3T8BA

Crystal structure of mycobacterium tuberculosis menb with altered hexameric assembly
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
256
structure length
235
Chain Sequence
b'DNPFDAKAWRLVDGFDDLTDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGDQRIRGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLLDDGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,4-Dihydroxy-2-naphthoyl-CoA synthase
publication title Mechanism of the Intramolecular Claisen Condensation Reaction Catalyzed by MenB, a Crotonase Superfamily Member.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
total genus 91
structure length 235
sequence length 256
chains with identical sequence B
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3t8bA00
4EMLA 4FN8A 4GHNA 3IB9A 4K2NA 3GKBA 3P2LA 2F9IB 4Q1IA 3QMJA 1PIXA 5DUFA 2VX2A 3ZW9A 5G1SA 4Q0GA 3TT6A 1RJMA 1UIYA 3HP0A 3QWDA 4K3WA 3ZWBA 3QREA 3PEAA 3HINA 1XNVA 4KPKA 3H0SA 2W3PA 2CE3A 4RYFH 2X24A 5G1RA 2PBPA 3BEZA 1FC9A 2EJ5A 4QIJA 3BPPA 5E0NX 4QFEA 4JSBA 3MOYA 1FC6A 3TLFA 4WZ8B 4ASIA 1HZDA 4JJTA 5DUCA 3R9SA 3MFMA 1TYFA 3L3SA 2BZRA 5DKPA 5FIFA 2J5GA 1FC7A 4DI1A 1O8UA 5DTPA 3H0JA 3TRRA 1EF9A 3ZW8A 1UYRA 3SLLA 3BF0A 5C9GA 2ZL3A 1NZYA 4FB8A 4JWVA 4U18A 4U19A 3GF3A 1K32A 5DU4A 4JCSA 1RJNA 2FW2A 2WTBA 2ZQQA 4JCTA 5JBXA 1MJ3A 2D3TA 1Y7OA 5DU6A 4MOUA 5IKLB 4GM2A 3SWXA 2A7KA 2J5SA 1WDLA 1EF8A 2VSSA 3H81A 5DL1A 2ZL2A 3DORA 4OG1A 3GMAA 2F9IA 3QXIA 1DUBA 5JBWA 3ZWAA 1HNUA 2VSUA 3R9QA 1Q52A 4KWBA 3N6RB 1XNYA 4FNDA 2F9YB 3U9RB 3M6MA 1SG4A 4FN7A 4U0GH 2VSSE 5E0SH 3Q7HA 4FNBA 3NJDA 4WYOB 1OD2A 3KTGA 4MXIA 2VSUE 3TDCA 2QQ3A 5DZKA 3G64A 4LK5A 3KTHA 4U0HA 4EMMA 2Q2XA 3RRVA 4ZDBA 4QIIA 1HNOA 1WDKA 2VSUC 1N6DA 4Z0MA 4OMRA 3OC7A 3PE8A 4G2RA 3H0QA 3QK8A 4YLHA 3PZKA 2VREA 2J5II 4JCQA 3P85A 3M6NA 4F47A 3V5IA 3KTKA 3LKEA 3HRXA 3T8BA 3T88A 3TV5A 3DJAA 3MYBA 5KJPA 4FZWA 4ZU2A 3R6HA 1XNWA 3R0OA 4JYLA 4JCRA 3R9TA 4RYFA 3K50A 2GTRA 1OD4A 4ZDFA 4MI2A 4NEKA 2VSSF 4U1AA 4ZDCA 3T3WA 2J5IB 4WCZA 5KDRB 4EMPA 5MGBA 1WDMA 3TVUA 1W2XA 4ZDDA 4L6WA 3QKAA 3Q1TA 2VSUF 2FBMA 2Q35A 2Q34A 3MT6A 3PGQA 4FZWC 1XX4A 3JU1A 1ON9A 1UYVA 3KTIA 4I42A 5INFA 4B3HA 1UYTA 3U9TB 1FCFA 2ZL0A 3Q0GA 2F9YA 4KNPA 5CTBA 1WZ8A 1ON3A 4IZCA 3K8XA 2DEOA 4I52A 2UZFA 3STAA 2ZQRA 3KQFA 3QXZA 2HW5A 5DU8A 3T8AA 1UYSA 4B3IA 1TG6A 4RCNA 3ST9A 4HNKA 1N6EA 1X0UA 5INGA 3HE2A 3VIVA 1J7XA 2FZSA 3HLN1 4KD6A 4JFCA 3ISAA 4ELSA 3QYRA 4K29A 2IEXA 3WG5A 4JYJA 1PJHA 3P5MA 4ELXA 3OT6A 4ELWA 4ZDEA 2X58A 2F6QA 2ZL4A 3KTJA 4U0GA 4OLQA 3TT7A 4JOTA 2DUBA 4HC8A 5E0SA 1N6FA 4FJWD 3I47A 2A7SA 3IAVA 2F6IA 1EY3A 3GF7A 2PPYA 4I4ZA 3TZ3A 1Q51A 4IZBA 2A81A 4IZDA 3H02A 2J5GD 4JVTA 3FDUA 1JXZA 1K39A 1DCIA 1SZOA 2J5IA 3LAOA 5KDRA 3FF6A 3H0UA 3Q0JA 1NZYB 3U9SB 4NNQA 5INIA 1XO6A 3OMEA 1VRGA 4L8KA 1YG6A 2CBYA 1YG8A 3ZWCA 2NP9A 5CTCA 2C8TA 5FUSA 3T89A 3RSTA 5DTWA 2PG8A 4B3JA 3RSIA 3NJBA 3IBBA 5DZKH 3GLMA 3TVWA 3V5EA 5C90A 5G1QA
chains in the Genus database with same CATH superfamily
4EMLA 4FN8A 4GHNA 3IB9A 4K2NA 3GKBA 3P2LA 2F9IB 4Q1IA 3QMJA 1PIXA 5DUFA 2VX2A 3ZW9A 5G1SA 4Q0GA 4HDTA 3TT6A 1RJMA 1UIYA 3HP0A 3QWDA 4K3WA 3ZWBA 3QREA 3PEAA 3HINA 1XNVA 4KPKA 3H0SA 2W3PA 2CE3A 4RYFH 2X24A 5G1RA 2PBPA 3BEZA 1FC9A 2EJ5A 4QIJA 3BPPA 5E0NX 4QFEA 4JSBA 3MOYA 1FC6A 3TLFA 4WZ8B 4ASIA 1HZDA 4JJTA 5DUCA 3R9SA 3MFMA 3BPTA 1TYFA 3L3SA 2BZRA 5DKPA 5FIFA 2J5GA 1FC7A 4DI1A 1O8UA 5DTPA 3H0JA 3TRRA 1EF9A 3ZW8A 1UYRA 3SLLA 3BF0A 5C9GA 2ZL3A 1NZYA 4FB8A 4JWVA 4U18A 4U19A 3GF3A 1K32A 5DU4A 4JCSA 1RJNA 2FW2A 2WTBA 2ZQQA 4JCTA 5JBXA 1MJ3A 2D3TA 1Y7OA 5DU6A 4MOUA 5IKLB 4GM2A 5HUQA 3SWXA 2A7KA 2J5SA 1WDLA 1EF8A 2VSSA 3H81A 5DL1A 2ZL2A 3DORA 4OG1A 3GMAA 2F9IA 4NARA 3QXIA 1DUBA 5JBWA 3ZWAA 1HNUA 2VSUA 3R9QA 1Q52A 4KWBA 3N6RB 1XNYA 4FNDA 2F9YB 3U9RB 3M6MA 1SG4A 4FN7A 4U0GH 2VSSE 5E0SH 3Q7HA 4FNBA 3NJDA 4WYOB 1OD2A 3KTGA 4MXIA 2VSUE 2YJGA 3TDCA 2QQ3A 5DZKA 3G64A 4LK5A 3KTHA 4U0HA 4EMMA 2Q2XA 3RRVA 4ZDBA 4QIIA 1HNOA 1WDKA 2VSUC 1N6DA 4Z0MA 4OMRA 3OC7A 3PE8A 4G2RA 3H0QA 3QK8A 4YLHA 3PZKA 2VREA 2J5II 4JCQA 3P85A 3M6NA 4F47A 3V5IA 3KTKA 3LKEA 3HRXA 3T8BA 3T88A 3TV5A 3DJAA 3MYBA 5KJPA 4FZWA 4ZU2A 3R6HA 1XNWA 3R0OA 4JYLA 4JCRA 3R9TA 4RYFA 3K50A 2GTRA 1OD4A 4ZDFA 4MI2A 4NEKA 2VSSF 4U1AA 4ZDCA 3T3WA 2J5IB 4WCZA 5KDRB 4EMPA 5MGBA 1WDMA 3TVUA 1W2XA 4ZDDA 4L6WA 3QKAA 3Q1TA 2VSUF 2FBMA 2Q35A 2Q34A 3MT6A 3PGQA 4FZWC 1XX4A 3JU1A 1ON9A 1UYVA 3KTIA 4I42A 5INFA 4B3HA 1UYTA 3U9TB 1FCFA 2ZL0A 4J2UA 3Q0GA 2F9YA 4KNPA 5CTBA 1WZ8A 1ON3A 4IZCA 3K8XA 2DEOA 4I52A 2UZFA 3STAA 2ZQRA 3KQFA 3QXZA 2HW5A 5DU8A 3T8AA 1UYSA 4B3IA 1TG6A 4RCNA 3ST9A 4HNKA 1N6EA 1X0UA 5INGA 3HE2A 3VIVA 1J7XA 2FZSA 3HLN1 4KD6A 4JFCA 3ISAA 4ELSA 3QYRA 4K29A 2IEXA 3WG5A 4JYJA 1PJHA 3P5MA 4ELXA 3OT6A 4ELWA 4ZDEA 2X58A 2F6QA 2ZL4A 3KTJA 4U0GA 4OLQA 3TT7A 4JOTA 2DUBA 4HC8A 5E0SA 1N6FA 4FJWD 3I47A 2A7SA 3IAVA 2F6IA 1EY3A 3GF7A 2PPYA 4I4ZA 3TZ3A 1Q51A 4IZBA 2A81A 4IZDA 3H02A 2J5GD 4JVTA 3FDUA 1JXZA 1K39A 1DCIA 1SZOA 2J5IA 3LAOA 5KDRA 3FF6A 3H0UA 3Q0JA 1NZYB 3U9SB 4NNQA 5INIA 1XO6A 3OMEA 1VRGA 4L8KA 1YG6A 2CBYA 1YG8A 3ZWCA 2NP9A 5CTCA 2C8TA 5FUSA 3T89A 3RSTA 5DTWA 2PG8A 4B3JA 3RSIA 3NJBA 3IBBA 5DZKH 3GLMA 3TVWA 3V5EA 5C90A 5G1QA
chains in the Genus database with same CATH topology
4EMLA 4FN8A 4GHNA 3IB9A 4K2NA 3GKBA 3P2LA 2F9IB 4Q1IA 3QMJA 1PIXA 5DUFA 2VX2A 3ZW9A 5G1SA 4Q0GA 4HDTA 3TT6A 1RJMA 1UIYA 3HP0A 3QWDA 4K3WA 3ZWBA 3QREA 3PEAA 3HINA 1XNVA 4KPKA 3H0SA 2W3PA 2CE3A 4RYFH 2X24A 5G1RA 2PBPA 3BEZA 1FC9A 2EJ5A 4QIJA 3BPPA 5E0NX 4QFEA 4JSBA 3MOYA 1FC6A 3TLFA 4WZ8B 4ASIA 1HZDA 4JJTA 5DUCA 3R9SA 3MFMA 3BPTA 1TYFA 3L3SA 2BZRA 5DKPA 5FIFA 2J5GA 1FC7A 4DI1A 1O8UA 5DTPA 3H0JA 3TRRA 1EF9A 3ZW8A 1UYRA 3SLLA 3BF0A 5C9GA 2ZL3A 1NZYA 4FB8A 4JWVA 4U18A 4U19A 3GF3A 1K32A 5DU4A 4JCSA 1RJNA 2FW2A 2WTBA 2ZQQA 4JCTA 5JBXA 1MJ3A 2D3TA 1Y7OA 5DU6A 4MOUA 5IKLB 4GM2A 5HUQA 3SWXA 2A7KA 2J5SA 1WDLA 1EF8A 2VSSA 3H81A 5DL1A 2ZL2A 3DORA 4OG1A 3GMAA 2F9IA 4NARA 3QXIA 1DUBA 5JBWA 3ZWAA 1HNUA 2VSUA 3R9QA 1Q52A 4KWBA 3N6RB 1XNYA 4FNDA 2F9YB 3U9RB 3M6MA 1SG4A 4FN7A 4U0GH 2VSSE 5E0SH 3Q7HA 4FNBA 3NJDA 4WYOB 1OD2A 3KTGA 4MXIA 2VSUE 2YJGA 3TDCA 2QQ3A 5DZKA 3G64A 4LK5A 3KTHA 4U0HA 4EMMA 2Q2XA 3RRVA 4ZDBA 4QIIA 1HNOA 1WDKA 2VSUC 1N6DA 4Z0MA 4OMRA 3OC7A 3PE8A 4G2RA 3H0QA 3QK8A 4YLHA 3PZKA 2VREA 2J5II 4JCQA 3P85A 3M6NA 4F47A 3V5IA 3KTKA 3LKEA 3HRXA 3T8BA 3T88A 3TV5A 3DJAA 3MYBA 5KJPA 4FZWA 4ZU2A 3R6HA 1XNWA 3R0OA 4JYLA 4JCRA 3R9TA 4RYFA 3K50A 2GTRA 1OD4A 4ZDFA 4MI2A 4NEKA 2VSSF 4U1AA 4ZDCA 3T3WA 2J5IB 4WCZA 5KDRB 4EMPA 5MGBA 1WDMA 3TVUA 1W2XA 4ZDDA 4L6WA 3QKAA 3Q1TA 2VSUF 2FBMA 2Q35A 2Q34A 3MT6A 3PGQA 4FZWC 1XX4A 3JU1A 1ON9A 1UYVA 3KTIA 4I42A 5INFA 4B3HA 1UYTA 3U9TB 1FCFA 2ZL0A 4J2UA 3Q0GA 2F9YA 4KNPA 5CTBA 1WZ8A 1ON3A 4IZCA 3K8XA 2DEOA 4I52A 2UZFA 3STAA 2ZQRA 3KQFA 3QXZA 2HW5A 5DU8A 3T8AA 1UYSA 4B3IA 1TG6A 4RCNA 3ST9A 4HNKA 1N6EA 1X0UA 5INGA 3HE2A 3VIVA 1J7XA 2FZSA 3HLN1 4KD6A 4JFCA 3ISAA 4ELSA 3QYRA 4K29A 2IEXA 3WG5A 4JYJA 1PJHA 3P5MA 4ELXA 3OT6A 4ELWA 4ZDEA 2X58A 2F6QA 2ZL4A 3KTJA 4U0GA 4OLQA 3TT7A 4JOTA 2DUBA 4HC8A 5E0SA 1N6FA 4FJWD 3I47A 2A7SA 3IAVA 2F6IA 1EY3A 3GF7A 2PPYA 4I4ZA 3TZ3A 1Q51A 4IZBA 2A81A 4IZDA 3H02A 2J5GD 4JVTA 3FDUA 1JXZA 1K39A 1DCIA 1SZOA 2J5IA 3LAOA 5KDRA 3FF6A 3H0UA 3Q0JA 1NZYB 3U9SB 4NNQA 5INIA 1XO6A 3OMEA 1VRGA 4L8KA 1YG6A 2CBYA 1YG8A 3ZWCA 2NP9A 5CTCA 2C8TA 5FUSA 3T89A 3RSTA 5DTWA 2PG8A 4B3JA 3RSIA 3NJBA 3IBBA 5DZKH 3GLMA 3TVWA 3V5EA 5C90A 5G1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EML A;  4FN8 A;  4GHN A;  3IB9 A;  4K2N A;  3GKB A;  3P2L A;  2F9I B;  4Q1I A;  3QMJ A;  1PIX A;  5DUF A;  2VX2 A;  3ZW9 A;  5G1S A;  4Q0G A;  3TT6 A;  1RJM A;  1UIY A;  3HP0 A;  3QWD A;  4K3W A;  3ZWB A;  3QRE A;  3PEA A;  3HIN A;  1XNV A;  4KPK A;  3H0S A;  2W3P A;  2CE3 A;  4RYF H;  2X24 A;  5G1R A;  2PBP A;  3BEZ A;  1FC9 A;  2EJ5 A;  4QIJ A;  3BPP A;  5E0N X;  4QFE A;  4JSB A;  3MOY A;  1FC6 A;  3TLF A;  4WZ8 B;  4ASI A;  1HZD A;  4JJT A;  5DUC A;  3R9S A;  3MFM A;  1TYF A;  3L3S A;  2BZR A;  5DKP A;  5FIF A;  2J5G A;  1FC7 A;  4DI1 A;  1O8U A;  5DTP A;  3H0J A;  3TRR A;  1EF9 A;  3ZW8 A;  1UYR A;  3SLL A;  3BF0 A;  5C9G A;  2ZL3 A;  1NZY A;  4FB8 A;  4JWV A;  4U18 A;  4U19 A;  3GF3 A;  1K32 A;  5DU4 A;  4JCS A;  1RJN A;  2FW2 A;  2WTB A;  2ZQQ A;  4JCT A;  5JBX A;  1MJ3 A;  2D3T A;  1Y7O A;  5DU6 A;  4MOU A;  5IKL B;  4GM2 A;  3SWX A;  2A7K A;  2J5S A;  1WDL A;  1EF8 A;  2VSS A;  3H81 A;  5DL1 A;  2ZL2 A;  3DOR A;  4OG1 A;  3GMA A;  2F9I A;  3QXI A;  1DUB A;  5JBW A;  3ZWA A;  1HNU A;  2VSU A;  3R9Q A;  1Q52 A;  4KWB A;  3N6R B;  1XNY A;  4FND A;  2F9Y B;  3U9R B;  3M6M A;  1SG4 A;  4FN7 A;  4U0G H;  2VSS E;  5E0S H;  3Q7H A;  4FNB A;  3NJD A;  4WYO B;  1OD2 A;  3KTG A;  4MXI A;  2VSU E;  3TDC A;  2QQ3 A;  5DZK A;  3G64 A;  4LK5 A;  3KTH A;  4U0H A;  4EMM A;  2Q2X A;  3RRV A;  4ZDB A;  4QII A;  1HNO A;  1WDK A;  2VSU C;  1N6D A;  4Z0M A;  4OMR A;  3OC7 A;  3PE8 A;  4G2R A;  3H0Q A;  3QK8 A;  4YLH A;  3PZK A;  2VRE A;  2J5I I;  4JCQ A;  3P85 A;  3M6N A;  4F47 A;  3V5I A;  3KTK A;  3LKE A;  3HRX A;  3T8B A;  3T88 A;  3TV5 A;  3DJA A;  3MYB A;  5KJP A;  4FZW A;  4ZU2 A;  3R6H A;  1XNW A;  3R0O A;  4JYL A;  4JCR A;  3R9T A;  4RYF A;  3K50 A;  2GTR A;  1OD4 A;  4ZDF A;  4MI2 A;  4NEK A;  2VSS F;  4U1A A;  4ZDC A;  3T3W A;  2J5I B;  4WCZ A;  5KDR B;  4EMP A;  5MGB A;  1WDM A;  3TVU A;  1W2X A;  4ZDD A;  4L6W A;  3QKA A;  3Q1T A;  2VSU F;  2FBM A;  2Q35 A;  2Q34 A;  3MT6 A;  3PGQ A;  4FZW C;  1XX4 A;  3JU1 A;  1ON9 A;  1UYV A;  3KTI A;  4I42 A;  5INF A;  4B3H A;  1UYT A;  3U9T B;  1FCF A;  2ZL0 A;  3Q0G A;  2F9Y A;  4KNP A;  5CTB A;  1WZ8 A;  1ON3 A;  4IZC A;  3K8X A;  2DEO A;  4I52 A;  2UZF A;  3STA A;  2ZQR A;  3KQF A;  3QXZ A;  2HW5 A;  5DU8 A;  3T8A A;  1UYS A;  4B3I A;  1TG6 A;  4RCN A;  3ST9 A;  4HNK A;  1N6E A;  1X0U A;  5ING A;  3HE2 A;  3VIV A;  1J7X A;  2FZS A;  3HLN 1;  4KD6 A;  4JFC A;  3ISA A;  4ELS A;  3QYR A;  4K29 A;  2IEX A;  3WG5 A;  4JYJ A;  1PJH A;  3P5M A;  4ELX A;  3OT6 A;  4ELW A;  4ZDE A;  2X58 A;  2F6Q A;  2ZL4 A;  3KTJ A;  4U0G A;  4OLQ A;  3TT7 A;  4JOT A;  2DUB A;  4HC8 A;  5E0S A;  1N6F A;  4FJW D;  3I47 A;  2A7S A;  3IAV A;  2F6I A;  1EY3 A;  3GF7 A;  2PPY A;  4I4Z A;  3TZ3 A;  1Q51 A;  4IZB A;  2A81 A;  4IZD A;  3H02 A;  2J5G D;  4JVT A;  3FDU A;  1JXZ A;  1K39 A;  1DCI A;  1SZO A;  2J5I A;  3LAO A;  5KDR A;  3FF6 A;  3H0U A;  3Q0J A;  1NZY B;  3U9S B;  4NNQ A;  5INI A;  1XO6 A;  3OME A;  1VRG A;  4L8K A;  1YG6 A;  2CBY A;  1YG8 A;  3ZWC A;  2NP9 A;  5CTC A;  2C8T A;  5FUS A;  3T89 A;  3RST A;  5DTW A;  2PG8 A;  4B3J A;  3RSI A;  3NJB A;  3IBB A;  5DZK H;  3GLM A;  3TVW A;  3V5E A;  5C90 A;  5G1Q A; 
#chains in the Genus database with same CATH topology
 4EML A;  4FN8 A;  4GHN A;  3IB9 A;  4K2N A;  3GKB A;  3P2L A;  2F9I B;  4Q1I A;  3QMJ A;  1PIX A;  5DUF A;  2VX2 A;  3ZW9 A;  5G1S A;  4Q0G A;  4HDT A;  3TT6 A;  1RJM A;  1UIY A;  3HP0 A;  3QWD A;  4K3W A;  3ZWB A;  3QRE A;  3PEA A;  3HIN A;  1XNV A;  4KPK A;  3H0S A;  2W3P A;  2CE3 A;  4RYF H;  2X24 A;  5G1R A;  2PBP A;  3BEZ A;  1FC9 A;  2EJ5 A;  4QIJ A;  3BPP A;  5E0N X;  4QFE A;  4JSB A;  3MOY A;  1FC6 A;  3TLF A;  4WZ8 B;  4ASI A;  1HZD A;  4JJT A;  5DUC A;  3R9S A;  3MFM A;  3BPT A;  1TYF A;  3L3S A;  2BZR A;  5DKP A;  5FIF A;  2J5G A;  1FC7 A;  4DI1 A;  1O8U A;  5DTP A;  3H0J A;  3TRR A;  1EF9 A;  3ZW8 A;  1UYR A;  3SLL A;  3BF0 A;  5C9G A;  2ZL3 A;  1NZY A;  4FB8 A;  4JWV A;  4U18 A;  4U19 A;  3GF3 A;  1K32 A;  5DU4 A;  4JCS A;  1RJN A;  2FW2 A;  2WTB A;  2ZQQ A;  4JCT A;  5JBX A;  1MJ3 A;  2D3T A;  1Y7O A;  5DU6 A;  4MOU A;  5IKL B;  4GM2 A;  5HUQ A;  3SWX A;  2A7K A;  2J5S A;  1WDL A;  1EF8 A;  2VSS A;  3H81 A;  5DL1 A;  2ZL2 A;  3DOR A;  4OG1 A;  3GMA A;  2F9I A;  4NAR A;  3QXI A;  1DUB A;  5JBW A;  3ZWA A;  1HNU A;  2VSU A;  3R9Q A;  1Q52 A;  4KWB A;  3N6R B;  1XNY A;  4FND A;  2F9Y B;  3U9R B;  3M6M A;  1SG4 A;  4FN7 A;  4U0G H;  2VSS E;  5E0S H;  3Q7H A;  4FNB A;  3NJD A;  4WYO B;  1OD2 A;  3KTG A;  4MXI A;  2VSU E;  2YJG A;  3TDC A;  2QQ3 A;  5DZK A;  3G64 A;  4LK5 A;  3KTH A;  4U0H A;  4EMM A;  2Q2X A;  3RRV A;  4ZDB A;  4QII A;  1HNO A;  1WDK A;  2VSU C;  1N6D A;  4Z0M A;  4OMR A;  3OC7 A;  3PE8 A;  4G2R A;  3H0Q A;  3QK8 A;  4YLH A;  3PZK A;  2VRE A;  2J5I I;  4JCQ A;  3P85 A;  3M6N A;  4F47 A;  3V5I A;  3KTK A;  3LKE A;  3HRX A;  3T8B A;  3T88 A;  3TV5 A;  3DJA A;  3MYB A;  5KJP A;  4FZW A;  4ZU2 A;  3R6H A;  1XNW A;  3R0O A;  4JYL A;  4JCR A;  3R9T A;  4RYF A;  3K50 A;  2GTR A;  1OD4 A;  4ZDF A;  4MI2 A;  4NEK A;  2VSS F;  4U1A A;  4ZDC A;  3T3W A;  2J5I B;  4WCZ A;  5KDR B;  4EMP A;  5MGB A;  1WDM A;  3TVU A;  1W2X A;  4ZDD A;  4L6W A;  3QKA A;  3Q1T A;  2VSU F;  2FBM A;  2Q35 A;  2Q34 A;  3MT6 A;  3PGQ A;  4FZW C;  1XX4 A;  3JU1 A;  1ON9 A;  1UYV A;  3KTI A;  4I42 A;  5INF A;  4B3H A;  1UYT A;  3U9T B;  1FCF A;  2ZL0 A;  4J2U A;  3Q0G A;  2F9Y A;  4KNP A;  5CTB A;  1WZ8 A;  1ON3 A;  4IZC A;  3K8X A;  2DEO A;  4I52 A;  2UZF A;  3STA A;  2ZQR A;  3KQF A;  3QXZ A;  2HW5 A;  5DU8 A;  3T8A A;  1UYS A;  4B3I A;  1TG6 A;  4RCN A;  3ST9 A;  4HNK A;  1N6E A;  1X0U A;  5ING A;  3HE2 A;  3VIV A;  1J7X A;  2FZS A;  3HLN 1;  4KD6 A;  4JFC A;  3ISA A;  4ELS A;  3QYR A;  4K29 A;  2IEX A;  3WG5 A;  4JYJ A;  1PJH A;  3P5M A;  4ELX A;  3OT6 A;  4ELW A;  4ZDE A;  2X58 A;  2F6Q A;  2ZL4 A;  3KTJ A;  4U0G A;  4OLQ A;  3TT7 A;  4JOT A;  2DUB A;  4HC8 A;  5E0S A;  1N6F A;  4FJW D;  3I47 A;  2A7S A;  3IAV A;  2F6I A;  1EY3 A;  3GF7 A;  2PPY A;  4I4Z A;  3TZ3 A;  1Q51 A;  4IZB A;  2A81 A;  4IZD A;  3H02 A;  2J5G D;  4JVT A;  3FDU A;  1JXZ A;  1K39 A;  1DCI A;  1SZO A;  2J5I A;  3LAO A;  5KDR A;  3FF6 A;  3H0U A;  3Q0J A;  1NZY B;  3U9S B;  4NNQ A;  5INI A;  1XO6 A;  3OME A;  1VRG A;  4L8K A;  1YG6 A;  2CBY A;  1YG8 A;  3ZWC A;  2NP9 A;  5CTC A;  2C8T A;  5FUS A;  3T89 A;  3RST A;  5DTW A;  2PG8 A;  4B3J A;  3RSI A;  3NJB A;  3IBB A;  5DZK H;  3GLM A;  3TVW A;  3V5E A;  5C90 A;  5G1Q A; 
#chains in the Genus database with same CATH homology
 4EML A;  4FN8 A;  4GHN A;  3IB9 A;  4K2N A;  3GKB A;  3P2L A;  2F9I B;  4Q1I A;  3QMJ A;  1PIX A;  5DUF A;  2VX2 A;  3ZW9 A;  5G1S A;  4Q0G A;  4HDT A;  3TT6 A;  1RJM A;  1UIY A;  3HP0 A;  3QWD A;  4K3W A;  3ZWB A;  3QRE A;  3PEA A;  3HIN A;  1XNV A;  4KPK A;  3H0S A;  2W3P A;  2CE3 A;  4RYF H;  2X24 A;  5G1R A;  2PBP A;  3BEZ A;  1FC9 A;  2EJ5 A;  4QIJ A;  3BPP A;  5E0N X;  4QFE A;  4JSB A;  3MOY A;  1FC6 A;  3TLF A;  4WZ8 B;  4ASI A;  1HZD A;  4JJT A;  5DUC A;  3R9S A;  3MFM A;  3BPT A;  1TYF A;  3L3S A;  2BZR A;  5DKP A;  5FIF A;  2J5G A;  1FC7 A;  4DI1 A;  1O8U A;  5DTP A;  3H0J A;  3TRR A;  1EF9 A;  3ZW8 A;  1UYR A;  3SLL A;  3BF0 A;  5C9G A;  2ZL3 A;  1NZY A;  4FB8 A;  4JWV A;  4U18 A;  4U19 A;  3GF3 A;  1K32 A;  5DU4 A;  4JCS A;  1RJN A;  2FW2 A;  2WTB A;  2ZQQ A;  4JCT A;  5JBX A;  1MJ3 A;  2D3T A;  1Y7O A;  5DU6 A;  4MOU A;  5IKL B;  4GM2 A;  5HUQ A;  3SWX A;  2A7K A;  2J5S A;  1WDL A;  1EF8 A;  2VSS A;  3H81 A;  5DL1 A;  2ZL2 A;  3DOR A;  4OG1 A;  3GMA A;  2F9I A;  4NAR A;  3QXI A;  1DUB A;  5JBW A;  3ZWA A;  1HNU A;  2VSU A;  3R9Q A;  1Q52 A;  4KWB A;  3N6R B;  1XNY A;  4FND A;  2F9Y B;  3U9R B;  3M6M A;  1SG4 A;  4FN7 A;  4U0G H;  2VSS E;  5E0S H;  3Q7H A;  4FNB A;  3NJD A;  4WYO B;  1OD2 A;  3KTG A;  4MXI A;  2VSU E;  2YJG A;  3TDC A;  2QQ3 A;  5DZK A;  3G64 A;  4LK5 A;  3KTH A;  4U0H A;  4EMM A;  2Q2X A;  3RRV A;  4ZDB A;  4QII A;  1HNO A;  1WDK A;  2VSU C;  1N6D A;  4Z0M A;  4OMR A;  3OC7 A;  3PE8 A;  4G2R A;  3H0Q A;  3QK8 A;  4YLH A;  3PZK A;  2VRE A;  2J5I I;  4JCQ A;  3P85 A;  3M6N A;  4F47 A;  3V5I A;  3KTK A;  3LKE A;  3HRX A;  3T8B A;  3T88 A;  3TV5 A;  3DJA A;  3MYB A;  5KJP A;  4FZW A;  4ZU2 A;  3R6H A;  1XNW A;  3R0O A;  4JYL A;  4JCR A;  3R9T A;  4RYF A;  3K50 A;  2GTR A;  1OD4 A;  4ZDF A;  4MI2 A;  4NEK A;  2VSS F;  4U1A A;  4ZDC A;  3T3W A;  2J5I B;  4WCZ A;  5KDR B;  4EMP A;  5MGB A;  1WDM A;  3TVU A;  1W2X A;  4ZDD A;  4L6W A;  3QKA A;  3Q1T A;  2VSU F;  2FBM A;  2Q35 A;  2Q34 A;  3MT6 A;  3PGQ A;  4FZW C;  1XX4 A;  3JU1 A;  1ON9 A;  1UYV A;  3KTI A;  4I42 A;  5INF A;  4B3H A;  1UYT A;  3U9T B;  1FCF A;  2ZL0 A;  4J2U A;  3Q0G A;  2F9Y A;  4KNP A;  5CTB A;  1WZ8 A;  1ON3 A;  4IZC A;  3K8X A;  2DEO A;  4I52 A;  2UZF A;  3STA A;  2ZQR A;  3KQF A;  3QXZ A;  2HW5 A;  5DU8 A;  3T8A A;  1UYS A;  4B3I A;  1TG6 A;  4RCN A;  3ST9 A;  4HNK A;  1N6E A;  1X0U A;  5ING A;  3HE2 A;  3VIV A;  1J7X A;  2FZS A;  3HLN 1;  4KD6 A;  4JFC A;  3ISA A;  4ELS A;  3QYR A;  4K29 A;  2IEX A;  3WG5 A;  4JYJ A;  1PJH A;  3P5M A;  4ELX A;  3OT6 A;  4ELW A;  4ZDE A;  2X58 A;  2F6Q A;  2ZL4 A;  3KTJ A;  4U0G A;  4OLQ A;  3TT7 A;  4JOT A;  2DUB A;  4HC8 A;  5E0S A;  1N6F A;  4FJW D;  3I47 A;  2A7S A;  3IAV A;  2F6I A;  1EY3 A;  3GF7 A;  2PPY A;  4I4Z A;  3TZ3 A;  1Q51 A;  4IZB A;  2A81 A;  4IZD A;  3H02 A;  2J5G D;  4JVT A;  3FDU A;  1JXZ A;  1K39 A;  1DCI A;  1SZO A;  2J5I A;  3LAO A;  5KDR A;  3FF6 A;  3H0U A;  3Q0J A;  1NZY B;  3U9S B;  4NNQ A;  5INI A;  1XO6 A;  3OME A;  1VRG A;  4L8K A;  1YG6 A;  2CBY A;  1YG8 A;  3ZWC A;  2NP9 A;  5CTC A;  2C8T A;  5FUS A;  3T89 A;  3RST A;  5DTW A;  2PG8 A;  4B3J A;  3RSI A;  3NJB A;  3IBB A;  5DZK H;  3GLM A;  3TVW A;  3V5E A;  5C90 A;  5G1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...