3T8BA

Crystal structure of mycobacterium tuberculosis menb with altered hexameric assembly
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
256
structure length
235
Chain Sequence
DNPFDAKAWRLVDGFDDLTDITYHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGDQRIRGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRMLKFAFNLLDDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,4-Dihydroxy-2-naphthoyl-CoA synthase
publication title Mechanism of the Intramolecular Claisen Condensation Reaction Catalyzed by MenB, a Crotonase Superfamily Member.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Lyase
total genus 91
structure length 235
sequence length 256
chains with identical sequence B
ec nomenclature ec 4.1.3.36: 1,4-dihydroxy-2-naphthoyl-CoA synthase.
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3t8bA00
2ZQQA 2F9YB 2WTBA 3H0SA 2FZSA 2F6IA 4FZWC 5DUCA 2GTRA 3LAOA 1SZOA 4YLHA 5DL1A 3QMJA 3KTJA 2ZL3A 5C9GA 5C90A 3OMEA 1K32A 2Q34A 4KWBA 3P5MA 3BPPA 3N6RB 4KD6A 2J5GD 3P85A 4ZDEA 3HRXA 4JVTA 1YG8A 5DZKA 4JYLA 1XNYA 2X58A 3P2LA 4EMMA 5IKLB 1XNWA 3QK8A 2F9YA 1RJNA 2J5II 1PIXA 3BEZA 1PJHA 3TLFA 4QIJA 3R0OA 4K2NA 3RRVA 3K8XA 2C8TA 5JBXA 3V5IA 3FF6A 3I47A 4ZDCA 4L6WA 4WCZA 5DUFA 3TT6A 3V5EA 1X0UA 4RCNA 2VSUA 4OG1A 2VX2A 4B3IA 3QREA 1NZYA 2IEXA 3DORA 5JBWA 4FNDA 2PG8A 4JJTA 1MJ3A 3OC7A 2PPYA 3HE2A 4JOTA 4WYOB 4I4ZA 2A7SA 3GMAA 3GKBA 3ISAA 4FJWD 3MYBA 5G1QA 3QXIA 4FZWA 4FN8A 5KJPA 4KPKA 4Q1IA 3KTHA 5DZKH 3T8AA 2DEOA 5G1RA 1XX4A 3T89A 5DTPA 3L3SA 1DUBA 3GLMA 1HZDA 4JCQA 2J5SA 1ON9A 3PE8A 2VSUE 4I42A 4IZDA 4ASIA 1TG6A 4LK5A 4NNQA 2QQ3A 1YG6A 1FC7A 3STAA 4MI2A 1DCIA 2J5IB 4EMPA 3Q7HA 4B3HA 4U18A 3VIVA 3IB9A 1FCFA 2F9IA 3TZ3A 1WZ8A 3U9TB 5E0NX 1OD4A 5G1SA 1UYSA 1W2XA 3Q1TA 2ZL4A 4OLQA 3MFMA 4FNBA 5FIFA 4HNKA 1Q52A 3Q0JA 3ZW8A 5FUSA 4ELSA 3K50A 1VRGA 1UYVA 4U19A 4JFCA 2A7KA 4IZCA 3H0UA 2VSUF 4FN7A 4L8KA 3H02A 4ELXA 1UYTA 3G64A 4IZBA 3TVUA 5INIA 4Q0GA 3IBBA 3BF0A 4WZ8B 3U9RB 1XNVA 4ZDBA 5MGBA 2EJ5A 4Z0MA 3SLLA 4JCSA 3TT7A 3M6NA 2VSSA 3JU1A 4ELWA 4K29A 3QKAA 5DU8A 3OT6A 5E0SA 5KDRB 3QXZA 1WDMA 3KTKA 1UYRA 4U1AA 2FW2A 1FC6A 3ZWAA 4MXIA 2D3TA 2FBMA 3TV5A 2CBYA 2W3PA 4ZDDA 1EY3A 2VREA 1N6DA 3TDCA 3U9SB 5CTBA 3R9QA 3HLN1 3PGQA 3MOYA 1HNOA 4GM2A 3TRRA 1N6EA 3MT6A 4JYJA 3HINA 4JCRA 2VSSE 3H0QA 1WDLA 4K3WA 5CTCA 4ZU2A 1ON3A 5KDRA 1EF9A 1TYFA 1NZYB 3T8BA 5DTWA 4QFEA 5E0SH 3GF7A 5DU4A 4NEKA 3QWDA 2ZL0A 1XO6A 1J7XA 4ZDFA 4MOUA 4U0GA 3KTGA 3IAVA 4U0HA 1JXZA 1UIYA 4KNPA 4OMRA 3ST9A 3ZW9A 1Q51A 3T3WA 2J5GA 1OD2A 1FC9A 4DI1A 2UZFA 3NJBA 4RYFA 2J5IA 4F47A 1SG4A 3GF3A 2PBPA 2X24A 3WG5A 3LKEA 5INFA 3T88A 2HW5A 3R6HA 3PZKA 4FB8A 5DKPA 2CE3A 2Q2XA 2F6QA 2A81A 4G2RA 2ZL2A 3HP0A 3TVWA 5INGA 3DJAA 4JSBA 3KTIA 3RSTA 2VSSF 2ZQRA 5DU6A 4B3JA 1N6FA 4GHNA 1O8UA 4EMLA 3NJDA 1RJMA 3ZWBA 1K39A 1HNUA 4I52A 3R9SA 4JWVA 3M6MA 2DUBA 1Y7OA 3QYRA 3Q0GA 3ZWCA 1EF8A 2F9IB 2NP9A 1WDKA 4QIIA 4U0GH 2Q35A 3FDUA 2VSUC 3H81A 3KQFA 3R9TA 3RSIA 3SWXA 4HC8A 3H0JA 4JCTA 3PEAA 4RYFH 2BZRA
chains in the Genus database with same CATH superfamily
2ZQQA 2F9YB 2WTBA 3H0SA 2FZSA 2F6IA 4FZWC 5DUCA 2GTRA 3LAOA 1SZOA 4YLHA 5DL1A 3QMJA 3KTJA 2ZL3A 5C9GA 5C90A 3OMEA 1K32A 2Q34A 4KWBA 3P5MA 3BPPA 3N6RB 4KD6A 2J5GD 3P85A 4ZDEA 3HRXA 4JVTA 1YG8A 5DZKA 4JYLA 1XNYA 2X58A 3P2LA 4EMMA 5IKLB 1XNWA 3QK8A 2F9YA 1RJNA 2J5II 1PIXA 3BEZA 1PJHA 3TLFA 4QIJA 3R0OA 4HDTA 4K2NA 3RRVA 3K8XA 2C8TA 5JBXA 3V5IA 3FF6A 3I47A 4ZDCA 4L6WA 4WCZA 5DUFA 3TT6A 3V5EA 1X0UA 4RCNA 2VSUA 4OG1A 2VX2A 4B3IA 3QREA 1NZYA 2IEXA 3DORA 5JBWA 4FNDA 5HUQA 2PG8A 4JJTA 1MJ3A 3OC7A 2PPYA 3HE2A 4JOTA 4WYOB 4I4ZA 2A7SA 3GMAA 3GKBA 3ISAA 4FJWD 3MYBA 5G1QA 3QXIA 4FZWA 4FN8A 5KJPA 4KPKA 4Q1IA 3KTHA 5DZKH 3T8AA 2DEOA 5G1RA 1XX4A 3T89A 5DTPA 3L3SA 1DUBA 3GLMA 1HZDA 4JCQA 2J5SA 1ON9A 3PE8A 2VSUE 4I42A 4IZDA 4ASIA 1TG6A 4LK5A 4NNQA 2QQ3A 1YG6A 1FC7A 3STAA 4MI2A 1DCIA 2J5IB 4EMPA 3Q7HA 4B3HA 4U18A 3VIVA 3IB9A 1FCFA 2F9IA 3TZ3A 1WZ8A 3U9TB 5E0NX 1OD4A 5G1SA 1UYSA 1W2XA 3Q1TA 2ZL4A 4OLQA 3MFMA 4FNBA 5FIFA 4HNKA 1Q52A 3Q0JA 3ZW8A 5FUSA 4ELSA 3K50A 1VRGA 1UYVA 4U19A 4JFCA 2A7KA 4IZCA 3H0UA 2VSUF 4FN7A 4L8KA 3H02A 4ELXA 1UYTA 3G64A 4IZBA 3TVUA 5INIA 4Q0GA 3IBBA 3BF0A 4WZ8B 3U9RB 1XNVA 4ZDBA 5MGBA 2EJ5A 4Z0MA 3SLLA 4JCSA 3TT7A 3M6NA 2VSSA 3JU1A 4ELWA 4K29A 3QKAA 5DU8A 3OT6A 5E0SA 5KDRB 3QXZA 1WDMA 3KTKA 1UYRA 4U1AA 2FW2A 1FC6A 3ZWAA 4MXIA 2D3TA 2FBMA 3TV5A 2CBYA 2W3PA 4J2UA 4ZDDA 1EY3A 2VREA 1N6DA 3TDCA 3U9SB 5CTBA 3R9QA 3HLN1 3PGQA 3MOYA 1HNOA 4GM2A 3TRRA 1N6EA 3MT6A 4JYJA 3HINA 4JCRA 2VSSE 3H0QA 1WDLA 4K3WA 5CTCA 4ZU2A 1ON3A 5KDRA 1EF9A 1TYFA 1NZYB 3T8BA 5DTWA 4QFEA 5E0SH 3GF7A 4NARA 5DU4A 4NEKA 3QWDA 2ZL0A 1XO6A 1J7XA 4ZDFA 4MOUA 4U0GA 3BPTA 3KTGA 3IAVA 4U0HA 1JXZA 1UIYA 4KNPA 4OMRA 3ST9A 3ZW9A 1Q51A 3T3WA 2J5GA 1OD2A 1FC9A 4DI1A 2UZFA 3NJBA 4RYFA 2J5IA 4F47A 1SG4A 3GF3A 2PBPA 2X24A 3WG5A 3LKEA 5INFA 3T88A 2HW5A 3R6HA 3PZKA 4FB8A 5DKPA 2CE3A 2Q2XA 2F6QA 2A81A 4G2RA 2ZL2A 3HP0A 3TVWA 5INGA 3DJAA 4JSBA 3KTIA 3RSTA 2VSSF 2ZQRA 5DU6A 4B3JA 1N6FA 4GHNA 1O8UA 4EMLA 3NJDA 1RJMA 3ZWBA 1K39A 1HNUA 4I52A 3R9SA 4JWVA 3M6MA 2DUBA 1Y7OA 3QYRA 3Q0GA 3ZWCA 1EF8A 2F9IB 2NP9A 1WDKA 4QIIA 4U0GH 2Q35A 3FDUA 2VSUC 3H81A 3KQFA 3R9TA 3RSIA 3SWXA 4HC8A 3H0JA 4JCTA 2YJGA 3PEAA 4RYFH 2BZRA
chains in the Genus database with same CATH topology
2ZQQA 2F9YB 2WTBA 3H0SA 2FZSA 2F6IA 4FZWC 5DUCA 2GTRA 3LAOA 1SZOA 4YLHA 5DL1A 3QMJA 3KTJA 2ZL3A 5C9GA 5C90A 3OMEA 1K32A 2Q34A 4KWBA 3P5MA 3BPPA 3N6RB 4KD6A 2J5GD 3P85A 4ZDEA 3HRXA 4JVTA 1YG8A 5DZKA 4JYLA 1XNYA 2X58A 3P2LA 4EMMA 5IKLB 1XNWA 3QK8A 2F9YA 1RJNA 2J5II 1PIXA 3BEZA 1PJHA 3TLFA 4QIJA 3R0OA 4HDTA 4K2NA 3RRVA 3K8XA 2C8TA 5JBXA 3V5IA 3FF6A 3I47A 4ZDCA 4L6WA 4WCZA 5DUFA 3TT6A 3V5EA 1X0UA 4RCNA 2VSUA 4OG1A 2VX2A 4B3IA 3QREA 1NZYA 2IEXA 3DORA 5JBWA 4FNDA 5HUQA 2PG8A 4JJTA 1MJ3A 3OC7A 2PPYA 3HE2A 4JOTA 4WYOB 4I4ZA 2A7SA 3GMAA 3GKBA 3ISAA 4FJWD 3MYBA 5G1QA 3QXIA 4FZWA 4FN8A 5KJPA 4KPKA 4Q1IA 3KTHA 5DZKH 3T8AA 2DEOA 5G1RA 1XX4A 3T89A 5DTPA 3L3SA 1DUBA 3GLMA 1HZDA 4JCQA 2J5SA 1ON9A 3PE8A 2VSUE 4I42A 4IZDA 4ASIA 1TG6A 4LK5A 4NNQA 2QQ3A 1YG6A 1FC7A 3STAA 4MI2A 1DCIA 2J5IB 4EMPA 3Q7HA 4B3HA 4U18A 3VIVA 3IB9A 1FCFA 2F9IA 3TZ3A 1WZ8A 3U9TB 5E0NX 1OD4A 5G1SA 1UYSA 1W2XA 3Q1TA 2ZL4A 4OLQA 3MFMA 4FNBA 5FIFA 4HNKA 1Q52A 3Q0JA 3ZW8A 5FUSA 4ELSA 3K50A 1VRGA 1UYVA 4U19A 4JFCA 2A7KA 4IZCA 3H0UA 2VSUF 4FN7A 4L8KA 3H02A 4ELXA 1UYTA 3G64A 4IZBA 3TVUA 5INIA 4Q0GA 3IBBA 3BF0A 4WZ8B 3U9RB 1XNVA 4ZDBA 5MGBA 2EJ5A 4Z0MA 3SLLA 4JCSA 3TT7A 3M6NA 2VSSA 3JU1A 4ELWA 4K29A 3QKAA 5DU8A 3OT6A 5E0SA 5KDRB 3QXZA 1WDMA 3KTKA 1UYRA 4U1AA 2FW2A 1FC6A 3ZWAA 4MXIA 2D3TA 2FBMA 3TV5A 2CBYA 2W3PA 4J2UA 4ZDDA 1EY3A 2VREA 1N6DA 3TDCA 3U9SB 5CTBA 3R9QA 3HLN1 3PGQA 3MOYA 1HNOA 4GM2A 3TRRA 1N6EA 3MT6A 4JYJA 3HINA 4JCRA 2VSSE 3H0QA 1WDLA 4K3WA 5CTCA 4ZU2A 1ON3A 5KDRA 1EF9A 1TYFA 1NZYB 3T8BA 5DTWA 4QFEA 5E0SH 3GF7A 4NARA 5DU4A 4NEKA 3QWDA 2ZL0A 1XO6A 1J7XA 4ZDFA 4MOUA 4U0GA 3BPTA 3KTGA 3IAVA 4U0HA 1JXZA 1UIYA 4KNPA 4OMRA 3ST9A 3ZW9A 1Q51A 3T3WA 2J5GA 1OD2A 1FC9A 4DI1A 2UZFA 3NJBA 4RYFA 2J5IA 4F47A 1SG4A 3GF3A 2PBPA 2X24A 3WG5A 3LKEA 5INFA 3T88A 2HW5A 3R6HA 3PZKA 4FB8A 5DKPA 2CE3A 2Q2XA 2F6QA 2A81A 4G2RA 2ZL2A 3HP0A 3TVWA 5INGA 3DJAA 4JSBA 3KTIA 3RSTA 2VSSF 2ZQRA 5DU6A 4B3JA 1N6FA 4GHNA 1O8UA 4EMLA 3NJDA 1RJMA 3ZWBA 1K39A 1HNUA 4I52A 3R9SA 4JWVA 3M6MA 2DUBA 1Y7OA 3QYRA 3Q0GA 3ZWCA 1EF8A 2F9IB 2NP9A 1WDKA 4QIIA 4U0GH 2Q35A 3FDUA 2VSUC 3H81A 3KQFA 3R9TA 3RSIA 3SWXA 4HC8A 3H0JA 4JCTA 2YJGA 3PEAA 4RYFH 2BZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQQ A;  2F9Y B;  2WTB A;  3H0S A;  2FZS A;  2F6I A;  4FZW C;  5DUC A;  2GTR A;  3LAO A;  1SZO A;  4YLH A;  5DL1 A;  3QMJ A;  3KTJ A;  2ZL3 A;  5C9G A;  5C90 A;  3OME A;  1K32 A;  2Q34 A;  4KWB A;  3P5M A;  3BPP A;  3N6R B;  4KD6 A;  2J5G D;  3P85 A;  4ZDE A;  3HRX A;  4JVT A;  1YG8 A;  5DZK A;  4JYL A;  1XNY A;  2X58 A;  3P2L A;  4EMM A;  5IKL B;  1XNW A;  3QK8 A;  2F9Y A;  1RJN A;  2J5I I;  1PIX A;  3BEZ A;  1PJH A;  3TLF A;  4QIJ A;  3R0O A;  4K2N A;  3RRV A;  3K8X A;  2C8T A;  5JBX A;  3V5I A;  3FF6 A;  3I47 A;  4ZDC A;  4L6W A;  4WCZ A;  5DUF A;  3TT6 A;  3V5E A;  1X0U A;  4RCN A;  2VSU A;  4OG1 A;  2VX2 A;  4B3I A;  3QRE A;  1NZY A;  2IEX A;  3DOR A;  5JBW A;  4FND A;  2PG8 A;  4JJT A;  1MJ3 A;  3OC7 A;  2PPY A;  3HE2 A;  4JOT A;  4WYO B;  4I4Z A;  2A7S A;  3GMA A;  3GKB A;  3ISA A;  4FJW D;  3MYB A;  5G1Q A;  3QXI A;  4FZW A;  4FN8 A;  5KJP A;  4KPK A;  4Q1I A;  3KTH A;  5DZK H;  3T8A A;  2DEO A;  5G1R A;  1XX4 A;  3T89 A;  5DTP A;  3L3S A;  1DUB A;  3GLM A;  1HZD A;  4JCQ A;  2J5S A;  1ON9 A;  3PE8 A;  2VSU E;  4I42 A;  4IZD A;  4ASI A;  1TG6 A;  4LK5 A;  4NNQ A;  2QQ3 A;  1YG6 A;  1FC7 A;  3STA A;  4MI2 A;  1DCI A;  2J5I B;  4EMP A;  3Q7H A;  4B3H A;  4U18 A;  3VIV A;  3IB9 A;  1FCF A;  2F9I A;  3TZ3 A;  1WZ8 A;  3U9T B;  5E0N X;  1OD4 A;  5G1S A;  1UYS A;  1W2X A;  3Q1T A;  2ZL4 A;  4OLQ A;  3MFM A;  4FNB A;  5FIF A;  4HNK A;  1Q52 A;  3Q0J A;  3ZW8 A;  5FUS A;  4ELS A;  3K50 A;  1VRG A;  1UYV A;  4U19 A;  4JFC A;  2A7K A;  4IZC A;  3H0U A;  2VSU F;  4FN7 A;  4L8K A;  3H02 A;  4ELX A;  1UYT A;  3G64 A;  4IZB A;  3TVU A;  5INI A;  4Q0G A;  3IBB A;  3BF0 A;  4WZ8 B;  3U9R B;  1XNV A;  4ZDB A;  5MGB A;  2EJ5 A;  4Z0M A;  3SLL A;  4JCS A;  3TT7 A;  3M6N A;  2VSS A;  3JU1 A;  4ELW A;  4K29 A;  3QKA A;  5DU8 A;  3OT6 A;  5E0S A;  5KDR B;  3QXZ A;  1WDM A;  3KTK A;  1UYR A;  4U1A A;  2FW2 A;  1FC6 A;  3ZWA A;  4MXI A;  2D3T A;  2FBM A;  3TV5 A;  2CBY A;  2W3P A;  4ZDD A;  1EY3 A;  2VRE A;  1N6D A;  3TDC A;  3U9S B;  5CTB A;  3R9Q A;  3HLN 1;  3PGQ A;  3MOY A;  1HNO A;  4GM2 A;  3TRR A;  1N6E A;  3MT6 A;  4JYJ A;  3HIN A;  4JCR A;  2VSS E;  3H0Q A;  1WDL A;  4K3W A;  5CTC A;  4ZU2 A;  1ON3 A;  5KDR A;  1EF9 A;  1TYF A;  1NZY B;  3T8B A;  5DTW A;  4QFE A;  5E0S H;  3GF7 A;  5DU4 A;  4NEK A;  3QWD A;  2ZL0 A;  1XO6 A;  1J7X A;  4ZDF A;  4MOU A;  4U0G A;  3KTG A;  3IAV A;  4U0H A;  1JXZ A;  1UIY A;  4KNP A;  4OMR A;  3ST9 A;  3ZW9 A;  1Q51 A;  3T3W A;  2J5G A;  1OD2 A;  1FC9 A;  4DI1 A;  2UZF A;  3NJB A;  4RYF A;  2J5I A;  4F47 A;  1SG4 A;  3GF3 A;  2PBP A;  2X24 A;  3WG5 A;  3LKE A;  5INF A;  3T88 A;  2HW5 A;  3R6H A;  3PZK A;  4FB8 A;  5DKP A;  2CE3 A;  2Q2X A;  2F6Q A;  2A81 A;  4G2R A;  2ZL2 A;  3HP0 A;  3TVW A;  5ING A;  3DJA A;  4JSB A;  3KTI A;  3RST A;  2VSS F;  2ZQR A;  5DU6 A;  4B3J A;  1N6F A;  4GHN A;  1O8U A;  4EML A;  3NJD A;  1RJM A;  3ZWB A;  1K39 A;  1HNU A;  4I52 A;  3R9S A;  4JWV A;  3M6M A;  2DUB A;  1Y7O A;  3QYR A;  3Q0G A;  3ZWC A;  1EF8 A;  2F9I B;  2NP9 A;  1WDK A;  4QII A;  4U0G H;  2Q35 A;  3FDU A;  2VSU C;  3H81 A;  3KQF A;  3R9T A;  3RSI A;  3SWX A;  4HC8 A;  3H0J A;  4JCT A;  3PEA A;  4RYF H;  2BZR A; 
#chains in the Genus database with same CATH topology
 2ZQQ A;  2F9Y B;  2WTB A;  3H0S A;  2FZS A;  2F6I A;  4FZW C;  5DUC A;  2GTR A;  3LAO A;  1SZO A;  4YLH A;  5DL1 A;  3QMJ A;  3KTJ A;  2ZL3 A;  5C9G A;  5C90 A;  3OME A;  1K32 A;  2Q34 A;  4KWB A;  3P5M A;  3BPP A;  3N6R B;  4KD6 A;  2J5G D;  3P85 A;  4ZDE A;  3HRX A;  4JVT A;  1YG8 A;  5DZK A;  4JYL A;  1XNY A;  2X58 A;  3P2L A;  4EMM A;  5IKL B;  1XNW A;  3QK8 A;  2F9Y A;  1RJN A;  2J5I I;  1PIX A;  3BEZ A;  1PJH A;  3TLF A;  4QIJ A;  3R0O A;  4HDT A;  4K2N A;  3RRV A;  3K8X A;  2C8T A;  5JBX A;  3V5I A;  3FF6 A;  3I47 A;  4ZDC A;  4L6W A;  4WCZ A;  5DUF A;  3TT6 A;  3V5E A;  1X0U A;  4RCN A;  2VSU A;  4OG1 A;  2VX2 A;  4B3I A;  3QRE A;  1NZY A;  2IEX A;  3DOR A;  5JBW A;  4FND A;  5HUQ A;  2PG8 A;  4JJT A;  1MJ3 A;  3OC7 A;  2PPY A;  3HE2 A;  4JOT A;  4WYO B;  4I4Z A;  2A7S A;  3GMA A;  3GKB A;  3ISA A;  4FJW D;  3MYB A;  5G1Q A;  3QXI A;  4FZW A;  4FN8 A;  5KJP A;  4KPK A;  4Q1I A;  3KTH A;  5DZK H;  3T8A A;  2DEO A;  5G1R A;  1XX4 A;  3T89 A;  5DTP A;  3L3S A;  1DUB A;  3GLM A;  1HZD A;  4JCQ A;  2J5S A;  1ON9 A;  3PE8 A;  2VSU E;  4I42 A;  4IZD A;  4ASI A;  1TG6 A;  4LK5 A;  4NNQ A;  2QQ3 A;  1YG6 A;  1FC7 A;  3STA A;  4MI2 A;  1DCI A;  2J5I B;  4EMP A;  3Q7H A;  4B3H A;  4U18 A;  3VIV A;  3IB9 A;  1FCF A;  2F9I A;  3TZ3 A;  1WZ8 A;  3U9T B;  5E0N X;  1OD4 A;  5G1S A;  1UYS A;  1W2X A;  3Q1T A;  2ZL4 A;  4OLQ A;  3MFM A;  4FNB A;  5FIF A;  4HNK A;  1Q52 A;  3Q0J A;  3ZW8 A;  5FUS A;  4ELS A;  3K50 A;  1VRG A;  1UYV A;  4U19 A;  4JFC A;  2A7K A;  4IZC A;  3H0U A;  2VSU F;  4FN7 A;  4L8K A;  3H02 A;  4ELX A;  1UYT A;  3G64 A;  4IZB A;  3TVU A;  5INI A;  4Q0G A;  3IBB A;  3BF0 A;  4WZ8 B;  3U9R B;  1XNV A;  4ZDB A;  5MGB A;  2EJ5 A;  4Z0M A;  3SLL A;  4JCS A;  3TT7 A;  3M6N A;  2VSS A;  3JU1 A;  4ELW A;  4K29 A;  3QKA A;  5DU8 A;  3OT6 A;  5E0S A;  5KDR B;  3QXZ A;  1WDM A;  3KTK A;  1UYR A;  4U1A A;  2FW2 A;  1FC6 A;  3ZWA A;  4MXI A;  2D3T A;  2FBM A;  3TV5 A;  2CBY A;  2W3P A;  4J2U A;  4ZDD A;  1EY3 A;  2VRE A;  1N6D A;  3TDC A;  3U9S B;  5CTB A;  3R9Q A;  3HLN 1;  3PGQ A;  3MOY A;  1HNO A;  4GM2 A;  3TRR A;  1N6E A;  3MT6 A;  4JYJ A;  3HIN A;  4JCR A;  2VSS E;  3H0Q A;  1WDL A;  4K3W A;  5CTC A;  4ZU2 A;  1ON3 A;  5KDR A;  1EF9 A;  1TYF A;  1NZY B;  3T8B A;  5DTW A;  4QFE A;  5E0S H;  3GF7 A;  4NAR A;  5DU4 A;  4NEK A;  3QWD A;  2ZL0 A;  1XO6 A;  1J7X A;  4ZDF A;  4MOU A;  4U0G A;  3BPT A;  3KTG A;  3IAV A;  4U0H A;  1JXZ A;  1UIY A;  4KNP A;  4OMR A;  3ST9 A;  3ZW9 A;  1Q51 A;  3T3W A;  2J5G A;  1OD2 A;  1FC9 A;  4DI1 A;  2UZF A;  3NJB A;  4RYF A;  2J5I A;  4F47 A;  1SG4 A;  3GF3 A;  2PBP A;  2X24 A;  3WG5 A;  3LKE A;  5INF A;  3T88 A;  2HW5 A;  3R6H A;  3PZK A;  4FB8 A;  5DKP A;  2CE3 A;  2Q2X A;  2F6Q A;  2A81 A;  4G2R A;  2ZL2 A;  3HP0 A;  3TVW A;  5ING A;  3DJA A;  4JSB A;  3KTI A;  3RST A;  2VSS F;  2ZQR A;  5DU6 A;  4B3J A;  1N6F A;  4GHN A;  1O8U A;  4EML A;  3NJD A;  1RJM A;  3ZWB A;  1K39 A;  1HNU A;  4I52 A;  3R9S A;  4JWV A;  3M6M A;  2DUB A;  1Y7O A;  3QYR A;  3Q0G A;  3ZWC A;  1EF8 A;  2F9I B;  2NP9 A;  1WDK A;  4QII A;  4U0G H;  2Q35 A;  3FDU A;  2VSU C;  3H81 A;  3KQF A;  3R9T A;  3RSI A;  3SWX A;  4HC8 A;  3H0J A;  4JCT A;  2YJG A;  3PEA A;  4RYF H;  2BZR A; 
#chains in the Genus database with same CATH homology
 2ZQQ A;  2F9Y B;  2WTB A;  3H0S A;  2FZS A;  2F6I A;  4FZW C;  5DUC A;  2GTR A;  3LAO A;  1SZO A;  4YLH A;  5DL1 A;  3QMJ A;  3KTJ A;  2ZL3 A;  5C9G A;  5C90 A;  3OME A;  1K32 A;  2Q34 A;  4KWB A;  3P5M A;  3BPP A;  3N6R B;  4KD6 A;  2J5G D;  3P85 A;  4ZDE A;  3HRX A;  4JVT A;  1YG8 A;  5DZK A;  4JYL A;  1XNY A;  2X58 A;  3P2L A;  4EMM A;  5IKL B;  1XNW A;  3QK8 A;  2F9Y A;  1RJN A;  2J5I I;  1PIX A;  3BEZ A;  1PJH A;  3TLF A;  4QIJ A;  3R0O A;  4HDT A;  4K2N A;  3RRV A;  3K8X A;  2C8T A;  5JBX A;  3V5I A;  3FF6 A;  3I47 A;  4ZDC A;  4L6W A;  4WCZ A;  5DUF A;  3TT6 A;  3V5E A;  1X0U A;  4RCN A;  2VSU A;  4OG1 A;  2VX2 A;  4B3I A;  3QRE A;  1NZY A;  2IEX A;  3DOR A;  5JBW A;  4FND A;  5HUQ A;  2PG8 A;  4JJT A;  1MJ3 A;  3OC7 A;  2PPY A;  3HE2 A;  4JOT A;  4WYO B;  4I4Z A;  2A7S A;  3GMA A;  3GKB A;  3ISA A;  4FJW D;  3MYB A;  5G1Q A;  3QXI A;  4FZW A;  4FN8 A;  5KJP A;  4KPK A;  4Q1I A;  3KTH A;  5DZK H;  3T8A A;  2DEO A;  5G1R A;  1XX4 A;  3T89 A;  5DTP A;  3L3S A;  1DUB A;  3GLM A;  1HZD A;  4JCQ A;  2J5S A;  1ON9 A;  3PE8 A;  2VSU E;  4I42 A;  4IZD A;  4ASI A;  1TG6 A;  4LK5 A;  4NNQ A;  2QQ3 A;  1YG6 A;  1FC7 A;  3STA A;  4MI2 A;  1DCI A;  2J5I B;  4EMP A;  3Q7H A;  4B3H A;  4U18 A;  3VIV A;  3IB9 A;  1FCF A;  2F9I A;  3TZ3 A;  1WZ8 A;  3U9T B;  5E0N X;  1OD4 A;  5G1S A;  1UYS A;  1W2X A;  3Q1T A;  2ZL4 A;  4OLQ A;  3MFM A;  4FNB A;  5FIF A;  4HNK A;  1Q52 A;  3Q0J A;  3ZW8 A;  5FUS A;  4ELS A;  3K50 A;  1VRG A;  1UYV A;  4U19 A;  4JFC A;  2A7K A;  4IZC A;  3H0U A;  2VSU F;  4FN7 A;  4L8K A;  3H02 A;  4ELX A;  1UYT A;  3G64 A;  4IZB A;  3TVU A;  5INI A;  4Q0G A;  3IBB A;  3BF0 A;  4WZ8 B;  3U9R B;  1XNV A;  4ZDB A;  5MGB A;  2EJ5 A;  4Z0M A;  3SLL A;  4JCS A;  3TT7 A;  3M6N A;  2VSS A;  3JU1 A;  4ELW A;  4K29 A;  3QKA A;  5DU8 A;  3OT6 A;  5E0S A;  5KDR B;  3QXZ A;  1WDM A;  3KTK A;  1UYR A;  4U1A A;  2FW2 A;  1FC6 A;  3ZWA A;  4MXI A;  2D3T A;  2FBM A;  3TV5 A;  2CBY A;  2W3P A;  4J2U A;  4ZDD A;  1EY3 A;  2VRE A;  1N6D A;  3TDC A;  3U9S B;  5CTB A;  3R9Q A;  3HLN 1;  3PGQ A;  3MOY A;  1HNO A;  4GM2 A;  3TRR A;  1N6E A;  3MT6 A;  4JYJ A;  3HIN A;  4JCR A;  2VSS E;  3H0Q A;  1WDL A;  4K3W A;  5CTC A;  4ZU2 A;  1ON3 A;  5KDR A;  1EF9 A;  1TYF A;  1NZY B;  3T8B A;  5DTW A;  4QFE A;  5E0S H;  3GF7 A;  4NAR A;  5DU4 A;  4NEK A;  3QWD A;  2ZL0 A;  1XO6 A;  1J7X A;  4ZDF A;  4MOU A;  4U0G A;  3BPT A;  3KTG A;  3IAV A;  4U0H A;  1JXZ A;  1UIY A;  4KNP A;  4OMR A;  3ST9 A;  3ZW9 A;  1Q51 A;  3T3W A;  2J5G A;  1OD2 A;  1FC9 A;  4DI1 A;  2UZF A;  3NJB A;  4RYF A;  2J5I A;  4F47 A;  1SG4 A;  3GF3 A;  2PBP A;  2X24 A;  3WG5 A;  3LKE A;  5INF A;  3T88 A;  2HW5 A;  3R6H A;  3PZK A;  4FB8 A;  5DKP A;  2CE3 A;  2Q2X A;  2F6Q A;  2A81 A;  4G2R A;  2ZL2 A;  3HP0 A;  3TVW A;  5ING A;  3DJA A;  4JSB A;  3KTI A;  3RST A;  2VSS F;  2ZQR A;  5DU6 A;  4B3J A;  1N6F A;  4GHN A;  1O8U A;  4EML A;  3NJD A;  1RJM A;  3ZWB A;  1K39 A;  1HNU A;  4I52 A;  3R9S A;  4JWV A;  3M6M A;  2DUB A;  1Y7O A;  3QYR A;  3Q0G A;  3ZWC A;  1EF8 A;  2F9I B;  2NP9 A;  1WDK A;  4QII A;  4U0G H;  2Q35 A;  3FDU A;  2VSU C;  3H81 A;  3KQF A;  3R9T A;  3RSI A;  3SWX A;  4HC8 A;  3H0J A;  4JCT A;  2YJG A;  3PEA A;  4RYF H;  2BZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...