA 1BD4A 1JILA 1I6LA 3AI2A 4PGGA 3NTUA 2BW0A 4YQEA 1J5XA 1N2EA 2CZGA 2FF5A 3AZPA 3VZRA 2XADA 4YT2A 1KEZA 1G42A 3LQRA 2D4HA 2O5RA 4G84A 1TZCA 4LGVA 4Q1VA 1YCGA 4MVCA 4D9GA 5BPHA 2WICA 3MF4A 1H2BA 2JJ1D 4KR3A 2EBWA 1Z4LA 1FSGA 3N2LA 4W1SA 5KTTA 3QIVA 5EIBD 5D51S 4CEJA 4GD3Q 4IHQA 3OIGA 4YPFA 2DBVO 2BGKA 3T3IA 4BZPA 4YDHB 1NY5A 4CFZA 1NI3A 4LG1A 4RYLA 1HNNA 2PMFA 3L4BC 1VYUA 1AKTA 4D9IA 4IEEA 4KYTA 5LFAA 3QM1A 1EIZA 4K9PA 4UARA 3FJ1A 1JGTA 3RTBA 2PXXA 1JHVA 1P45A 1XCPA 2ZSDA 5F1OA 4E5PA 1Y42X 2VQ6A 2ZI7A 4RFLA 4UDOA 3NYWA 4X1KA 3L6UA 1OAAA 1RRVA 3UJBA 3TRDA 2H1LA 2ZWAA 3Q3HA 3VISA 5CXQA 1FTYA 3H5AA 2E3JA 4XWTA 1AUQA 4OFBA 5H82A 1CUVA 4MR9B 4MI9A 4KOAA 2VH2A 1HE2A 3HACA 1X7ZA 4P3NA 1EUYA 1KKLA 2QQGA 2VPZA 5IHPA 4FGJA 5BNIA 4K03A 5DM2A 1FNNA 1JJIA 3OP4A 2E21A 5FL7A 4UNNA 2MYPA 5IVDA 3BAZA 3SD7A 1XZEA 4PYIA 3QWHA 4S1PA 4LHVA 2UAGA 1QC5B 1YS1X 2YIMA 5DLQC 5I9BA 3CUSA 4P83A 4OGFA 2OSBA 1L5WA 2ZRDA 4EK9A 1AB5A 4PCVA 1G5RA 3WLRA 2WK1A 2X14A 1ODLA 4CKEA 4YMVA 3PZBA 1TTHA 4OHUA 3D64A 2QN1A 3BH6A 5CCBA 1GV1A 3CLHA 2J4CA 2XQKA 3D2AA 4W63A 4QM6A 2WUFA 5PNTA 4UU8A 3IE1A 1UDWA 4IVRA 1SR8A 5J1TB 3LQ2A 3ZC3A 2DYKA 2QUAA 2HDOA 3VPSA 2MSNA 3U9LA 4EO7A 4PRZA 5DPMA 5B3JC 2JIBA 2YOGA 4J0CA 2NSJA 2RKOA 3M34A 1WB5A 2O4CA 2VYCA 1JIXA 2ZDQA 5AW6A 3V2UA 2V1XA 3IP8A 3U7QA 3KPJA 4U7HA 4QE3A 4DLYA 4EPRA 5A3QA 2NT4A 5EWLB 3ZDBA 4JFRA 3DV0B 4D41A 1PTJA 2R7KA 2WIBA 4FKBA 4WACA 3U9TA 4AN4A 4EY7A 2X9GA 1ULUA 4IRUB 1N8NA 4TL8A 4DRXB 1VPVA 1K2WA 1GL7A 2RH4A 3ITDA 1LBQA 3PC6A 4EGJA 3GLVA 4L07A 4F96A 4QICA 3MJVA 5GV8A 3HP4A 4DIOA 4LFAB 1I4WA 2EKZA 4Z8XA 3IIKA 2WU8A 1TIKA 1Z8DA 3AFHA 3EN0A 3O4VA 4QLAA 3G49A 3RV3A 4WE3A 2IH5A 3O21A 3ORHA 2HHCA 2Q4DA 4LK3A 3PDWA 2O5VA 2EX4A 1H0KA 3HRHA 3L7CA 4LWOA 4MAMA 2OORC 1P3Y1 1YZFA 4NPCA 2WG2A 4JLWA 5A62A 1FNCA 2LCQA 3N2KB 1GFZA 3EPLA 2HC9A 3U09A 1R5OA 1L4UA 2COEA 2XYGA 1ZVJA 3MTJA 1PG0A 2N1BA 3FYUA 4UZFA 5JSQA 1YOVB 3DL0A 4FNOA 1XXHE 2P8SA 5ALFA 3WGYA 1DV1A 2PPLA 2Q1UA 1P0MA 3PRYA 4H3VA 2ZJ3A 2JI9A 3VH1A 4EG7A 1GD1O 2W90A 5IEJA 4B8YA 4RMIA 2B61A 4ARZA 1VKJA 3KX2A 1E2PA 1TZKA 4O4HA 3VPBA 3DOUA 1KK0A 3E0XA 5JDCC 4DLBA 3TQCA 1Y3BE 2J3LA 1SO8A 2PAAA 3DKIA 3P9RA 2VHWA 3BFJA 2K7ZA 3S2YA 1M1YE 4K1XA 1U4NA 2JBAB 1N2CB 3EPKA 3BSSA 4NTZA 4COKA 3BULA 3QGMA 1XNQB 2G82A 4EKGA 5I4BA 3L0DA 4ND2A 3L79A 3NAMA 3OEHA 5LYJA 5GOZA 2RGAA 2ROQA 3DC2A 3FVRA 4HGYA 5CGQB 3TPZA 2PM8A 2QAIA 3O2NA 4KO4S 3SYLA 1H9AA 4XJXA 4Y6LA 5IM4A 1XVVA 4N7JA 3TKLA 1V35A 2QTVA 4B71A 1DJLA 1E62A 3NHRA 3WRXC 2DLCX 2PZGA 2CF5A 1W8IA 2ATVA 5TJHA 1UAGA 2B8TA 2V6IA 1NV9A 1ZSNA 3DBOB 4UMDA 3ZWPA 4K8OA 3OTOB 2I91A 2E49A 3Q4GA 1EBFA 1J2TA 1OJLA 1D6JA 4B33A 8ADHA 1RRGA 3FJOA 3HDQA 1VYHA 3EGDB 3MUOA 4QWMA 2PVPA 2V7GA 3AHCA 2PX4A 2YWGA 1PGJA 1NUSA 3V4PB 2OECA 3ER6A 3U1BA 4XUGB 2JAHA 3CQ9A 4F6RB 9LDBA 1YL6A 2CWWA 5J3JA 1HKHA 3DBHA 4F86A 5AJTA 5HKAA 1G3IA 3RUCA 1D9XA 1N2GA 1IZ7A 3JYQA 3R3YA 4JLOA 3SC2A 2HD4A 3WYAA 1WRBA 2LUOA 2IXTA 4URUR 3DTTA 1IBCA 4W8OA 2FK8A 4EJ0A 1FPQA 1Q15A 2O7RA 3A1WA 1NX9A 3OSUA 5E6RB 3RO7A 4CYMA 4FBLA 5EE3A 5E9AA 5B7NA 1KQGA 2XUZA 2RAPA 3A1DA 1IIRA 4FKZA 4DJFC 1KQPA 4G89A 4LHEA 1B0ZA 2RG7A 4YJHA 1U65A 2RB5A 2VDNB 4ZDWA 3FIJA 5JMTA 5EKTA 1VPEA 4DR6B 3D54D 3PCXA 2D13A 3BWVA 4BCBA 3I4FA 4OBXA 3A37A 1GPYA 1SB8A 4XVRA 4Q7LA 1HPLA 4NMLA 1BGWA 3N6RA 3WICA 1JEQA 2V5UA 3NTVA 3U26A 3ZCPA 2HLDA 2B4RO 4PTZA 5LB2A 1NBWB 2R6GA 1YDFA 4LY9A 1E1CA 2JCGA 3N2YA 2VL7A 4DUPA 1Q92A 4WKCA 4AJEA 4DSZA 4HQOA 1T9BA 3IJEB 4JOCA 4TSFA 1YJCA 2GNAA 1DO8A 2FPPA 4P84A 1ORHA 2ATIA 3A6DA 4P86A 3QE4A 4UD2A 5AXAA 2DUMA 1OZHA 2PY6A 2Z5FA 3MFYA 4L4UA 4OI4A 1W36D 4B3TB 3AESA 3NHBA 4HXYA 3H8VA 4NVRA 5HIIA 4ZQIA 4LJ4A 3IVXA 1CT9A 3ZK8A 4HI0E 2PDAA 2QY6A 2IPOA 5JD4A 3GJ8A 5HGJA 1NWCA 4YAJA 4B6PA 4BLUA 4J07A 1U0GA 4KKVA 4MI3A 4W8HA 1FNDA 3H86A 4DM7A 1LLFA 2IBMA 1SEPA 2Y9PB 1I0LA 2ZR9A 3G0OA 5T3YA 3DHYA 5I8ZA 4CF6A 3GAMA 2J3DA 1URPA 4BHTA 4YRDA 1SKYB 2GKGA 1YCDA 4FGLA 1NU8A 2CCGA 5KU7A 3L4JA 4YAFA 3LRTA 5CJJA 1DAEA 1Z2PX 5DWVA 3UH0A 2GNPA 1K5GA 3PWSA 3GFTA 5B30A 2C77A 4GE0A 3V46A 2CNWD 4ENRA 2Q3HA 1UZMA 4NC9A 4TRRA 3ZIDA 2YVAA 1XMJA 2BT4A 4FYMA 4BAGA 4BCDA 2O8DB 3UB2A 1WR8A 4IIXA 4TS3A 5DHAA 1M1UA 4JSRA 2H51A 2YVKA 2AR7A 3PSHA 3BC1A 4LJYA 3WIEA 5M29A 3A4IA 2JJQA 4L50A 3ZQUA 2NVUA 2E55A 1L5KA 1YRWA 2JRCA 4KQFA 1M8KA 5BVGB 4M9RA 2ZJAA 4E1VA 2WHPA 1DJQA 1RWBA 1JE0A 2I6TA 4MV7A 4HBZA 4DN6A 3HJCA 4YP1A 4F5YA 1Z4IA 3JQGB 5KYYA 3K92A 4G07A 3JASA 1R9NA 2WF6A 2WJ4A 3DNMA 2NPFA 1IHDA 4BB9A 4OOFA 2H7XA 3B53X 3CZ4A 2REOA 3GO4A 4O3MA 3P96A 5FI5A 3EARA 1CUIA 4JT9A 1O6GA 4RVGA 5HHTA 3R5JA 4MW9A 2ST1A 5AVQA 3HJBA 1FTQA 1USVA 4F0JA 1FFAA 1ZM4A 1M72A 5AM0A 1VHWA 1YR3A 3BMQB 1AF4A 2HK9A 3LXUX 5HM6A 2W58A 3F78A 4YJDA 3SP1A 2ORYA 4CMIB 1W9HA 2BMAA 3GFSA 4E12A 9GPBA 2RHLA 1O97C 3ZBUA 3WRXA 1GQYA 4PLHA 2XITA 4BN4A 3CPJB 3LOQA 3G9XA 2FN7A 1GPDG 1IAQA 4IW3B 1T4MA 2IU6A 1SBHA 3HI4A 2V65A 3WQHA 3NGXA 3AM5A 3T7EA 3MQ4A 3ZGVA 3HXLA 3LRXA 1U0SY 3E1SA 3RRMA 2IEZA 3SZ3A 4BGDA 1WW8A 3PKIA 3GROA 5IBPA 2YICA 2ADFA 2IIVA 2VG8A 3BPSA 4Z9AA 2V9CA 3SBOA 3M9WA 1UEXC 4L51A 1KBQA 1K7EB 2PSEA 3DZJA 1ZHHA 3K09C 4GRAA 1HQYE 3NTOA 4H3SA 4XR4A 2X8AA 4C4TA 3H3JA 1MB9A 5JDCA 5FO0A 3DFFA 2DWOA 2R1UA 3F3KA 3PNBA 1UKAA 3AY0A 3Q12A 4NP6A 3Q10A 1CP2A 2MR6A 4IJQA 3J80A 4UCXA 4O4JF 1BFUA 4PR0A 3U3RA 2V4ZA 1F8FA 2NGRA 2GN0A 4BP9A 2VZ0A 3OHSX 4J0HA 3QU4A 4TV8F 2YV4A 5G3YA 3ZKWB 3K96A 2EVWX 4RE5A 1I9CA 3BD9A 2DERA 2BGTA 4HR7A 3LXXA 3N6VA 5FNVF 3IEKA 3WLOA 4V24A 4F56A 2O5CA 1EJBA 1JR4A 1VL8A 2AUNA 2IW3A 4OXRA 2JFHA 1N6HA 4TT3D 1VYVA 1EXWA 2VRBA 5IK2D 3IVRA 3DFZA 1XPRA 2OORA 3NAZA 1C0PA 2DETA 3I4CA 1HDGO 1BYUA 1S5PA 2VR1A 3KPWA 1DI0A 4XYEA 2P1DA 3A2MA 3ABOB 3AJEA 3WV5A 1AKQA 2AQKA 2GASA 4CCYA 3GT7A 2BOVA 4DJ5X 3PS9A 3RIMA 4E70A 4EFNA 5HNKA 2ACWA 3BXEA 4QUIA 2D5CA 3EC1A 4F7WA 3HFGA 5HTOA 3MHPA 2O2GA 3GI1A 4XYMA 3CV3A 3T9BA 4P5PA 1ISPA 4QO7A 3WWCA 4AJPA 5CDHA 5EJMA 4RVSA 1NFRA 2B1QA 5G4LA 1ULHA 1FLDA 3S1LA 2H1OA 5CVTA 1RP7A 1UJ2A 2AL7A 3NHJA 3FPBA 3BWEA 4Y6RA 5UKDA 1KWGA 2UYCA 2IZOA 5FA8A 4I4CA 3KQMA 4GOND 4TXNA 2I87A 1I7DA 2EV9A 5CVJA 1OLSB 3CVYA 4W1QA 4LJ9A 2LE0A 3HN6A 2APJA 3R5TA 4K9LA 1UCFA 1EWKA 4JFAA 1WNTA 5D5QA 4ZCMA 1TT7A 1JFTA 3TEMA 3WOHA 4TSKA 2QTZA 1EZ1A 4DMGA 4KPYA 1XKTA 2BGJA 1E6CA 1ZPDA 2QLMA 3I12A 2V7XA 3BJIC 1M1NB 4ZEXA 2H4WA 3H99A 3I53A 3PKJA 2B21A 3R1IA 3U0VA 3V48A 4BQQA 1CNFA 1E0SA 3NHUA 3GLFA 1YR6A 4HNSA 3KUKA 2ESRA 5F9FA 1LI5A 4B3BA 4BMPB 1H2HA 1N32B 3NHLA 2C3YA 2WAMA 3NUZA 3EA5A 1TU4A 1JV2B 2P9EA 2BUBA 4YNBA 2Q5IA 1O7JA 2EX0A 5DWDA 3S81A 4IXNA 1B76A 3PIIA 2ERXA 4Z9YA 1CQIA 1XZHA 3A6ZA 3PEYA 2IYPA 1AS3A 4Z4GA 4XXHA 3N8DA 4WBNB 4MLZA 3O8DA 5C3MA 1NAIA 3FSJX 4GM0A 1N2SA 3BE8A 3FRHA 3RVLA 5LLSA 4ENQA 1XPOA 2R8ZA 4CMEC 3H2YA 2HDWA 3MT9A 3FOFC 1ZD2P 2D62A 3OU2A 2WNHA 4IXMA 4UBJA 3WQSB 2OGWA 1CZRA 1YBAA 1MT0A 1W96A 2ZITA 4UHDA 5KJ1A 1BVUA 1XD2A 3EOBI 3OLZA 4WKPA 2XGOA 4L9RA 4Q9KA 3MLBA 3ECSA 5AW9A 3FGOA 2ZRLA 2PRJA 1RPJA 2YHSA 1QBGA 4XGQA 5AK0A 1RACA 2PS0A 3X0DA 1I24A 1L8QA 6AT1A 3GUHA 2P0AA 2PKQO 3IUYA 4EP1A 4N3AA 1L5HB 3A28A 3MCTA 4K26A 3ZLTA 1OWNA 4UTNA 2H4JA 1ZM7A 1E1QA 2ORVA 3V8NA 1JDNA 4R71A 4BASA 4DUGD 3GP5A 3DDNA 1A4XA 4XGIA 4PSDA 3V42A 1T2FA 5K3FB 3GEIA 5IAGA 5C53B 5LBUA 2NN3C 4QRIA 3KSRA 4TMVA 1GQRA 4ZVPA 1ODKA 2XNHA 5ESDA 1HYGA 3C1TA 3VUEA 1E99A 1JL3A 4GP7A 2FSHA 3RRYA 5SY9A 3CGWA 3O8RA 1ZGAA 2FPLA 2WU4A 3GDHA 1EWRA 5AJWA 4QT0A 1U04A 1ZMXA 2XMPA 2Z04A 1ONSA 3C6MA 4R69A 2RHDA 5K0LA 1ZI8A 2X0NA 1Q7BA 1X9IA 4IX1A 4MPDA 4ZRDA 3LLMA 1JQEA 1I3NA 4UHHA 2W2PA 2F8MA 1NXOA 3DEHA 3GFPA 2OXTA 4F60A 2OV8A 4ITVA 4YP5A 4GBED 4L5AA 3QOXA 2ZS9A 4NARA 5TMPA 4KGVA 3BH0A 4K6MA 1L3CA 1NONA 5G4KA 2B1IA 1UPCA 2O0JA 3OKCA 3Q15C 1X3LA 4N03A 4Y6GB 3B2NA 3TLZA 4ASUA 4MGZR 1J33A 2ZWOA 5A9RA 2BELA 3VHLB 3WRYA 3HYCA 5IW8A 3K0CA 1QONA 3FI0A 3ESZA 3BIFA 1M7HA 5HWSA 3K5HA 1D4ZA 3RU9A 4KQ2A 1RKUA 1LLDA 1OTYA 1Z25A 1TQDA 1OTHA 1QZTA 1IUOA 1GILA 2JH3A 2XQIA 3HXTA 1O96B 3OOWA 3QYJA 4NU8X 2GTHA 2XVXA 4PFQA 2HCRA 1QH1A 1E4EB 5ICEA 3G02A 4LTNA 4NMXB 5C37A 1TM3E 2QVYX 4GX0A 3N7TA 3SZRA 4K9NA 3U9SA 2W6IA 3JD3A 2QTFA 4X93A 2QQ5A 3D9QX 4DPKA 4EVQA 5BUZA 1O2DA 3FHCB 3Q9LA 4Y0AA 3DAGA 1Z2DA 2ZRIA 4LQ4A 2M2IA 4O2RA 4PXSA 2GVZC 4F9TA 1UJBA 1V6SA 1YIOA 2FUCA 3M6UA 1ZAYA 1BGVA 5DRYA 4DT1A 3DUFA 1GTMA 1IWPB 2BTQA 2K5UA 3GN2A 4CM5A 2PLAA 4MEJA 3UA3A 3VPCA 3B8HA 3CLKA 3ML1A 4P80A 4ZD6A 4QBHA 1C14A 2C59A 1F1BA 2LR0A 4QYTA 4U9HS 2FMFA 1LDMA 4R1MA 4RXTA 3NTXA 3D6FA 2IJGX 3ZXYA 1P2UA 1E3EA 1TQ8A 3UF0A 2FHPA 4F46A 4QFMA 4RD1A 1J0CA 3VR5H 4O1HA 1EESA 4F2HA 3THWB 4OJYA 4L15A 3BSFA 1AKRA 4ZT3A 1DDIA 4W7HA 3IMFA 1LBHA 5DM0A 3ZHZA 4FLMA 5K3AA 2X2EA 1T25A 1XEXA 4JELA 2GF0A 3D4NA 3AKYA 3DNFA 1E7WA 2X86A 4YFYA 3ZLVA 1Y4UA 3R6LA 3M1LA 4M87A 1TIPA 2PX2A 2V7WA 3WDKA 2J3QA 1LQUA 3I73A 4M55A 4QYIA 3AM3A 4WLEA 3S4YA 1KK2A 2B36A 2VS1A 2YQ5A 3FCUB 2AEJA 3NP7A 1RXIA 3EQ8A 2B34A 3H83A 2J6BA 1KY3A 3WGIA 4W1PA 1KETA 2ZPUA 1GFWA 1YIAA 2NUPA 2UVDA 2VJPA 3TXYA 4XVCA 1NVGA 5BN5B 3PQDA 1EJ6A 4NCJA 2XXJA 3JALB 1E5DA 2M9MA 3IAM1 1AU9A 1R0WA 1OU0A 4I55A 2Z1DA 2WWIA 5AOCA 1RZUA 2BHNA 1F12A 1P0IA 1SD2A 1R4NB 1SXHA 1Z5VA 1YVUA 1C0KA 2UZIR 3K0EA 3LFHA 2NUAB 4ZGBA 1IAVA 4EA9A 1A7AA 5HX7A 3VMMA 4M21A 3DV9A 1IBLB 4IL5A 2CUTA 1JDTA 3II6X 1O4VA 1WG8A 4HDSB 3S1AA 2WJWA 5JE8A 1ACJA 5B3LA 5ADWA 5NLLA 4PZ0A 4C6TA 3RIGA 1V45E 2QHXA 4U2FA 2WWRA 4Q6WA 4ENWA 3L4EA 4O2BB 4LNUB 4QQNA 2TMKA 3UJ9A 3KVVA 421PA 4KQCA 1K7YA 5EJIA 5B4UA 1IB6A 4IIJA 1GG9A 2OO7A 2LDXA 4PFJA 3ZDAA 1ZX1A 1K68A 3FBGA 3KWMA 4GQAA 2XVAA 1JDVA 2AW3A 2ODEA 2EU8A 3NT5A 3BXXA 4NONA 3VC1A 1V1MA 5LD2B 4BQFA 1D4FA 1ENZA 4BLQA 1R74A 1LX7A 4M76B 1Q1QA 1KSHA 1LDEA 2XODA 3DOCA 3HDGA 4RZQA 4CLHA 1YDMA 2H5JA 1M2HA 1T8WA 2IX3A 4MW4A 4JH0A 2QYTA 2FJPA 5JSZA 4BN5A 3RF6A 2NO5A 3G68A 3DFIA 4TWAA 3BA6A 3ZS9A 4URFA 5IWAB 2ZAOA 3B3GA 4MGIR 1YS2X 3G7SA 3CH4B 2VC2B 1P4GA 1TTQB 2WM3A 3IAXA 1P1HA 4GVXA 3RIHA 1QE0A 4DSOA 2JFYA 5CG2A 2JAOA 1D1TA 2F8SA 2II6A 2WIAA 4RFSB 3RVKA 4G1BA 4V2UA 5J5CA 1FZTA 1MXHA 4KXWA 3OLXA 1PJQA 1ZH8A 4IG9A 2WUEA 3V3KA 1E3LA 2VWGA 2FWAA 5F33A 2FW7A 4D9NA 1KNXA 2EGUA 4PYRA 2CLCX 2QSYA 4FHFA 4QODA 2PS1A 1ACMA 3KJZA 2GCEA 4XWAA 4IH4A 3NIFB 1G63A 1PUJA 3DMYA 1JLKA 1KJNA 1TD9A 2PZBA 3ELUA 2B7LA 3CRZA 4MVJF 2VP3A 5D01A 5FXMA 1L7RA 3RIXA 3MWJA 3ZNPA 3B1ZA 2R65A 4YV1A 5JNVA 1M8PA 4IHJB 1VBMA 3FPJA 3O38A 3OFND 4I1YA 4JNCA 4ZEWA 4JYPA 5IH3A 4AULA 3UICA 1I33A 3L8DA 1UC4B 3N3BC 2B3DA 3W5UA 2JEYA 1XLVA 3GV0A 4JIMA 2D8MA 1AX9A 2XVMA 4DM4A 1QYCA 2G63A 1O57A 4ZO4A 3DXZA 5BSKA 4XWOA 3D6NB 1LI4A 3PVCA 3TJMA 1BWRA 1VL5A 2I2AA 1NR7A 4URWR 4G0YA 3IYLW 4ID9A 1Z8HA 4MIEA 4YTEA 2JHAA 2QL7A 5FIUA 4JYZA 4LUCA 1T4CB 2HX1A 3WSTA 3LKDA 1AZSC 2EP8A 3ETNA 5EJGA 3O8CA 4LCBA 4XTRA 3K9FC 1Q17A 4YRQA 4F3TA 2YH2A 4KWCA 1SU7A 4BO7A 2PA3A 4JLDA 5FO1A 1HNWB 3EVZA 4FMBB 4G0XA 3IKJA 2ICAA 1C3LA 3WNCA 1SEVA 3OHMA 3ZQJA 1RBYA 3A1SA 1ZJYA 2Q3BA 3ONDA 2PKWA 4FFMA 2DUJA 4PWYA 1RXWA 4UDNA 1OFVA 5FWYA 4ND4A 1Q14A 3G23A 3KQWA 1KDRA 2EQAA 3QYAA 2XTMA 5EE0A 1OPRA 1VSTA 3NIBA 2DFLA 2QM8A 4FMCB 4IGIA 2P41A 5GJVC 1T3GA 3MJRA 4KGXA 2CN1A 2RH5A 4JJGA 3EIQA 5G53C 5HUQA 3I52A 4DDTA 3KZXA 5E2AA 2W4QA 3WB1A 1LDBA 4Q7JB 4MO9A 3KYCB 4MVJG 4GX2A 2GAJA 1XG5A 2O8VA 3HBMA 3PJGA 4HJRA 5CDFA 3W1VA 5BQ5A 1UFRA 2HTEA 3VYWA 2GSDA 5HPYB 4XQ0A 3FUWA 1PJAA 2RBEA 2YHAA 3KWFA 3FCOA 5GIOE 2AN3A 2CY0A 4FSDA 3WIOA 2K2QB 3AUUA 4ND8A 5TEVA 4AL4A 3AUFA 3DFUA 3S8EA 1LBIA 2LPMA 4IAOA 3L8EA 2I7DA 1UFOA 2CV0A 3HABA 4EPWA 3C1UA 3RC8A 3TAXA 2JGNA 3IH5A 1EVZA 1GZ4A 1Z6TA 2EZTA 3IUJA 5D7NA 1Z0JA 4OVKA 5AQEA 2FZWA 4N0QA 1P4AA 3ACCA 1U7UA 3CH7A 4V39A 3QEAZ 1NQ5A 4PLCA 1FSFA 2B82A 5EHZA 1GTRA 4GZLA 1QFXA 2ZUWA 1SQSA 4HDNA 1N25A 1OZFA 2AEMA 5KMGB 4OI0A 1DG9A 1AOXA 5CVEA 3JZIA 1JA1A 1L7QA 1ISRA 1E60A 1HEUA 1QHXA 4JLAA 4UDXX 4A8PA 4JCOA 5H4GA 1EGMB 2ZUBA 3BZBA 2UZ1A 5BV1A 2IKQA 3K15A 4Q9AA 4BBAA 4EJFA 3ZDYB 4MW7A 4PGHA 4F1JA 5I4IA 3ONNA 1MC4A 1UBTS 2NZWA 4MHSA 1JZQA 1KYYA 1SIOA 2C9CA 4TRJA 5ALPA 5J2TA 5LP6B 2BGWA 4Q1FA 1J2RA 2DUWA 4Y1EA 5DNDA 5DSTA 1K89A 4ZCPA 3EODA 5BSMA 2PRZA 1AXEA 3AG5A 4IRMA 5NULA 2I6QA 1OVGA 1N0UA 5FUXA 3E70C 4RU1A 1KAEA 1EFDN 3C6KA 2VSXA 3NT4A 3HL0A 3M6VA 5G2OA 5HIKA 3V97A 1ZMBA 2ACVA 3ZN2A 4B3XA 1QHNA 4UM5A 2DQSA 3U37A 2HF8A 3RAJA 1YFKA 2GI4A 4UM7A 5EMNA 4P4TA 1QWOA 3SAJA 4OQZA 1BQEA 3SK0A 5FD8A 3DL2A 2F1IA 4HEA1 2FSSA 3UC9A 5BWMA 3ZE8A 2Q3FA 4F4CA 2WRZA 1EFCA 2GCGA 1KRHA 2A1UB 4GPZA 1VCOA 2OHIA 2O6HA 2RHMA 1A77A 1V8BA 1P3DA 2IE0A 5JAIA 1UMBA 2BIFA 2XF8A 3OU7A 3BGSA 2IYZA 3WYDA 2H0QA 3E05A 3GPBA 5CFMA 1SN7A 3CONA 1XEWY 1ADYA 4XDHA 1CIVA 1R4ZA 4C76A 5CDYA 3R3XA 4MQ5A 1NMYA 3ZUPA 4RZXA 3MCWA 1G38A 3RC1A 1EFAA 4OGWA 1E3DA 3ND8A 4I1UA 2Z4TA 4MA5A 4PLFA 3NRBA 2G88A 4NENB 2HDHA 4D0LB 2YWDA 1V47A 2GF9A 1H66A 4ROSA 2WPDA 4YJGB 5DN9A 3EULA 2G1PA 2P2GA 1EQAA 1TYBE 1ZS9A 2XYHA 1JBKA 5LP6C 2AOTB 2B8EA 2VAMA 3R7BA 2BMFA 3SR4A 3AEUA 4Q9HA 5IF9A 5AYVA 1E9BA 2G8NA 1ZD1A 2G5TA 4ISCA 1CR1A 1C8VB 3SM9A 4ZHQA 4P35A 4Z3DA 2VAXA 1J23A 1OF1A 4ESVA 3IMEA 2BY4A 3RNOA 1G20A 3KCNA 1KH2A 2FN4A 2CUZA 4DRZA 4DQVA 2X2FA 2IDKA 3Q3GE 4Q16A 5AESA 1IEVA 3G5LA 2XNJA 1G6HA 1YE8A 1RJFA 5H83A 4EB8A 4OXXA 1E1MA 1J0AA 3GJ4A 4US2R 1N2JA 3ILXA 4YHBA 4JC8A 2Z9DA 5I3CA 1SKAA 4KL8S 3U7HB 2Q6TA 4FYVA 5FPSA 1QP0A 3OZRA 3R74A 3V8BA 1FRVA 4O63O 5KSZA 3FIUA 4O2BF 4S05A 3VAYA 2SNIE 1O03A 2PR7A 4FFRA 3BFKA 3PB3A 1O8CA 5L7WA 5ESRA 3DHWC 4NU5A 3F8WA 3ZGNA 5HJ5A 2V7QD 5KQPA 1W581 5IT9A 1ULAA 1LRKA 1V71A 2ZXUA 2FSGA 4K8RB 3NWEA 4BB6A 3ICEA 2P4UA 1D2GA 1W35A 2Q8PA 3CLSD 3OJ0A 4NH4A 4NR0A 5FQNA 2JI6A 4LXHA 3TMYA 2G4CA 2D0DA 3OPYI 5BV7A 4AWBA 2YUIA 3WBKA 4TLCA 3H5TA 1UBNA 2V5VA 3RJZA 1QAQA 1L6RA 5BRAA 4EW6A 2M1ZA 3SYTA 2OV3A 5FFMA 1Z28A 3DNPA 1SB9A 5T8KC 3MELA 4OLJA 4Q19A 5KWVA 4TLDA 2W70A 4EM6A 4EW2A 3V4VB 1PDVA 2OO3A 4LX0A 4UPVA 4OYLA 2R8PA 3CX3A 2R751 4JGBA 4S12A 5ERXA 2JLVA 2CJWB 2H08A 1EKXA 5IJXA 4WZAA 4WNAA 1KO5A 1XK7A 1ZJ4A 1DC5A 2AXEA 4A23A 1OASA 3FMIA 3SF8A 3FNRA 3PXAA 3ZGLA 4UVIA 5FHQA 4M89A 1U3DA 1N6RA 1QLWA 4FZ3A 2J6CA 4IR7A 1ADFA 1PGOA 3VGPA 4A8TA 1QOPB 4E6PA 1DQZA 3KU1A 4LFCB 3HN7A 2GRAA 4DY6A 5HF9A 4HADA 2QJFA 3TM5A 3UV7A 4DCCA 4X8OA 1II8A 4IG4A 1U2RA 4YREA 1K8YB 1O0SA 2ONKA 4D46A 3CVXA 3I34X 1W0KD 2J31A 2Q46A 1HZZC 1SU4A 1Y9EA 1Y1LA 2CKMA 2VNSA 4R98A 4NBTA 1XNRB 3MBIA 2VYVD 3BZUA 4KFSA 1Z5PA 1KQOA 2ZBDA 1E8NA 3NIDB 4H6VA 3ROMA 5GIPE 1M5RA 4P34A 4M60A 4L22A 4TOIA 5BV2P 1JYFA 2Y6VA 4BGVA 1WY7A 3VX4A 1H2XA 1B3BA 3CZ9A 1SWWA 3LX6A 4DWWA 4YRSA 2XLBA 3DYIA 3Q3VA 3A4YA 4IDDA 2DFTA 2C8KA 3C98A 2HEIA 3PTLA 4E2YA 1H05A 4FPXA 1UKCA 2L0XA 3BB4A 3CM0A 4XJVA 3SQDA 3UB4A 5CRIA 2F