3T8AA

Crystal structure of mycobacterium tuberculosis menb in complex with substrate analogue, osb-ncoa
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
279
structure length
252
Chain Sequence
b'DNPFDAKAWRLVDGFDDLTDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGDLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGEATRLAYMTDEAVEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,4-Dihydroxy-2-naphthoyl-CoA synthase
publication title Mechanism of the Intramolecular Claisen Condensation Reaction Catalyzed by MenB, a Crotonase Superfamily Member.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase/lyase inhibitor
total genus 95
structure length 252
sequence length 279
chains with identical sequence B, C
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 3t8aA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3t8aA01
3LAOA 4FNDA 5FIFA 5FUSA 3BF0A 4QIIA 3HE2A 4JFCA 2ZQRA 2J5GD 3BPPA 3RRVA 4IZBA 4ELXA 5DTWA 3ST9A 3QXZA 4F47A 2IEXA 4FN7A 4RCNA 4OG1A 4QFEA 4Z0MA 1W2XA 1TG6A 4B3JA 1K32A 4L8KA 4EMLA 2J5IA 1WZ8A 2VX2A 3TDCA 3KTJA 2Q2XA 1WDLA 2ZQQA 4I42A 4I52A 1VRGA 5CTBA 3QYRA 2FZSA 3V5EA 2A7SA 4FJWD 2VREA 1UYVA 5DTPA 5E0SH 3U9TB 1K39A 5DKPA 3PEAA 4DI1A 5MGBA 3MFMA 3KTIA 4JCQA 5DL1A 3GF7A 3H81A 4EMPA 3WG5A 1OD2A 4EMMA 5DZKA 4HNKA 4ZDFA 3RSIA 3HLN1 3KTGA 3R9TA 4NNQA 4U0GA 4OMRA 4KD6A 3KQFA 4B3HA 1XNVA 3QREA 4B3IA 3H0SA 3STAA 1XNWA 3TVWA 2UZFA 3TT6A 2QQ3A 1WDMA 4KPKA 4ZDEA 2X58A 2Q35A 2FBMA 4ZDCA 3HP0A 3NJBA 2CBYA 3GLMA 3TZ3A 5DU4A 4NEKA 4Q1IA 3T8BA 4KWBA 4ELWA 5JBWA 1FC9A 4JCTA 2PBPA 4K2NA 3GF3A 3ISAA 3H0UA 4JWVA 4IZDA 2DEOA 4GHNA 2Q34A 4LK5A 3PZKA 1DUBA 3H0JA 3ZWBA 4JSBA 2WTBA 1EF9A 4ASIA 5G1RA 4L6WA 2VSSF 1UYRA 3DORA 1Q52A 3TLFA 3M6NA 1YG8A 5INFA 3P5MA 3T8AA 2VSSA 5KDRB 3MOYA 4K29A 4JYJA 2J5IB 3VIVA 5KDRA 3Q0GA 5DZKH 5DU8A 4K3WA 4WYOB 4G2RA 3T89A 4U0GH 2HW5A 3ZW9A 4FNBA 5E0NX 2BZRA 1RJMA 4RYFA 1X0UA 1PIXA 2A81A 1UYTA 4U0HA 3OMEA 3H02A 3DJAA 3TRRA 2EJ5A 3BEZA 2F6QA 4FZWA 1NZYB 3R0OA 4KNPA 3KTHA 4WCZA 4YLHA 1NZYA 1XX4A 3NJDA 4JVTA 4JCSA 4QIJA 1SZOA 3K8XA 1RJNA 2CE3A 5INIA 1ON3A 5KJPA 3OT6A 3OC7A 1HZDA 5INGA 4MI2A 1FCFA 3LKEA 4I4ZA 1FC7A 2F6IA 1DCIA 5CTCA 5DUFA 3V5IA 3ZWCA 1Q51A 3SLLA 3GMAA 1TYFA 4ZDDA 1XNYA 1WDKA 1ON9A 4U19A 5IKLB 1O8UA 3QWDA 1MJ3A 2VSUF 3M6MA 5DUCA 4U18A 2ZL0A 1J7XA 2ZL2A 3I47A 2J5II 3Q1TA 1N6DA 3R9QA 5C90A 1SG4A 1HNOA 3QMJA 3H0QA 2VSUA 3TVUA 1JXZA 3R9SA 2VSSE 4RYFH 4FN8A 3PE8A 1PJHA 1OD4A 2D3TA 4JCRA 3L3SA 3IBBA 3QK8A 3JU1A 2PPYA 2ZL3A 3FDUA 1EY3A 3ZW8A 2J5SA 2C8TA 3Q0JA 3G64A 3P85A 2VSUC 3KTKA 3T88A 3PGQA 2ZL4A 4ZU2A 4Q0GA 3HRXA 3QXIA 3QKAA 4OLQA 1FC6A 4HC8A 2X24A 4MXIA 1EF8A 2NP9A 1XO6A 2A7KA 3Q7HA 3MYBA 1HNUA 4JJTA 2W3PA 4U1AA 2FW2A 3K50A 4JYLA 3SWXA 3IAVA 3N6RB 3U9RB 1YG6A 3TT7A 2F9IB 4ELSA 1N6EA 3T3WA 2F9IA 3FF6A 5JBXA 4IZCA 2F9YB 3GKBA 4FZWC 2GTRA 5G1QA 2F9YA 3RSTA 5C9GA 3MT6A 4FB8A 1N6FA 4GM2A 2J5GA 3IB9A 4WZ8B 2PG8A 3HINA 2VSUE 2DUBA 1UYSA 3TV5A 5DU6A 1UIYA 4JOTA 5G1SA 4MOUA 3ZWAA 1Y7OA 3P2LA 4ZDBA 5E0SA 3U9SB 3R6HA
chains in the Genus database with same CATH superfamily
3LAOA 4FNDA 3ADDA 5FIFA 5FUSA 3BF0A 4QIIA 3W8HB 3HE2A 4JFCA 2ZQRA 4NARA 2J5GD 3BPPA 3RRVA 4IZBA 3W8IB 4ELXA 5DTWA 3ST9A 3QXZA 4F47A 2IEXA 4FN7A 4RCNA 4OG1A 4HDTA 4QFEA 4Z0MA 1W2XA 1TG6A 4B3JA 1K32A 4L8KA 4EMLA 2J5IA 1WZ8A 2VX2A 3TDCA 3KTJA 2Q2XA 1WDLA 3ADCA 2ZQQA 4I42A 4I52A 3BPTA 1VRGA 5CTBA 3QYRA 2FZSA 3V5EA 2A7SA 4FJWD 2VREA 1UYVA 5DTPA 5E0SH 1UX4A 3U9TB 1K39A 5DKPA 3PEAA 4DI1A 5MGBA 3MFMA 3KTIA 4JCQA 5DL1A 3GF7A 3H81A 4EMPA 3WG5A 1OD2A 4EMMA 4HNKA 5DZKA 4ZDFA 3RSIA 3HLN1 3KTGA 3R9TA 4NNQA 4U0GA 4OMRA 3A4NA 4KD6A 3O4XE 1UX5A 3KQFA 4B3HA 1XNVA 3QREA 4B3IA 3H0SA 3STAA 1XNWA 3TVWA 2UZFA 3TT6A 2QQ3A 1WDMA 4KPKA 4ZDEA 2X58A 2Q35A 2FBMA 4ZDCA 3HP0A 3NJBA 2CBYA 3GLMA 3TZ3A 5DU4A 4NEKA 4Q1IA 3T8BA 4KWBA 4ELWA 5JBWA 1FC9A 4JCTA 2PBPA 4K2NA 3GF3A 3ISAA 3H0UA 4JWVA 4IZDA 2DEOA 4GHNA 2Q34A 4LK5A 3PZKA 1DUBA 3H0JA 3ZWBA 4JSBA 2WTBA 1EF9A 4ASIA 5G1RA 4L6WA 2VSSF 1UYRA 3DORA 1Q52A 3TLFA 3M6NA 1YG8A 5INFA 3P5MA 3T8AA 2VSSA 5KDRB 3MOYA 4K29A 4JYJA 2J5IB 3VIVA 5KDRA 3Q0GA 5DZKH 5DU8A 4K3WA 4WYOB 4G2RA 2P63A 3T89A 4U0GH 2HW5A 3ZW9A 4FNBA 3L8JA 5E0NX 2BZRA 1RJMA 4RYFA 1X0UA 1PIXA 2A81A 1UYTA 4U0HA 3OMEA 3H02A 3DJAA 3TRRA 2EJ5A 3BEZA 2F6QA 4FZWA 1NZYB 3R0OA 3IRBA 4KNPA 3KTHA 4WCZA 4YLHA 1NZYA 1XX4A 3RQEA 3NJDA 4JVTA 4JCSA 4QIJA 1SZOA 3K8XA 1RJNA 2YJGA 2CE3A 5INIA 1ON3A 3RQFA 5KJPA 3OT6A 3OC7A 1HZDA 5INGA 4MI2A 1FCFA 3LKEA 4I4ZA 1FC7A 2F6IA 1DCIA 5CTCA 5DUFA 3V5IA 3ZWCA 1Q51A 3SLLA 3GMAA 1TYFA 4ZDDA 3A4LA 1XNYA 1WDKA 1ON9A 4U19A 5IKLB 1O8UA 3QWDA 5HUQA 1MJ3A 2VSUF 3M6MA 3RQGA 5DUCA 4U18A 2ZL0A 1J7XA 2ZL2A 3I47A 3L8IA 2J5II 3Q1TA 1N6DA 3R9QA 5C90A 1SG4A 1HNOA 3QMJA 3H0QA 2VSUA 3TVUA 1JXZA 3R9SA 2VSSE 4RYFH 4FN8A 3PE8A 1PJHA 1OD4A 2D3TA 4JCRA 3L3SA 3IBBA 3QK8A 3JU1A 2PPYA 2ZL3A 3FDUA 1EY3A 4GEHB 3AM1A 3ZW8A 2J5SA 2C8TA 3Q0JA 3G64A 3P85A 2VSUC 3KTKA 3T88A 3PGQA 2ZL4A 4ZU2A 4Q0GA 3HRXA 3QXIA 3QKAA 4OLQA 1FC6A 4HC8A 2X24A 4MXIA 1EF8A 2NP9A 1XO6A 2A7KA 3Q7HA 3MYBA 1HNUA 4JJTA 2W3PA 4U1AA 2FW2A 3K50A 4JYLA 3SWXA 3IAVA 3N6RB 3U9RB 1YG6A 3TT7A 2F9IB 4ELSA 1N6EA 3T3WA 2F9IA 3FF6A 5JBXA 4IZCA 2F9YB 3GKBA 4FZWC 2GTRA 3AJMA 5G1QA 2F9YA 3RSTA 5C9GA 3MT6A 4FB8A 1N6FA 4GM2A 4J2UA 3ADBA 2J5GA 3IB9A 4WZ8B 2PG8A 3HINA 2VSUE 2DUBA 1UYSA 3TV5A 5DU6A 1UIYA 4JOTA 5G1SA 4MOUA 1Y64B 3ZWAA 1Y7OA 3P2LA 4ZDBA 5E0SA 3A4MA 3U9SB 3R6HA
chains in the Genus database with same CATH topology
3LAOA 4FNDA 5FIFA 5FUSA 3BF0A 4QIIA 3HE2A 4JFCA 2ZQRA 4NARA 2J5GD 3BPPA 3RRVA 4IZBA 4ELXA 5DTWA 3ST9A 3QXZA 4F47A 2IEXA 4FN7A 4RCNA 4OG1A 4HDTA 4QFEA 4Z0MA 1W2XA 1TG6A 4B3JA 1K32A 4L8KA 4EMLA 2J5IA 1WZ8A 2VX2A 3TDCA 3KTJA 2Q2XA 1WDLA 2ZQQA 4I42A 4I52A 3BPTA 1VRGA 5CTBA 3QYRA 2FZSA 3V5EA 2A7SA 4FJWD 2VREA 1UYVA 5DTPA 5E0SH 3U9TB 1K39A 5DKPA 3PEAA 4DI1A 5MGBA 3MFMA 3KTIA 4JCQA 5DL1A 3GF7A 3H81A 4EMPA 3WG5A 1OD2A 4EMMA 5DZKA 4HNKA 4ZDFA 3RSIA 3HLN1 3KTGA 3R9TA 4NNQA 4U0GA 4OMRA 4KD6A 3KQFA 4B3HA 1XNVA 3QREA 4B3IA 3H0SA 3STAA 1XNWA 3TVWA 2UZFA 3TT6A 2QQ3A 1WDMA 4KPKA 4ZDEA 2X58A 2Q35A 2FBMA 4ZDCA 3HP0A 3NJBA 2CBYA 3GLMA 3TZ3A 5DU4A 4NEKA 4Q1IA 3T8BA 4KWBA 4ELWA 5JBWA 1FC9A 4JCTA 2PBPA 4K2NA 3GF3A 3ISAA 3H0UA 4JWVA 4IZDA 2DEOA 4GHNA 2Q34A 4LK5A 3PZKA 1DUBA 3H0JA 3ZWBA 4JSBA 2WTBA 1EF9A 4ASIA 5G1RA 4L6WA 2VSSF 1UYRA 3DORA 1Q52A 3TLFA 3M6NA 1YG8A 5INFA 3P5MA 3T8AA 2VSSA 5KDRB 3MOYA 4K29A 4JYJA 2J5IB 3VIVA 5KDRA 3Q0GA 5DZKH 5DU8A 4K3WA 4WYOB 4G2RA 3T89A 4U0GH 2HW5A 3ZW9A 4FNBA 5E0NX 2BZRA 1RJMA 4RYFA 1X0UA 1PIXA 2A81A 1UYTA 4U0HA 3OMEA 3H02A 3DJAA 3TRRA 2EJ5A 3BEZA 2F6QA 4FZWA 1NZYB 3R0OA 4KNPA 3KTHA 4WCZA 4YLHA 1NZYA 1XX4A 3NJDA 4JVTA 4JCSA 4QIJA 1SZOA 3K8XA 1RJNA 2YJGA 2CE3A 5INIA 1ON3A 5KJPA 3OT6A 3OC7A 1HZDA 5INGA 4MI2A 1FCFA 3LKEA 4I4ZA 1FC7A 2F6IA 1DCIA 5CTCA 5DUFA 3V5IA 3ZWCA 1Q51A 3SLLA 3GMAA 1TYFA 4ZDDA 1XNYA 1WDKA 1ON9A 4U19A 5IKLB 1O8UA 3QWDA 5HUQA 1MJ3A 2VSUF 3M6MA 5DUCA 4U18A 2ZL0A 1J7XA 2ZL2A 3I47A 2J5II 3Q1TA 1N6DA 3R9QA 5C90A 1SG4A 1HNOA 3QMJA 3H0QA 2VSUA 3TVUA 1JXZA 3R9SA 2VSSE 4RYFH 4FN8A 3PE8A 1PJHA 1OD4A 2D3TA 4JCRA 3L3SA 3IBBA 3QK8A 3JU1A 2PPYA 2ZL3A 3FDUA 1EY3A 3ZW8A 2J5SA 2C8TA 3Q0JA 3G64A 3P85A 2VSUC 3KTKA 3T88A 3PGQA 2ZL4A 4ZU2A 4Q0GA 3HRXA 3QXIA 3QKAA 4OLQA 1FC6A 4HC8A 2X24A 4MXIA 1EF8A 2NP9A 1XO6A 2A7KA 3Q7HA 3MYBA 1HNUA 4JJTA 2W3PA 4U1AA 2FW2A 3K50A 4JYLA 3SWXA 3IAVA 3N6RB 3U9RB 1YG6A 3TT7A 2F9IB 4ELSA 1N6EA 3T3WA 2F9IA 3FF6A 5JBXA 4IZCA 2F9YB 3GKBA 4FZWC 2GTRA 5G1QA 2F9YA 3RSTA 5C9GA 3MT6A 4FB8A 1N6FA 4GM2A 4J2UA 2J5GA 3IB9A 4WZ8B 2PG8A 3HINA 2VSUE 2DUBA 1UYSA 3TV5A 5DU6A 1UIYA 4JOTA 5G1SA 4MOUA 3ZWAA 1Y7OA 3P2LA 4ZDBA 5E0SA 3U9SB 3R6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LAO A;  4FND A;  5FIF A;  5FUS A;  3BF0 A;  4QII A;  3HE2 A;  4JFC A;  2ZQR A;  2J5G D;  3BPP A;  3RRV A;  4IZB A;  4ELX A;  5DTW A;  3ST9 A;  3QXZ A;  4F47 A;  2IEX A;  4FN7 A;  4RCN A;  4OG1 A;  4QFE A;  4Z0M A;  1W2X A;  1TG6 A;  4B3J A;  1K32 A;  4L8K A;  4EML A;  2J5I A;  1WZ8 A;  2VX2 A;  3TDC A;  3KTJ A;  2Q2X A;  1WDL A;  2ZQQ A;  4I42 A;  4I52 A;  1VRG A;  5CTB A;  3QYR A;  2FZS A;  3V5E A;  2A7S A;  4FJW D;  2VRE A;  1UYV A;  5DTP A;  5E0S H;  3U9T B;  1K39 A;  5DKP A;  3PEA A;  4DI1 A;  5MGB A;  3MFM A;  3KTI A;  4JCQ A;  5DL1 A;  3GF7 A;  3H81 A;  4EMP A;  3WG5 A;  1OD2 A;  4EMM A;  5DZK A;  4HNK A;  4ZDF A;  3RSI A;  3HLN 1;  3KTG A;  3R9T A;  4NNQ A;  4U0G A;  4OMR A;  4KD6 A;  3KQF A;  4B3H A;  1XNV A;  3QRE A;  4B3I A;  3H0S A;  3STA A;  1XNW A;  3TVW A;  2UZF A;  3TT6 A;  2QQ3 A;  1WDM A;  4KPK A;  4ZDE A;  2X58 A;  2Q35 A;  2FBM A;  4ZDC A;  3HP0 A;  3NJB A;  2CBY A;  3GLM A;  3TZ3 A;  5DU4 A;  4NEK A;  4Q1I A;  3T8B A;  4KWB A;  4ELW A;  5JBW A;  1FC9 A;  4JCT A;  2PBP A;  4K2N A;  3GF3 A;  3ISA A;  3H0U A;  4JWV A;  4IZD A;  2DEO A;  4GHN A;  2Q34 A;  4LK5 A;  3PZK A;  1DUB A;  3H0J A;  3ZWB A;  4JSB A;  2WTB A;  1EF9 A;  4ASI A;  5G1R A;  4L6W A;  2VSS F;  1UYR A;  3DOR A;  1Q52 A;  3TLF A;  3M6N A;  1YG8 A;  5INF A;  3P5M A;  3T8A A;  2VSS A;  5KDR B;  3MOY A;  4K29 A;  4JYJ A;  2J5I B;  3VIV A;  5KDR A;  3Q0G A;  5DZK H;  5DU8 A;  4K3W A;  4WYO B;  4G2R A;  3T89 A;  4U0G H;  2HW5 A;  3ZW9 A;  4FNB A;  5E0N X;  2BZR A;  1RJM A;  4RYF A;  1X0U A;  1PIX A;  2A81 A;  1UYT A;  4U0H A;  3OME A;  3H02 A;  3DJA A;  3TRR A;  2EJ5 A;  3BEZ A;  2F6Q A;  4FZW A;  1NZY B;  3R0O A;  4KNP A;  3KTH A;  4WCZ A;  4YLH A;  1NZY A;  1XX4 A;  3NJD A;  4JVT A;  4JCS A;  4QIJ A;  1SZO A;  3K8X A;  1RJN A;  2CE3 A;  5INI A;  1ON3 A;  5KJP A;  3OT6 A;  3OC7 A;  1HZD A;  5ING A;  4MI2 A;  1FCF A;  3LKE A;  4I4Z A;  1FC7 A;  2F6I A;  1DCI A;  5CTC A;  5DUF A;  3V5I A;  3ZWC A;  1Q51 A;  3SLL A;  3GMA A;  1TYF A;  4ZDD A;  1XNY A;  1WDK A;  1ON9 A;  4U19 A;  5IKL B;  1O8U A;  3QWD A;  1MJ3 A;  2VSU F;  3M6M A;  5DUC A;  4U18 A;  2ZL0 A;  1J7X A;  2ZL2 A;  3I47 A;  2J5I I;  3Q1T A;  1N6D A;  3R9Q A;  5C90 A;  1SG4 A;  1HNO A;  3QMJ A;  3H0Q A;  2VSU A;  3TVU A;  1JXZ A;  3R9S A;  2VSS E;  4RYF H;  4FN8 A;  3PE8 A;  1PJH A;  1OD4 A;  2D3T A;  4JCR A;  3L3S A;  3IBB A;  3QK8 A;  3JU1 A;  2PPY A;  2ZL3 A;  3FDU A;  1EY3 A;  3ZW8 A;  2J5S A;  2C8T A;  3Q0J A;  3G64 A;  3P85 A;  2VSU C;  3KTK A;  3T88 A;  3PGQ A;  2ZL4 A;  4ZU2 A;  4Q0G A;  3HRX A;  3QXI A;  3QKA A;  4OLQ A;  1FC6 A;  4HC8 A;  2X24 A;  4MXI A;  1EF8 A;  2NP9 A;  1XO6 A;  2A7K A;  3Q7H A;  3MYB A;  1HNU A;  4JJT A;  2W3P A;  4U1A A;  2FW2 A;  3K50 A;  4JYL A;  3SWX A;  3IAV A;  3N6R B;  3U9R B;  1YG6 A;  3TT7 A;  2F9I B;  4ELS A;  1N6E A;  3T3W A;  2F9I A;  3FF6 A;  5JBX A;  4IZC A;  2F9Y B;  3GKB A;  4FZW C;  2GTR A;  5G1Q A;  2F9Y A;  3RST A;  5C9G A;  3MT6 A;  4FB8 A;  1N6F A;  4GM2 A;  2J5G A;  3IB9 A;  4WZ8 B;  2PG8 A;  3HIN A;  2VSU E;  2DUB A;  1UYS A;  3TV5 A;  5DU6 A;  1UIY A;  4JOT A;  5G1S A;  4MOU A;  3ZWA A;  1Y7O A;  3P2L A;  4ZDB A;  5E0S A;  3U9S B;  3R6H A; 
#chains in the Genus database with same CATH topology
 3LAO A;  4FND A;  3ADD A;  5FIF A;  5FUS A;  3BF0 A;  4QII A;  3W8H B;  3HE2 A;  4JFC A;  2ZQR A;  4NAR A;  2J5G D;  3BPP A;  3RRV A;  4IZB A;  3W8I B;  4ELX A;  5DTW A;  3ST9 A;  3QXZ A;  4F47 A;  2IEX A;  4FN7 A;  4RCN A;  4OG1 A;  4HDT A;  4QFE A;  4Z0M A;  1W2X A;  1TG6 A;  4B3J A;  1K32 A;  4L8K A;  4EML A;  2J5I A;  1WZ8 A;  2VX2 A;  3TDC A;  3KTJ A;  2Q2X A;  1WDL A;  3ADC A;  2ZQQ A;  4I42 A;  4I52 A;  3BPT A;  1VRG A;  5CTB A;  3QYR A;  2FZS A;  3V5E A;  2A7S A;  4FJW D;  2VRE A;  1UYV A;  5DTP A;  5E0S H;  1UX4 A;  3U9T B;  1K39 A;  5DKP A;  3PEA A;  4DI1 A;  5MGB A;  3MFM A;  3KTI A;  4JCQ A;  5DL1 A;  3GF7 A;  3H81 A;  4EMP A;  3WG5 A;  1OD2 A;  4EMM A;  4HNK A;  5DZK A;  4ZDF A;  3RSI A;  3HLN 1;  3KTG A;  3R9T A;  4NNQ A;  4U0G A;  4OMR A;  3A4N A;  4KD6 A;  3O4X E;  1UX5 A;  3KQF A;  4B3H A;  1XNV A;  3QRE A;  4B3I A;  3H0S A;  3STA A;  1XNW A;  3TVW A;  2UZF A;  3TT6 A;  2QQ3 A;  1WDM A;  4KPK A;  4ZDE A;  2X58 A;  2Q35 A;  2FBM A;  4ZDC A;  3HP0 A;  3NJB A;  2CBY A;  3GLM A;  3TZ3 A;  5DU4 A;  4NEK A;  4Q1I A;  3T8B A;  4KWB A;  4ELW A;  5JBW A;  1FC9 A;  4JCT A;  2PBP A;  4K2N A;  3GF3 A;  3ISA A;  3H0U A;  4JWV A;  4IZD A;  2DEO A;  4GHN A;  2Q34 A;  4LK5 A;  3PZK A;  1DUB A;  3H0J A;  3ZWB A;  4JSB A;  2WTB A;  1EF9 A;  4ASI A;  5G1R A;  4L6W A;  2VSS F;  1UYR A;  3DOR A;  1Q52 A;  3TLF A;  3M6N A;  1YG8 A;  5INF A;  3P5M A;  3T8A A;  2VSS A;  5KDR B;  3MOY A;  4K29 A;  4JYJ A;  2J5I B;  3VIV A;  5KDR A;  3Q0G A;  5DZK H;  5DU8 A;  4K3W A;  4WYO B;  4G2R A;  2P63 A;  3T89 A;  4U0G H;  2HW5 A;  3ZW9 A;  4FNB A;  3L8J A;  5E0N X;  2BZR A;  1RJM A;  4RYF A;  1X0U A;  1PIX A;  2A81 A;  1UYT A;  4U0H A;  3OME A;  3H02 A;  3DJA A;  3TRR A;  2EJ5 A;  3BEZ A;  2F6Q A;  4FZW A;  1NZY B;  3R0O A;  3IRB A;  4KNP A;  3KTH A;  4WCZ A;  4YLH A;  1NZY A;  1XX4 A;  3RQE A;  3NJD A;  4JVT A;  4JCS A;  4QIJ A;  1SZO A;  3K8X A;  1RJN A;  2YJG A;  2CE3 A;  5INI A;  1ON3 A;  3RQF A;  5KJP A;  3OT6 A;  3OC7 A;  1HZD A;  5ING A;  4MI2 A;  1FCF A;  3LKE A;  4I4Z A;  1FC7 A;  2F6I A;  1DCI A;  5CTC A;  5DUF A;  3V5I A;  3ZWC A;  1Q51 A;  3SLL A;  3GMA A;  1TYF A;  4ZDD A;  3A4L A;  1XNY A;  1WDK A;  1ON9 A;  4U19 A;  5IKL B;  1O8U A;  3QWD A;  5HUQ A;  1MJ3 A;  2VSU F;  3M6M A;  3RQG A;  5DUC A;  4U18 A;  2ZL0 A;  1J7X A;  2ZL2 A;  3I47 A;  3L8I A;  2J5I I;  3Q1T A;  1N6D A;  3R9Q A;  5C90 A;  1SG4 A;  1HNO A;  3QMJ A;  3H0Q A;  2VSU A;  3TVU A;  1JXZ A;  3R9S A;  2VSS E;  4RYF H;  4FN8 A;  3PE8 A;  1PJH A;  1OD4 A;  2D3T A;  4JCR A;  3L3S A;  3IBB A;  3QK8 A;  3JU1 A;  2PPY A;  2ZL3 A;  3FDU A;  1EY3 A;  4GEH B;  3AM1 A;  3ZW8 A;  2J5S A;  2C8T A;  3Q0J A;  3G64 A;  3P85 A;  2VSU C;  3KTK A;  3T88 A;  3PGQ A;  2ZL4 A;  4ZU2 A;  4Q0G A;  3HRX A;  3QXI A;  3QKA A;  4OLQ A;  1FC6 A;  4HC8 A;  2X24 A;  4MXI A;  1EF8 A;  2NP9 A;  1XO6 A;  2A7K A;  3Q7H A;  3MYB A;  1HNU A;  4JJT A;  2W3P A;  4U1A A;  2FW2 A;  3K50 A;  4JYL A;  3SWX A;  3IAV A;  3N6R B;  3U9R B;  1YG6 A;  3TT7 A;  2F9I B;  4ELS A;  1N6E A;  3T3W A;  2F9I A;  3FF6 A;  5JBX A;  4IZC A;  2F9Y B;  3GKB A;  4FZW C;  2GTR A;  3AJM A;  5G1Q A;  2F9Y A;  3RST A;  5C9G A;  3MT6 A;  4FB8 A;  1N6F A;  4GM2 A;  4J2U A;  3ADB A;  2J5G A;  3IB9 A;  4WZ8 B;  2PG8 A;  3HIN A;  2VSU E;  2DUB A;  1UYS A;  3TV5 A;  5DU6 A;  1UIY A;  4JOT A;  5G1S A;  4MOU A;  1Y64 B;  3ZWA A;  1Y7O A;  3P2L A;  4ZDB A;  5E0S A;  3A4M A;  3U9S B;  3R6H A; 
#chains in the Genus database with same CATH homology
 3LAO A;  4FND A;  5FIF A;  5FUS A;  3BF0 A;  4QII A;  3HE2 A;  4JFC A;  2ZQR A;  4NAR A;  2J5G D;  3BPP A;  3RRV A;  4IZB A;  4ELX A;  5DTW A;  3ST9 A;  3QXZ A;  4F47 A;  2IEX A;  4FN7 A;  4RCN A;  4OG1 A;  4HDT A;  4QFE A;  4Z0M A;  1W2X A;  1TG6 A;  4B3J A;  1K32 A;  4L8K A;  4EML A;  2J5I A;  1WZ8 A;  2VX2 A;  3TDC A;  3KTJ A;  2Q2X A;  1WDL A;  2ZQQ A;  4I42 A;  4I52 A;  3BPT A;  1VRG A;  5CTB A;  3QYR A;  2FZS A;  3V5E A;  2A7S A;  4FJW D;  2VRE A;  1UYV A;  5DTP A;  5E0S H;  3U9T B;  1K39 A;  5DKP A;  3PEA A;  4DI1 A;  5MGB A;  3MFM A;  3KTI A;  4JCQ A;  5DL1 A;  3GF7 A;  3H81 A;  4EMP A;  3WG5 A;  1OD2 A;  4EMM A;  5DZK A;  4HNK A;  4ZDF A;  3RSI A;  3HLN 1;  3KTG A;  3R9T A;  4NNQ A;  4U0G A;  4OMR A;  4KD6 A;  3KQF A;  4B3H A;  1XNV A;  3QRE A;  4B3I A;  3H0S A;  3STA A;  1XNW A;  3TVW A;  2UZF A;  3TT6 A;  2QQ3 A;  1WDM A;  4KPK A;  4ZDE A;  2X58 A;  2Q35 A;  2FBM A;  4ZDC A;  3HP0 A;  3NJB A;  2CBY A;  3GLM A;  3TZ3 A;  5DU4 A;  4NEK A;  4Q1I A;  3T8B A;  4KWB A;  4ELW A;  5JBW A;  1FC9 A;  4JCT A;  2PBP A;  4K2N A;  3GF3 A;  3ISA A;  3H0U A;  4JWV A;  4IZD A;  2DEO A;  4GHN A;  2Q34 A;  4LK5 A;  3PZK A;  1DUB A;  3H0J A;  3ZWB A;  4JSB A;  2WTB A;  1EF9 A;  4ASI A;  5G1R A;  4L6W A;  2VSS F;  1UYR A;  3DOR A;  1Q52 A;  3TLF A;  3M6N A;  1YG8 A;  5INF A;  3P5M A;  3T8A A;  2VSS A;  5KDR B;  3MOY A;  4K29 A;  4JYJ A;  2J5I B;  3VIV A;  5KDR A;  3Q0G A;  5DZK H;  5DU8 A;  4K3W A;  4WYO B;  4G2R A;  3T89 A;  4U0G H;  2HW5 A;  3ZW9 A;  4FNB A;  5E0N X;  2BZR A;  1RJM A;  4RYF A;  1X0U A;  1PIX A;  2A81 A;  1UYT A;  4U0H A;  3OME A;  3H02 A;  3DJA A;  3TRR A;  2EJ5 A;  3BEZ A;  2F6Q A;  4FZW A;  1NZY B;  3R0O A;  4KNP A;  3KTH A;  4WCZ A;  4YLH A;  1NZY A;  1XX4 A;  3NJD A;  4JVT A;  4JCS A;  4QIJ A;  1SZO A;  3K8X A;  1RJN A;  2YJG A;  2CE3 A;  5INI A;  1ON3 A;  5KJP A;  3OT6 A;  3OC7 A;  1HZD A;  5ING A;  4MI2 A;  1FCF A;  3LKE A;  4I4Z A;  1FC7 A;  2F6I A;  1DCI A;  5CTC A;  5DUF A;  3V5I A;  3ZWC A;  1Q51 A;  3SLL A;  3GMA A;  1TYF A;  4ZDD A;  1XNY A;  1WDK A;  1ON9 A;  4U19 A;  5IKL B;  1O8U A;  3QWD A;  5HUQ A;  1MJ3 A;  2VSU F;  3M6M A;  5DUC A;  4U18 A;  2ZL0 A;  1J7X A;  2ZL2 A;  3I47 A;  2J5I I;  3Q1T A;  1N6D A;  3R9Q A;  5C90 A;  1SG4 A;  1HNO A;  3QMJ A;  3H0Q A;  2VSU A;  3TVU A;  1JXZ A;  3R9S A;  2VSS E;  4RYF H;  4FN8 A;  3PE8 A;  1PJH A;  1OD4 A;  2D3T A;  4JCR A;  3L3S A;  3IBB A;  3QK8 A;  3JU1 A;  2PPY A;  2ZL3 A;  3FDU A;  1EY3 A;  3ZW8 A;  2J5S A;  2C8T A;  3Q0J A;  3G64 A;  3P85 A;  2VSU C;  3KTK A;  3T88 A;  3PGQ A;  2ZL4 A;  4ZU2 A;  4Q0G A;  3HRX A;  3QXI A;  3QKA A;  4OLQ A;  1FC6 A;  4HC8 A;  2X24 A;  4MXI A;  1EF8 A;  2NP9 A;  1XO6 A;  2A7K A;  3Q7H A;  3MYB A;  1HNU A;  4JJT A;  2W3P A;  4U1A A;  2FW2 A;  3K50 A;  4JYL A;  3SWX A;  3IAV A;  3N6R B;  3U9R B;  1YG6 A;  3TT7 A;  2F9I B;  4ELS A;  1N6E A;  3T3W A;  2F9I A;  3FF6 A;  5JBX A;  4IZC A;  2F9Y B;  3GKB A;  4FZW C;  2GTR A;  5G1Q A;  2F9Y A;  3RST A;  5C9G A;  3MT6 A;  4FB8 A;  1N6F A;  4GM2 A;  4J2U A;  2J5G A;  3IB9 A;  4WZ8 B;  2PG8 A;  3HIN A;  2VSU E;  2DUB A;  1UYS A;  3TV5 A;  5DU6 A;  1UIY A;  4JOT A;  5G1S A;  4MOU A;  3ZWA A;  1Y7O A;  3P2L A;  4ZDB A;  5E0S A;  3U9S B;  3R6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...