3T89A

Crystal structure of escherichia coli menb, the 1,4-dihydroxy-2-naphthoyl-coa synthase in vitamin k2 biosynthesis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
285
structure length
270
Chain Sequence
MIYPDEAMLYAPVEWHDCSEGFEDIRYEKSTDGIAKITINRPQVRNAFRPLTVKEMIQALADARYDDNIGVIILTGAGDKAFCSGGDQKHLNVLDFQRQIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAADNAIFGQTGPKVGSFDGGWGASYMARIVGQKKAREIWFLCRQYDAKQALDMGLVNTVVPLADLEKETVRWCREMLQNSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGRNAFNQKRQPDFSKFKRNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of the Intramolecular Claisen Condensation Reaction Catalyzed by MenB, a Crotonase Superfamily Member.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords 1,4-Dihydroxy-2-naphthoyl-CoA synthase
total genus 100
structure length 270
sequence length 285
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 3t89A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3t89A01
1OD4A 1RJMA 4QIIA 4ZU2A 5DUCA 2DUBA 1O8UA 1WDMA 4WCZA 4B3HA 4U19A 1EF8A 2ZL0A 3MOYA 2NP9A 4ZDDA 5G1QA 3TT7A 3FF6A 4ELSA 3HP0A 3R9SA 3P2LA 4ELWA 4U0GH 4JWVA 3K50A 4IZCA 2F9YA 2VSUA 4FZWA 1N6EA 3ST9A 1X0UA 5G1SA 3ISAA 5DU6A 3HE2A 2FZSA 4QIJA 3KTIA 3NJDA 3QMJA 2CE3A 2A7KA 4DI1A 2F9IB 1Q52A 4JYLA 1HNOA 3P5MA 3ZW8A 3QKAA 3PZKA 3SLLA 3HINA 4JCRA 1XNWA 2BZRA 4GM2A 5E0SA 1XNVA 5DUFA 3P85A 4FJWD 1ON3A 1UYVA 2VREA 1XNYA 3Q0JA 4RYFH 1EF9A 1YG6A 3FDUA 3OT6A 1DUBA 4F47A 5E0SH 2VSSE 4OMRA 4LK5A 3QXZA 4U18A 5C90A 3RSIA 5DZKA 2VSUE 3N6RB 5C9GA 4OG1A 3T8AA 2ZQRA 1EY3A 4KNPA 2VSUF 3QXIA 4FNDA 1K39A 2DEOA 2J5SA 2A81A 3GMAA 1WDKA 5DU4A 3G64A 1JXZA 3MFMA 3NJBA 3TV5A 3T88A 1OD2A 1HZDA 3PEAA 1TG6A 3TZ3A 2VSSA 3H81A 3KTHA 4L8KA 1ON9A 3U9TB 1NZYA 1N6DA 1UYTA 2ZL2A 1FC9A 3BEZA 1PJHA 2PBPA 1WZ8A 3IBBA 4FB8A 4GHNA 1VRGA 4JVTA 3RSTA 4JSBA 5CTCA 3GF3A 3H02A 1UYSA 4FZWC 3DJAA 3SWXA 3TRRA 4FNBA 2D3TA 3M6NA 1MJ3A 4QFEA 1N6FA 3PGQA 5INGA 2GTRA 2ZL3A 2C8TA 5DU8A 2FW2A 3TDCA 3KQFA 3H0QA 1Y7OA 1YG8A 4ELXA 5KJPA 2WTBA 3Q1TA 4KWBA 4MOUA 3TVUA 3KTGA 4K29A 4RCNA 3I47A 4I4ZA 2VSSF 2W3PA 3OMEA 5DZKH 4JCTA 5DTWA 4K2NA 3TVWA 4U0HA 4WYOB 3TT6A 3VIVA 5FIFA 3T89A 4EMMA 3GF7A 3QK8A 4ZDFA 2ZQQA 3Q7HA 2J5IA 4K3WA 1Q51A 4Q1IA 5IKLB 1XX4A 3R9TA 3JU1A 2CBYA 4ZDBA 4MI2A 3KTKA 4HC8A 3MYBA 1WDLA 4G2RA 3Q0GA 2Q34A 3KTJA 4U0GA 2J5GA 3OC7A 3R0OA 3PE8A 1DCIA 5JBWA 4NNQA 5KDRB 1W2XA 3T8BA 1SZOA 2F6IA 1UIYA 2J5IB 3U9RB 1XO6A 2PG8A 4EMLA 3H0SA 2EJ5A 2VSUC 3M6MA 2J5GD 3ZW9A 3K8XA 5INIA 3R9QA 5G1RA 4OLQA 5KDRA 1FCFA 2QQ3A 4JOTA 3L3SA 1FC6A 3IAVA 4I52A 2F9YB 4HNKA 1UYRA 3LKEA 3QYRA 5MGBA 4IZBA 3HLN1 4EMPA 3QWDA 4NEKA 3U9SB 4MXIA 4ZDCA 5CTBA 4I42A 3LAOA 2X58A 4IZDA 4U1AA 4ASIA 5E0NX 3HRXA 4JFCA 2HW5A 3H0UA 1FC7A 4ZDEA 4FN7A 2PPYA 2F6QA 4FN8A 2X24A 3BPPA 4Q0GA 4WZ8B 1NZYB 1RJNA 2Q35A 2F9IA 1K32A 4JCSA 5DKPA 2VX2A 5DL1A 4B3IA 4KPKA 4YLHA 2UZFA 3STAA 3V5EA 3DORA 3MT6A 1PIXA 3V5IA 3R6HA 5FUSA 4B3JA 2IEXA 5DTPA 3TLFA 4JCQA 4Z0MA 1HNUA 3IB9A 2ZL4A 4RYFA 3T3WA 3ZWBA 3WG5A 3ZWCA 5INFA 4KD6A 5JBXA 1J7XA 3BF0A 1SG4A 2A7SA 2Q2XA 1TYFA 2FBMA 3RRVA 4JJTA 3GKBA 3H0JA 3ZWAA 3GLMA 4L6WA 4JYJA 3QREA 2J5II
chains in the Genus database with same CATH superfamily
1OD4A 1RJMA 4QIIA 4ZU2A 3L8JA 5DUCA 2DUBA 1O8UA 1WDMA 4WCZA 4B3HA 4U19A 1EF8A 2ZL0A 3AM1A 3MOYA 3RQEA 2NP9A 4ZDDA 5G1QA 3TT7A 3FF6A 4ELSA 3HP0A 3R9SA 3P2LA 4ELWA 4U0GH 4JWVA 3K50A 4IZCA 2F9YA 2VSUA 4FZWA 3A4NA 1N6EA 2P63A 3ST9A 1X0UA 5G1SA 3ISAA 5DU6A 3HE2A 2FZSA 4QIJA 3KTIA 3NJDA 3QMJA 2CE3A 2A7KA 4DI1A 2F9IB 1Q52A 4JYLA 4GEHB 1HNOA 3P5MA 3ZW8A 3QKAA 3PZKA 3SLLA 3HINA 4JCRA 1XNWA 2BZRA 4GM2A 5E0SA 1XNVA 5DUFA 3P85A 4FJWD 1ON3A 1UYVA 2VREA 1XNYA 3Q0JA 4RYFH 1EF9A 1YG6A 3FDUA 3OT6A 1DUBA 4F47A 5E0SH 3ADBA 2VSSE 4OMRA 4LK5A 3QXZA 4U18A 5C90A 3RSIA 5DZKA 2VSUE 3N6RB 5C9GA 4OG1A 3T8AA 2ZQRA 1EY3A 4KNPA 2VSUF 3QXIA 4FNDA 1K39A 2DEOA 2J5SA 2A81A 3GMAA 1WDKA 5DU4A 3G64A 1JXZA 3MFMA 3NJBA 3TV5A 3T88A 1OD2A 1HZDA 3PEAA 1TG6A 3A4MA 3TZ3A 2VSSA 3H81A 3KTHA 4L8KA 1ON9A 3U9TB 1NZYA 1N6DA 1UYTA 2ZL2A 1FC9A 3BEZA 1PJHA 2PBPA 1WZ8A 3IBBA 4FB8A 4GHNA 1VRGA 4JVTA 3RSTA 4JSBA 5CTCA 3GF3A 3H02A 1UYSA 4FZWC 3DJAA 3SWXA 3TRRA 3ADCA 4FNBA 2D3TA 3M6NA 1MJ3A 4QFEA 1N6FA 3PGQA 5INGA 3ADDA 2GTRA 2ZL3A 2C8TA 5DU8A 2FW2A 3TDCA 3KQFA 3H0QA 1Y7OA 1YG8A 4ELXA 5KJPA 2WTBA 3Q1TA 4KWBA 3IRBA 4MOUA 3TVUA 3KTGA 4K29A 4RCNA 3I47A 4I4ZA 2VSSF 2W3PA 3OMEA 5DZKH 4JCTA 5DTWA 4K2NA 4J2UA 3TVWA 3A4LA 4U0HA 4WYOB 3TT6A 3VIVA 5FIFA 4NARA 3T89A 4EMMA 3GF7A 3QK8A 4ZDFA 2ZQQA 3Q7HA 2J5IA 4K3WA 1Q51A 4Q1IA 5IKLB 2YJGA 1XX4A 3R9TA 3JU1A 2CBYA 4ZDBA 4MI2A 4HDTA 3KTKA 4HC8A 3MYBA 1WDLA 4G2RA 3Q0GA 2Q34A 3KTJA 5HUQA 4U0GA 2J5GA 3OC7A 3R0OA 3PE8A 1DCIA 5JBWA 4NNQA 5KDRB 1W2XA 3T8BA 1SZOA 2F6IA 3L8IA 1UIYA 2J5IB 3U9RB 1XO6A 3AJMA 2PG8A 3H0SA 4EMLA 2EJ5A 2VSUC 3O4XE 3M6MA 2J5GD 3ZW9A 3K8XA 5INIA 3R9QA 5G1RA 4OLQA 5KDRA 1FCFA 2QQ3A 4JOTA 3L3SA 1FC6A 3IAVA 3RQGA 3W8IB 4I52A 2F9YB 4HNKA 1UYRA 3LKEA 3QYRA 5MGBA 4IZBA 3HLN1 4EMPA 3QWDA 4NEKA 3U9SB 4MXIA 4ZDCA 1Y64B 3RQFA 5CTBA 4I42A 3LAOA 2X58A 4IZDA 4U1AA 4ASIA 5E0NX 3HRXA 4JFCA 2HW5A 3H0UA 1FC7A 4ZDEA 4FN7A 2PPYA 2F6QA 4FN8A 2X24A 3BPPA 4Q0GA 4WZ8B 1NZYB 1RJNA 2Q35A 2F9IA 1K32A 4JCSA 5DKPA 2VX2A 3BPTA 5DL1A 4B3IA 4KPKA 4YLHA 2UZFA 3STAA 1UX5A 3V5EA 3DORA 3MT6A 1PIXA 3V5IA 3R6HA 5FUSA 4B3JA 2IEXA 5DTPA 3TLFA 4JCQA 4Z0MA 1HNUA 3IB9A 2ZL4A 4RYFA 3T3WA 3ZWBA 3WG5A 3ZWCA 5INFA 4KD6A 5JBXA 1J7XA 3BF0A 1SG4A 2A7SA 2Q2XA 1UX4A 1TYFA 2FBMA 3RRVA 4JJTA 3GKBA 3H0JA 3ZWAA 3GLMA 4L6WA 4JYJA 3QREA 2J5II 3W8HB
chains in the Genus database with same CATH topology
1OD4A 1RJMA 4QIIA 4ZU2A 5DUCA 2DUBA 1O8UA 1WDMA 4WCZA 4B3HA 4U19A 1EF8A 2ZL0A 3MOYA 2NP9A 4ZDDA 5G1QA 3TT7A 3FF6A 4ELSA 3HP0A 3R9SA 3P2LA 4ELWA 4U0GH 4JWVA 3K50A 4IZCA 2F9YA 2VSUA 4FZWA 1N6EA 3ST9A 1X0UA 5G1SA 3ISAA 5DU6A 3HE2A 2FZSA 4QIJA 3KTIA 3NJDA 3QMJA 2CE3A 2A7KA 4DI1A 2F9IB 1Q52A 4JYLA 1HNOA 3P5MA 3ZW8A 3QKAA 3PZKA 3SLLA 3HINA 4JCRA 1XNWA 2BZRA 4GM2A 5E0SA 1XNVA 5DUFA 3P85A 4FJWD 1ON3A 1UYVA 2VREA 1XNYA 3Q0JA 4RYFH 1EF9A 1YG6A 3FDUA 3OT6A 1DUBA 4F47A 5E0SH 2VSSE 4OMRA 4LK5A 3QXZA 4U18A 5C90A 3RSIA 5DZKA 2VSUE 3N6RB 5C9GA 4OG1A 3T8AA 2ZQRA 1EY3A 4KNPA 2VSUF 3QXIA 4FNDA 1K39A 2DEOA 2J5SA 2A81A 3GMAA 1WDKA 5DU4A 3G64A 1JXZA 3MFMA 3NJBA 3TV5A 3T88A 1OD2A 1HZDA 3PEAA 1TG6A 3TZ3A 2VSSA 3H81A 3KTHA 4L8KA 1ON9A 3U9TB 1NZYA 1N6DA 1UYTA 2ZL2A 1FC9A 3BEZA 1PJHA 2PBPA 1WZ8A 3IBBA 4FB8A 4GHNA 1VRGA 4JVTA 3RSTA 4JSBA 5CTCA 3GF3A 3H02A 1UYSA 4FZWC 3DJAA 3SWXA 3TRRA 4FNBA 2D3TA 3M6NA 1MJ3A 4QFEA 1N6FA 3PGQA 5INGA 2GTRA 2ZL3A 2C8TA 5DU8A 2FW2A 3TDCA 3KQFA 3H0QA 1Y7OA 1YG8A 4ELXA 5KJPA 2WTBA 3Q1TA 4KWBA 4MOUA 3TVUA 3KTGA 4K29A 4RCNA 3I47A 4I4ZA 2VSSF 2W3PA 3OMEA 5DZKH 4JCTA 5DTWA 4K2NA 4J2UA 3TVWA 4U0HA 4WYOB 3TT6A 3VIVA 5FIFA 4NARA 3T89A 4EMMA 3GF7A 3QK8A 4ZDFA 2ZQQA 3Q7HA 2J5IA 4K3WA 1Q51A 4Q1IA 5IKLB 2YJGA 1XX4A 3R9TA 3JU1A 2CBYA 4ZDBA 4MI2A 4HDTA 3KTKA 4HC8A 3MYBA 1WDLA 4G2RA 3Q0GA 2Q34A 3KTJA 5HUQA 4U0GA 2J5GA 3OC7A 3R0OA 3PE8A 1DCIA 5JBWA 4NNQA 5KDRB 1W2XA 3T8BA 1SZOA 2F6IA 1UIYA 2J5IB 3U9RB 1XO6A 2PG8A 4EMLA 3H0SA 2EJ5A 2VSUC 3M6MA 2J5GD 3ZW9A 3K8XA 5INIA 3R9QA 5G1RA 4OLQA 5KDRA 1FCFA 2QQ3A 4JOTA 3L3SA 1FC6A 3IAVA 4I52A 2F9YB 4HNKA 1UYRA 3LKEA 3QYRA 5MGBA 4IZBA 3HLN1 4EMPA 3QWDA 4NEKA 3U9SB 4MXIA 4ZDCA 5CTBA 4I42A 3LAOA 2X58A 4IZDA 4U1AA 4ASIA 5E0NX 3HRXA 4JFCA 2HW5A 3H0UA 1FC7A 4ZDEA 4FN7A 2PPYA 2F6QA 4FN8A 2X24A 3BPPA 4Q0GA 4WZ8B 1NZYB 1RJNA 2Q35A 2F9IA 1K32A 4JCSA 5DKPA 2VX2A 3BPTA 5DL1A 4B3IA 4KPKA 4YLHA 2UZFA 3STAA 3V5EA 3DORA 3MT6A 1PIXA 3V5IA 3R6HA 5FUSA 4B3JA 2IEXA 5DTPA 3TLFA 4JCQA 4Z0MA 1HNUA 3IB9A 2ZL4A 4RYFA 3T3WA 3ZWBA 3WG5A 3ZWCA 5INFA 4KD6A 5JBXA 1J7XA 3BF0A 1SG4A 2A7SA 2Q2XA 1TYFA 2FBMA 3RRVA 4JJTA 3GKBA 3H0JA 3ZWAA 3GLMA 4L6WA 4JYJA 3QREA 2J5II
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OD4 A;  1RJM A;  4QII A;  4ZU2 A;  5DUC A;  2DUB A;  1O8U A;  1WDM A;  4WCZ A;  4B3H A;  4U19 A;  1EF8 A;  2ZL0 A;  3MOY A;  2NP9 A;  4ZDD A;  5G1Q A;  3TT7 A;  3FF6 A;  4ELS A;  3HP0 A;  3R9S A;  3P2L A;  4ELW A;  4U0G H;  4JWV A;  3K50 A;  4IZC A;  2F9Y A;  2VSU A;  4FZW A;  1N6E A;  3ST9 A;  1X0U A;  5G1S A;  3ISA A;  5DU6 A;  3HE2 A;  2FZS A;  4QIJ A;  3KTI A;  3NJD A;  3QMJ A;  2CE3 A;  2A7K A;  4DI1 A;  2F9I B;  1Q52 A;  4JYL A;  1HNO A;  3P5M A;  3ZW8 A;  3QKA A;  3PZK A;  3SLL A;  3HIN A;  4JCR A;  1XNW A;  2BZR A;  4GM2 A;  5E0S A;  1XNV A;  5DUF A;  3P85 A;  4FJW D;  1ON3 A;  1UYV A;  2VRE A;  1XNY A;  3Q0J A;  4RYF H;  1EF9 A;  1YG6 A;  3FDU A;  3OT6 A;  1DUB A;  4F47 A;  5E0S H;  2VSS E;  4OMR A;  4LK5 A;  3QXZ A;  4U18 A;  5C90 A;  3RSI A;  5DZK A;  2VSU E;  3N6R B;  5C9G A;  4OG1 A;  3T8A A;  2ZQR A;  1EY3 A;  4KNP A;  2VSU F;  3QXI A;  4FND A;  1K39 A;  2DEO A;  2J5S A;  2A81 A;  3GMA A;  1WDK A;  5DU4 A;  3G64 A;  1JXZ A;  3MFM A;  3NJB A;  3TV5 A;  3T88 A;  1OD2 A;  1HZD A;  3PEA A;  1TG6 A;  3TZ3 A;  2VSS A;  3H81 A;  3KTH A;  4L8K A;  1ON9 A;  3U9T B;  1NZY A;  1N6D A;  1UYT A;  2ZL2 A;  1FC9 A;  3BEZ A;  1PJH A;  2PBP A;  1WZ8 A;  3IBB A;  4FB8 A;  4GHN A;  1VRG A;  4JVT A;  3RST A;  4JSB A;  5CTC A;  3GF3 A;  3H02 A;  1UYS A;  4FZW C;  3DJA A;  3SWX A;  3TRR A;  4FNB A;  2D3T A;  3M6N A;  1MJ3 A;  4QFE A;  1N6F A;  3PGQ A;  5ING A;  2GTR A;  2ZL3 A;  2C8T A;  5DU8 A;  2FW2 A;  3TDC A;  3KQF A;  3H0Q A;  1Y7O A;  1YG8 A;  4ELX A;  5KJP A;  2WTB A;  3Q1T A;  4KWB A;  4MOU A;  3TVU A;  3KTG A;  4K29 A;  4RCN A;  3I47 A;  4I4Z A;  2VSS F;  2W3P A;  3OME A;  5DZK H;  4JCT A;  5DTW A;  4K2N A;  3TVW A;  4U0H A;  4WYO B;  3TT6 A;  3VIV A;  5FIF A;  3T89 A;  4EMM A;  3GF7 A;  3QK8 A;  4ZDF A;  2ZQQ A;  3Q7H A;  2J5I A;  4K3W A;  1Q51 A;  4Q1I A;  5IKL B;  1XX4 A;  3R9T A;  3JU1 A;  2CBY A;  4ZDB A;  4MI2 A;  3KTK A;  4HC8 A;  3MYB A;  1WDL A;  4G2R A;  3Q0G A;  2Q34 A;  3KTJ A;  4U0G A;  2J5G A;  3OC7 A;  3R0O A;  3PE8 A;  1DCI A;  5JBW A;  4NNQ A;  5KDR B;  1W2X A;  3T8B A;  1SZO A;  2F6I A;  1UIY A;  2J5I B;  3U9R B;  1XO6 A;  2PG8 A;  4EML A;  3H0S A;  2EJ5 A;  2VSU C;  3M6M A;  2J5G D;  3ZW9 A;  3K8X A;  5INI A;  3R9Q A;  5G1R A;  4OLQ A;  5KDR A;  1FCF A;  2QQ3 A;  4JOT A;  3L3S A;  1FC6 A;  3IAV A;  4I52 A;  2F9Y B;  4HNK A;  1UYR A;  3LKE A;  3QYR A;  5MGB A;  4IZB A;  3HLN 1;  4EMP A;  3QWD A;  4NEK A;  3U9S B;  4MXI A;  4ZDC A;  5CTB A;  4I42 A;  3LAO A;  2X58 A;  4IZD A;  4U1A A;  4ASI A;  5E0N X;  3HRX A;  4JFC A;  2HW5 A;  3H0U A;  1FC7 A;  4ZDE A;  4FN7 A;  2PPY A;  2F6Q A;  4FN8 A;  2X24 A;  3BPP A;  4Q0G A;  4WZ8 B;  1NZY B;  1RJN A;  2Q35 A;  2F9I A;  1K32 A;  4JCS A;  5DKP A;  2VX2 A;  5DL1 A;  4B3I A;  4KPK A;  4YLH A;  2UZF A;  3STA A;  3V5E A;  3DOR A;  3MT6 A;  1PIX A;  3V5I A;  3R6H A;  5FUS A;  4B3J A;  2IEX A;  5DTP A;  3TLF A;  4JCQ A;  4Z0M A;  1HNU A;  3IB9 A;  2ZL4 A;  4RYF A;  3T3W A;  3ZWB A;  3WG5 A;  3ZWC A;  5INF A;  4KD6 A;  5JBX A;  1J7X A;  3BF0 A;  1SG4 A;  2A7S A;  2Q2X A;  1TYF A;  2FBM A;  3RRV A;  4JJT A;  3GKB A;  3H0J A;  3ZWA A;  3GLM A;  4L6W A;  4JYJ A;  3QRE A;  2J5I I; 
#chains in the Genus database with same CATH topology
 1OD4 A;  1RJM A;  4QII A;  4ZU2 A;  3L8J A;  5DUC A;  2DUB A;  1O8U A;  1WDM A;  4WCZ A;  4B3H A;  4U19 A;  1EF8 A;  2ZL0 A;  3AM1 A;  3MOY A;  3RQE A;  2NP9 A;  4ZDD A;  5G1Q A;  3TT7 A;  3FF6 A;  4ELS A;  3HP0 A;  3R9S A;  3P2L A;  4ELW A;  4U0G H;  4JWV A;  3K50 A;  4IZC A;  2F9Y A;  2VSU A;  4FZW A;  3A4N A;  1N6E A;  2P63 A;  3ST9 A;  1X0U A;  5G1S A;  3ISA A;  5DU6 A;  3HE2 A;  2FZS A;  4QIJ A;  3KTI A;  3NJD A;  3QMJ A;  2CE3 A;  2A7K A;  4DI1 A;  2F9I B;  1Q52 A;  4JYL A;  4GEH B;  1HNO A;  3P5M A;  3ZW8 A;  3QKA A;  3PZK A;  3SLL A;  3HIN A;  4JCR A;  1XNW A;  2BZR A;  4GM2 A;  5E0S A;  1XNV A;  5DUF A;  3P85 A;  4FJW D;  1ON3 A;  1UYV A;  2VRE A;  1XNY A;  3Q0J A;  4RYF H;  1EF9 A;  1YG6 A;  3FDU A;  3OT6 A;  1DUB A;  4F47 A;  5E0S H;  3ADB A;  2VSS E;  4OMR A;  4LK5 A;  3QXZ A;  4U18 A;  5C90 A;  3RSI A;  5DZK A;  2VSU E;  3N6R B;  5C9G A;  4OG1 A;  3T8A A;  2ZQR A;  1EY3 A;  4KNP A;  2VSU F;  3QXI A;  4FND A;  1K39 A;  2DEO A;  2J5S A;  2A81 A;  3GMA A;  1WDK A;  5DU4 A;  3G64 A;  1JXZ A;  3MFM A;  3NJB A;  3TV5 A;  3T88 A;  1OD2 A;  1HZD A;  3PEA A;  1TG6 A;  3A4M A;  3TZ3 A;  2VSS A;  3H81 A;  3KTH A;  4L8K A;  1ON9 A;  3U9T B;  1NZY A;  1N6D A;  1UYT A;  2ZL2 A;  1FC9 A;  3BEZ A;  1PJH A;  2PBP A;  1WZ8 A;  3IBB A;  4FB8 A;  4GHN A;  1VRG A;  4JVT A;  3RST A;  4JSB A;  5CTC A;  3GF3 A;  3H02 A;  1UYS A;  4FZW C;  3DJA A;  3SWX A;  3TRR A;  3ADC A;  4FNB A;  2D3T A;  3M6N A;  1MJ3 A;  4QFE A;  1N6F A;  3PGQ A;  5ING A;  3ADD A;  2GTR A;  2ZL3 A;  2C8T A;  5DU8 A;  2FW2 A;  3TDC A;  3KQF A;  3H0Q A;  1Y7O A;  1YG8 A;  4ELX A;  5KJP A;  2WTB A;  3Q1T A;  4KWB A;  3IRB A;  4MOU A;  3TVU A;  3KTG A;  4K29 A;  4RCN A;  3I47 A;  4I4Z A;  2VSS F;  2W3P A;  3OME A;  5DZK H;  4JCT A;  5DTW A;  4K2N A;  4J2U A;  3TVW A;  3A4L A;  4U0H A;  4WYO B;  3TT6 A;  3VIV A;  5FIF A;  4NAR A;  3T89 A;  4EMM A;  3GF7 A;  3QK8 A;  4ZDF A;  2ZQQ A;  3Q7H A;  2J5I A;  4K3W A;  1Q51 A;  4Q1I A;  5IKL B;  2YJG A;  1XX4 A;  3R9T A;  3JU1 A;  2CBY A;  4ZDB A;  4MI2 A;  4HDT A;  3KTK A;  4HC8 A;  3MYB A;  1WDL A;  4G2R A;  3Q0G A;  2Q34 A;  3KTJ A;  5HUQ A;  4U0G A;  2J5G A;  3OC7 A;  3R0O A;  3PE8 A;  1DCI A;  5JBW A;  4NNQ A;  5KDR B;  1W2X A;  3T8B A;  1SZO A;  2F6I A;  3L8I A;  1UIY A;  2J5I B;  3U9R B;  1XO6 A;  3AJM A;  2PG8 A;  3H0S A;  4EML A;  2EJ5 A;  2VSU C;  3O4X E;  3M6M A;  2J5G D;  3ZW9 A;  3K8X A;  5INI A;  3R9Q A;  5G1R A;  4OLQ A;  5KDR A;  1FCF A;  2QQ3 A;  4JOT A;  3L3S A;  1FC6 A;  3IAV A;  3RQG A;  3W8I B;  4I52 A;  2F9Y B;  4HNK A;  1UYR A;  3LKE A;  3QYR A;  5MGB A;  4IZB A;  3HLN 1;  4EMP A;  3QWD A;  4NEK A;  3U9S B;  4MXI A;  4ZDC A;  1Y64 B;  3RQF A;  5CTB A;  4I42 A;  3LAO A;  2X58 A;  4IZD A;  4U1A A;  4ASI A;  5E0N X;  3HRX A;  4JFC A;  2HW5 A;  3H0U A;  1FC7 A;  4ZDE A;  4FN7 A;  2PPY A;  2F6Q A;  4FN8 A;  2X24 A;  3BPP A;  4Q0G A;  4WZ8 B;  1NZY B;  1RJN A;  2Q35 A;  2F9I A;  1K32 A;  4JCS A;  5DKP A;  2VX2 A;  3BPT A;  5DL1 A;  4B3I A;  4KPK A;  4YLH A;  2UZF A;  3STA A;  1UX5 A;  3V5E A;  3DOR A;  3MT6 A;  1PIX A;  3V5I A;  3R6H A;  5FUS A;  4B3J A;  2IEX A;  5DTP A;  3TLF A;  4JCQ A;  4Z0M A;  1HNU A;  3IB9 A;  2ZL4 A;  4RYF A;  3T3W A;  3ZWB A;  3WG5 A;  3ZWC A;  5INF A;  4KD6 A;  5JBX A;  1J7X A;  3BF0 A;  1SG4 A;  2A7S A;  2Q2X A;  1UX4 A;  1TYF A;  2FBM A;  3RRV A;  4JJT A;  3GKB A;  3H0J A;  3ZWA A;  3GLM A;  4L6W A;  4JYJ A;  3QRE A;  2J5I I;  3W8H B; 
#chains in the Genus database with same CATH homology
 1OD4 A;  1RJM A;  4QII A;  4ZU2 A;  5DUC A;  2DUB A;  1O8U A;  1WDM A;  4WCZ A;  4B3H A;  4U19 A;  1EF8 A;  2ZL0 A;  3MOY A;  2NP9 A;  4ZDD A;  5G1Q A;  3TT7 A;  3FF6 A;  4ELS A;  3HP0 A;  3R9S A;  3P2L A;  4ELW A;  4U0G H;  4JWV A;  3K50 A;  4IZC A;  2F9Y A;  2VSU A;  4FZW A;  1N6E A;  3ST9 A;  1X0U A;  5G1S A;  3ISA A;  5DU6 A;  3HE2 A;  2FZS A;  4QIJ A;  3KTI A;  3NJD A;  3QMJ A;  2CE3 A;  2A7K A;  4DI1 A;  2F9I B;  1Q52 A;  4JYL A;  1HNO A;  3P5M A;  3ZW8 A;  3QKA A;  3PZK A;  3SLL A;  3HIN A;  4JCR A;  1XNW A;  2BZR A;  4GM2 A;  5E0S A;  1XNV A;  5DUF A;  3P85 A;  4FJW D;  1ON3 A;  1UYV A;  2VRE A;  1XNY A;  3Q0J A;  4RYF H;  1EF9 A;  1YG6 A;  3FDU A;  3OT6 A;  1DUB A;  4F47 A;  5E0S H;  2VSS E;  4OMR A;  4LK5 A;  3QXZ A;  4U18 A;  5C90 A;  3RSI A;  5DZK A;  2VSU E;  3N6R B;  5C9G A;  4OG1 A;  3T8A A;  2ZQR A;  1EY3 A;  4KNP A;  2VSU F;  3QXI A;  4FND A;  1K39 A;  2DEO A;  2J5S A;  2A81 A;  3GMA A;  1WDK A;  5DU4 A;  3G64 A;  1JXZ A;  3MFM A;  3NJB A;  3TV5 A;  3T88 A;  1OD2 A;  1HZD A;  3PEA A;  1TG6 A;  3TZ3 A;  2VSS A;  3H81 A;  3KTH A;  4L8K A;  1ON9 A;  3U9T B;  1NZY A;  1N6D A;  1UYT A;  2ZL2 A;  1FC9 A;  3BEZ A;  1PJH A;  2PBP A;  1WZ8 A;  3IBB A;  4FB8 A;  4GHN A;  1VRG A;  4JVT A;  3RST A;  4JSB A;  5CTC A;  3GF3 A;  3H02 A;  1UYS A;  4FZW C;  3DJA A;  3SWX A;  3TRR A;  4FNB A;  2D3T A;  3M6N A;  1MJ3 A;  4QFE A;  1N6F A;  3PGQ A;  5ING A;  2GTR A;  2ZL3 A;  2C8T A;  5DU8 A;  2FW2 A;  3TDC A;  3KQF A;  3H0Q A;  1Y7O A;  1YG8 A;  4ELX A;  5KJP A;  2WTB A;  3Q1T A;  4KWB A;  4MOU A;  3TVU A;  3KTG A;  4K29 A;  4RCN A;  3I47 A;  4I4Z A;  2VSS F;  2W3P A;  3OME A;  5DZK H;  4JCT A;  5DTW A;  4K2N A;  4J2U A;  3TVW A;  4U0H A;  4WYO B;  3TT6 A;  3VIV A;  5FIF A;  4NAR A;  3T89 A;  4EMM A;  3GF7 A;  3QK8 A;  4ZDF A;  2ZQQ A;  3Q7H A;  2J5I A;  4K3W A;  1Q51 A;  4Q1I A;  5IKL B;  2YJG A;  1XX4 A;  3R9T A;  3JU1 A;  2CBY A;  4ZDB A;  4MI2 A;  4HDT A;  3KTK A;  4HC8 A;  3MYB A;  1WDL A;  4G2R A;  3Q0G A;  2Q34 A;  3KTJ A;  5HUQ A;  4U0G A;  2J5G A;  3OC7 A;  3R0O A;  3PE8 A;  1DCI A;  5JBW A;  4NNQ A;  5KDR B;  1W2X A;  3T8B A;  1SZO A;  2F6I A;  1UIY A;  2J5I B;  3U9R B;  1XO6 A;  2PG8 A;  4EML A;  3H0S A;  2EJ5 A;  2VSU C;  3M6M A;  2J5G D;  3ZW9 A;  3K8X A;  5INI A;  3R9Q A;  5G1R A;  4OLQ A;  5KDR A;  1FCF A;  2QQ3 A;  4JOT A;  3L3S A;  1FC6 A;  3IAV A;  4I52 A;  2F9Y B;  4HNK A;  1UYR A;  3LKE A;  3QYR A;  5MGB A;  4IZB A;  3HLN 1;  4EMP A;  3QWD A;  4NEK A;  3U9S B;  4MXI A;  4ZDC A;  5CTB A;  4I42 A;  3LAO A;  2X58 A;  4IZD A;  4U1A A;  4ASI A;  5E0N X;  3HRX A;  4JFC A;  2HW5 A;  3H0U A;  1FC7 A;  4ZDE A;  4FN7 A;  2PPY A;  2F6Q A;  4FN8 A;  2X24 A;  3BPP A;  4Q0G A;  4WZ8 B;  1NZY B;  1RJN A;  2Q35 A;  2F9I A;  1K32 A;  4JCS A;  5DKP A;  2VX2 A;  3BPT A;  5DL1 A;  4B3I A;  4KPK A;  4YLH A;  2UZF A;  3STA A;  3V5E A;  3DOR A;  3MT6 A;  1PIX A;  3V5I A;  3R6H A;  5FUS A;  4B3J A;  2IEX A;  5DTP A;  3TLF A;  4JCQ A;  4Z0M A;  1HNU A;  3IB9 A;  2ZL4 A;  4RYF A;  3T3W A;  3ZWB A;  3WG5 A;  3ZWC A;  5INF A;  4KD6 A;  5JBX A;  1J7X A;  3BF0 A;  1SG4 A;  2A7S A;  2Q2X A;  1TYF A;  2FBM A;  3RRV A;  4JJT A;  3GKB A;  3H0J A;  3ZWA A;  3GLM A;  4L6W A;  4JYJ A;  3QRE A;  2J5I I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...