3T8AA

Crystal structure of mycobacterium tuberculosis menb in complex with substrate analogue, osb-ncoa
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
279
structure length
252
Chain Sequence
DNPFDAKAWRLVDGFDDLTDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGDLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGEATRLAYMTDEAVEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of the Intramolecular Claisen Condensation Reaction Catalyzed by MenB, a Crotonase Superfamily Member.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase/lyase inhibitor
molecule keywords 1,4-Dihydroxy-2-naphthoyl-CoA synthase
total genus 95
structure length 252
sequence length 279
chains with identical sequence B, C
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 3t8aA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3t8aA01
4JCRA 3HP0A 3GF7A 4U0HA 2J5GD 1TYFA 1SG4A 3GLMA 1O8UA 2A7KA 3IB9A 2X24A 3TVWA 1DUBA 1NZYB 1MJ3A 4MXIA 3IAVA 4B3HA 4JYJA 4B3JA 5DZKH 3K8XA 4QFEA 4EMPA 3M6NA 2ZL3A 5IKLB 5DKPA 5DUCA 1ON9A 1SZOA 4ASIA 4FNBA 3V5EA 3K50A 3U9RB 2EJ5A 3H0UA 3HRXA 3PEAA 4I52A 3M6MA 1UIYA 2F6IA 5DU8A 3FF6A 3MYBA 2F9YA 3RSTA 2PBPA 1N6EA 3KTJA 4DI1A 4FNDA 4I4ZA 1NZYA 3Q1TA 4ELXA 3MT6A 4ZDDA 5DZKA 3Q0GA 3BF0A 3R9TA 3TVUA 5JBXA 3HINA 4ELWA 1UYRA 4U0GH 3R6HA 1XNYA 5KJPA 2VSUE 1XX4A 3GMAA 3Q7HA 2VSUC 4IZDA 5FIFA 2VREA 2VSUA 1K39A 3GF3A 4JVTA 3QWDA 5INFA 4JWVA 3KTKA 4U19A 3TLFA 3ZWBA 5MGBA 2Q34A 3T3WA 3MFMA 1WDMA 4FN8A 5C9GA 4KPKA 2DUBA 3BEZA 1FCFA 3KTIA 3U9TB 5INGA 3ZW8A 5KDRA 4FZWA 3JU1A 3ZWAA 3PZKA 4Q0GA 4L8KA 4GM2A 2ZL0A 2F6QA 4GHNA 3LAOA 4K3WA 2J5IA 3U9SB 3N6RB 2BZRA 3ISAA 3QREA 3VIVA 4IZCA 1XNVA 3H02A 5DL1A 3DORA 3ST9A 5G1RA 3R9QA 1WDKA 1K32A 1PIXA 3STAA 3P2LA 4JOTA 2CE3A 5CTBA 3LKEA 4U0GA 3T89A 3QMJA 2F9IB 3OMEA 1X0UA 3I47A 4Q1IA 1N6DA 1VRGA 1DCIA 2VSUF 3RRVA 2C8TA 2FW2A 4OMRA 3GKBA 4Z0MA 2DEOA 4RYFH 2VX2A 1Q51A 3RSIA 1ON3A 4KWBA 2W3PA 4U1AA 4HNKA 5DTWA 4G2RA 3OT6A 3KTGA 5G1SA 3R0OA 3QXZA 4EMLA 4U18A 3SLLA 1TG6A 4RCNA 5E0SA 4MI2A 4JSBA 1RJMA 1UYTA 3QK8A 5DTPA 4FJWD 1YG8A 3FDUA 1FC6A 3H81A 4L6WA 2PPYA 2FZSA 2WTBA 1OD2A 5G1QA 3L3SA 3TT7A 4JFCA 4EMMA 5C90A 3H0QA 4YLHA 2CBYA 4IZBA 4ZDEA 3ZWCA 3PGQA 1EY3A 3NJDA 2F9YB 3TDCA 2ZL4A 2Q35A 3DJAA 4K2NA 5KDRB 3TRRA 3QYRA 3T8BA 4ZU2A 4MOUA 5DU4A 3TZ3A 1YG6A 4ZDFA 1HNUA 3KQFA 2VSSF 4JYLA 4HC8A 1XNWA 3IBBA 2FBMA 3OC7A 5INIA 2X58A 1JXZA 3QKAA 1J7XA 4QIIA 4WZ8B 1FC7A 4JJTA 2ZQRA 3H0JA 3H0SA 2Q2XA 3HE2A 2J5II 3T88A 3TV5A 4QIJA 3SWXA 1UYVA 3MOYA 3NJBA 3G64A 3Q0JA 2J5GA 2HW5A 1FC9A 2VSSA 1EF9A 4JCSA 4FN7A 4WYOB 1XO6A 1Q52A 4ZDBA 3V5IA 4WCZA 1WZ8A 3WG5A 4FB8A 5FUSA 3ZW9A 1EF8A 5CTCA 2UZFA 3TT6A 3BPPA 1HZDA 2D3TA 4I42A 3KTHA 4K29A 4JCQA 2F9IA 5DUFA 2A81A 1N6FA 3T8AA 1HNOA 2J5SA 2ZL2A 1OD4A 4F47A 4ELSA 1PJHA 4FZWC 3QXIA 4KD6A 5DU6A 4KNPA 3P85A 5JBWA 4ZDCA 2ZQQA 1RJNA 3HLN1 3PE8A 4OG1A 2IEXA 4LK5A 4B3IA 5E0NX 2PG8A 4JCTA 5E0SH 1WDLA 2A7SA 2GTRA 3R9SA 4OLQA 4NNQA 1UYSA 4RYFA 1Y7OA 4NEKA 2NP9A 1W2XA 2VSSE 2J5IB 2QQ3A 3P5MA
chains in the Genus database with same CATH superfamily
4JCRA 3HP0A 3GF7A 4U0HA 2J5GD 1TYFA 1SG4A 3GLMA 1O8UA 2A7KA 3IB9A 2X24A 3TVWA 1DUBA 1NZYB 1MJ3A 4MXIA 3IAVA 4B3HA 4JYJA 4B3JA 5DZKH 3K8XA 4QFEA 4EMPA 3M6NA 2ZL3A 5IKLB 5DKPA 5DUCA 1ON9A 3AJMA 1SZOA 4ASIA 4FNBA 3V5EA 3K50A 3U9RB 2EJ5A 3H0UA 3HRXA 3PEAA 4I52A 3M6MA 1UIYA 2F6IA 5DU8A 3RQEA 3FF6A 3MYBA 2F9YA 3RSTA 2PBPA 1N6EA 3KTJA 4DI1A 4FNDA 3A4NA 4I4ZA 1NZYA 3Q1TA 4ELXA 3MT6A 4ZDDA 5DZKA 3Q0GA 3BF0A 3R9TA 3TVUA 5JBXA 3HINA 4ELWA 1UYRA 4U0GH 3R6HA 1XNYA 5KJPA 2VSUE 1XX4A 3GMAA 3Q7HA 2VSUC 4IZDA 3L8JA 5FIFA 2VREA 2VSUA 1K39A 3GF3A 4JVTA 3QWDA 5INFA 4JWVA 3KTKA 4U19A 3TLFA 3ZWBA 5MGBA 2Q34A 3T3WA 3MFMA 1WDMA 4FN8A 5C9GA 4KPKA 2DUBA 3BEZA 1FCFA 3KTIA 3U9TB 5INGA 3ZW8A 5KDRA 4FZWA 3JU1A 3ZWAA 3PZKA 4Q0GA 4L8KA 4GM2A 2ZL0A 2F6QA 4GHNA 3LAOA 4K3WA 2J5IA 3U9SB 3N6RB 2BZRA 3ISAA 3QREA 3VIVA 4IZCA 1XNVA 3H02A 5DL1A 3DORA 3ST9A 5G1RA 3R9QA 1WDKA 1K32A 1PIXA 3STAA 3P2LA 4JOTA 3A4LA 2CE3A 5CTBA 4U0GA 3LKEA 2P63A 3T89A 3QMJA 1UX4A 2F9IB 3OMEA 1X0UA 3I47A 4Q1IA 1N6DA 1VRGA 1DCIA 2VSUF 3RRVA 2C8TA 2FW2A 4OMRA 3GKBA 4Z0MA 2DEOA 4RYFH 2VX2A 1Q51A 3RSIA 1ON3A 4KWBA 2W3PA 4U1AA 4HNKA 5DTWA 4G2RA 3OT6A 3KTGA 5G1SA 3R0OA 3QXZA 4EMLA 4U18A 3SLLA 1TG6A 4RCNA 5E0SA 4MI2A 4JSBA 1RJMA 1UYTA 3QK8A 5DTPA 4FJWD 5HUQA 1YG8A 3FDUA 1FC6A 3H81A 4L6WA 2PPYA 2FZSA 2WTBA 1OD2A 3W8IB 5G1QA 3L3SA 3TT7A 4JFCA 4EMMA 5C90A 3H0QA 4YLHA 2CBYA 4IZBA 4ZDEA 3ZWCA 3PGQA 1EY3A 3NJDA 2F9YB 3TDCA 3W8HB 2ZL4A 2Q35A 3DJAA 4K2NA 4GEHB 5KDRB 3TRRA 3QYRA 3T8BA 4ZU2A 3BPTA 4MOUA 5DU4A 3IRBA 3TZ3A 1YG6A 4ZDFA 1HNUA 3KQFA 2VSSF 4JYLA 3A4MA 4HC8A 1XNWA 3IBBA 3L8IA 2FBMA 3OC7A 2X58A 1JXZA 5INIA 3QKAA 1J7XA 4QIIA 4WZ8B 1FC7A 4JJTA 2ZQRA 3H0JA 3H0SA 2Q2XA 3HE2A 2J5II 3T88A 3TV5A 4J2UA 4QIJA 3SWXA 1UYVA 3MOYA 3NJBA 3G64A 3Q0JA 2J5GA 2HW5A 3RQFA 1FC9A 2VSSA 1EF9A 4JCSA 4FN7A 4WYOB 1XO6A 1Q52A 4ZDBA 3V5IA 4WCZA 1WZ8A 3WG5A 4FB8A 5FUSA 3ZW9A 1EF8A 3AM1A 5CTCA 2UZFA 3TT6A 3BPPA 1HZDA 2D3TA 4I42A 3KTHA 3ADDA 4K29A 3O4XE 4JCQA 2F9IA 5DUFA 3ADBA 2A81A 1N6FA 3T8AA 1HNOA 1UX5A 2J5SA 2ZL2A 1OD4A 4F47A 4ELSA 1PJHA 4FZWC 4NARA 3QXIA 4KD6A 5DU6A 4KNPA 3P85A 1Y64B 2YJGA 5JBWA 4ZDCA 2ZQQA 1RJNA 3HLN1 3PE8A 4OG1A 2IEXA 4LK5A 4B3IA 4HDTA 5E0NX 2PG8A 4JCTA 5E0SH 3ADCA 1WDLA 2A7SA 2GTRA 3R9SA 4OLQA 4NNQA 1UYSA 3RQGA 4RYFA 1Y7OA 4NEKA 2NP9A 1W2XA 2VSSE 2J5IB 2QQ3A 3P5MA
chains in the Genus database with same CATH topology
4JCRA 3HP0A 3GF7A 4U0HA 2J5GD 1TYFA 1SG4A 3GLMA 1O8UA 2A7KA 3IB9A 2X24A 3TVWA 1DUBA 1NZYB 1MJ3A 4MXIA 3IAVA 4B3HA 4JYJA 4B3JA 5DZKH 3K8XA 4QFEA 4EMPA 3M6NA 2ZL3A 5IKLB 5DKPA 5DUCA 1ON9A 1SZOA 4ASIA 4FNBA 3V5EA 3K50A 3U9RB 2EJ5A 3H0UA 3HRXA 3PEAA 4I52A 3M6MA 1UIYA 2F6IA 5DU8A 3FF6A 3MYBA 2F9YA 3RSTA 2PBPA 1N6EA 3KTJA 4DI1A 4FNDA 4I4ZA 1NZYA 3Q1TA 4ELXA 3MT6A 4ZDDA 5DZKA 3Q0GA 3BF0A 3R9TA 3TVUA 5JBXA 3HINA 4ELWA 1UYRA 4U0GH 3R6HA 1XNYA 5KJPA 2VSUE 1XX4A 3GMAA 3Q7HA 2VSUC 4IZDA 5FIFA 2VREA 2VSUA 1K39A 3GF3A 4JVTA 3QWDA 5INFA 4JWVA 3KTKA 4U19A 3TLFA 3ZWBA 5MGBA 2Q34A 3T3WA 3MFMA 1WDMA 4FN8A 5C9GA 4KPKA 2DUBA 3BEZA 1FCFA 3KTIA 3U9TB 5INGA 3ZW8A 5KDRA 4FZWA 3JU1A 3ZWAA 3PZKA 4Q0GA 4L8KA 4GM2A 2ZL0A 2F6QA 4GHNA 3LAOA 4K3WA 2J5IA 3U9SB 3N6RB 2BZRA 3ISAA 3QREA 3VIVA 4IZCA 1XNVA 3H02A 5DL1A 3DORA 3ST9A 5G1RA 3R9QA 1WDKA 1K32A 1PIXA 3STAA 3P2LA 4JOTA 2CE3A 5CTBA 3LKEA 4U0GA 3T89A 3QMJA 2F9IB 3OMEA 1X0UA 3I47A 4Q1IA 1N6DA 1VRGA 1DCIA 2VSUF 3RRVA 2C8TA 2FW2A 4OMRA 3GKBA 4Z0MA 2DEOA 4RYFH 2VX2A 1Q51A 3RSIA 1ON3A 4KWBA 2W3PA 4U1AA 4HNKA 5DTWA 4G2RA 3OT6A 3KTGA 5G1SA 3R0OA 3QXZA 4EMLA 4U18A 3SLLA 1TG6A 4RCNA 5E0SA 4MI2A 4JSBA 1RJMA 1UYTA 3QK8A 5DTPA 4FJWD 5HUQA 1YG8A 3FDUA 1FC6A 3H81A 4L6WA 2PPYA 2FZSA 2WTBA 1OD2A 5G1QA 3L3SA 3TT7A 4JFCA 4EMMA 5C90A 3H0QA 4YLHA 2CBYA 4IZBA 4ZDEA 3ZWCA 3PGQA 1EY3A 3NJDA 2F9YB 3TDCA 2ZL4A 2Q35A 3DJAA 4K2NA 5KDRB 3TRRA 3QYRA 3T8BA 4ZU2A 3BPTA 4MOUA 5DU4A 3TZ3A 1YG6A 4ZDFA 1HNUA 3KQFA 2VSSF 4JYLA 4HC8A 1XNWA 3IBBA 2FBMA 3OC7A 2X58A 1JXZA 5INIA 3QKAA 1J7XA 4QIIA 4WZ8B 1FC7A 4JJTA 2ZQRA 3H0JA 3H0SA 2Q2XA 3HE2A 2J5II 3T88A 3TV5A 4J2UA 4QIJA 3SWXA 1UYVA 3MOYA 3NJBA 3G64A 3Q0JA 2J5GA 2HW5A 1FC9A 2VSSA 1EF9A 4JCSA 4FN7A 4WYOB 1XO6A 1Q52A 4ZDBA 3V5IA 4WCZA 1WZ8A 3WG5A 4FB8A 5FUSA 3ZW9A 1EF8A 5CTCA 2UZFA 3TT6A 3BPPA 1HZDA 2D3TA 4I42A 3KTHA 4K29A 4JCQA 2F9IA 5DUFA 2A81A 1N6FA 3T8AA 1HNOA 2J5SA 2ZL2A 1OD4A 4F47A 4ELSA 1PJHA 4FZWC 4NARA 3QXIA 4KD6A 5DU6A 4KNPA 3P85A 2YJGA 5JBWA 4ZDCA 2ZQQA 1RJNA 3HLN1 3PE8A 4OG1A 2IEXA 4LK5A 4B3IA 4HDTA 5E0NX 2PG8A 4JCTA 5E0SH 1WDLA 2A7SA 2GTRA 3R9SA 4OLQA 4NNQA 1UYSA 4RYFA 1Y7OA 4NEKA 2NP9A 1W2XA 2VSSE 2J5IB 2QQ3A 3P5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JCR A;  3HP0 A;  3GF7 A;  4U0H A;  2J5G D;  1TYF A;  1SG4 A;  3GLM A;  1O8U A;  2A7K A;  3IB9 A;  2X24 A;  3TVW A;  1DUB A;  1NZY B;  1MJ3 A;  4MXI A;  3IAV A;  4B3H A;  4JYJ A;  4B3J A;  5DZK H;  3K8X A;  4QFE A;  4EMP A;  3M6N A;  2ZL3 A;  5IKL B;  5DKP A;  5DUC A;  1ON9 A;  1SZO A;  4ASI A;  4FNB A;  3V5E A;  3K50 A;  3U9R B;  2EJ5 A;  3H0U A;  3HRX A;  3PEA A;  4I52 A;  3M6M A;  1UIY A;  2F6I A;  5DU8 A;  3FF6 A;  3MYB A;  2F9Y A;  3RST A;  2PBP A;  1N6E A;  3KTJ A;  4DI1 A;  4FND A;  4I4Z A;  1NZY A;  3Q1T A;  4ELX A;  3MT6 A;  4ZDD A;  5DZK A;  3Q0G A;  3BF0 A;  3R9T A;  3TVU A;  5JBX A;  3HIN A;  4ELW A;  1UYR A;  4U0G H;  3R6H A;  1XNY A;  5KJP A;  2VSU E;  1XX4 A;  3GMA A;  3Q7H A;  2VSU C;  4IZD A;  5FIF A;  2VRE A;  2VSU A;  1K39 A;  3GF3 A;  4JVT A;  3QWD A;  5INF A;  4JWV A;  3KTK A;  4U19 A;  3TLF A;  3ZWB A;  5MGB A;  2Q34 A;  3T3W A;  3MFM A;  1WDM A;  4FN8 A;  5C9G A;  4KPK A;  2DUB A;  3BEZ A;  1FCF A;  3KTI A;  3U9T B;  5ING A;  3ZW8 A;  5KDR A;  4FZW A;  3JU1 A;  3ZWA A;  3PZK A;  4Q0G A;  4L8K A;  4GM2 A;  2ZL0 A;  2F6Q A;  4GHN A;  3LAO A;  4K3W A;  2J5I A;  3U9S B;  3N6R B;  2BZR A;  3ISA A;  3QRE A;  3VIV A;  4IZC A;  1XNV A;  3H02 A;  5DL1 A;  3DOR A;  3ST9 A;  5G1R A;  3R9Q A;  1WDK A;  1K32 A;  1PIX A;  3STA A;  3P2L A;  4JOT A;  2CE3 A;  5CTB A;  3LKE A;  4U0G A;  3T89 A;  3QMJ A;  2F9I B;  3OME A;  1X0U A;  3I47 A;  4Q1I A;  1N6D A;  1VRG A;  1DCI A;  2VSU F;  3RRV A;  2C8T A;  2FW2 A;  4OMR A;  3GKB A;  4Z0M A;  2DEO A;  4RYF H;  2VX2 A;  1Q51 A;  3RSI A;  1ON3 A;  4KWB A;  2W3P A;  4U1A A;  4HNK A;  5DTW A;  4G2R A;  3OT6 A;  3KTG A;  5G1S A;  3R0O A;  3QXZ A;  4EML A;  4U18 A;  3SLL A;  1TG6 A;  4RCN A;  5E0S A;  4MI2 A;  4JSB A;  1RJM A;  1UYT A;  3QK8 A;  5DTP A;  4FJW D;  1YG8 A;  3FDU A;  1FC6 A;  3H81 A;  4L6W A;  2PPY A;  2FZS A;  2WTB A;  1OD2 A;  5G1Q A;  3L3S A;  3TT7 A;  4JFC A;  4EMM A;  5C90 A;  3H0Q A;  4YLH A;  2CBY A;  4IZB A;  4ZDE A;  3ZWC A;  3PGQ A;  1EY3 A;  3NJD A;  2F9Y B;  3TDC A;  2ZL4 A;  2Q35 A;  3DJA A;  4K2N A;  5KDR B;  3TRR A;  3QYR A;  3T8B A;  4ZU2 A;  4MOU A;  5DU4 A;  3TZ3 A;  1YG6 A;  4ZDF A;  1HNU A;  3KQF A;  2VSS F;  4JYL A;  4HC8 A;  1XNW A;  3IBB A;  2FBM A;  3OC7 A;  5INI A;  2X58 A;  1JXZ A;  3QKA A;  1J7X A;  4QII A;  4WZ8 B;  1FC7 A;  4JJT A;  2ZQR A;  3H0J A;  3H0S A;  2Q2X A;  3HE2 A;  2J5I I;  3T88 A;  3TV5 A;  4QIJ A;  3SWX A;  1UYV A;  3MOY A;  3NJB A;  3G64 A;  3Q0J A;  2J5G A;  2HW5 A;  1FC9 A;  2VSS A;  1EF9 A;  4JCS A;  4FN7 A;  4WYO B;  1XO6 A;  1Q52 A;  4ZDB A;  3V5I A;  4WCZ A;  1WZ8 A;  3WG5 A;  4FB8 A;  5FUS A;  3ZW9 A;  1EF8 A;  5CTC A;  2UZF A;  3TT6 A;  3BPP A;  1HZD A;  2D3T A;  4I42 A;  3KTH A;  4K29 A;  4JCQ A;  2F9I A;  5DUF A;  2A81 A;  1N6F A;  3T8A A;  1HNO A;  2J5S A;  2ZL2 A;  1OD4 A;  4F47 A;  4ELS A;  1PJH A;  4FZW C;  3QXI A;  4KD6 A;  5DU6 A;  4KNP A;  3P85 A;  5JBW A;  4ZDC A;  2ZQQ A;  1RJN A;  3HLN 1;  3PE8 A;  4OG1 A;  2IEX A;  4LK5 A;  4B3I A;  5E0N X;  2PG8 A;  4JCT A;  5E0S H;  1WDL A;  2A7S A;  2GTR A;  3R9S A;  4OLQ A;  4NNQ A;  1UYS A;  4RYF A;  1Y7O A;  4NEK A;  2NP9 A;  1W2X A;  2VSS E;  2J5I B;  2QQ3 A;  3P5M A; 
#chains in the Genus database with same CATH topology
 4JCR A;  3HP0 A;  3GF7 A;  4U0H A;  2J5G D;  1TYF A;  1SG4 A;  3GLM A;  1O8U A;  2A7K A;  3IB9 A;  2X24 A;  3TVW A;  1DUB A;  1NZY B;  1MJ3 A;  4MXI A;  3IAV A;  4B3H A;  4JYJ A;  4B3J A;  5DZK H;  3K8X A;  4QFE A;  4EMP A;  3M6N A;  2ZL3 A;  5IKL B;  5DKP A;  5DUC A;  1ON9 A;  3AJM A;  1SZO A;  4ASI A;  4FNB A;  3V5E A;  3K50 A;  3U9R B;  2EJ5 A;  3H0U A;  3HRX A;  3PEA A;  4I52 A;  3M6M A;  1UIY A;  2F6I A;  5DU8 A;  3RQE A;  3FF6 A;  3MYB A;  2F9Y A;  3RST A;  2PBP A;  1N6E A;  3KTJ A;  4DI1 A;  4FND A;  3A4N A;  4I4Z A;  1NZY A;  3Q1T A;  4ELX A;  3MT6 A;  4ZDD A;  5DZK A;  3Q0G A;  3BF0 A;  3R9T A;  3TVU A;  5JBX A;  3HIN A;  4ELW A;  1UYR A;  4U0G H;  3R6H A;  1XNY A;  5KJP A;  2VSU E;  1XX4 A;  3GMA A;  3Q7H A;  2VSU C;  4IZD A;  3L8J A;  5FIF A;  2VRE A;  2VSU A;  1K39 A;  3GF3 A;  4JVT A;  3QWD A;  5INF A;  4JWV A;  3KTK A;  4U19 A;  3TLF A;  3ZWB A;  5MGB A;  2Q34 A;  3T3W A;  3MFM A;  1WDM A;  4FN8 A;  5C9G A;  4KPK A;  2DUB A;  3BEZ A;  1FCF A;  3KTI A;  3U9T B;  5ING A;  3ZW8 A;  5KDR A;  4FZW A;  3JU1 A;  3ZWA A;  3PZK A;  4Q0G A;  4L8K A;  4GM2 A;  2ZL0 A;  2F6Q A;  4GHN A;  3LAO A;  4K3W A;  2J5I A;  3U9S B;  3N6R B;  2BZR A;  3ISA A;  3QRE A;  3VIV A;  4IZC A;  1XNV A;  3H02 A;  5DL1 A;  3DOR A;  3ST9 A;  5G1R A;  3R9Q A;  1WDK A;  1K32 A;  1PIX A;  3STA A;  3P2L A;  4JOT A;  3A4L A;  2CE3 A;  5CTB A;  4U0G A;  3LKE A;  2P63 A;  3T89 A;  3QMJ A;  1UX4 A;  2F9I B;  3OME A;  1X0U A;  3I47 A;  4Q1I A;  1N6D A;  1VRG A;  1DCI A;  2VSU F;  3RRV A;  2C8T A;  2FW2 A;  4OMR A;  3GKB A;  4Z0M A;  2DEO A;  4RYF H;  2VX2 A;  1Q51 A;  3RSI A;  1ON3 A;  4KWB A;  2W3P A;  4U1A A;  4HNK A;  5DTW A;  4G2R A;  3OT6 A;  3KTG A;  5G1S A;  3R0O A;  3QXZ A;  4EML A;  4U18 A;  3SLL A;  1TG6 A;  4RCN A;  5E0S A;  4MI2 A;  4JSB A;  1RJM A;  1UYT A;  3QK8 A;  5DTP A;  4FJW D;  5HUQ A;  1YG8 A;  3FDU A;  1FC6 A;  3H81 A;  4L6W A;  2PPY A;  2FZS A;  2WTB A;  1OD2 A;  3W8I B;  5G1Q A;  3L3S A;  3TT7 A;  4JFC A;  4EMM A;  5C90 A;  3H0Q A;  4YLH A;  2CBY A;  4IZB A;  4ZDE A;  3ZWC A;  3PGQ A;  1EY3 A;  3NJD A;  2F9Y B;  3TDC A;  3W8H B;  2ZL4 A;  2Q35 A;  3DJA A;  4K2N A;  4GEH B;  5KDR B;  3TRR A;  3QYR A;  3T8B A;  4ZU2 A;  3BPT A;  4MOU A;  5DU4 A;  3IRB A;  3TZ3 A;  1YG6 A;  4ZDF A;  1HNU A;  3KQF A;  2VSS F;  4JYL A;  3A4M A;  4HC8 A;  1XNW A;  3IBB A;  3L8I A;  2FBM A;  3OC7 A;  2X58 A;  1JXZ A;  5INI A;  3QKA A;  1J7X A;  4QII A;  4WZ8 B;  1FC7 A;  4JJT A;  2ZQR A;  3H0J A;  3H0S A;  2Q2X A;  3HE2 A;  2J5I I;  3T88 A;  3TV5 A;  4J2U A;  4QIJ A;  3SWX A;  1UYV A;  3MOY A;  3NJB A;  3G64 A;  3Q0J A;  2J5G A;  2HW5 A;  3RQF A;  1FC9 A;  2VSS A;  1EF9 A;  4JCS A;  4FN7 A;  4WYO B;  1XO6 A;  1Q52 A;  4ZDB A;  3V5I A;  4WCZ A;  1WZ8 A;  3WG5 A;  4FB8 A;  5FUS A;  3ZW9 A;  1EF8 A;  3AM1 A;  5CTC A;  2UZF A;  3TT6 A;  3BPP A;  1HZD A;  2D3T A;  4I42 A;  3KTH A;  3ADD A;  4K29 A;  3O4X E;  4JCQ A;  2F9I A;  5DUF A;  3ADB A;  2A81 A;  1N6F A;  3T8A A;  1HNO A;  1UX5 A;  2J5S A;  2ZL2 A;  1OD4 A;  4F47 A;  4ELS A;  1PJH A;  4FZW C;  4NAR A;  3QXI A;  4KD6 A;  5DU6 A;  4KNP A;  3P85 A;  1Y64 B;  2YJG A;  5JBW A;  4ZDC A;  2ZQQ A;  1RJN A;  3HLN 1;  3PE8 A;  4OG1 A;  2IEX A;  4LK5 A;  4B3I A;  4HDT A;  5E0N X;  2PG8 A;  4JCT A;  5E0S H;  3ADC A;  1WDL A;  2A7S A;  2GTR A;  3R9S A;  4OLQ A;  4NNQ A;  1UYS A;  3RQG A;  4RYF A;  1Y7O A;  4NEK A;  2NP9 A;  1W2X A;  2VSS E;  2J5I B;  2QQ3 A;  3P5M A; 
#chains in the Genus database with same CATH homology
 4JCR A;  3HP0 A;  3GF7 A;  4U0H A;  2J5G D;  1TYF A;  1SG4 A;  3GLM A;  1O8U A;  2A7K A;  3IB9 A;  2X24 A;  3TVW A;  1DUB A;  1NZY B;  1MJ3 A;  4MXI A;  3IAV A;  4B3H A;  4JYJ A;  4B3J A;  5DZK H;  3K8X A;  4QFE A;  4EMP A;  3M6N A;  2ZL3 A;  5IKL B;  5DKP A;  5DUC A;  1ON9 A;  1SZO A;  4ASI A;  4FNB A;  3V5E A;  3K50 A;  3U9R B;  2EJ5 A;  3H0U A;  3HRX A;  3PEA A;  4I52 A;  3M6M A;  1UIY A;  2F6I A;  5DU8 A;  3FF6 A;  3MYB A;  2F9Y A;  3RST A;  2PBP A;  1N6E A;  3KTJ A;  4DI1 A;  4FND A;  4I4Z A;  1NZY A;  3Q1T A;  4ELX A;  3MT6 A;  4ZDD A;  5DZK A;  3Q0G A;  3BF0 A;  3R9T A;  3TVU A;  5JBX A;  3HIN A;  4ELW A;  1UYR A;  4U0G H;  3R6H A;  1XNY A;  5KJP A;  2VSU E;  1XX4 A;  3GMA A;  3Q7H A;  2VSU C;  4IZD A;  5FIF A;  2VRE A;  2VSU A;  1K39 A;  3GF3 A;  4JVT A;  3QWD A;  5INF A;  4JWV A;  3KTK A;  4U19 A;  3TLF A;  3ZWB A;  5MGB A;  2Q34 A;  3T3W A;  3MFM A;  1WDM A;  4FN8 A;  5C9G A;  4KPK A;  2DUB A;  3BEZ A;  1FCF A;  3KTI A;  3U9T B;  5ING A;  3ZW8 A;  5KDR A;  4FZW A;  3JU1 A;  3ZWA A;  3PZK A;  4Q0G A;  4L8K A;  4GM2 A;  2ZL0 A;  2F6Q A;  4GHN A;  3LAO A;  4K3W A;  2J5I A;  3U9S B;  3N6R B;  2BZR A;  3ISA A;  3QRE A;  3VIV A;  4IZC A;  1XNV A;  3H02 A;  5DL1 A;  3DOR A;  3ST9 A;  5G1R A;  3R9Q A;  1WDK A;  1K32 A;  1PIX A;  3STA A;  3P2L A;  4JOT A;  2CE3 A;  5CTB A;  3LKE A;  4U0G A;  3T89 A;  3QMJ A;  2F9I B;  3OME A;  1X0U A;  3I47 A;  4Q1I A;  1N6D A;  1VRG A;  1DCI A;  2VSU F;  3RRV A;  2C8T A;  2FW2 A;  4OMR A;  3GKB A;  4Z0M A;  2DEO A;  4RYF H;  2VX2 A;  1Q51 A;  3RSI A;  1ON3 A;  4KWB A;  2W3P A;  4U1A A;  4HNK A;  5DTW A;  4G2R A;  3OT6 A;  3KTG A;  5G1S A;  3R0O A;  3QXZ A;  4EML A;  4U18 A;  3SLL A;  1TG6 A;  4RCN A;  5E0S A;  4MI2 A;  4JSB A;  1RJM A;  1UYT A;  3QK8 A;  5DTP A;  4FJW D;  5HUQ A;  1YG8 A;  3FDU A;  1FC6 A;  3H81 A;  4L6W A;  2PPY A;  2FZS A;  2WTB A;  1OD2 A;  5G1Q A;  3L3S A;  3TT7 A;  4JFC A;  4EMM A;  5C90 A;  3H0Q A;  4YLH A;  2CBY A;  4IZB A;  4ZDE A;  3ZWC A;  3PGQ A;  1EY3 A;  3NJD A;  2F9Y B;  3TDC A;  2ZL4 A;  2Q35 A;  3DJA A;  4K2N A;  5KDR B;  3TRR A;  3QYR A;  3T8B A;  4ZU2 A;  3BPT A;  4MOU A;  5DU4 A;  3TZ3 A;  1YG6 A;  4ZDF A;  1HNU A;  3KQF A;  2VSS F;  4JYL A;  4HC8 A;  1XNW A;  3IBB A;  2FBM A;  3OC7 A;  2X58 A;  1JXZ A;  5INI A;  3QKA A;  1J7X A;  4QII A;  4WZ8 B;  1FC7 A;  4JJT A;  2ZQR A;  3H0J A;  3H0S A;  2Q2X A;  3HE2 A;  2J5I I;  3T88 A;  3TV5 A;  4J2U A;  4QIJ A;  3SWX A;  1UYV A;  3MOY A;  3NJB A;  3G64 A;  3Q0J A;  2J5G A;  2HW5 A;  1FC9 A;  2VSS A;  1EF9 A;  4JCS A;  4FN7 A;  4WYO B;  1XO6 A;  1Q52 A;  4ZDB A;  3V5I A;  4WCZ A;  1WZ8 A;  3WG5 A;  4FB8 A;  5FUS A;  3ZW9 A;  1EF8 A;  5CTC A;  2UZF A;  3TT6 A;  3BPP A;  1HZD A;  2D3T A;  4I42 A;  3KTH A;  4K29 A;  4JCQ A;  2F9I A;  5DUF A;  2A81 A;  1N6F A;  3T8A A;  1HNO A;  2J5S A;  2ZL2 A;  1OD4 A;  4F47 A;  4ELS A;  1PJH A;  4FZW C;  4NAR A;  3QXI A;  4KD6 A;  5DU6 A;  4KNP A;  3P85 A;  2YJG A;  5JBW A;  4ZDC A;  2ZQQ A;  1RJN A;  3HLN 1;  3PE8 A;  4OG1 A;  2IEX A;  4LK5 A;  4B3I A;  4HDT A;  5E0N X;  2PG8 A;  4JCT A;  5E0S H;  1WDL A;  2A7S A;  2GTR A;  3R9S A;  4OLQ A;  4NNQ A;  1UYS A;  4RYF A;  1Y7O A;  4NEK A;  2NP9 A;  1W2X A;  2VSS E;  2J5I B;  2QQ3 A;  3P5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...