3T89A

Crystal structure of escherichia coli menb, the 1,4-dihydroxy-2-naphthoyl-coa synthase in vitamin k2 biosynthesis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
285
structure length
270
Chain Sequence
b'MIYPDEAMLYAPVEWHDCSEGFEDIRYEKSTDGIAKITINRPQVRNAFRPLTVKEMIQALADARYDDNIGVIILTGAGDKAFCSGGDQKHLNVLDFQRQIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAADNAIFGQTGPKVGSFDGGWGASYMARIVGQKKAREIWFLCRQYDAKQALDMGLVNTVVPLADLEKETVRWCREMLQNSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGRNAFNQKRQPDFSKFKRNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,4-Dihydroxy-2-naphthoyl-CoA synthase
publication title Mechanism of the Intramolecular Claisen Condensation Reaction Catalyzed by MenB, a Crotonase Superfamily Member.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 100
structure length 270
sequence length 285
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 3t89A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3t89A01
2ZL2A 3QXZA 2DEOA 2IEXA 1N6EA 2J5GD 3PE8A 1EF9A 4ELSA 3P5MA 4U1AA 1K32A 3KTHA 5FUSA 4F47A 1XNWA 2DUBA 1UYSA 3ST9A 1HNOA 1ON9A 5INIA 4EMPA 1Q52A 3PZKA 2VSSF 3HP0A 3BPPA 3HRXA 5DL1A 3TVUA 2J5GA 3OMEA 3KTJA 3LAOA 4DI1A 2C8TA 5KDRB 4QFEA 2D3TA 2PPYA 1Y7OA 1XX4A 2X24A 3R9QA 3OC7A 4ZDDA 1HZDA 5E0SH 1YG6A 3H0JA 3T89A 1FC9A 2J5IA 4RYFA 3GMAA 4K29A 3Q0GA 4FN8A 3PEAA 1RJNA 3K8XA 4JJTA 2A81A 3T8AA 4U0GH 3MOYA 1DUBA 1VRGA 1SG4A 4KWBA 4QIJA 3R6HA 4G2RA 1UIYA 5JBWA 5DZKA 4WCZA 3Q7HA 3Q1TA 2F6IA 3T8BA 4GHNA 4LK5A 4JYLA 5DUFA 3BF0A 4K2NA 3RRVA 4JCTA 4B3HA 2A7KA 3PGQA 1XO6A 2F9IB 3RSTA 5G1SA 3R9SA 1UYVA 2VSUF 5JBXA 2GTRA 2ZL0A 2FBMA 4K3WA 1WDLA 1YG8A 4FZWA 3QXIA 4I52A 3MYBA 4L8KA 5KJPA 2FW2A 4ELWA 4MXIA 3NJDA 1W2XA 2BZRA 3K50A 4ASIA 1RJMA 3QK8A 1OD2A 3G64A 3KQFA 4Q1IA 1FCFA 4NNQA 4FZWC 3WG5A 4I42A 4MI2A 1JXZA 1UYRA 2Q35A 4NEKA 5KDRA 3QKAA 5C9GA 4ELXA 3FDUA 1PJHA 4WYOB 3TZ3A 2ZL3A 1TYFA 3ISAA 4JFCA 5DTPA 5DU6A 2VSSE 4EMLA 4OG1A 1WDKA 1N6FA 3BEZA 5MGBA 4RYFH 4JCQA 5E0NX 1O8UA 3GKBA 2CBYA 2J5II 2X58A 4KPKA 1XNVA 2EJ5A 3QWDA 1FC6A 5DU8A 2VREA 5DZKH 4FB8A 5G1QA 3ZWBA 2UZFA 3LKEA 5DU4A 4RCNA 4JCSA 3QYRA 2VSSA 4OMRA 2QQ3A 3R9TA 2CE3A 4JCRA 5CTCA 4JWVA 4JOTA 1HNUA 3RSIA 3QMJA 2FZSA 5CTBA 4ZU2A 4IZCA 2F9IA 2NP9A 3JU1A 4FNDA 3ZWAA 2VX2A 4U18A 3TT7A 2WTBA 3R0OA 4ZDEA 3MFMA 3KTGA 2Q34A 4MOUA 3H0QA 4IZDA 3OT6A 4I4ZA 3KTIA 3HINA 4L6WA 3V5IA 3FF6A 4IZBA 5INFA 1X0UA 1WZ8A 3VIVA 3M6NA 3T3WA 4HNKA 2VSUE 3TRRA 2PBPA 1SZOA 1ON3A 3P2LA 4HC8A 3Q0JA 3N6RB 3TV5A 3DORA 4KNPA 3U9TB 3ZW9A 3GF3A 3GF7A 5DUCA 4FJWD 1K39A 3TLFA 3DJAA 2HW5A 1XNYA 2W3PA 1UYTA 3TT6A 3H0UA 1WDMA 2PG8A 3P85A 3U9RB 5DTWA 2ZQQA 3TVWA 1EF8A 3SWXA 4EMMA 3NJBA 4B3IA 3IAVA 5IKLB 2VSUA 4QIIA 1MJ3A 2J5SA 4FN7A 3U9SB 4Q0GA 5C90A 5FIFA 3TDCA 4ZDFA 4ZDCA 3IB9A 5E0SA 3STAA 2A7SA 3H02A 3MT6A 2J5IB 3HE2A 3T88A 5DKPA 4Z0MA 3SLLA 2VSUC 3ZWCA 2ZQRA 1FC7A 1PIXA 3V5EA 4U0GA 3KTKA 1J7XA 3HLN1 1TG6A 4JYJA 3IBBA 4KD6A 3M6MA 4ZDBA 4FNBA 3GLMA 1DCIA 2F9YA 2F9YB 4JSBA 3ZW8A 4OLQA 3L3SA 2ZL4A 3H81A 1EY3A 4U19A 2F6QA 2Q2XA 4JVTA 1OD4A 3I47A 4YLHA 1Q51A 4GM2A 1N6DA 5G1RA 4U0HA 5INGA 4WZ8B 3H0SA 4B3JA 1NZYA 1NZYB 3QREA
chains in the Genus database with same CATH superfamily
2ZL2A 3QXZA 2DEOA 2IEXA 1N6EA 2J5GD 3PE8A 1EF9A 4ELSA 3P5MA 4U1AA 1K32A 3KTHA 5FUSA 4F47A 1XNWA 2DUBA 1UYSA 3ST9A 3W8HB 1HNOA 1ON9A 5INIA 4EMPA 1Q52A 3PZKA 2VSSF 3HP0A 3BPPA 3HRXA 5DL1A 3TVUA 2J5GA 3OMEA 3KTJA 3LAOA 4DI1A 2C8TA 5KDRB 4QFEA 2D3TA 2PPYA 1Y7OA 1XX4A 2X24A 3R9QA 3OC7A 4ZDDA 1HZDA 5E0SH 1YG6A 3H0JA 3T89A 1FC9A 2J5IA 4RYFA 3GMAA 3ADBA 4K29A 3Q0GA 4FN8A 3PEAA 1RJNA 3K8XA 4JJTA 2A81A 3T8AA 4J2UA 3O4XE 4U0GH 3MOYA 3W8IB 3A4LA 1DUBA 1VRGA 1SG4A 4KWBA 4QIJA 3R6HA 4G2RA 1UIYA 5JBWA 5DZKA 4WCZA 3Q7HA 3Q1TA 2F6IA 3T8BA 4GHNA 4LK5A 4JYLA 5DUFA 3BF0A 4K2NA 3RRVA 4NARA 4JCTA 4B3HA 2A7KA 3PGQA 1XO6A 2F9IB 3RSTA 5G1SA 3IRBA 3R9SA 1UYVA 2VSUF 5JBXA 2GTRA 2ZL0A 3L8JA 2FBMA 4K3WA 1WDLA 1YG8A 4FZWA 3QXIA 4I52A 3MYBA 4L8KA 5KJPA 2FW2A 4ELWA 4MXIA 3NJDA 3RQEA 1W2XA 2BZRA 3K50A 4ASIA 3ADDA 1RJMA 3QK8A 1OD2A 3G64A 3KQFA 4Q1IA 1FCFA 4NNQA 4FZWC 3WG5A 4I42A 4MI2A 1JXZA 1UYRA 2Q35A 3ADCA 4NEKA 5KDRA 3QKAA 5C9GA 4ELXA 3A4MA 3FDUA 1PJHA 2YJGA 4WYOB 3TZ3A 2ZL3A 1TYFA 3ISAA 4JFCA 5DTPA 5DU6A 2VSSE 4EMLA 4OG1A 1WDKA 1N6FA 3BEZA 5MGBA 4RYFH 4JCQA 5E0NX 3RQFA 5HUQA 1O8UA 3GKBA 2CBYA 2J5II 2X58A 4KPKA 1XNVA 2EJ5A 3QWDA 1FC6A 1Y64B 5DU8A 2VREA 3AJMA 3BPTA 5DZKH 4FB8A 5G1QA 3ZWBA 2UZFA 3LKEA 5DU4A 4RCNA 4JCSA 3QYRA 2VSSA 4OMRA 2QQ3A 3R9TA 2CE3A 1UX5A 4JCRA 5CTCA 4JWVA 4JOTA 1HNUA 3RSIA 3QMJA 2FZSA 3RQGA 5CTBA 4ZU2A 4IZCA 2F9IA 2NP9A 3JU1A 4FNDA 3ZWAA 2VX2A 4U18A 3TT7A 2WTBA 3R0OA 4ZDEA 3MFMA 3KTGA 2Q34A 4MOUA 3L8IA 3H0QA 4IZDA 3OT6A 4I4ZA 3KTIA 3HINA 4L6WA 3V5IA 3FF6A 4IZBA 5INFA 1X0UA 1WZ8A 3VIVA 3M6NA 3T3WA 4HNKA 2VSUE 3TRRA 2PBPA 1SZOA 1ON3A 3P2LA 4HC8A 3Q0JA 3N6RB 3TV5A 3DORA 4KNPA 3U9TB 3A4NA 3ZW9A 3GF3A 3GF7A 5DUCA 4FJWD 1K39A 3TLFA 3DJAA 2HW5A 1XNYA 2W3PA 1UYTA 3TT6A 3H0UA 1WDMA 2PG8A 3P85A 3U9RB 5DTWA 2ZQQA 3TVWA 1EF8A 3SWXA 4EMMA 3NJBA 4B3IA 3IAVA 5IKLB 2VSUA 4QIIA 1MJ3A 2J5SA 4FN7A 3U9SB 4Q0GA 5C90A 5FIFA 3TDCA 4ZDFA 4ZDCA 3IB9A 4HDTA 5E0SA 3STAA 2A7SA 3H02A 3MT6A 2J5IB 3HE2A 3T88A 5DKPA 4Z0MA 3SLLA 2VSUC 3ZWCA 2ZQRA 1FC7A 1PIXA 3V5EA 4U0GA 3KTKA 1J7XA 3HLN1 1TG6A 4JYJA 3IBBA 4KD6A 3M6MA 4ZDBA 4FNBA 3GLMA 1DCIA 2F9YA 4GEHB 2F9YB 4JSBA 3ZW8A 4OLQA 1UX4A 3L3SA 2ZL4A 3H81A 3AM1A 1EY3A 4U19A 2F6QA 2Q2XA 4JVTA 1OD4A 3I47A 4YLHA 1Q51A 2P63A 4GM2A 1N6DA 5G1RA 4U0HA 5INGA 4WZ8B 3H0SA 4B3JA 1NZYA 1NZYB 3QREA
chains in the Genus database with same CATH topology
2ZL2A 3QXZA 2DEOA 2IEXA 1N6EA 2J5GD 3PE8A 1EF9A 4ELSA 3P5MA 4U1AA 1K32A 3KTHA 5FUSA 4F47A 1XNWA 2DUBA 1UYSA 3ST9A 1HNOA 1ON9A 5INIA 4EMPA 1Q52A 3PZKA 2VSSF 3HP0A 3BPPA 3HRXA 5DL1A 3TVUA 2J5GA 3OMEA 3KTJA 3LAOA 4DI1A 2C8TA 5KDRB 4QFEA 2D3TA 2PPYA 1Y7OA 1XX4A 2X24A 3R9QA 3OC7A 4ZDDA 1HZDA 5E0SH 1YG6A 3H0JA 3T89A 1FC9A 2J5IA 4RYFA 3GMAA 4K29A 3Q0GA 4FN8A 3PEAA 1RJNA 3K8XA 4JJTA 2A81A 3T8AA 4J2UA 4U0GH 3MOYA 1DUBA 1VRGA 1SG4A 4KWBA 4QIJA 3R6HA 4G2RA 1UIYA 5JBWA 5DZKA 4WCZA 3Q7HA 3Q1TA 2F6IA 3T8BA 4GHNA 4LK5A 4JYLA 5DUFA 3BF0A 4K2NA 3RRVA 4NARA 4JCTA 4B3HA 2A7KA 3PGQA 1XO6A 2F9IB 3RSTA 5G1SA 3R9SA 1UYVA 2VSUF 5JBXA 2GTRA 2ZL0A 2FBMA 4K3WA 1WDLA 1YG8A 4FZWA 3QXIA 4I52A 3MYBA 4L8KA 5KJPA 2FW2A 4ELWA 4MXIA 3NJDA 1W2XA 2BZRA 3K50A 4ASIA 1RJMA 3QK8A 1OD2A 3G64A 3KQFA 4Q1IA 1FCFA 4NNQA 4FZWC 3WG5A 4I42A 4MI2A 1JXZA 1UYRA 2Q35A 4NEKA 5KDRA 3QKAA 5C9GA 4ELXA 3FDUA 1PJHA 2YJGA 4WYOB 3TZ3A 2ZL3A 1TYFA 3ISAA 4JFCA 5DTPA 5DU6A 2VSSE 4EMLA 4OG1A 1WDKA 1N6FA 3BEZA 5MGBA 4RYFH 4JCQA 5E0NX 5HUQA 1O8UA 3GKBA 2CBYA 2J5II 2X58A 4KPKA 1XNVA 2EJ5A 3QWDA 1FC6A 5DU8A 2VREA 3BPTA 5DZKH 4FB8A 5G1QA 3ZWBA 2UZFA 3LKEA 5DU4A 4RCNA 4JCSA 3QYRA 2VSSA 4OMRA 2QQ3A 3R9TA 2CE3A 4JCRA 5CTCA 4JWVA 4JOTA 1HNUA 3RSIA 3QMJA 2FZSA 5CTBA 4ZU2A 4IZCA 2F9IA 2NP9A 3JU1A 4FNDA 3ZWAA 2VX2A 4U18A 3TT7A 2WTBA 3R0OA 4ZDEA 3MFMA 3KTGA 2Q34A 4MOUA 3H0QA 4IZDA 3OT6A 4I4ZA 3KTIA 3HINA 4L6WA 3V5IA 3FF6A 4IZBA 5INFA 1X0UA 1WZ8A 3VIVA 3M6NA 3T3WA 4HNKA 2VSUE 3TRRA 2PBPA 1SZOA 1ON3A 3P2LA 4HC8A 3Q0JA 3N6RB 3TV5A 3DORA 4KNPA 3U9TB 3ZW9A 3GF3A 3GF7A 5DUCA 4FJWD 1K39A 3TLFA 3DJAA 2HW5A 1XNYA 2W3PA 1UYTA 3TT6A 3H0UA 1WDMA 2PG8A 3P85A 3U9RB 5DTWA 2ZQQA 3TVWA 1EF8A 3SWXA 4EMMA 3NJBA 4B3IA 3IAVA 5IKLB 2VSUA 4QIIA 1MJ3A 2J5SA 4FN7A 3U9SB 4Q0GA 5C90A 5FIFA 3TDCA 4ZDFA 4ZDCA 3IB9A 4HDTA 5E0SA 3STAA 2A7SA 3H02A 3MT6A 2J5IB 3HE2A 3T88A 5DKPA 4Z0MA 3SLLA 2VSUC 3ZWCA 2ZQRA 1FC7A 1PIXA 3V5EA 4U0GA 3KTKA 1J7XA 3HLN1 1TG6A 4JYJA 3IBBA 4KD6A 3M6MA 4ZDBA 4FNBA 3GLMA 1DCIA 2F9YA 2F9YB 4JSBA 3ZW8A 4OLQA 3L3SA 2ZL4A 3H81A 1EY3A 4U19A 2F6QA 2Q2XA 4JVTA 1OD4A 3I47A 4YLHA 1Q51A 4GM2A 1N6DA 5G1RA 4U0HA 5INGA 4WZ8B 3H0SA 4B3JA 1NZYA 1NZYB 3QREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZL2 A;  3QXZ A;  2DEO A;  2IEX A;  1N6E A;  2J5G D;  3PE8 A;  1EF9 A;  4ELS A;  3P5M A;  4U1A A;  1K32 A;  3KTH A;  5FUS A;  4F47 A;  1XNW A;  2DUB A;  1UYS A;  3ST9 A;  1HNO A;  1ON9 A;  5INI A;  4EMP A;  1Q52 A;  3PZK A;  2VSS F;  3HP0 A;  3BPP A;  3HRX A;  5DL1 A;  3TVU A;  2J5G A;  3OME A;  3KTJ A;  3LAO A;  4DI1 A;  2C8T A;  5KDR B;  4QFE A;  2D3T A;  2PPY A;  1Y7O A;  1XX4 A;  2X24 A;  3R9Q A;  3OC7 A;  4ZDD A;  1HZD A;  5E0S H;  1YG6 A;  3H0J A;  3T89 A;  1FC9 A;  2J5I A;  4RYF A;  3GMA A;  4K29 A;  3Q0G A;  4FN8 A;  3PEA A;  1RJN A;  3K8X A;  4JJT A;  2A81 A;  3T8A A;  4U0G H;  3MOY A;  1DUB A;  1VRG A;  1SG4 A;  4KWB A;  4QIJ A;  3R6H A;  4G2R A;  1UIY A;  5JBW A;  5DZK A;  4WCZ A;  3Q7H A;  3Q1T A;  2F6I A;  3T8B A;  4GHN A;  4LK5 A;  4JYL A;  5DUF A;  3BF0 A;  4K2N A;  3RRV A;  4JCT A;  4B3H A;  2A7K A;  3PGQ A;  1XO6 A;  2F9I B;  3RST A;  5G1S A;  3R9S A;  1UYV A;  2VSU F;  5JBX A;  2GTR A;  2ZL0 A;  2FBM A;  4K3W A;  1WDL A;  1YG8 A;  4FZW A;  3QXI A;  4I52 A;  3MYB A;  4L8K A;  5KJP A;  2FW2 A;  4ELW A;  4MXI A;  3NJD A;  1W2X A;  2BZR A;  3K50 A;  4ASI A;  1RJM A;  3QK8 A;  1OD2 A;  3G64 A;  3KQF A;  4Q1I A;  1FCF A;  4NNQ A;  4FZW C;  3WG5 A;  4I42 A;  4MI2 A;  1JXZ A;  1UYR A;  2Q35 A;  4NEK A;  5KDR A;  3QKA A;  5C9G A;  4ELX A;  3FDU A;  1PJH A;  4WYO B;  3TZ3 A;  2ZL3 A;  1TYF A;  3ISA A;  4JFC A;  5DTP A;  5DU6 A;  2VSS E;  4EML A;  4OG1 A;  1WDK A;  1N6F A;  3BEZ A;  5MGB A;  4RYF H;  4JCQ A;  5E0N X;  1O8U A;  3GKB A;  2CBY A;  2J5I I;  2X58 A;  4KPK A;  1XNV A;  2EJ5 A;  3QWD A;  1FC6 A;  5DU8 A;  2VRE A;  5DZK H;  4FB8 A;  5G1Q A;  3ZWB A;  2UZF A;  3LKE A;  5DU4 A;  4RCN A;  4JCS A;  3QYR A;  2VSS A;  4OMR A;  2QQ3 A;  3R9T A;  2CE3 A;  4JCR A;  5CTC A;  4JWV A;  4JOT A;  1HNU A;  3RSI A;  3QMJ A;  2FZS A;  5CTB A;  4ZU2 A;  4IZC A;  2F9I A;  2NP9 A;  3JU1 A;  4FND A;  3ZWA A;  2VX2 A;  4U18 A;  3TT7 A;  2WTB A;  3R0O A;  4ZDE A;  3MFM A;  3KTG A;  2Q34 A;  4MOU A;  3H0Q A;  4IZD A;  3OT6 A;  4I4Z A;  3KTI A;  3HIN A;  4L6W A;  3V5I A;  3FF6 A;  4IZB A;  5INF A;  1X0U A;  1WZ8 A;  3VIV A;  3M6N A;  3T3W A;  4HNK A;  2VSU E;  3TRR A;  2PBP A;  1SZO A;  1ON3 A;  3P2L A;  4HC8 A;  3Q0J A;  3N6R B;  3TV5 A;  3DOR A;  4KNP A;  3U9T B;  3ZW9 A;  3GF3 A;  3GF7 A;  5DUC A;  4FJW D;  1K39 A;  3TLF A;  3DJA A;  2HW5 A;  1XNY A;  2W3P A;  1UYT A;  3TT6 A;  3H0U A;  1WDM A;  2PG8 A;  3P85 A;  3U9R B;  5DTW A;  2ZQQ A;  3TVW A;  1EF8 A;  3SWX A;  4EMM A;  3NJB A;  4B3I A;  3IAV A;  5IKL B;  2VSU A;  4QII A;  1MJ3 A;  2J5S A;  4FN7 A;  3U9S B;  4Q0G A;  5C90 A;  5FIF A;  3TDC A;  4ZDF A;  4ZDC A;  3IB9 A;  5E0S A;  3STA A;  2A7S A;  3H02 A;  3MT6 A;  2J5I B;  3HE2 A;  3T88 A;  5DKP A;  4Z0M A;  3SLL A;  2VSU C;  3ZWC A;  2ZQR A;  1FC7 A;  1PIX A;  3V5E A;  4U0G A;  3KTK A;  1J7X A;  3HLN 1;  1TG6 A;  4JYJ A;  3IBB A;  4KD6 A;  3M6M A;  4ZDB A;  4FNB A;  3GLM A;  1DCI A;  2F9Y A;  2F9Y B;  4JSB A;  3ZW8 A;  4OLQ A;  3L3S A;  2ZL4 A;  3H81 A;  1EY3 A;  4U19 A;  2F6Q A;  2Q2X A;  4JVT A;  1OD4 A;  3I47 A;  4YLH A;  1Q51 A;  4GM2 A;  1N6D A;  5G1R A;  4U0H A;  5ING A;  4WZ8 B;  3H0S A;  4B3J A;  1NZY A;  1NZY B;  3QRE A; 
#chains in the Genus database with same CATH topology
 2ZL2 A;  3QXZ A;  2DEO A;  2IEX A;  1N6E A;  2J5G D;  3PE8 A;  1EF9 A;  4ELS A;  3P5M A;  4U1A A;  1K32 A;  3KTH A;  5FUS A;  4F47 A;  1XNW A;  2DUB A;  1UYS A;  3ST9 A;  3W8H B;  1HNO A;  1ON9 A;  5INI A;  4EMP A;  1Q52 A;  3PZK A;  2VSS F;  3HP0 A;  3BPP A;  3HRX A;  5DL1 A;  3TVU A;  2J5G A;  3OME A;  3KTJ A;  3LAO A;  4DI1 A;  2C8T A;  5KDR B;  4QFE A;  2D3T A;  2PPY A;  1Y7O A;  1XX4 A;  2X24 A;  3R9Q A;  3OC7 A;  4ZDD A;  1HZD A;  5E0S H;  1YG6 A;  3H0J A;  3T89 A;  1FC9 A;  2J5I A;  4RYF A;  3GMA A;  3ADB A;  4K29 A;  3Q0G A;  4FN8 A;  3PEA A;  1RJN A;  3K8X A;  4JJT A;  2A81 A;  3T8A A;  4J2U A;  3O4X E;  4U0G H;  3MOY A;  3W8I B;  3A4L A;  1DUB A;  1VRG A;  1SG4 A;  4KWB A;  4QIJ A;  3R6H A;  4G2R A;  1UIY A;  5JBW A;  5DZK A;  4WCZ A;  3Q7H A;  3Q1T A;  2F6I A;  3T8B A;  4GHN A;  4LK5 A;  4JYL A;  5DUF A;  3BF0 A;  4K2N A;  3RRV A;  4NAR A;  4JCT A;  4B3H A;  2A7K A;  3PGQ A;  1XO6 A;  2F9I B;  3RST A;  5G1S A;  3IRB A;  3R9S A;  1UYV A;  2VSU F;  5JBX A;  2GTR A;  2ZL0 A;  3L8J A;  2FBM A;  4K3W A;  1WDL A;  1YG8 A;  4FZW A;  3QXI A;  4I52 A;  3MYB A;  4L8K A;  5KJP A;  2FW2 A;  4ELW A;  4MXI A;  3NJD A;  3RQE A;  1W2X A;  2BZR A;  3K50 A;  4ASI A;  3ADD A;  1RJM A;  3QK8 A;  1OD2 A;  3G64 A;  3KQF A;  4Q1I A;  1FCF A;  4NNQ A;  4FZW C;  3WG5 A;  4I42 A;  4MI2 A;  1JXZ A;  1UYR A;  2Q35 A;  3ADC A;  4NEK A;  5KDR A;  3QKA A;  5C9G A;  4ELX A;  3A4M A;  3FDU A;  1PJH A;  2YJG A;  4WYO B;  3TZ3 A;  2ZL3 A;  1TYF A;  3ISA A;  4JFC A;  5DTP A;  5DU6 A;  2VSS E;  4EML A;  4OG1 A;  1WDK A;  1N6F A;  3BEZ A;  5MGB A;  4RYF H;  4JCQ A;  5E0N X;  3RQF A;  5HUQ A;  1O8U A;  3GKB A;  2CBY A;  2J5I I;  2X58 A;  4KPK A;  1XNV A;  2EJ5 A;  3QWD A;  1FC6 A;  1Y64 B;  5DU8 A;  2VRE A;  3AJM A;  3BPT A;  5DZK H;  4FB8 A;  5G1Q A;  3ZWB A;  2UZF A;  3LKE A;  5DU4 A;  4RCN A;  4JCS A;  3QYR A;  2VSS A;  4OMR A;  2QQ3 A;  3R9T A;  2CE3 A;  1UX5 A;  4JCR A;  5CTC A;  4JWV A;  4JOT A;  1HNU A;  3RSI A;  3QMJ A;  2FZS A;  3RQG A;  5CTB A;  4ZU2 A;  4IZC A;  2F9I A;  2NP9 A;  3JU1 A;  4FND A;  3ZWA A;  2VX2 A;  4U18 A;  3TT7 A;  2WTB A;  3R0O A;  4ZDE A;  3MFM A;  3KTG A;  2Q34 A;  4MOU A;  3L8I A;  3H0Q A;  4IZD A;  3OT6 A;  4I4Z A;  3KTI A;  3HIN A;  4L6W A;  3V5I A;  3FF6 A;  4IZB A;  5INF A;  1X0U A;  1WZ8 A;  3VIV A;  3M6N A;  3T3W A;  4HNK A;  2VSU E;  3TRR A;  2PBP A;  1SZO A;  1ON3 A;  3P2L A;  4HC8 A;  3Q0J A;  3N6R B;  3TV5 A;  3DOR A;  4KNP A;  3U9T B;  3A4N A;  3ZW9 A;  3GF3 A;  3GF7 A;  5DUC A;  4FJW D;  1K39 A;  3TLF A;  3DJA A;  2HW5 A;  1XNY A;  2W3P A;  1UYT A;  3TT6 A;  3H0U A;  1WDM A;  2PG8 A;  3P85 A;  3U9R B;  5DTW A;  2ZQQ A;  3TVW A;  1EF8 A;  3SWX A;  4EMM A;  3NJB A;  4B3I A;  3IAV A;  5IKL B;  2VSU A;  4QII A;  1MJ3 A;  2J5S A;  4FN7 A;  3U9S B;  4Q0G A;  5C90 A;  5FIF A;  3TDC A;  4ZDF A;  4ZDC A;  3IB9 A;  4HDT A;  5E0S A;  3STA A;  2A7S A;  3H02 A;  3MT6 A;  2J5I B;  3HE2 A;  3T88 A;  5DKP A;  4Z0M A;  3SLL A;  2VSU C;  3ZWC A;  2ZQR A;  1FC7 A;  1PIX A;  3V5E A;  4U0G A;  3KTK A;  1J7X A;  3HLN 1;  1TG6 A;  4JYJ A;  3IBB A;  4KD6 A;  3M6M A;  4ZDB A;  4FNB A;  3GLM A;  1DCI A;  2F9Y A;  4GEH B;  2F9Y B;  4JSB A;  3ZW8 A;  4OLQ A;  1UX4 A;  3L3S A;  2ZL4 A;  3H81 A;  3AM1 A;  1EY3 A;  4U19 A;  2F6Q A;  2Q2X A;  4JVT A;  1OD4 A;  3I47 A;  4YLH A;  1Q51 A;  2P63 A;  4GM2 A;  1N6D A;  5G1R A;  4U0H A;  5ING A;  4WZ8 B;  3H0S A;  4B3J A;  1NZY A;  1NZY B;  3QRE A; 
#chains in the Genus database with same CATH homology
 2ZL2 A;  3QXZ A;  2DEO A;  2IEX A;  1N6E A;  2J5G D;  3PE8 A;  1EF9 A;  4ELS A;  3P5M A;  4U1A A;  1K32 A;  3KTH A;  5FUS A;  4F47 A;  1XNW A;  2DUB A;  1UYS A;  3ST9 A;  1HNO A;  1ON9 A;  5INI A;  4EMP A;  1Q52 A;  3PZK A;  2VSS F;  3HP0 A;  3BPP A;  3HRX A;  5DL1 A;  3TVU A;  2J5G A;  3OME A;  3KTJ A;  3LAO A;  4DI1 A;  2C8T A;  5KDR B;  4QFE A;  2D3T A;  2PPY A;  1Y7O A;  1XX4 A;  2X24 A;  3R9Q A;  3OC7 A;  4ZDD A;  1HZD A;  5E0S H;  1YG6 A;  3H0J A;  3T89 A;  1FC9 A;  2J5I A;  4RYF A;  3GMA A;  4K29 A;  3Q0G A;  4FN8 A;  3PEA A;  1RJN A;  3K8X A;  4JJT A;  2A81 A;  3T8A A;  4J2U A;  4U0G H;  3MOY A;  1DUB A;  1VRG A;  1SG4 A;  4KWB A;  4QIJ A;  3R6H A;  4G2R A;  1UIY A;  5JBW A;  5DZK A;  4WCZ A;  3Q7H A;  3Q1T A;  2F6I A;  3T8B A;  4GHN A;  4LK5 A;  4JYL A;  5DUF A;  3BF0 A;  4K2N A;  3RRV A;  4NAR A;  4JCT A;  4B3H A;  2A7K A;  3PGQ A;  1XO6 A;  2F9I B;  3RST A;  5G1S A;  3R9S A;  1UYV A;  2VSU F;  5JBX A;  2GTR A;  2ZL0 A;  2FBM A;  4K3W A;  1WDL A;  1YG8 A;  4FZW A;  3QXI A;  4I52 A;  3MYB A;  4L8K A;  5KJP A;  2FW2 A;  4ELW A;  4MXI A;  3NJD A;  1W2X A;  2BZR A;  3K50 A;  4ASI A;  1RJM A;  3QK8 A;  1OD2 A;  3G64 A;  3KQF A;  4Q1I A;  1FCF A;  4NNQ A;  4FZW C;  3WG5 A;  4I42 A;  4MI2 A;  1JXZ A;  1UYR A;  2Q35 A;  4NEK A;  5KDR A;  3QKA A;  5C9G A;  4ELX A;  3FDU A;  1PJH A;  2YJG A;  4WYO B;  3TZ3 A;  2ZL3 A;  1TYF A;  3ISA A;  4JFC A;  5DTP A;  5DU6 A;  2VSS E;  4EML A;  4OG1 A;  1WDK A;  1N6F A;  3BEZ A;  5MGB A;  4RYF H;  4JCQ A;  5E0N X;  5HUQ A;  1O8U A;  3GKB A;  2CBY A;  2J5I I;  2X58 A;  4KPK A;  1XNV A;  2EJ5 A;  3QWD A;  1FC6 A;  5DU8 A;  2VRE A;  3BPT A;  5DZK H;  4FB8 A;  5G1Q A;  3ZWB A;  2UZF A;  3LKE A;  5DU4 A;  4RCN A;  4JCS A;  3QYR A;  2VSS A;  4OMR A;  2QQ3 A;  3R9T A;  2CE3 A;  4JCR A;  5CTC A;  4JWV A;  4JOT A;  1HNU A;  3RSI A;  3QMJ A;  2FZS A;  5CTB A;  4ZU2 A;  4IZC A;  2F9I A;  2NP9 A;  3JU1 A;  4FND A;  3ZWA A;  2VX2 A;  4U18 A;  3TT7 A;  2WTB A;  3R0O A;  4ZDE A;  3MFM A;  3KTG A;  2Q34 A;  4MOU A;  3H0Q A;  4IZD A;  3OT6 A;  4I4Z A;  3KTI A;  3HIN A;  4L6W A;  3V5I A;  3FF6 A;  4IZB A;  5INF A;  1X0U A;  1WZ8 A;  3VIV A;  3M6N A;  3T3W A;  4HNK A;  2VSU E;  3TRR A;  2PBP A;  1SZO A;  1ON3 A;  3P2L A;  4HC8 A;  3Q0J A;  3N6R B;  3TV5 A;  3DOR A;  4KNP A;  3U9T B;  3ZW9 A;  3GF3 A;  3GF7 A;  5DUC A;  4FJW D;  1K39 A;  3TLF A;  3DJA A;  2HW5 A;  1XNY A;  2W3P A;  1UYT A;  3TT6 A;  3H0U A;  1WDM A;  2PG8 A;  3P85 A;  3U9R B;  5DTW A;  2ZQQ A;  3TVW A;  1EF8 A;  3SWX A;  4EMM A;  3NJB A;  4B3I A;  3IAV A;  5IKL B;  2VSU A;  4QII A;  1MJ3 A;  2J5S A;  4FN7 A;  3U9S B;  4Q0G A;  5C90 A;  5FIF A;  3TDC A;  4ZDF A;  4ZDC A;  3IB9 A;  4HDT A;  5E0S A;  3STA A;  2A7S A;  3H02 A;  3MT6 A;  2J5I B;  3HE2 A;  3T88 A;  5DKP A;  4Z0M A;  3SLL A;  2VSU C;  3ZWC A;  2ZQR A;  1FC7 A;  1PIX A;  3V5E A;  4U0G A;  3KTK A;  1J7X A;  3HLN 1;  1TG6 A;  4JYJ A;  3IBB A;  4KD6 A;  3M6M A;  4ZDB A;  4FNB A;  3GLM A;  1DCI A;  2F9Y A;  2F9Y B;  4JSB A;  3ZW8 A;  4OLQ A;  3L3S A;  2ZL4 A;  3H81 A;  1EY3 A;  4U19 A;  2F6Q A;  2Q2X A;  4JVT A;  1OD4 A;  3I47 A;  4YLH A;  1Q51 A;  4GM2 A;  1N6D A;  5G1R A;  4U0H A;  5ING A;  4WZ8 B;  3H0S A;  4B3J A;  1NZY A;  1NZY B;  3QRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...