3T8BA

Crystal structure of mycobacterium tuberculosis menb with altered hexameric assembly
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
256
structure length
235
Chain Sequence
DNPFDAKAWRLVDGFDDLTDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGDQRIRGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLLDDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of the Intramolecular Claisen Condensation Reaction Catalyzed by MenB, a Crotonase Superfamily Member.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
molecule keywords 1,4-Dihydroxy-2-naphthoyl-CoA synthase
total genus 91
structure length 235
sequence length 256
chains with identical sequence B
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3t8bA00
1UYSA 3N6RB 2ZL4A 4FJWD 4Q1IA 1HZDA 3DJAA 3H0QA 3K8XA 4DI1A 3Q0JA 3QYRA 5MGBA 3ZWBA 2IEXA 3T8BA 2PBPA 3Q1TA 3L3SA 3P2LA 1FC7A 2F9YA 2F9IA 4ZDCA 4L8KA 4FN7A 5DUCA 3OC7A 2VSUE 4QIIA 3TT6A 2FZSA 2Q34A 3PEAA 3ZW9A 4IZDA 3SWXA 5IKLB 4JYLA 3LKEA 5JBXA 4ZDFA 2Q2XA 1FC6A 2F9YB 3GLMA 4IZCA 4K3WA 3GMAA 4FB8A 4GM2A 2F6IA 3DORA 4JJTA 5DKPA 1UYRA 5E0NX 1JXZA 1XNYA 3RSTA 1SZOA 2PPYA 4JCRA 4RYFA 4JOTA 1UIYA 2A7SA 4EMLA 2A81A 1WDKA 3TZ3A 2VSUC 3IAVA 1XNWA 4FZWA 3HINA 2NP9A 3VIVA 3MYBA 4JCQA 3TT7A 4JVTA 5G1RA 3QXIA 4FNBA 4NEKA 5INIA 4I4ZA 4JYJA 3U9TB 3T89A 2VSSF 3M6MA 2A7KA 2F6QA 2EJ5A 1K39A 1ON3A 4JCSA 1DUBA 3KTGA 4MXIA 2ZL0A 3PZKA 1MJ3A 4U1AA 1XO6A 5CTCA 1N6EA 5DU8A 4ASIA 1Y7OA 4JSBA 1TYFA 4B3HA 4LK5A 4OLQA 3ZWCA 2PG8A 4I42A 2ZL2A 2BZRA 3ZWAA 4B3JA 3HP0A 3QK8A 5C9GA 3FDUA 4RYFH 4JWVA 5C90A 1TG6A 1XNVA 3HE2A 3QMJA 5INFA 5E0SA 1WDLA 1RJMA 3QWDA 3NJBA 3FF6A 2UZFA 2FW2A 3MOYA 1NZYA 5DL1A 1FCFA 1EF9A 4Q0GA 5DTPA 3R9TA 2W3PA 1HNOA 3KTKA 1WZ8A 2J5II 3T3WA 2J5IB 3M6NA 2VSUF 3STAA 4K29A 1ON9A 4U18A 1UYTA 2X58A 3TDCA 3BPPA 4ELSA 4U19A 1OD2A 1K32A 5KJPA 3GF3A 4OMRA 1Q51A 2CBYA 5G1QA 2DUBA 3U9RB 4KWBA 4GHNA 3LAOA 3K50A 3Q7HA 3MFMA 4NNQA 1PIXA 5DZKH 2DEOA 3RSIA 3H02A 1N6FA 4MOUA 5DU4A 3QREA 3R9QA 4L6WA 2VSUA 3HLN1 3IBBA 3QXZA 4IZBA 3ST9A 1RJNA 1YG8A 4EMMA 4G2RA 3RRVA 2D3TA 5KDRA 3R9SA 4ZDDA 5KDRB 4FN8A 4QFEA 4B3IA 2X24A 4U0HA 2VX2A 5E0SH 3TVWA 1PJHA 5DZKA 3OMEA 1WDMA 3H0SA 4Z0MA 4ELXA 4HNKA 3V5IA 2C8TA 3TVUA 1EY3A 2VREA 3HRXA 4ZDBA 4FZWC 3IB9A 1N6DA 2J5IA 3ISAA 1O8UA 3BEZA 2CE3A 3JU1A 4U0GH 2GTRA 3ZW8A 3U9SB 1UYVA 3KQFA 3SLLA 3KTIA 2J5GA 4RCNA 2FBMA 1EF8A 4F47A 3P85A 4ELWA 1Q52A 1OD4A 1NZYB 4YLHA 3BF0A 4K2NA 4OG1A 3TLFA 4FNDA 2Q35A 2ZQQA 5FIFA 3GF7A 5DUFA 4KNPA 5DTWA 4MI2A 4ZDEA 4WZ8B 5G1SA 1W2XA 3QKAA 4U0GA 3H0JA 4EMPA 4JCTA 4WCZA 1FC9A 1VRGA 3NJDA 3TRRA 3Q0GA 5DU6A 3I47A 4KPKA 3P5MA 2F9IB 3GKBA 5FUSA 5CTBA 3H81A 1SG4A 4ZU2A 1YG6A 3PE8A 1J7XA 3R6HA 1DCIA 3PGQA 1XX4A 4QIJA 1HNUA 4WYOB 2WTBA 5INGA 4KD6A 3G64A 4JFCA 2HW5A 2J5GD 3OT6A 3T88A 2QQ3A 5JBWA 3V5EA 1X0UA 3T8AA 3KTJA 3MT6A 3TV5A 2ZL3A 3WG5A 2J5SA 3H0UA 2VSSA 2VSSE 3KTHA 2ZQRA 3R0OA 4HC8A 4I52A
chains in the Genus database with same CATH superfamily
1UYSA 3N6RB 2ZL4A 4FJWD 4Q1IA 1HZDA 3DJAA 3H0QA 3K8XA 4DI1A 3Q0JA 3QYRA 5MGBA 3ZWBA 2IEXA 3T8BA 4J2UA 2PBPA 3Q1TA 3L3SA 3P2LA 1FC7A 2F9YA 2F9IA 4ZDCA 4L8KA 4FN7A 5DUCA 3OC7A 2VSUE 4QIIA 3TT6A 2FZSA 5HUQA 2Q34A 3PEAA 3ZW9A 4IZDA 3SWXA 5IKLB 4JYLA 3LKEA 5JBXA 4ZDFA 2Q2XA 1FC6A 2F9YB 3GLMA 4IZCA 4K3WA 3GMAA 4FB8A 4GM2A 2F6IA 3DORA 4JJTA 5DKPA 1UYRA 5E0NX 1JXZA 1XNYA 3RSTA 1SZOA 2PPYA 4JCRA 4RYFA 4JOTA 1UIYA 2A7SA 4EMLA 2A81A 1WDKA 3TZ3A 2VSUC 3IAVA 1XNWA 4FZWA 3HINA 2NP9A 3VIVA 3MYBA 4JCQA 3TT7A 4JVTA 5G1RA 3QXIA 4FNBA 4NEKA 5INIA 4I4ZA 4JYJA 3U9TB 3T89A 2VSSF 3M6MA 2A7KA 2F6QA 2EJ5A 1K39A 1ON3A 4JCSA 1DUBA 3KTGA 4MXIA 2ZL0A 2YJGA 3PZKA 1MJ3A 4U1AA 1XO6A 5CTCA 1N6EA 5DU8A 4ASIA 1Y7OA 4JSBA 1TYFA 4B3HA 4LK5A 4OLQA 3ZWCA 2PG8A 4I42A 2ZL2A 2BZRA 3ZWAA 4B3JA 3HP0A 3QK8A 5C9GA 3FDUA 4RYFH 4JWVA 5C90A 1TG6A 1XNVA 3HE2A 3QMJA 5INFA 5E0SA 1WDLA 1RJMA 3QWDA 3NJBA 3FF6A 2UZFA 2FW2A 3MOYA 1NZYA 5DL1A 1FCFA 1EF9A 4Q0GA 5DTPA 3R9TA 2W3PA 1HNOA 3KTKA 3BPTA 1WZ8A 2J5II 3T3WA 2J5IB 3M6NA 2VSUF 3STAA 4K29A 1ON9A 4U18A 1UYTA 2X58A 3TDCA 3BPPA 4ELSA 4U19A 1OD2A 1K32A 5KJPA 3GF3A 4OMRA 1Q51A 2CBYA 5G1QA 2DUBA 3U9RB 4KWBA 4GHNA 3LAOA 3K50A 3Q7HA 3MFMA 4NNQA 1PIXA 5DZKH 2DEOA 3RSIA 3H02A 1N6FA 4MOUA 5DU4A 3QREA 3R9QA 4L6WA 2VSUA 3HLN1 3IBBA 3QXZA 4IZBA 3ST9A 1RJNA 1YG8A 4EMMA 4G2RA 3RRVA 2D3TA 5KDRA 3R9SA 4ZDDA 5KDRB 4FN8A 4QFEA 4B3IA 4NARA 2X24A 4U0HA 2VX2A 5E0SH 3TVWA 1PJHA 5DZKA 3OMEA 1WDMA 3H0SA 4Z0MA 4ELXA 4HNKA 3V5IA 2C8TA 3TVUA 1EY3A 2VREA 3HRXA 4ZDBA 4FZWC 3IB9A 1N6DA 2J5IA 3ISAA 1O8UA 3BEZA 2CE3A 3JU1A 4U0GH 2GTRA 3ZW8A 3U9SB 1UYVA 3KQFA 3SLLA 3KTIA 2J5GA 4RCNA 2FBMA 1EF8A 4F47A 3P85A 4ELWA 1Q52A 1OD4A 1NZYB 4YLHA 3BF0A 4K2NA 4OG1A 3TLFA 4FNDA 2Q35A 2ZQQA 5FIFA 3GF7A 5DUFA 4KNPA 5DTWA 4MI2A 4ZDEA 4WZ8B 5G1SA 1W2XA 3QKAA 4U0GA 3H0JA 4EMPA 4JCTA 4WCZA 1FC9A 1VRGA 3NJDA 3TRRA 3Q0GA 5DU6A 3I47A 4KPKA 3P5MA 2F9IB 3GKBA 5FUSA 5CTBA 3H81A 1SG4A 4ZU2A 1YG6A 3PE8A 1J7XA 3R6HA 1DCIA 3PGQA 1XX4A 4QIJA 1HNUA 4WYOB 2WTBA 5INGA 4KD6A 3G64A 4JFCA 2HW5A 2J5GD 3OT6A 3T88A 2QQ3A 5JBWA 3V5EA 1X0UA 3T8AA 3KTJA 3MT6A 4HDTA 3TV5A 2ZL3A 3WG5A 2J5SA 3H0UA 2VSSA 2VSSE 3KTHA 2ZQRA 3R0OA 4HC8A 4I52A
chains in the Genus database with same CATH topology
1UYSA 3N6RB 2ZL4A 4FJWD 4Q1IA 1HZDA 3DJAA 3H0QA 3K8XA 4DI1A 3Q0JA 3QYRA 5MGBA 3ZWBA 2IEXA 3T8BA 4J2UA 2PBPA 3Q1TA 3L3SA 3P2LA 1FC7A 2F9YA 2F9IA 4ZDCA 4L8KA 4FN7A 5DUCA 3OC7A 2VSUE 4QIIA 3TT6A 2FZSA 5HUQA 2Q34A 3PEAA 3ZW9A 4IZDA 3SWXA 5IKLB 4JYLA 3LKEA 5JBXA 4ZDFA 2Q2XA 1FC6A 2F9YB 3GLMA 4IZCA 4K3WA 3GMAA 4FB8A 4GM2A 2F6IA 3DORA 4JJTA 5DKPA 1UYRA 5E0NX 1JXZA 1XNYA 3RSTA 1SZOA 2PPYA 4JCRA 4RYFA 4JOTA 1UIYA 2A7SA 4EMLA 2A81A 1WDKA 3TZ3A 2VSUC 3IAVA 1XNWA 4FZWA 3HINA 2NP9A 3VIVA 3MYBA 4JCQA 3TT7A 4JVTA 5G1RA 3QXIA 4FNBA 4NEKA 5INIA 4I4ZA 4JYJA 3U9TB 3T89A 2VSSF 3M6MA 2A7KA 2F6QA 2EJ5A 1K39A 1ON3A 4JCSA 1DUBA 3KTGA 4MXIA 2ZL0A 2YJGA 3PZKA 1MJ3A 4U1AA 1XO6A 5CTCA 1N6EA 5DU8A 4ASIA 1Y7OA 4JSBA 1TYFA 4B3HA 4LK5A 4OLQA 3ZWCA 2PG8A 4I42A 2ZL2A 2BZRA 3ZWAA 4B3JA 3HP0A 3QK8A 5C9GA 3FDUA 4RYFH 4JWVA 5C90A 1TG6A 1XNVA 3HE2A 3QMJA 5INFA 5E0SA 1WDLA 1RJMA 3QWDA 3NJBA 3FF6A 2UZFA 2FW2A 3MOYA 1NZYA 5DL1A 1FCFA 1EF9A 4Q0GA 5DTPA 3R9TA 2W3PA 1HNOA 3KTKA 3BPTA 1WZ8A 2J5II 3T3WA 2J5IB 3M6NA 2VSUF 3STAA 4K29A 1ON9A 4U18A 1UYTA 2X58A 3TDCA 3BPPA 4ELSA 4U19A 1OD2A 1K32A 5KJPA 3GF3A 4OMRA 1Q51A 2CBYA 5G1QA 2DUBA 3U9RB 4KWBA 4GHNA 3LAOA 3K50A 3Q7HA 3MFMA 4NNQA 1PIXA 5DZKH 2DEOA 3RSIA 3H02A 1N6FA 4MOUA 5DU4A 3QREA 3R9QA 4L6WA 2VSUA 3HLN1 3IBBA 3QXZA 4IZBA 3ST9A 1RJNA 1YG8A 4EMMA 4G2RA 3RRVA 2D3TA 5KDRA 3R9SA 4ZDDA 5KDRB 4FN8A 4QFEA 4B3IA 4NARA 2X24A 4U0HA 2VX2A 5E0SH 3TVWA 1PJHA 5DZKA 3OMEA 1WDMA 3H0SA 4Z0MA 4ELXA 4HNKA 3V5IA 2C8TA 3TVUA 1EY3A 2VREA 3HRXA 4ZDBA 4FZWC 3IB9A 1N6DA 2J5IA 3ISAA 1O8UA 3BEZA 2CE3A 3JU1A 4U0GH 2GTRA 3ZW8A 3U9SB 1UYVA 3KQFA 3SLLA 3KTIA 2J5GA 4RCNA 2FBMA 1EF8A 4F47A 3P85A 4ELWA 1Q52A 1OD4A 1NZYB 4YLHA 3BF0A 4K2NA 4OG1A 3TLFA 4FNDA 2Q35A 2ZQQA 5FIFA 3GF7A 5DUFA 4KNPA 5DTWA 4MI2A 4ZDEA 4WZ8B 5G1SA 1W2XA 3QKAA 4U0GA 3H0JA 4EMPA 4JCTA 4WCZA 1FC9A 1VRGA 3NJDA 3TRRA 3Q0GA 5DU6A 3I47A 4KPKA 3P5MA 2F9IB 3GKBA 5FUSA 5CTBA 3H81A 1SG4A 4ZU2A 1YG6A 3PE8A 1J7XA 3R6HA 1DCIA 3PGQA 1XX4A 4QIJA 1HNUA 4WYOB 2WTBA 5INGA 4KD6A 3G64A 4JFCA 2HW5A 2J5GD 3OT6A 3T88A 2QQ3A 5JBWA 3V5EA 1X0UA 3T8AA 3KTJA 3MT6A 4HDTA 3TV5A 2ZL3A 3WG5A 2J5SA 3H0UA 2VSSA 2VSSE 3KTHA 2ZQRA 3R0OA 4HC8A 4I52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UYS A;  3N6R B;  2ZL4 A;  4FJW D;  4Q1I A;  1HZD A;  3DJA A;  3H0Q A;  3K8X A;  4DI1 A;  3Q0J A;  3QYR A;  5MGB A;  3ZWB A;  2IEX A;  3T8B A;  2PBP A;  3Q1T A;  3L3S A;  3P2L A;  1FC7 A;  2F9Y A;  2F9I A;  4ZDC A;  4L8K A;  4FN7 A;  5DUC A;  3OC7 A;  2VSU E;  4QII A;  3TT6 A;  2FZS A;  2Q34 A;  3PEA A;  3ZW9 A;  4IZD A;  3SWX A;  5IKL B;  4JYL A;  3LKE A;  5JBX A;  4ZDF A;  2Q2X A;  1FC6 A;  2F9Y B;  3GLM A;  4IZC A;  4K3W A;  3GMA A;  4FB8 A;  4GM2 A;  2F6I A;  3DOR A;  4JJT A;  5DKP A;  1UYR A;  5E0N X;  1JXZ A;  1XNY A;  3RST A;  1SZO A;  2PPY A;  4JCR A;  4RYF A;  4JOT A;  1UIY A;  2A7S A;  4EML A;  2A81 A;  1WDK A;  3TZ3 A;  2VSU C;  3IAV A;  1XNW A;  4FZW A;  3HIN A;  2NP9 A;  3VIV A;  3MYB A;  4JCQ A;  3TT7 A;  4JVT A;  5G1R A;  3QXI A;  4FNB A;  4NEK A;  5INI A;  4I4Z A;  4JYJ A;  3U9T B;  3T89 A;  2VSS F;  3M6M A;  2A7K A;  2F6Q A;  2EJ5 A;  1K39 A;  1ON3 A;  4JCS A;  1DUB A;  3KTG A;  4MXI A;  2ZL0 A;  3PZK A;  1MJ3 A;  4U1A A;  1XO6 A;  5CTC A;  1N6E A;  5DU8 A;  4ASI A;  1Y7O A;  4JSB A;  1TYF A;  4B3H A;  4LK5 A;  4OLQ A;  3ZWC A;  2PG8 A;  4I42 A;  2ZL2 A;  2BZR A;  3ZWA A;  4B3J A;  3HP0 A;  3QK8 A;  5C9G A;  3FDU A;  4RYF H;  4JWV A;  5C90 A;  1TG6 A;  1XNV A;  3HE2 A;  3QMJ A;  5INF A;  5E0S A;  1WDL A;  1RJM A;  3QWD A;  3NJB A;  3FF6 A;  2UZF A;  2FW2 A;  3MOY A;  1NZY A;  5DL1 A;  1FCF A;  1EF9 A;  4Q0G A;  5DTP A;  3R9T A;  2W3P A;  1HNO A;  3KTK A;  1WZ8 A;  2J5I I;  3T3W A;  2J5I B;  3M6N A;  2VSU F;  3STA A;  4K29 A;  1ON9 A;  4U18 A;  1UYT A;  2X58 A;  3TDC A;  3BPP A;  4ELS A;  4U19 A;  1OD2 A;  1K32 A;  5KJP A;  3GF3 A;  4OMR A;  1Q51 A;  2CBY A;  5G1Q A;  2DUB A;  3U9R B;  4KWB A;  4GHN A;  3LAO A;  3K50 A;  3Q7H A;  3MFM A;  4NNQ A;  1PIX A;  5DZK H;  2DEO A;  3RSI A;  3H02 A;  1N6F A;  4MOU A;  5DU4 A;  3QRE A;  3R9Q A;  4L6W A;  2VSU A;  3HLN 1;  3IBB A;  3QXZ A;  4IZB A;  3ST9 A;  1RJN A;  1YG8 A;  4EMM A;  4G2R A;  3RRV A;  2D3T A;  5KDR A;  3R9S A;  4ZDD A;  5KDR B;  4FN8 A;  4QFE A;  4B3I A;  2X24 A;  4U0H A;  2VX2 A;  5E0S H;  3TVW A;  1PJH A;  5DZK A;  3OME A;  1WDM A;  3H0S A;  4Z0M A;  4ELX A;  4HNK A;  3V5I A;  2C8T A;  3TVU A;  1EY3 A;  2VRE A;  3HRX A;  4ZDB A;  4FZW C;  3IB9 A;  1N6D A;  2J5I A;  3ISA A;  1O8U A;  3BEZ A;  2CE3 A;  3JU1 A;  4U0G H;  2GTR A;  3ZW8 A;  3U9S B;  1UYV A;  3KQF A;  3SLL A;  3KTI A;  2J5G A;  4RCN A;  2FBM A;  1EF8 A;  4F47 A;  3P85 A;  4ELW A;  1Q52 A;  1OD4 A;  1NZY B;  4YLH A;  3BF0 A;  4K2N A;  4OG1 A;  3TLF A;  4FND A;  2Q35 A;  2ZQQ A;  5FIF A;  3GF7 A;  5DUF A;  4KNP A;  5DTW A;  4MI2 A;  4ZDE A;  4WZ8 B;  5G1S A;  1W2X A;  3QKA A;  4U0G A;  3H0J A;  4EMP A;  4JCT A;  4WCZ A;  1FC9 A;  1VRG A;  3NJD A;  3TRR A;  3Q0G A;  5DU6 A;  3I47 A;  4KPK A;  3P5M A;  2F9I B;  3GKB A;  5FUS A;  5CTB A;  3H81 A;  1SG4 A;  4ZU2 A;  1YG6 A;  3PE8 A;  1J7X A;  3R6H A;  1DCI A;  3PGQ A;  1XX4 A;  4QIJ A;  1HNU A;  4WYO B;  2WTB A;  5ING A;  4KD6 A;  3G64 A;  4JFC A;  2HW5 A;  2J5G D;  3OT6 A;  3T88 A;  2QQ3 A;  5JBW A;  3V5E A;  1X0U A;  3T8A A;  3KTJ A;  3MT6 A;  3TV5 A;  2ZL3 A;  3WG5 A;  2J5S A;  3H0U A;  2VSS A;  2VSS E;  3KTH A;  2ZQR A;  3R0O A;  4HC8 A;  4I52 A; 
#chains in the Genus database with same CATH topology
 1UYS A;  3N6R B;  2ZL4 A;  4FJW D;  4Q1I A;  1HZD A;  3DJA A;  3H0Q A;  3K8X A;  4DI1 A;  3Q0J A;  3QYR A;  5MGB A;  3ZWB A;  2IEX A;  3T8B A;  4J2U A;  2PBP A;  3Q1T A;  3L3S A;  3P2L A;  1FC7 A;  2F9Y A;  2F9I A;  4ZDC A;  4L8K A;  4FN7 A;  5DUC A;  3OC7 A;  2VSU E;  4QII A;  3TT6 A;  2FZS A;  5HUQ A;  2Q34 A;  3PEA A;  3ZW9 A;  4IZD A;  3SWX A;  5IKL B;  4JYL A;  3LKE A;  5JBX A;  4ZDF A;  2Q2X A;  1FC6 A;  2F9Y B;  3GLM A;  4IZC A;  4K3W A;  3GMA A;  4FB8 A;  4GM2 A;  2F6I A;  3DOR A;  4JJT A;  5DKP A;  1UYR A;  5E0N X;  1JXZ A;  1XNY A;  3RST A;  1SZO A;  2PPY A;  4JCR A;  4RYF A;  4JOT A;  1UIY A;  2A7S A;  4EML A;  2A81 A;  1WDK A;  3TZ3 A;  2VSU C;  3IAV A;  1XNW A;  4FZW A;  3HIN A;  2NP9 A;  3VIV A;  3MYB A;  4JCQ A;  3TT7 A;  4JVT A;  5G1R A;  3QXI A;  4FNB A;  4NEK A;  5INI A;  4I4Z A;  4JYJ A;  3U9T B;  3T89 A;  2VSS F;  3M6M A;  2A7K A;  2F6Q A;  2EJ5 A;  1K39 A;  1ON3 A;  4JCS A;  1DUB A;  3KTG A;  4MXI A;  2ZL0 A;  2YJG A;  3PZK A;  1MJ3 A;  4U1A A;  1XO6 A;  5CTC A;  1N6E A;  5DU8 A;  4ASI A;  1Y7O A;  4JSB A;  1TYF A;  4B3H A;  4LK5 A;  4OLQ A;  3ZWC A;  2PG8 A;  4I42 A;  2ZL2 A;  2BZR A;  3ZWA A;  4B3J A;  3HP0 A;  3QK8 A;  5C9G A;  3FDU A;  4RYF H;  4JWV A;  5C90 A;  1TG6 A;  1XNV A;  3HE2 A;  3QMJ A;  5INF A;  5E0S A;  1WDL A;  1RJM A;  3QWD A;  3NJB A;  3FF6 A;  2UZF A;  2FW2 A;  3MOY A;  1NZY A;  5DL1 A;  1FCF A;  1EF9 A;  4Q0G A;  5DTP A;  3R9T A;  2W3P A;  1HNO A;  3KTK A;  3BPT A;  1WZ8 A;  2J5I I;  3T3W A;  2J5I B;  3M6N A;  2VSU F;  3STA A;  4K29 A;  1ON9 A;  4U18 A;  1UYT A;  2X58 A;  3TDC A;  3BPP A;  4ELS A;  4U19 A;  1OD2 A;  1K32 A;  5KJP A;  3GF3 A;  4OMR A;  1Q51 A;  2CBY A;  5G1Q A;  2DUB A;  3U9R B;  4KWB A;  4GHN A;  3LAO A;  3K50 A;  3Q7H A;  3MFM A;  4NNQ A;  1PIX A;  5DZK H;  2DEO A;  3RSI A;  3H02 A;  1N6F A;  4MOU A;  5DU4 A;  3QRE A;  3R9Q A;  4L6W A;  2VSU A;  3HLN 1;  3IBB A;  3QXZ A;  4IZB A;  3ST9 A;  1RJN A;  1YG8 A;  4EMM A;  4G2R A;  3RRV A;  2D3T A;  5KDR A;  3R9S A;  4ZDD A;  5KDR B;  4FN8 A;  4QFE A;  4B3I A;  4NAR A;  2X24 A;  4U0H A;  2VX2 A;  5E0S H;  3TVW A;  1PJH A;  5DZK A;  3OME A;  1WDM A;  3H0S A;  4Z0M A;  4ELX A;  4HNK A;  3V5I A;  2C8T A;  3TVU A;  1EY3 A;  2VRE A;  3HRX A;  4ZDB A;  4FZW C;  3IB9 A;  1N6D A;  2J5I A;  3ISA A;  1O8U A;  3BEZ A;  2CE3 A;  3JU1 A;  4U0G H;  2GTR A;  3ZW8 A;  3U9S B;  1UYV A;  3KQF A;  3SLL A;  3KTI A;  2J5G A;  4RCN A;  2FBM A;  1EF8 A;  4F47 A;  3P85 A;  4ELW A;  1Q52 A;  1OD4 A;  1NZY B;  4YLH A;  3BF0 A;  4K2N A;  4OG1 A;  3TLF A;  4FND A;  2Q35 A;  2ZQQ A;  5FIF A;  3GF7 A;  5DUF A;  4KNP A;  5DTW A;  4MI2 A;  4ZDE A;  4WZ8 B;  5G1S A;  1W2X A;  3QKA A;  4U0G A;  3H0J A;  4EMP A;  4JCT A;  4WCZ A;  1FC9 A;  1VRG A;  3NJD A;  3TRR A;  3Q0G A;  5DU6 A;  3I47 A;  4KPK A;  3P5M A;  2F9I B;  3GKB A;  5FUS A;  5CTB A;  3H81 A;  1SG4 A;  4ZU2 A;  1YG6 A;  3PE8 A;  1J7X A;  3R6H A;  1DCI A;  3PGQ A;  1XX4 A;  4QIJ A;  1HNU A;  4WYO B;  2WTB A;  5ING A;  4KD6 A;  3G64 A;  4JFC A;  2HW5 A;  2J5G D;  3OT6 A;  3T88 A;  2QQ3 A;  5JBW A;  3V5E A;  1X0U A;  3T8A A;  3KTJ A;  3MT6 A;  4HDT A;  3TV5 A;  2ZL3 A;  3WG5 A;  2J5S A;  3H0U A;  2VSS A;  2VSS E;  3KTH A;  2ZQR A;  3R0O A;  4HC8 A;  4I52 A; 
#chains in the Genus database with same CATH homology
 1UYS A;  3N6R B;  2ZL4 A;  4FJW D;  4Q1I A;  1HZD A;  3DJA A;  3H0Q A;  3K8X A;  4DI1 A;  3Q0J A;  3QYR A;  5MGB A;  3ZWB A;  2IEX A;  3T8B A;  4J2U A;  2PBP A;  3Q1T A;  3L3S A;  3P2L A;  1FC7 A;  2F9Y A;  2F9I A;  4ZDC A;  4L8K A;  4FN7 A;  5DUC A;  3OC7 A;  2VSU E;  4QII A;  3TT6 A;  2FZS A;  5HUQ A;  2Q34 A;  3PEA A;  3ZW9 A;  4IZD A;  3SWX A;  5IKL B;  4JYL A;  3LKE A;  5JBX A;  4ZDF A;  2Q2X A;  1FC6 A;  2F9Y B;  3GLM A;  4IZC A;  4K3W A;  3GMA A;  4FB8 A;  4GM2 A;  2F6I A;  3DOR A;  4JJT A;  5DKP A;  1UYR A;  5E0N X;  1JXZ A;  1XNY A;  3RST A;  1SZO A;  2PPY A;  4JCR A;  4RYF A;  4JOT A;  1UIY A;  2A7S A;  4EML A;  2A81 A;  1WDK A;  3TZ3 A;  2VSU C;  3IAV A;  1XNW A;  4FZW A;  3HIN A;  2NP9 A;  3VIV A;  3MYB A;  4JCQ A;  3TT7 A;  4JVT A;  5G1R A;  3QXI A;  4FNB A;  4NEK A;  5INI A;  4I4Z A;  4JYJ A;  3U9T B;  3T89 A;  2VSS F;  3M6M A;  2A7K A;  2F6Q A;  2EJ5 A;  1K39 A;  1ON3 A;  4JCS A;  1DUB A;  3KTG A;  4MXI A;  2ZL0 A;  2YJG A;  3PZK A;  1MJ3 A;  4U1A A;  1XO6 A;  5CTC A;  1N6E A;  5DU8 A;  4ASI A;  1Y7O A;  4JSB A;  1TYF A;  4B3H A;  4LK5 A;  4OLQ A;  3ZWC A;  2PG8 A;  4I42 A;  2ZL2 A;  2BZR A;  3ZWA A;  4B3J A;  3HP0 A;  3QK8 A;  5C9G A;  3FDU A;  4RYF H;  4JWV A;  5C90 A;  1TG6 A;  1XNV A;  3HE2 A;  3QMJ A;  5INF A;  5E0S A;  1WDL A;  1RJM A;  3QWD A;  3NJB A;  3FF6 A;  2UZF A;  2FW2 A;  3MOY A;  1NZY A;  5DL1 A;  1FCF A;  1EF9 A;  4Q0G A;  5DTP A;  3R9T A;  2W3P A;  1HNO A;  3KTK A;  3BPT A;  1WZ8 A;  2J5I I;  3T3W A;  2J5I B;  3M6N A;  2VSU F;  3STA A;  4K29 A;  1ON9 A;  4U18 A;  1UYT A;  2X58 A;  3TDC A;  3BPP A;  4ELS A;  4U19 A;  1OD2 A;  1K32 A;  5KJP A;  3GF3 A;  4OMR A;  1Q51 A;  2CBY A;  5G1Q A;  2DUB A;  3U9R B;  4KWB A;  4GHN A;  3LAO A;  3K50 A;  3Q7H A;  3MFM A;  4NNQ A;  1PIX A;  5DZK H;  2DEO A;  3RSI A;  3H02 A;  1N6F A;  4MOU A;  5DU4 A;  3QRE A;  3R9Q A;  4L6W A;  2VSU A;  3HLN 1;  3IBB A;  3QXZ A;  4IZB A;  3ST9 A;  1RJN A;  1YG8 A;  4EMM A;  4G2R A;  3RRV A;  2D3T A;  5KDR A;  3R9S A;  4ZDD A;  5KDR B;  4FN8 A;  4QFE A;  4B3I A;  4NAR A;  2X24 A;  4U0H A;  2VX2 A;  5E0S H;  3TVW A;  1PJH A;  5DZK A;  3OME A;  1WDM A;  3H0S A;  4Z0M A;  4ELX A;  4HNK A;  3V5I A;  2C8T A;  3TVU A;  1EY3 A;  2VRE A;  3HRX A;  4ZDB A;  4FZW C;  3IB9 A;  1N6D A;  2J5I A;  3ISA A;  1O8U A;  3BEZ A;  2CE3 A;  3JU1 A;  4U0G H;  2GTR A;  3ZW8 A;  3U9S B;  1UYV A;  3KQF A;  3SLL A;  3KTI A;  2J5G A;  4RCN A;  2FBM A;  1EF8 A;  4F47 A;  3P85 A;  4ELW A;  1Q52 A;  1OD4 A;  1NZY B;  4YLH A;  3BF0 A;  4K2N A;  4OG1 A;  3TLF A;  4FND A;  2Q35 A;  2ZQQ A;  5FIF A;  3GF7 A;  5DUF A;  4KNP A;  5DTW A;  4MI2 A;  4ZDE A;  4WZ8 B;  5G1S A;  1W2X A;  3QKA A;  4U0G A;  3H0J A;  4EMP A;  4JCT A;  4WCZ A;  1FC9 A;  1VRG A;  3NJD A;  3TRR A;  3Q0G A;  5DU6 A;  3I47 A;  4KPK A;  3P5M A;  2F9I B;  3GKB A;  5FUS A;  5CTB A;  3H81 A;  1SG4 A;  4ZU2 A;  1YG6 A;  3PE8 A;  1J7X A;  3R6H A;  1DCI A;  3PGQ A;  1XX4 A;  4QIJ A;  1HNU A;  4WYO B;  2WTB A;  5ING A;  4KD6 A;  3G64 A;  4JFC A;  2HW5 A;  2J5G D;  3OT6 A;  3T88 A;  2QQ3 A;  5JBW A;  3V5E A;  1X0U A;  3T8A A;  3KTJ A;  3MT6 A;  4HDT A;  3TV5 A;  2ZL3 A;  3WG5 A;  2J5S A;  3H0U A;  2VSS A;  2VSS E;  3KTH A;  2ZQR A;  3R0O A;  4HC8 A;  4I52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...