3T8RA

Crystal structure of staphylococcus aureus cymr
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
126
structure length
122
Chain Sequence
STKGRYGLTLMISLAKKEGQGCISLKSIAEENNLSDLYLEQLVGPLRNAGLIRSVRGAKGGYQLRVPAEEISAGDIIRLLEGPESIESEPPAQKQLWIRMRDAVRDVLDNTTLKYLAEYVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcus aureus CymR
publication title Staphylococcus aureus CymR Is a New Thiol-based Oxidation-sensing Regulator of Stress Resistance and Oxidative Response.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Unknown function
total genus 43
structure length 122
sequence length 126
ec nomenclature
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02082 Rrf2 Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3t8rA00
1G4DA 2NNYA 2E7WA 2GXBA 2DI3A 3QAHA 2KKOA 2DK5A 3MAJA 2FBKA 1FYLA 5D5UB 2MD5A 2HEOA 4EJOA 2IVMA 3IRQA 3NRVA 4HA8A 1OYWA 2L3DA 3FXRA 2WTEA 1P4XA 1SD7A 3I4PA 1R5GA 2NNNA 3RIRA 1HSJA 1FLIA 4HBLA 3J7AO 5E17F 2O8XA 4G9YA 5K5RA 3V8KA 4AIKA 1R22A 1USSA 1K79A 3MZHA 1USTA 4HQEA 4EVIA 3TO9A 2KRFA 4UVAA 1O7LA 1W7PA 2EJRA 1BIBA 2D1VA 5JHUA 3I64A 3PQKA 2JT1A 3GFJA 2A5YB 3I5UA 2OBPA 2BE5F 3J80Z 2G7HA 3HTSB 3D5LA 2FBIA 5D4SA 1T98A 2IW5A 2HZTA 1YLFA 2DLLA 2LF7A 4MQ9F 1UB9A 4M6XA 4CHUA 1V4RA 4I09A 4FT8A 4N0BA 2V9VA 5HLHA 3HHHA 1I6XA 3DPTA 3FMSA 4ESBA 1QZZA 3QPHA 2ZO4A 1XSVA 3WE2A 3K1MA 1P92A 4AIJA 4K2EA 4L9JA 4HYEA 1FNNA 2OU2A 2XKOA 3DP7A 4H0EA 4ENNA 1H9TA 3QOPA 2RKHA 2CYYA 3ECHA 2RN7A 5DEQA 4MQVA 1IF1A 3P9IA 2JPBA 2YX7A 4A0ZA 2P8TA 5J8CA 2EV0A 2FEZA 2R3SA 4TV7A 3RJPA 1E17A 4ASNA 4A0YA 2DBBA 2F5CA 4EJTA 3JSPA 2QVOA 1IXRC 2PMHA 2IP2A 4M74A 1XCBA 2CSOA 3L9FA 2Q2EA 4R8HA 1GHCA 2CQKA 4L9VA 1XN7A 3KCCA 5H6RA 2OA4A 1R1TA 3GEZA 2DFIA 3JAMZ 3DF8A 5LLQA 2ESNA 4RB0A 1FC3A 4MGRA 5LEJA 3F8FA 3LQQA 5HS7A 3WODF 1R7JA 3TOBA 4BXUA 1J2XA 4AWXB 1R23A 4A6EA 2HFHA 4XLPF 5DYMA 4M9XA 3CUOA 3CUQA 2GIVA 1LB2A 4MHGA 5E8IA 1REPC 2BBYA 1B1BA 3HSRA 5FFXA 3HOTA 1B9NA 1XMAA 2XHKA 4KN4X 3TQNA 5TRDA 5E1XA 3WU0A 4KMFA 4UNOA 1BI1A 5ERIA 3IHUA 3E5QA 5HLIA 4HV6A 2FU4A 4BH9A 2GQQA 3QP5A 4HQMA 2AS5F 1FP2A 2CW0F 3ZMDA 1G3SA 5FLXK 2QM3A 2P7CB 2NS0A 2DT5A 5ICEA 1CF7A 1OYIA 3M1EA 1SAXA 4OIPF 1FWZA 2XAJA 3F6VA 4ENKA 1IAWA 4E70A 5L3FA 2RGVA 3TGNA 1H0MA 2ZMEB 2MC3A 5CVVA 1BIAA 1J5YA 3KEOA 4ENMA 2EFQA 2O03A 4HOBA 4PZJA 5CJ9A 4HZFA 3G3ZA 1B4AA 4Q47A 3O6BB 2FOKA 2FQ3A 3OV8A 2ZBKA 1JHHA 2FNAA 2OZ6A 5K1YA 1JHFA 2IA0A 2JRTA 1O3SA 5BS6A 4RB3C 1ON2A 2P5VA 2XAHA 4LLGF 1RUOA 2YU3A 2EFPA 1TLHB 1KU3A 1EH7A 5E20A 3N97A 3M8FA 3I0TA 3V4GA 3LA7A 2J5PA 5D5VB 1BN5A 4P96A 2LNBA 5L3BA 1L3LA 4KMUX 4KT5C 1O57A 2VE9A 4IVNA 2QBYB 2JSCA 3I59B 1U3EM 4HF2A 2P4WA 3KP5A 4LLNA 1F9NA 3KETA 3KP6A 5AIQA 1XCVA 5HDGA 4XSXF 1QNTA 4XLNF 5D6FA 4LK1F 3WU1B 4ENJA 3WGIA 3FF5A 1MJBA 3F8MA 2KIMA 2O0YA 2ISYA 4L0ZB 3SFZA 3RI4A 1Z7UA 2RVCA 2D2WA 3R0JA 1PDNC 5BOXA 4KIGA 2LDUA 3WE3A 3D0SA 3I54A 3ABTA 2XASA 1JXSA 3PFIA 4KN7X 3CUQB 2ZJ2A 2ADUA 3I58A 4N9HA 4OIOF 2BV6A 1MZBA 1DP7P 3P7NA 1WSUA 4WXHA 3N4MA 2DPDA 2XGXA 1HW2A 2DPUA 3I53A 4I7HA 5TJJA 5BQTA 2CG4A 3BZ6A 1T2KA 5ILSA 3VODA 3GFLA 3KP2A 2FE3A 1ZG5A 2VT3A 2Z9OA 4L0YB 2QZ8A 2STWA 1FX7A 2IA2A 3ZQ7A 3K0LA 4UUVA 4P9UA 1IN6A 4EGZA 1KU7A 5JI6A 2F5FA 1BI3A 3C3WA 3RKXA 3F8NA 2EV6A 5KVRA 3F6OA 4CO8A 4WXCA 5LHHA 2HQRA 1TBXA 4HX4A 4NB5A 1V3FA 4A6DA 2DAOA 1YFHA 4YG2F 2IT0A 3RPQA 1SD4A 2RDPA 2PLYA 4ZYEA 4HAMA 1BJAA 4RAZA 3E6CC 3Q5FA 3BPXA 4XSZF 3HRUA 3J81Z 1E2XA 2OAZA 3MQ0A 5ILUA 4G94A 2M8EA 2P5KA 3TOAA 2Z5UA 5FD6A 2M5WA 3HRSA 2EK5A 1WWXA 4B8XA 3BJ6A 3FXUA 2EFNA 5LHGA 4OOIA 3TKYA 2PEXA 1R58A 1YO5C 1KA8A 5ILVA 1K6OA 4RB2C 1D8KA 4A0XA 1MDMB 3B73A 5D5WB 1ZAOA 5LGNA 1HBXG 1MJ9A 5D4RA 4KNYA 1BBYA 6PAXA 3REOA 1XDUA 4HLYA 4Q48A 3IKVA 1UHWA 4FX4A 1DDNA 4EJWA 3WGHA 1QPMA 2HR3A 3IKTA 1QQIA 1G3TA 1AOYA 2MLGA 1IN7A 4RS8A 2WV0A 4WXDA 3IRRA 2PQ8A 5KK1A 1TQIA 3WTUC 3RYPA 1K7AA 3WTVC 4Y17A 3K1NA 1G3WA 4OIRF 2PI0A 3ZN0A 3SZTA 1G6NA 4I2OA 2ZXJA 2FSWA 4M71A 3Q9VA 2P5LC 2ZMEA 3MWMA 1BOAA 1XD7A 4AD9A 3MCZA 2YSRA 1T39A 4GYIA 3V7RA 3KZZA 3RTRA 2GA1A 2XAFA 2RV8A 4A5NA 1IRGA 4I0AA 4EMSA 5BMZA 2XUBA 1HW1A 1GVJA 3BOQA 1FSEA 3KLNA 4OMZA 5DD8A 1T6SA 3ZMVA 3M9AA 1OPCA 5D5XB 5BPIA 3JTHA 2DK8A 4MEXF 3JTGA 2ESHA 2VOOA 4EGYA 2E1NA 2VBWA 3VFZA 1FBQA 5DCFA 4WCGA 2X4HA 3KP3A 2BGCA 2DO7A 1YIOA 1XGOA 4QLCU 4A5MA 2A6HF 1U6GA 3ZMSA 2YR2A 2VBXA 5K5OA 4P55A 4Y13A 2QYOA 2QBYA 2K7LA 4ZZLA 3I59A 4R79A 3F8CA 5CLSA 1F5TA 1J7KA 1U5TA 3COAC 2GXGA 1L0OC 4IRHA 3ZMUA 4HX8A 5LRSA 1I5ZA 2L01A 3HSEA 2F2EA 2G9WA 1FP1D 2P7VB 4HF1A 1MKMA 1Z6RA 3BROA 2DW4A 5ICGA 3LA3A 1A04A 2FXAA 2HKOA 3VEPA 2Z33A 5DCMB 2HOEA 2D45A 4Q4ZF 1RI7A 1R1UA 3IWZA 3T0YA 1RNLA 1BC8C 5DV5A 2ETHA 4CZZA 3B02A 2A68F 3VB2A 1U78A 5FB2A 2H09A 3O2PE 3H92A 4QWQA 4GYGA 2XV4S 1FOKA 1H9GA 4A12A 2L02A 1P2FA 2M45A 2ZFWA 2H6BA 2IPQX 3FZVA 1OR7A 3E5UA 2UXNA 2A07F 2VOPA 1ZYRF 3FWEA 2ZKZA 4HDUA 1TNSA 2R7FA 4GGGA 4WX9A 1XGNA 2XVCA 1FY7A 5H20A 4M72A 3U2RA 3GW2A 3ERED 3RDIA 4LGWA 2Y48A 5D6EA 1HXDA 1SMTA 2QQAA 5IT9Z 3HUGA 3AAFA 4P5OA 2VODA 3HIFA 3L7WA 3BY6A 1MJAA 3HSFA 1XSXA 2HDCA 1Z05A 3EUHA 4ZZDA 4LLLA 4EM1A 1EH6A 3WTSC 3QPTA 2CFXA 2EB7A 3EDPA 4I98B 2L54A 2GZWA 4AIHA 1HKTA 5AONA 2VN2A 2XAGA 4UV8A 4G7OF 1ZGAA 1ZGJA 2QQ9A 5E18F 2BEOA 3ML6A 2BYVE 4LK0F 5L3CA 3ISPA 1IZ1A 5DUIA 3WTWC 2V79A 2QQBA 1U8RA 2MBFA 2JTVA 4BAYA 3TDZC 1HW5A 3DV8A 5LBQA 3L00A 1S7OA 1YW7A 1B6AA 2MH2A 3PQJA 5CYVA 3S2WA 3R0AA 3EYIA 2LSOA 2FA5A 1ZLKA 5CVJA 1FPQA 1XGMA 1MDMA 1ZHFA 1P4AA 3KZYA 1SD5A 3QU6A 5E8GA 4CGZA 1IN5A 1K78B 1LNWA 4AVPA 4RAYA 2D1HA 2O3FA 1HKQA 3W6KB 1J0RA 3R61A 2DTRA 1MD0A 1W5TA 1LDJA 2LKPA 3KFWX 4N9IA 2HGCA 1D8JA 5E1WA 5HS8A 4Y15A 3JSOA 1KU9A 4G6QA 1U5TB 3M7GA 2MH9A 1B9MA 3GZ6A 4RGRA 2A3SA 1PUEE 3FM3A 4KFCA 3GXOA 1YS6A 2W57A 4LB6B 3DKWA 1R00A 1SD6A 2XRNA 4M6YA 5J8FA 3QP6A 2ZCWA 2EA4A 1R1VA 5HVQC 3WTXC 2V6CA 4U7DA 2K02A 1I1GA 5F64A 2ELHA 3JAMK 2HKXA 3HTUA 4U0YA 1O3RA 4U0WA 1FYMA 2O6GE 3E6BA 5JR3A 2UZKA 2NAZA 1VTNC 1O3TA 3ELKA 5FFZA 4KDPA 4NHJA 1EH8A 3LWFA 4R1HA 4I01A 1AWCA 2IRFG 1LVAA 3T1BA 1S6LA 1R36A 5D8LB 3E97A 4LFUA 3RKWA 2JPCA 3U1DA 2M30A 1P4WA 2W24A 4PDKA 1WI9A 2EFWA 3H3ZA 2FNPA 5DD4A 1DUXC 3E6DA 4D0PA 3GF2A 4YFNF 4MNUA 3GFMA 4KIFA 1TW2A 1KYWA 3KE2A 5CVIA 1O3QA 1QBJA 5A2QK 3WGGA 2F5EA 5DDGA 4GO1A 3K1PA 5J6XA 1ODDA 2HTSA 3BJAA 2Q8KA 4HW0A 2P6TA 4L9TA 3ZPLA 3SZPA 5DCMA 3ZP5A 3FMQA 1F4KA 4U7BA 2MA3A 4IRIA 1Q1HA 3WTTC 1WQ2A 3EQLF 2A61A 5ICCA 1ZH5A 1IW7F 1ZG3A 3BP8A 2QUFA 3LQRA 3WTYC 1FT9A 4ZH4F 4F7ZA 2L4AA 1ZREA 1KQ9A 1IN8A 1FBSA 2NYXA 5IT3A 2PJPA 3LFKA 1SMYF 4BYYA 1CGPA 3E6MA 3KEQA 2A6EF 2ACJA 1PP8F 1S7AA 3JW4A 1ZRDA 1ZG1A 1QO0D 2VONA 4I02A 4KIBA 4GCVA 4BHBA 2OZUA 5F6FA 3HHGA 2QWWA 1UCRA 5FLXZ 2COMA 4KICA 3CUQC 4EM2A 4L5IA 3DXJF 2AXLA 1HKSA 4M9SA 2ZNYA 3E3VA 2YX4A 1FSHA 1GXPA 4HX7A 4RGSA 4UVCA 2KIUA 3O3KA 2FF4A 4KUMA 3GZ5A 2NRAC 1J59A 5F1RA 1S29A 4ZYHA 2Z3YA 3TDUC 5L3EA 3CDHA 4JBAA 2MLKA 1ZLJA 4BQAA 4Z2YA 1DPUA 3V8LA 1BC7C 2EV5A 3R6SA 1Z1DA 5FD5A 2VC0A 3V7SA 4OINF 3DFGA 2M1BA 3VOEA 5LHIA 3WTZA 4FX0A 3DPLC 2EWNA 1KYZA 4B09A 1RZ4A 1W4MA 4P9FA 5EEGA 4HF0A 4DQ2A 3GLXA 4YFKF 5FO5A 4IF4A 5DUKA 4LG0B 1K78A 3C18A 3OOPA 4WF2A 3T8RA 4IRGA 3P9CA 3BDDA 1YG2A 3SHFA 2PMUA 1FYKA 2EA2A 1YQAA 2VXZA 4UHTA 4PCQA 2CGPA 3SXYA 1HQCA 3T8TA 4YIIA 4I0BA 1RUNA 4XRFA 3CO6C 5ED4A 2K4JA 4Q5SF 3R60A 4ESFA 3QRFF 2V1UA 3CO7C 2J5OA 2HWVA 1S3JA 3R4KA 4NQWA 3WG9A 1SFEA 4HDVA 2JZYA 5HOOA 5LGTA 3KP4A 2CO5A 4EV0A 3HRMA 1IUYA 1XDSA 3F23A 5LGUA 5L3DA 3EETA 5L3GA 1ZARA 2E7XA 3P9KA 1G3YA 3LA2A 2OQGA 2P6SA 1YW9A 2C6YA 3J81K 3GVAA 2FMYA 3FX3A 5HDNA 5EEHA 1KGSA 4CXFA 1S8NA 4JQFA 4LD5A 4L5JA 4IXAA 2VC1A 2VT2A 3ABUA 1C0WA 1FZPB 4KA4A 4G7ZF 1ZRFA 1Z91A 2OQRA 3T5XA 1PP7U 4G6DA 2QENA 4MTDA 3LSTA 1Z9CA 2VE8A 3C7JA 1B59A 2O61A 1W7PD 1YS7A 4CICA 2PN6A 1ULYA 2OD5A 2H27A 2FRHA 2HYFA 1JE8A 4RGUA 4IPAA 3BPVA 3F21A 3KP7A 3IC7A 3HRTA 4EM0B 2FMLA 4IJAA 2GA2A 5HDKA 1Y0UA 2K4BA 1YW8A 3G73A 3MFKA 2GWRA 4UV9A 1STZA 3L09A 3KLOA 3C1DA 3SQNA 3CLOA 4UVBA 3CJNA 2KJCA 4U88A 2KJBA 3RYRA 1XGSA 4WWCA 5LRRA 2A69F 2EFOA 1YYVA 2KIFA 2UWMA 1W5SA 3E5XA 2XAQA 2ISZA 3GUDA 2UXXA 5ICFA 1HSTA 2W85A 2WC2A 3M8EA 1IRFA 5A2QZ 2LF8A 5E1ZB 4BHCA 2L4MA 3TO7A 4PGGA 1QGPA 3IL2A 1LEAA 2XROA 1W7PB 4UXNA 3ULQB 4FHTA 5K5QA 3V7CA 2HTJA 1U2WA 4RB1A 2IA1A 4LMYA 3TO6A 2H6CA 1TTYA 4EJVA 2VBYA 3ECOA 1LDKB 5LEKA 2QLZA 3U9GA 1D3YA 4YIFA 1YTYA 1FBUA 3J80K 1TNTA 4KYWA 3F22A 3K9TA 5FGMA 2M87A 5HLGA 2B0LA 2V1DA 1TQPA 4ESJA 2HQNA 4GXOA 1KQ0A 1KQ8A 3GFIA 3LAJA 1XSDA 2HYGD 3ZMZA 1D5VA 1LDDA 4EQQA 2G7UA 2XKPA 4BNCA 2STTA 2H94A 1LJ9A 4S05A 5AIPA 3FHZA 3FXQA 2Z99A 4RGXA 2WWYA 4OIQF 2PG4A 3MZYA 3F72A 2K86A 1T38A 1ZRCA 1BI0A 1SFXA 1R5HA 4LJZF 4LB5A 1LQ1A 3DEUA 3LAPA 1OYYA 1IN4A 5BPDA 3GYHX 4M9ZA 4IHSA 1UHMA 1UFMA 2PFBA 4G8XA 3Q9SA 2Y75A 5D8KB 2DQRA 4L18B 1O7FA 2W25A 4O3MA 3FMRA 3L2CA 4ZYGA 1OKRA 1XMKA 1EV7A 3HYIA 3V8JA 2XIGA 3RKYA 4CYDA 4MTEA 4ON0A 1TW3A 3QU3A 1Z6TA 1TQMA 3W6JB 4G7HF 4YFXF 2DU9A 4BHPA 1I1SA 2R7DA 4ETSA 3GX4X 3I71A 2TDXA 1T0FA 5CVRA 2DQLA 2E1CA 1I27A 2YPRA 4CDGA 4PGHA 2F5DA 3DQVC 3H3UA 4LG0A 1ON1A 1IXSB 1OMIA 3F8BA 1X3UA 1MGTA 1KU2A 4A2UA 1BM9A 2PBIA 2RC4A 4HLXA 4WK8F 3NQOA 3ROUA 3GO5A 3ZN1A 2IJLA 1J9IA 4JK1X 4U0VA 4OMYA 4ZYDA 3BWGA 4XBFA 2CWEA 4L9NA 5IT9K 4HV5A 5H6QA 5CVUA 2X0LA 4OU0A 4EJUA 1CF7B 4IHTA 5HS9A 1P6RA 4O5VA 3NEUA 1WRJA 3MEXA 4O6JA 2Y0MA 1ONVA 1BI2A 2GAUA 1XB4A 1F1ZA 4MEYF 2Q0OA 3GWZA 3HOSA 1DPRA 1GXQA 3IWFA 5JFRA 1ZN2A 5JVTA 2FBHA 1WKMA 4M73A 2RQPA 3EYYA 1QZYA 1SFUA 1IXCA 2V1XA 3RPUA 1JGSA 2W84A 3CTAA 3K2ZA 3FM5A 2VBZA 4S04A 1J75A 4DNCA 1LEBA 2HS5A 1U5TC 2RNJA 1NHAA 3K69A 1RIOH 3ZMTA 3F3XA 3BJOA 2ZNZA 2K27A
chains in the Genus database with same CATH superfamily
1G4DA 2NNYA 1V5GA 4NC7A 1FTTA 2E7WA 2GXBA 3L2QA 2TRTA 2DI3A 1X1AA 3QAHA 2ZSIB 4RMNA 2KKOA 2E1MB 5EZGA 4XRMA 2DK5A 3MAJA 2FBKA 4DW6A 1FYLA 2L9VA 2LP0A 4C2TA 5D5UB 2EIMH 4BXFA 2MD5A 2HEOA 2CQNA 2IVMA 2ME0A 4BKXA 4EJOA 3IRQA 4XOTA 3NRVA 5HLTA 4HA8A 1OYWA 2L3DA 3JCUC 2E5NA 4A3BJ 3FXRA 4E7JA 4RAGA 4L5EA 2WTEA 3VPRA 1P4XA 1SD7A 5C44J 4W1UA 3G4SI 1YRNA 3BR0A 3I4PA 3VDXA 2W4SA 2H8WA 4BGDA 1R5GA 2NNNA 3RIRA 3F0CA 1LE8A 3OYDA 3S8PA 1HSJA 2E36A 4LITA 2M9HA 3SJMA 1FLIA 4HBLA 1AA7A 3J7AO 3L2WA 3BG9A 3CP8A 5E17F 2O8XA 4G9YA 2X9DA 5K5RA 3V8KA 3A01A 3BR1A 3J7YJ 4CSWA 4AIKA 2XRLA 2CMPA 1R22A 1USSA 3HPHA 1K79A 3MZHA 4PK4A 1USTA 4NUBA 2ME6A 4Y4RA 4HQEA 3DLLF 4EVIA 3AL0C 2E1OA 4BY1J 3TO9A 2LK2A 3M07A 3JRHA 2KRFA 4UVAA 3MKZA 2GXAA 1O7LA 1MNDA 3H35A 1W7PA 2EJRA 1BIBA 2D1VA 5JHUA 1ACIA 3I64A 3KYLA 3PQKA 4YIRX 1EKEA 3AFHA 1X3WB 4IKFA 3H1CA 3LSMA 2JT1A 4A3GJ 3GFJA 2A5YB 3FIWA 3I5UA 2LFBA 4A3KJ 2R5YB 4W97A 3ERMA 2OBPA 3CJRB 1VQ9I 2VIXA 4CCLA 2BE5F 3EUHC 4PUSA 5HNFA 3ABKH 4PJJA 1Y6IA 3FK7A 3OYLA 3OOUA 2WY7Q 3J80Z 5DM6F 2G7HA 3H9QA 3HTSB 3D5LA 1JTXA 2FBIA 4DBRA 5D4SA 1T98A 2PMZN 3OYJA 2VXDA 2IW5A 2HZTA 1MSEC 1YLFA 2DLLA 2LF7A 4NC6A 4MQ9F 2JA5J 1UB9A 4IOCF 5IOYA 4FISA 4M6XA 1RKTA 1V4RA 4I09A 2E2HJ 4FT8A 4N0BA 2V9VA 5HLHA 4CHUA 2JA8J 1H8AC 3HHHA 1I6XA 4E7SA 3DPTA 5IYBJ 2HXIA 3FMSA 2XSDC 3W2VA 1QZZA 4ESBA 3RPUD 4BL0B 3QPHA 2ZO4A 1XSVA 3K1MA 3WE2A 1K61A 1P92A 4AIJA 4K2EA 4L9JA 3I56I 1WPKA 4HYEA 1NG6A 2XF7A 3PNYA 5GPCA 1FNNA 3K2AA 1QU3A 3H9JA 4FE4A 1HC8A 2OU2A 3OSFA 2HPMA 3S1RJ 2XKOA 1E0EA 1UG2A 3DP7A 3LNQA 4H0EA 4ENNA 1H9TA 2HDWA 3CCLI 3QOPA 2RKHA 1DU6A 3ZQIA 2CYYA 4PJ0C 3DBRB 3ECHA 2RN7A 2M34A 2JSPA 5DEQA 1ZGWA 4MQVA 2GM4A 2VJJA 1CQTA 2IBDA 1IF1A 2QA4I 3P9IA 1QHHD 2JPBA 1X19A 1MBFA 2YX7A 4A0ZA 3JR9A 1WCMJ 2P8TA 3BR5A 1HOMA 5J8CA 1FOWA 2EV0A 2F4OB 2FEZA 1OQYA 2R3SA 3H5NA 4TV7A 1G8XA 1LFPA 3BQZA 3A0BC 1MBJA 2DFHA 3RJPA 5EF6A 2LD5A 4ASNA 4A0YA 2DBBA 1E17A 2F5CA 2WBMA 4EJTA 3JSPA 2QVOA 4M3GA 3S15J 3CC4I 1IXRC 2PMHA 1OCOH 2IP2A 4M74A 1XCBA 2K9LA 3GTQJ 5IP7J 2CSOA 2W48A 3L9FA 2R7TA 3OIOA 2X1DA 2Q2EA 4R8HA 1GHCA 1Y8RB 2CQKA 2WAQA 1TT5B 1GV5A 1D0XA 3FKIJ 4L9VA 3RQIA 1XN7A 3KCCA 5H6RA 3OYNA 3I55I 3S3MA 3FDYA 1MBGA 2OA4A 4RAFA 4AU7A 3S93A 4FETA 2ZC2A 4E7HA 1R1TA 2F48A 3BZCA 3GEZA 3B6AA 2MFZA 2DFIA 3JAMZ 4N4NB 3K4NA 5CPRB 3SYTA 3DF8A 5LLQA 2ESNA 3E1SA 4RB0A 1FC3A 4MGRA 5LEJA 3F8FA 5F0CA 1QZEA 2HQ5A 3LQQA 4B4CA 5HS7A 3DKXA 3WODF 1R7JA 3VWBA 5F0HA 2M0MA 4DYCA 3TOBA 2LY9A 4BXUA 1O4XA 4A93J 1J2XA 5F08A 3N05A 4X1EA 1R23A 4A6EA 2FUG2 2HFHA 4AWXB 4F92B 4XLPF 4BJ6C 5DYMA 4M9XA 3CUOA 3CUQA 2GIVA 1LB2A 4MHGA 5E8IA 1QVUA 1REPC 2QF7A 2BBYA 1B1BA 3HSRA 2L5QA 5FFXA 3HOTA 1B9NA 1XMAA 2R4GA 3ZQFA 2ZJRF 1W36D 2XHKA 4KN4X 3TQNA 5TRDA 2LBFA 2HI3A 4X0GA 2IS6A 5E1XA 3WU0A 4KMFA 4UNOA 1BI1A 4JYKA 2XF5A 5ERIA 3DBLB 2M3AA 3S1MJ 3IHUA 4E4HA 3E5QA 5HLIA 4HV6A 2FU4A 1DGWY 4MFEA 4CYCB 4BH9A 1K4TA 3MVPA 1NTCA 2Z16A 4I6ZA 3K4BA 2DMUA 2GQQA 3QP5A 2CH0A 4HQMA 3FXLA 2AS5F 1FP2A 2JK3A 3G1OA 3CC2I 5BNGA 2CW0F 3TL4X 3ZMDA 1BW6A 4QPOA 3HOYJ 1G3SA 2DA4A 2QM3A 5FLXK 2P7CB 3UR3C 4BQNA 2NS0A 2DT5A 1TL8A 4IHWA 1A6QA 4HNTA 5ICEA 1CF7A 1JTYA 1T0FC 5IP6A 1OYIA 3AG3H 1D1AA 3M1EA 1SAXA 4B44A 4AM3A 3RSNA 2B7EA 1UZCA 4PSXA 4OIPF 1FWZA 2XAJA 2AQEA 5GADJ 4QSHA 2CUEA 3F6VA 4ENKA 1IAWA 2PJRA 4E70A 1WJDA 5L3FA 3GCMA 1JKPC 2RGVA 3TGNA 3FISA 1H0MA 2BOLA 2ZMEB 2Y30A 1G2HA 2MC3A 3V42A 5CVVA 1BIAA 1J5YA 3KEOA 3FHNA 1D1BA 2NXNB 2Y0SA 4ENMA 5IYDJ 2EFQA 1VQKI 2O03A 4HOBA 4PZJA 5CJ9A 4C3HJ 4HZFA 4XN3A 3G3ZA 2Q1ZB 3FXOA 1B4AA 2X48A 4Q47A 2VI6A 3O6BB 1XMXA 4Y33A 2DA3A 2Y31A 2FOKA 3NWTA 1WJCA 2FQ3A 1LUJB 3UNGC 3OV8A 1QRYA 2XPUA 3VYSB 2DODA 4JX4A 4BACA 2ZBKA 1JHHA 3G2BA 2FNAA 2OC6A 2OZ6A 2V7FA 5K1YA 1JHFA 1Y0NA 2HYJA 2IA0A 1MMGA 2JRTA 2O7OA 1O3SA 1XTAA 2CQXA 5BS6A 4RB3C 1ON2A 3SEQA 2P5VA 1WJBA 2XAHA 3OYAA 4LLGF 1RUOA 2YU3A 3LOCA 1KZHA 2EFPA 4E7IA 5KCMA 1TLHB 1R5ID 1KU3A 1EH7A 2FQ4A 4B48A 1WGXA 2KT0A 5E20A 3N97A 3M8FA 3GTJJ 3CDIA 3I0TA 1RPWA 3V4GA 3LA7A 4LIUA 2M4GA 2XPVA 3WU2C 3ZGKA 2J5PA 3F9KA 5D5VB 1DP3A 1BN5A 4P96A 4CH7A 1ETYA 2LNBA 5L3BA 4OAZA 2FX0A 1L3LA 4KMUX 4KT5C 2B63J 1O57A 3CLQA 3DU6A 2COBA 2VE9A 2GBYA 4DJAA 3ASOH 3G1MA 1SFKA 1VF9A 4IVNA 2QBYB 2JSCA 3PO3J 3I59B 1U3EM 3DEEA 4HF2A 2P4WA 3KP5A 4LLNA 3H3VK 1F9NA 3KETA 3UKGA 4A3JJ 2ID3A 3KP6A 5AIQA 1XCVA 5HDGA 4XSXF 1QNTA 4XLNF 5D6FA 2L7FP 4BY7J 3QYBA 4LK1F 4QTRA 3WU1B 1ITYA 1VNDA 5B3SH 4ENJA 2XPWA 4GDFA 4XLHA 2BZTA 2DJNA 4II2A 3LSIA 3WGIA 1T08B 1MJBA 3FF5A 3F8MA 2KIMA 3M4OJ 2O0YA 2ISYA 2F6CA 2E2JJ 3ESWB 4L0ZB 4O5VA 2KMUA 3SFZA 1M1EB 4CCJA 2H1KA 3A02A 4D5CA 1YOVB 5IP9J 3RI4A 1OCRH 3HGYA 2KLOA 5HNHA 1Z7UA 1Z21A 2RVCA 1D1CA 2D2WA 3R0JA 5IOZA 2CQQA 1DGRM 1PDNC 5BOXA 2R5YA 1WH5A 2KDZA 3GTKJ 1SC7A 1V5EA 4KIGA 2LDUA 3WE3A 2EIJH 3DEWA 3D0SA 3D5RC 1IJWC 4BJ5C 3ABMH 1Z0XA 3I54A 3ABTA 2XASA 3IUOA 2K9NA 5IPAA 1TP4A 1JXSA 1X1PA 3PFIA 1LFUP 1ETVA 2E60A 4KN7X 3CUQB 3JRDA 5E3OA 2ZJ2A 2WB1N 2X6WA 2ADUA 3I58A 4N9HA 3ZQCA 4OIOF 3OWTA 2PMZA 2BV6A 1MZBA 2LREA 1LVKA 1DP7P 3P7NA 1TWAJ 2HVSA 1WSUA 4ZTFA 4WXHA 4Z6YA 3N4MA 2DPDA 2KPMA 3TP0A 2R7OA 1SVLA 2XGXA 1SVOA 3K4CA 3QWLA 4IHYA 4XKWA 3OY9A 1HW2A 3G1LA 1A5JA 4BU2A 2DPUA 1Y1VJ 3I53A 2CUJA 4I7HA 5TJJA 5BQTA 2CG4A 3BZ6A 2W7NA 1T2KA 5ILSA 3VODA 2HOSA 1X1CA 4ABZA 4XRSG 3HEFA 3GFLA 3KP2A 2FE3A 1ZG5A 2IS2A 2VT3A 1IDYA 1BW5A 2Z9OA 2QEXI 4L0YB 4GRIA 2O9LA 2QZ8A 3BC8A 2DJIA 3LSKA 2STWA 2OUMA 1FX7A 2IA2A 2UV1A 3ZQ7A 3K0LA 4X6AJ 4UUVA 4P9UA 1IN6A 4EGZA 2K85A 1HA8A 1VQMI 3S1QJ 2QSFX 1H89C 2CJJA 2AHQA 1KU7A 2ZJQF 5JI6A 1QA6A 2F5FA 1BI3A 1R49A 3C3WA 1JUMA 3RKXA 1YJ9I 2X85A 3F8NA 4DYQA 2EV6A 2OV7A 5KVRA 3HOVJ 3F6OA 3TMOA 4CO8A 4WXCA 5LHHA 2HQRA 2LKXA 5J3LA 1TBXA 2EILH 2PJRB 3OR1C 4HX4A 2WADA 1V3FA 2OJED 4NB5A 4A6DA 2DAOA 2FOWA 1YFHA 2MD0A 4YG2F 4ZDPA 2IT0A 4A3CJ 3RPQA 1SD4A 5FKNA 2WAFA 1X2MA 2RDPA 3S3OA 3CMYA 4B3AA 2PLYA 2VQLA 5JLWA 4IX7A 4ZYEA 4HAMA 1BJAA 1YJNI 4RAZA 3E6CC 3Q5FA 3VSLA 3BPXA 1FMVA 4XSZF 3FBNB 3HRUA 3J81Z 1E2XA 3CP2A 4J19A 2OAZA 3MQ0A 2R93J 4U87A 1JKOC 5ILUA 1ETQA 1EF4A 4G94A 2M8EA 2P5KA 3TOAA 2Z5UA 5F27A 2EZIA 1T56A 2M5WA 3HRSA 3ZXSA 5FD6A 4XICA 2EK5A 1WWXA 2M8GX 4OAYA 4B8XA 3BJ6A 2NVQJ 3S2DJ 3FXUA 2EFNA 4C2UA 3GBGA 3AKZA 2DOFA 2RQQA 4XQFA 2IGNA 5J4VA 3SFIA 1B72A 2DA7A 3TW7A 2JA2A 1IC8A 1HLVA 5LHGA 3QOEA 4V19K 4OOIA 2NVYJ 3TKYA 3CCMI 1XG1A 2H8RA 2PEXA 1AU7A 1R58A 1YO5C 2EPFA 1KA8A 4II3A 5ILVA 4M6VA 2LYCA 2HVQA 1D8KA 4A0XA 4KITB 4RB2C 1K6OA 4Y7NJ 1MDMB 3B73A 4C2MJ 3Q3SA 5D5WB 1GT0C 1ZAOA 4H4KC 5LGNA 2KP6A 1HBXG 1MJ9A 3LMMA 5D4RA 4KNYA 1BBYA 3K70C 1S7EA 2YUSA 6PAXA 3REOA 1XDUA 4HLYA 4Q48A 3IKVA 1G59A 4CYCA 1Z77A 1UHWA 1Z7LA 2LRDA 4FX4A 3ABLH 4EJWA 1DDNA 2E71A 3WGHA 3IP4B 3PSIA 1QPMA 1SAUA 5LFAA 2HR3A 3IKTA 1MMDA 1QQIA 2DDAA 1G3TA 1AOYA 4A3FJ 5CQEA 3KEYA 3S1NJ 2MLGA 2CV1A 1IN7A 4RS8A 3OYGA 2W82A 3HOZJ 1PYVA 2CW7A 2BHZA 2WV0A 4WXDA 3IRRA 2PQ8A 5KK1A 3L2VA 3PNTA 1R71A 1TQIA 3WTUC 3RYPA 1K7AA 3WTVC 4Y17A 3K1NA 3DLAA 3Q0WA 1G3WA 4OIRF 2PI0A 2MW8A 1UELB 3ZN0A 2K3PA 3VYTB 3JRCA 3SZTA 5H2FC 1IV8A 1G6NA 2ZXIA 1OJLA 4I2OA 1MBKA 3CF5F 2JUGA 1D0YA 1NH3A 2ZXJA 2FSWA 3AG1H 4M71A 4DBQA 3Q9VA 1XX5A 2P5LC 2ZMEA 3MWMA 3RCOA 4BJTA 1SEUA 5E79C 1WVRA 1BOAA 3W2AA 2LY2A 2HXOA 1XD7A 2QCOA 4AD9A 3MCZA 2YSRA 1T39A 4GYIA 2ZFUA 3V7RA 3KZZA 4N4OB 1XC5A 3RTRA 1U9OA 2GA1A 2FJ1A 2XAFA 2RV8A 3IH3A 3GZNB 4A5NA 1IRGA 5M3FJ 4F3QA 2BY2A 4I0AA 1XS9A 4EMSA 5BMZA 4BBRJ 2XUBA 1HW1A 1GVJA 3BOQA 4RDUA 1FSEA 3KLNA 4OMZA 5DD8A 1T6SA 3ZMVA 1T8IA 3M9AA 4HG2A 2XDVA 3KYCB 2XGCA 1OPCA 5D5XB 4UB8C 3JTHA 5BPIA 1R4MB 2DK8A 2VLAA 5FRNA 1QVTA 4MEXF 1E3PA 3ZR8X 2ESHA 3LSJA 3S32A 3JTGA 2VOOA 3S2HJ 2NS7A 4EGYA 2YU9J 2BW3B 2E1NA 5B1BH 3VSKA 2VBWA 3VFZA 1FBQA 2F4IA 5DCFA 4XIDA 1ETKA 2Z2SB 2D5VA 3VYUB 4WCGA 3OYHA 2X4HA 1TWHJ 4V2GA 3KP3A 1P7IA 2WV1A 2BGCA 2DO7A 1YIOA 1XGOA 4M3EA 4QLCU 1MH4A 4A5MA 2E2IJ 1IUFA 1VI0A 1Q1VA 1IGNA 1VQ6I 2A6HF 2ELJA 1ZR2A 1U6GA 3ZMSA 2YR2A 2IXSA 2VBXA 5K5OA 2DYRH 4MLOA 1A35A 1VQ4I 4P55A 1MW7A 4Y13A 1HDPA 2QYOA 3Q0VA 2QBYA 2K7LA 4ZZLA 3I59A 4QPQA 4R79A 2L9RA 2F4MB 3W3CA 3F8CA 5CLSA 4DYRA 1F5TA 1UMQA 5C3EJ 1J7KA 2BHYA 2I8DA 3K7AJ 3TP3A 4XN0A 1U5TA 1OFCX 2R7ZJ 3COAC 2GXGA 1BJZA 1L0OC 4IRHA 3ZMUA 4HX8A 2KISA 2E1MC 2OF7A 5LRSA 2Y9ZA 4D9JA 3MZ8A 1V55H 2QGUA 3BT9A 1I5ZA 2L01A 3CCVI 3HSEA 2F2EA 2G9WA 2KFDA 1FP1D 3KPHA 2P7VB 3A0HC 4HF1A 5E3MA 3BROA 1MKMA 1Z6RA 2DW4A 5ICGA 3LA3A 1A04A 2FXAA 4BEHB 2HKOA 3VEPA 2DMTA 1QPIA 2Z33A 3FXMA 5DCMB 1OCZH 3D5SC 2HOEA 2YS9A 2IGOA 4XLAA 2D45A 4Q4ZF 1RI7A 1R1UA 4V2FA 3IWZA 1FJLA 4ZC3A 3DCFA 3T0YA 1RNLA 1BC8C 5DV5A 2ETHA 4CZZA 3S17J 1S5LC 2EH3A 3B02A 2A68F 3VB2A 4M3BA 1U78A 5J1UA 2XSJC 5FB2A 1OLTA 2H09A 3O2PE 2WA0A 3H92A 4QWQA 3DTIA 1VQ8I 1GUUA 5GTHC 1BR4A 2JUCA 3I4NJ 2ECBA 3CJQB 2NOGA 1YI2I 4GYGA 2XV4S 1FOKA 2RAEA 1H9GA 4A12A 2L02A 4F93B 1P2FA 2M45A 4YEJA 2ZFWA 2H6BA 5J4YA 2IPQX 2ZB9A 3FZVA 4DOZA 3PIOF 3OS2A 3L2RA 1OR7A 3E5UA 2UXNA 4CCNA 2A07F 2BY0A 1GDTA 2WB1A 2VOPA 1ZYRF 5J1YA 3BG6A 3FWEA 4G12A 3CZ6A 3MMYB 2ZKZA 4HDUA 3BCBA 1TNSA 2DMPA 2R7FA 2GLOA 3X2QH 4GGGA 2BY3A 2X51A 3ZRGA 4WX9A 3OYCA 1XGNA 2XVCA 3PO2J 4ZDOA 2JVGA 3TW6A 1FY7A 5H20A 4M72A 4KT6A 4A3LJ 5KNLA 1RKWA 4FTHA 5E3NA 2WY8Q 3U2RA 5J40A 3EPZA 3GW2A 4MIMA 3S16J 3ERED 2DN0A 3RDIA 1J09A 4LGWA 1N77A 2RNGA 3OYFA 4LOCA 2Y48A 3CQZJ 2KL4A 5D6EA 5FKLA 5F04A 1HXDA 1SMTA 2QQAA 3M8JA 5IT9Z 4XNFA 2O5RA 1HDDC 3HUGA 3AAFA 4P5OA 2BXZA 1YJWI 2VODA 3HIFA 3A1YA 3L7WA 3BY6A 1MJAA 3HSFA 1XSXA 5JVGF 2M2EA 1BR1A 5C4JJ 2HDCA 1RC9A 1Z05A 2VKHA 2EZKA 3JREA 4QIWN 5KAFC 3FBIB 3HDDA 3EUHA 4ZZDA 4RM3A 4LLLA 3GTMJ 2OCCH 3BTLA 4D7NA 1EH6A 4EM1A 5F1JA 3WTSC 3QPTA 3A2KA 2E19A 1P9QC 2CFXA 2EB7A 3EDPA 4I98B 4OWRB 2L54A 2GZWA 4AIHA 1HKTA 5AONA 2VN2A 2ECCA 2XAGA 4BQOA 3OIQA 1K83J 3H5AA 4UV8A 4BDYA 4XOPA 2QSGX 4G7OF 1ZGAA 4EEFG 1K4SA 1IG7A 4E6KG 1ZGJA 2QQ9A 5E18F 2VJ4A 1VQPI 1POGA 4AVZA 3PUFA 2BEOA 3ML6A 4UUSB 2BYVE 2XB5A 2DDBA 4LK0F 5L3CA 1YX5A 3ISPA 3DWLE 2A5WA 1A6IA 1IZ1A 5DUIA 3MKYB 3WTWC 4B3XA 4ZJZA 4A3IJ 3Q0UA 2V79A 3A03A 2QQBA 1U8RA 2MBFA 1MSFC 4ITVA 3RKQA 2JTVA 4BAYA 5FLVA 3TDZC 1TC3C 4A3EJ 3GMEA 1HW5A 3DV8A 5LBQA 1YITI 2MSYA 3L00A 1S7OA 1SVMA 1YW7A 1ERDA 1B6AA 2MH2A 3PQJA 5CYVA 3HC7A 1T95A 3MKLA 1X58A 3S2WA 3R0AA 3EYIA 2LSOA 2FA5A 1ZLKA 5CVJA 3DBHB 1D5YA 2B9SA 4XORA 2ELKA 1FPQA 1XGMA 4IO9F 1MDMA 1ZHFA 2Y2ZA 4XLCA 1I6HJ 1P4AA 2OPTA 1VQNI 2JA7J 2CU7A 3KZYA 4XMYA 3HB9A 1WI3A 1SD5A 2H1LA 3QU6A 1F36A 3HOXJ 1ENHA 1DQUA 1OISA 5E8GA 1LPQA 4CGZA 1IN5A 3PJRA 1K78B 1LNWA 4AVPA 1YE9A 2CW8A 3PSFA 2LOOA 4RAYA 2D1HA 2O3FA 1HKQA 3W6KB 1J0RA 4HSTA 3R61A 2ID6A 2KRHA 2DTRA 1MD0A 1W5TA 1W0TA 1LDJA 2LKPA 3KFWX 1MNEA 4N9IA 1N78A 2HGCA 2R7XA 1V54H 2AXTC 3L1PA 1IRZA 2KRCA 1FOYA 1D8JA 1JI8A 1MBHA 5E1WA 5HS8A 3HOUJ 4MFDA 4Y15A 4JX6A 3JSOA 2HNHA 1KU9A 4G6QA 1U5TB 2JJ7A 3M7GA 2MH9A 1B9MA 3GZ6A 4Y52J 4RGRA 1H88C 2A3SA 4ZDLA 1PUEE 1KONA 2XGEA 3FM3A 4UY8I 4XK4A 1NG7A 4NQWB 5GAGJ 2NOJB 4KFCA 3GXOA 1MMSA 1YS6A 5B5EC 2W57A 4LB6B 3DKWA 2CFOA 1R00A 1SD6A 3BTIA 9ANTA 4A69C 2AQFA 2LKSA 2XRNA 4XKBA 4M6YA 1PUFB 2IAIA 2DMNA 1JUSA 2VKEA 5J8FA 1GVDA 3JRIA 3MN2A 2HPIA 2VL8A 3QP6A 3EUKL 2ZCWA 4CZCA 3EUAA 3JRGA 2EA4A 1R1VA 2L7MP 5HVQC 3WTXC 3BLYA 2V6CA 5EYRA 4CUGA 4U7DA 2X6XA 2DA2A 2K02A 1I1GA 2EIKH 4YELA 5F64A 2ELHA 3WHCA 4IQJA 3JAMK 2HKXA 3HTUA 4U0YA 1O3RA 4U0WA 4A3DJ 1FYMA 2O6GE 3E6BA 5JR3A 2UZKA 4XL9A 2NAZA 1VTNC 1O3TA 3ELKA 1AHDP 5FFZA 3RZDJ 5K7FA 1FTZA 4KDPA 1D0ZA 1I3QJ 2HOTA 4NHJA 1EH8A 2CS3A 3LWFA 2EZLA 4R1HA 4I01A 1AWCA 2IRFG 1LVAA 5GAEJ 1GLNA 3T1BA 1S6LA 1R36A 3H0GJ 2R5ZB 5D8LB 3E97A 1JT6A 3U21A 3BTCA 4LFUA 3RKWA 1RR7A 2JPCA 3U1DA 2M30A 2BW3A 5F0FA 1P4WA 3HBLA 2OTLI 2W24A 4PDKA 1W36C 1WI9A 2EFWA 2EQRA 1FIPA 4XRSA 4RBOA 3H3ZA 3AL0B 2FNPA 5DD4A 1DUXC 3SDBA 3CC7I 1WJ5A 3E6DA 2JN6A 4AIDA 2Y9YA 1TZLA 5EG0B 4D0PA 4XR6A 1B8IB 3GF2A 2K40A 1IRXA 4IOAF 2L9SA 3CF2A 4YFNF 1RR8C 4MNUA 4UUTA 3HUGB 5M5YJ 3GFMA 2DA6A 4KIFA 3I4MJ 1TW2A 3E7LA 1X1BA 3H36A 1KYWA 2N8GA 3KE2A 2XGDA 2V26A 5CVIA 5GP9A 2Y69H 1VQLI 2QKLB 3HL2A 1O3QA 4DZJA 2G0EA 2K9QA 1QBJA 3HPGA 5A2QK 2O8KA 3WGGA 1I39A 1VQOI 5EGOB 2F5EA 3AG4H 4F55A 4GO1A 5DDGA 3K1PA 3M1CA 3CCSI 2MGQA 5J6XA 1BOBA 1ODDA 2HTSA 3OIPA 4UB6C 3BJAA 2Q8KA 2A6TA 3CCJI 4HW0A 2E34A 2IGKA 1W0UA 2EINH 2P6TA 1I3AA 4ZTJA 2PX9A 4BEHA 4YRVA 3CMAI 4L9TA 1WFXA 2VB6A 3SZPA 5DCMA 3ZPLA 4IEJA 3ZP5A 3FMQA 1F4KA 3M3YJ 2VJ5A 3KZIC 1VZ0A 4U7BA 2MA3A 1ZKGA 4A3MJ 2CV2A 4IRIA 2TCTA 1Q1HA 3WTTC 1WQ2A 2MYSA 1JKQC 3EQLF 4NBQA 5FKMA 1Y39A 5C4XJ 1MIJA 2A61A 5ICCA 1ZH5A 1K6YA 1IW7F 1ZG3A 3BP8A 2QUFA 3LQRA 5B1AH 2DOEA 1FT9A 3WTYC 4ZH4F 2OTJI 3LFUA 4F7ZA 3PL8A 2L4AA 3IAS2 1ZREA 4AUXA 1KQ9A 1IN8A 1FBSA 2NYXA 5IT3A 2PJPA 3BR2A 2VQGA 3LFKA 1SMYF 4BYYA 1CGPA 3E6MA 3OS1A 2DXIA 2K5CA 3KEQA 1U9NA 3CCEI 2A6EF 2ACJA 1NK2P 1PP8F 1S7AA 3JW4A 1ZRDA 1ZG1A 1QO0D 2VONA 2IEKA 3HKZA 4I02A 4KIBA 1OCPA 4GCVA 1ETXA 3OR2C 4Y3OA 4BHBA 3H0DA 3I9V2 4XLFA 2HU9A 2OZUA 4C9YA 4HPQA 3P5JA 4C3IJ 1TWGJ 5F6FA 3HHGA 4BDZA 2KZVA 1LKXA 5HODA 2QWWA 2JMWA 1UJ8A 1UCRA 4HNVA 5FLXZ 3H9GA 1E3HA 3QYFA 2COMA 4KICA 3CUQC 4NDLA 5M5XJ 4EM2A 5CKTA 3MKWB 1Z3XA 2ZXWH 4L5IA 3DXJF 1OR7C 4IQ4A 2AXLA 1HKSA 3BZKA 3BCAA 1EA3A 4M9SA 4B47A 4I99C 2ZNYA 3E3VA 5FLMJ 2YX4A 2NVTJ 1FSHA 1GXPA 5FROA 4HNUA 3KX2A 3JRBA 1VQ7I 4HX7A 4RGSA 4UVCA 3K4KA 2VPLA 2KIUA 3O3KA 1TWFJ 2FF4A 1P7JA 4KUMA 3LSPA 3GZ5A 4PJLA 2JVHA 5TGTA 2NRAC 2KZGA 1J59A 2A05A 2XF6A 3ONQA 5F1RA 1S29A 4MO7A 4ZYHA 4UUSA 2Z3YA 2I10A 3TDUC 2KDOA 5J47A 1DU0A 4AYBN 5L3EA 3ZOBA 3CDHA 4HSRA 4JBAA 1FOXA 1N75A 2MLKA 5J1RA 1AKHB 1ZLJA 2DT6A 4BQAA 3OL3A 3JRAA 4PFPA 4Z2YA 1DPUA 4IZZA 3V8LA 3S14J 3O8HA 4M3DA 1BC7C 4PFOA 2EV5A 5FKOA 1U8BA 4C3JJ 3R6SA 1Z1DA 5FD5A 2VC0A 3V7SA 4OINF 1BL0A 4DZPA 5M3MJ 3DFGA 2OCEA 5IYCJ 2M1BA 3VOEA 2MABA 5LHIA 3WTZA 1X1DA 4FX0A 3DPLC 5DM7F 3IH2A 1TWCJ 3KYDB 2EWNA 3H5RA 1KYZA 4B09A 1RZ4A 1W4MA 4LIVA 4P9FA 5EEGA 3GLLA 1X4OA 2LLKA 1ZTRA 4EATA 4HF0A 2F5VA 5B66C 4DQ2A 3QODA 3S3NA 3GLXA 2DA1A 4YFKF 5FO5A 2JQ7A 2NVXJ 2R7UA 4IF4A 5DUKA 4BE0A 1WH7A 4LG0B 2IS1A 1K78A 3AG2H 3C18A 5K7HA 3OOPA 1UAAA 4WF2A 1RESA 2HDDA 3BTJA 4IRGA 3T8RA 3P9CA 3BDDA 1YG2A 3MD2A 3SHFA 2PMUA 4RLFA 1ETWA 1FYKA 2VUMJ 2M0CA 2EA2A 1YQAA 2VXZA 1WJEA 3BG5A 3DPUA 4UHTA 1MBEA 1MMNA 4PCQA 4F91B 2CGPA 1NK3P 3SXYA 1FIAA 1HQCA 3T8TA 3PFYA 2VQCA 1MH3A 2LVSA 4YIIA 2CRGA 2XB0X 2GOMA 3LSGA 2R7RA 4I0BA 3TEDA 4AC0A 4XRFA 3CO6C 1RUNA 1X2NA 2LTPA 5ED4A 2K4JA 4Q5SF 3R60A 4ESFA 1EJ9A 4ZYAA 3QRFF 1Y1WJ 1R9TJ 2V1UA 2M7AA 3FXJA 5DTDA 2J5OA 2HWVA 3CO7C 3VYRB 1S3JA 2R7WA 2DTZA 4IHXA 3R4KA 1WJAA 3ASNH 3OL4A 3LSHA 4NQWA 3CCUI 1YHQI 4FASD 3GTPJ 3WG9A 1SFEA 2ZJPF 1IV6A 4HDVA 2JZYA 4XLEA 5HOOA 2DCEA 1R6RA 2VQHA 3A4CA 5LGTA 3KP4A 2CO5A 4EV0A 1PJRA 2LY1A 3HRMA 4RM2A 1PUFA 1IUYA 2NVUB 3QPLA 1Y56A 5EZHA 1XDSA 4ANJA 3F23A 5LGUA 5L3DA 3EETA 5TISC 5L3GA 1ZARA 3WHBA 5GTIC 3U1KA 2E7XA 3P9KA 1WHUA 2EBIA 1G3YA 3LA2A 1ZELA 1IDZA 2OQGA 2P6SA 4CA0A 1Y8QB 1YW9A 2L0KA 4KJZA 2C6YA 3J81K 5FJ8J 3GVAA 2FMYA 3PIPF 1SFOJ 3FX3A 2XAUA 5HDNA 5EEHA 1KGSA 5LD2C 4CXFA 1S8NA 2BVLA 1MMAA 2Z1DA 4JQFA 3CCQI 4LD5A 4L5JA 4IXAA 2R92J 2VC1A 2VT2A 3ABUA 1C0WA 1BR2A 4XKCA 1FZPB 4KA4A 3LSRA 4G7ZF 1ZRFA 1Z91A 2L7KA 2OQRA 3T5XA 1W1WE 5GPAA 1PP7U 4G6DA 2QENA 4MTDA 2WAEA 3HKZN 2M4KA 3HXLA 3W6VA 5JHFA 4D1QA 2R5ZA 2E35A 3QQAA 3LSTA 1Z9CA 2VE8A 4P1WA 3C7JA 3SEZA 1B59A 2O61A 1W7PD 3K4MA 1YS7A 4CICA 2LR8A 2PN6A 1ULYA 2OD5A 3JRFA 4BBSJ 3E0JB 2H27A 2FRHA 3OYEA 1JKRC 2HYFA 3OMYA 1JE8A 1JGGA 2IS4A 2DYSH 4G6TB 1LFBA 4BE2A 3CDLA 2CUFA 4IPAA 4RGUA 3BPVA 3F21A 2X1EA 4BXXJ 1IO2A 2ZXHA 3KP7A 5EG0A 1E3OC 3IC7A 3HRTA 3HOWJ 1GV2A 4E7KA 1B8IA 4EM0B 2FMLA 2GOXB 4IJAA 2GA2A 5HDKA 1Y0UA 3IV5A 2K4BA 1YW8A 3G73A 3MFKA 1WJFA 2GWRA 4UV9A 1STZA 1N25A 1YRNB 3L09A 2VKVA 1RETA 3BG7A 3KLOA 3ZQLA 3BR6A 3K6GA 3C1DA 3SDGA 3SQNA 2LMDA 3CLOA 4UVBA 3CJNA 2KJCA 1YX3A 1SANA 4U88A 3G71I 1LE8B 2KJBA 3RYRA 1XGSA 2ZSHB 4WWCA 3ZQQA 3OSGA 1ETOA 2A69F 5LRRA 2EFOA 2LG4A 5KHDA 1YYVA 2KIFA 3C2HA 2UWMA 1W5SA 4J00A 2L7ZA 3NAUA 2FD5A 3E5XA 2XAQA 2ISZA 3A01B 3GUDA 2UXXA 2QKMB 4RLQA 5ICFA 1HSTA 2W85A 5EGOA 2WC2A 3M8EA 1IRFA 5A2QZ 3G6EI 5GAHJ 2LF8A 4GFBA 5E1ZB 4BHCA 1T33A 2L4MA 3CCYA 2VPRA 3TO7A 3J7AY 4PGGA 2DFFA 1U0JA 1QGPA 4RA2A 3IL2A 3O8GA 1LEAA 4JX5A 5K7ZA 2XROA 4FCYA 5KAIC 2QSHX 1W7PB 2I5UA 4UXNA 1HF0A 3BG3A 4HEA2 2BVMA 3ULQB 3PUBA 3HM5A 4FHTA 3V7CA 5K5QA 1A31A 2V9KA 2HTJA 3B6CA 5IY5H 1U2WA 2E5ZA 2IA1A 3ZCOA 4RB1A 4LMYA 3TO6A 2P81A 2H6CA 2R7VA 1TTYA 4EJVA 2VBYA 3ECOA 1LDKB 1ZK8A 4FQGA 5LEKA 3OYKA 3OYIA 2QLZA 3U9GA 4J01A 1B72B 1Z3YA 1D3YA 4YIFA 2IGMA 4C30A 1YTYA 1FBUA 3J80K 2JRMA 1MNMC 3FXKA 3QPSA 1TNTA 4KYWA 3F22A 3DTEA 3K9TA 3D1NI 3K10A 3WG7H 5FGMA 5DS9A 2M87A 5HLGA 2B0LA 2V1DA 2KQRA 1TQPA 4ESJA 2HQNA 4GXOA 1KQ0A 1KQ8A 3GFIA 2X1CA 3LAJA 1XSDA 2K9SA 5CQGA 2HYGD 1JJ6C 1OCTC 3ZMZA 5M5WJ 1D5VA 2HQAA 1F43A 2BY1A 3K4JA 3GTGJ 2HVRA 1LDDA 4IL6C 4PJMA 4S0HB 3RQ4A 2KIQA 3HZJA 4EQQA 3CJTB 1QHGA 2DOAA 3K70D 1APLC 2CQ7A 2G7UA 3HJEA 4FE7A 1VQ5I 2XKPA 1JT0A 2HZDA 3KIOA 4BNCA 1JUPA 2V6EA 3J7ZI 2STTA 1XPXA 2H94A 1LJ9A 4S05A 5AIPA 3FHZA 3FXQA 2Z99A 4BS9A 2JWTA 4RGXA 4DIQA 2WWYA 1BA5A 2R0QC 4OIQF 2PG4A 3MZYA 3F72A 3CMEI 2VASA 2K86A 4F52A 2DA5A 2ICWG 3K4LA 1WZ2A 1T38A 4DGWB 1ZRCA 4BUPA 1OCCH 1BI0A 1SFXA 1R5HA 4LJZF 4CCKA 4LB5A 1LQ1A 3RZOJ 3DEUA 3LAPA 1OYYA 1A36A 1IN4A 3CESA 4XONA 3DTKA 5BPDA 3GYHX 1YIJI 4M9ZA 2WAQN 4IHSA 1UHMA 1UFMA 2PFBA 4G8XA 4IHVA 3W2WA 3Q9SA 4B43A 2Y75A 5D8KB 2DQRA 2Q2EB 2R7QA 4L18B 3OS0A 1O7FA 2LH9A 2W25A 4O3MA 3OYBA 4BQQA 3C2BA 1AKHA 1VFCA 3FMRA 1ZR4A 3SZGA 3L2CA 3NARA 3ZQHA 4ZYGA 3NWSA 3PM1A 4I76A 4AYBA 1OKRA 2MC4A 1XMKA 1EV7A 1ORKA 2W1OA 2CV0A 1UG0A 3QYEA 3HYIA 3V8JA 3TBIA 2XIGA 3RKYA 4CYDA 2NS8A 4NNJA 4MTEA 4ON0A 2JA6J 1TW3A 3QU3A 1Z67A 1Z6TA 4CCMA 1TQMA 3W6JB 4G7HF 4M3FA 4YFXF 2DU9A 4BHPA 3CD6I 1I1SA 2R7DA 4ETSA 3GX4X 3I71A 2XC7A 3GTLJ 2TDXA 1T0FA 1TT0A 1PVEA 1S72I 5CVRA 1FMWA 2ZMEC 2DQLA 2E1CA 1I27A 2VJIA 2YPRA 4D7MA 4CDGA 1S9HA 4PGHA 5EDNA 3BQYA 2F5DA 3DQVC 4E7ZA 3H3UA 2LBFB 4LG0A 1ON1A 1IXSB 1OMIA 3F8BA 1X3UA 3CCRI 3PNVA 1MGTA 2DT7B 1KU2A 2GIZA 2VKDA 4A2UA 1BM9A 2PBIA 1I50J 2RC4A 4HLXA 4LG3A 4WK8F 3C2GA 1FEXA 3I3LA 3NQOA 3ROUA 3GO5A 2M7BA 3ZN1A 2IJLA 2R7SA 3FK6A 4JOMA 1J9IA 4JK1X 4U0VA 4OMYA 1V5FA 4ZYDA 5FKKA 3BWGA 4HRIA 2KHMA 4XBFA 2CWEA 4L9NA 5IT9K 2L2OA 5E3LA 4HV5A 2BXYA 3FKJA 4XM3A 5H6QA 5CVUA 2MG4A 2X0LA 5JLXA 1UHSA 3L2UA 4OU0A 2X6YA 4EJUA 3HG9A 5EJCA 1W5CC 1CF7B 4IHTA 5HS9A 4XKVA 1P6RA 3BR3A 3IH4A 3HGGA 4JP0A 2LC2A 1WRJA 2EZHA 2RREA 3DU5A 3NEUA 3MEXA 4O6JA 3OYMA 2Y0MA 1ONVA 4KISA 1BI2A 2GAUA 4CCOA 2HOAA 2V4JC 1XB4A 1F1ZA 4MEYF 2Q0OA 3GWZA 1X4PA 3HOSA 1HCRA 1DPRA 1GXQA 3IWFA 5JFRA 1ZN2A 5JVTA 3GTOJ 2FBHA 1WKMA 4M73A 2K3FA 5FRMA 2RQPA 3EYYA 1QZYA 1SFUA 2L9NA 1IXCA 2Y0SN 2V1XA 2K9MA 2DFEA 4B1RA 2V1NA 1ZQ3P 2V9PA 2W00A 2UUZA 3RPUA 1JGSA 2DMQA 2W84A 3LL7A 3CTAA 3K2ZA 3FM5A 2VBZA 3ZQGA 4D5FA 4S04A 1R4NB 2P0WA 1J75A 4PSWA 1JJ8C 4DNCA 4E7LA 1LEBA 2CUZA 2HS5A 1U5TC 2RNJA 1NHAA 2QQ8A 1X3ZB 4NC8A 4PJNA 2AO9A 3K69A 1RIOH 3ZMTA 4BE1A 5EEAA 3F3XA 3BJOA 3IAM2 2ZNZA 3CMMA 2X6OA 1RRJA 3DKYA 2K27A
chains in the Genus database with same CATH topology
1G4DA 2NNYA 2E7WA 2GXBA 2DI3A 3QAHA 2KKOA 2DK5A 3MAJA 2FBKA 1FYLA 5D5UB 2MD5A 2HEOA 4EJOA 2IVMA 3IRQA 3NRVA 4HA8A 1OYWA 2L3DA 3FXRA 2WTEA 1P4XA 1SD7A 3I4PA 1R5GA 2NNNA 3RIRA 1HSJA 1FLIA 4HBLA 3J7AO 5E17F 2O8XA 4G9YA 5K5RA 3V8KA 4AIKA 1R22A 1USSA 1K79A 3MZHA 1USTA 4HQEA 4EVIA 3TO9A 2KRFA 4UVAA 1O7LA 1W7PA 2EJRA 1BIBA 2D1VA 5JHUA 3I64A 3PQKA 2JT1A 3GFJA 2A5YB 3I5UA 2OBPA 2BE5F 3J80Z 2G7HA 3HTSB 3D5LA 2FBIA 5D4SA 1T98A 2IW5A 2HZTA 1YLFA 2DLLA 2LF7A 4MQ9F 1UB9A 4M6XA 4CHUA 1V4RA 4I09A 4FT8A 4N0BA 2V9VA 5HLHA 3HHHA 1I6XA 3DPTA 3FMSA 4ESBA 1QZZA 3QPHA 2ZO4A 1XSVA 3WE2A 3K1MA 1P92A 4AIJA 4K2EA 4L9JA 4HYEA 1FNNA 2OU2A 2XKOA 3DP7A 4H0EA 4ENNA 1H9TA 3QOPA 2RKHA 2CYYA 3ECHA 2RN7A 5DEQA 4MQVA 1IF1A 3P9IA 2JPBA 2YX7A 4A0ZA 2P8TA 5J8CA 2EV0A 2FEZA 2R3SA 4TV7A 3RJPA 1E17A 4ASNA 4A0YA 2DBBA 2F5CA 4EJTA 3JSPA 2QVOA 1IXRC 2PMHA 2IP2A 4M74A 1XCBA 2CSOA 3L9FA 2Q2EA 4R8HA 1GHCA 2CQKA 4L9VA 1XN7A 3KCCA 5H6RA 2OA4A 1R1TA 3GEZA 2DFIA 3JAMZ 3DF8A 5LLQA 2ESNA 4RB0A 1FC3A 4MGRA 5LEJA 3F8FA 3LQQA 5HS7A 3WODF 1R7JA 3TOBA 4BXUA 1J2XA 4AWXB 1R23A 4A6EA 2HFHA 4XLPF 5DYMA 4M9XA 3CUOA 3CUQA 2GIVA 1LB2A 4MHGA 5E8IA 1REPC 2BBYA 1B1BA 3HSRA 5FFXA 3HOTA 1B9NA 1XMAA 2XHKA 4KN4X 3TQNA 5TRDA 5E1XA 3WU0A 4KMFA 4UNOA 1BI1A 5ERIA 3IHUA 3E5QA 5HLIA 4HV6A 2FU4A 4BH9A 2GQQA 3QP5A 4HQMA 2AS5F 1FP2A 2CW0F 3ZMDA 1G3SA 5FLXK 2QM3A 2P7CB 2NS0A 2DT5A 5ICEA 1CF7A 1OYIA 3M1EA 1SAXA 4OIPF 1FWZA 2XAJA 3F6VA 4ENKA 1IAWA 4E70A 5L3FA 2RGVA 3TGNA 1H0MA 2ZMEB 2MC3A 5CVVA 1BIAA 1J5YA 3KEOA 4ENMA 2EFQA 2O03A 4HOBA 4PZJA 5CJ9A 4HZFA 3G3ZA 1B4AA 4Q47A 3O6BB 2FOKA 2FQ3A 3OV8A 2ZBKA 1JHHA 2FNAA 2OZ6A 5K1YA 1JHFA 2IA0A 2JRTA 1O3SA 5BS6A 4RB3C 1ON2A 2P5VA 2XAHA 4LLGF 1RUOA 2YU3A 2EFPA 1TLHB 1KU3A 1EH7A 5E20A 3N97A 3M8FA 3I0TA 3V4GA 3LA7A 2J5PA 5D5VB 1BN5A 4P96A 2LNBA 5L3BA 1L3LA 4KMUX 4KT5C 1O57A 2VE9A 4IVNA 2QBYB 2JSCA 3I59B 1U3EM 4HF2A 2P4WA 3KP5A 4LLNA 1F9NA 3KETA 3KP6A 5AIQA 1XCVA 5HDGA 4XSXF 1QNTA 4XLNF 5D6FA 4LK1F 3WU1B 4ENJA 3WGIA 3FF5A 1MJBA 3F8MA 2KIMA 2O0YA 2ISYA 4L0ZB 3SFZA 3RI4A 1Z7UA 2RVCA 2D2WA 3R0JA 1PDNC 5BOXA 4KIGA 2LDUA 3WE3A 3D0SA 3I54A 3ABTA 2XASA 1JXSA 3PFIA 4KN7X 3CUQB 2ZJ2A 2ADUA 3I58A 4N9HA 4OIOF 2BV6A 1MZBA 1DP7P 3P7NA 1WSUA 4WXHA 3N4MA 2DPDA 2XGXA 1HW2A 2DPUA 3I53A 4I7HA 5TJJA 5BQTA 2CG4A 3BZ6A 1T2KA 5ILSA 3VODA 3GFLA 3KP2A 2FE3A 1ZG5A 2VT3A 2Z9OA 4L0YB 2QZ8A 2STWA 1FX7A 2IA2A 3ZQ7A 3K0LA 4UUVA 4P9UA 1IN6A 4EGZA 1KU7A 5JI6A 2F5FA 1BI3A 3C3WA 3RKXA 3F8NA 2EV6A 5KVRA 3F6OA 4CO8A 4WXCA 5LHHA 2HQRA 1TBXA 4HX4A 4NB5A 1V3FA 4A6DA 2DAOA 1YFHA 4YG2F 2IT0A 3RPQA 1SD4A 2RDPA 2PLYA 4ZYEA 4HAMA 1BJAA 4RAZA 3E6CC 3Q5FA 3BPXA 4XSZF 3HRUA 3J81Z 1E2XA 2OAZA 3MQ0A 5ILUA 4G94A 2M8EA 2P5KA 3TOAA 2Z5UA 5FD6A 2M5WA 3HRSA 2EK5A 1WWXA 4B8XA 3BJ6A 3FXUA 2EFNA 5LHGA 4OOIA 3TKYA 2PEXA 1R58A 1YO5C 1KA8A 5ILVA 1K6OA 4RB2C 1D8KA 4A0XA 1MDMB 3B73A 5D5WB 1ZAOA 5LGNA 1HBXG 1MJ9A 5D4RA 4KNYA 1BBYA 6PAXA 3REOA 1XDUA 4HLYA 4Q48A 3IKVA 1UHWA 4FX4A 1DDNA 4EJWA 3WGHA 1QPMA 2HR3A 3IKTA 1QQIA 1G3TA 1AOYA 2MLGA 1IN7A 4RS8A 2WV0A 4WXDA 3IRRA 2PQ8A 5KK1A 1TQIA 3WTUC 3RYPA 1K7AA 3WTVC 4Y17A 3K1NA 1G3WA 4OIRF 2PI0A 3ZN0A 3SZTA 1G6NA 4I2OA 2ZXJA 2FSWA 4M71A 3Q9VA 2P5LC 2ZMEA 3MWMA 1BOAA 1XD7A 4AD9A 3MCZA 2YSRA 1T39A 4GYIA 3V7RA 3KZZA 3RTRA 2GA1A 2XAFA 2RV8A 4A5NA 1IRGA 4I0AA 4EMSA 5BMZA 2XUBA 1HW1A 1GVJA 3BOQA 1FSEA 3KLNA 4OMZA 5DD8A 1T6SA 3ZMVA 3M9AA 1OPCA 5D5XB 5BPIA 3JTHA 2DK8A 4MEXF 3JTGA 2ESHA 2VOOA 4EGYA 2E1NA 2VBWA 3VFZA 1FBQA 5DCFA 4WCGA 2X4HA 3KP3A 2BGCA 2DO7A 1YIOA 1XGOA 4QLCU 4A5MA 2A6HF 1U6GA 3ZMSA 2YR2A 2VBXA 5K5OA 4P55A 4Y13A 2QYOA 2QBYA 2K7LA 4ZZLA 3I59A 4R79A 3F8CA 5CLSA 1F5TA 1J7KA 1U5TA 3COAC 2GXGA 1L0OC 4IRHA 3ZMUA 4HX8A 5LRSA 1I5ZA 2L01A 3HSEA 2F2EA 2G9WA 1FP1D 2P7VB 4HF1A 1MKMA 1Z6RA 3BROA 2DW4A 5ICGA 3LA3A 1A04A 2FXAA 2HKOA 3VEPA 2Z33A 5DCMB 2HOEA 2D45A 4Q4ZF 1RI7A 1R1UA 3IWZA 3T0YA 1RNLA 1BC8C 5DV5A 2ETHA 4CZZA 3B02A 2A68F 3VB2A 1U78A 5FB2A 2H09A 3O2PE 3H92A 4QWQA 4GYGA 2XV4S 1FOKA 1H9GA 4A12A 2L02A 1P2FA 2M45A 2ZFWA 2H6BA 2IPQX 3FZVA 1OR7A 3E5UA 2UXNA 2A07F 2VOPA 1ZYRF 3FWEA 2ZKZA 4HDUA 1TNSA 2R7FA 4GGGA 4WX9A 1XGNA 2XVCA 1FY7A 5H20A 4M72A 3U2RA 3GW2A 3ERED 3RDIA 4LGWA 2Y48A 5D6EA 1HXDA 1SMTA 2QQAA 5IT9Z 3HUGA 3AAFA 4P5OA 2VODA 3HIFA 3L7WA 3BY6A 1MJAA 3HSFA 1XSXA 2HDCA 1Z05A 3EUHA 4ZZDA 4LLLA 4EM1A 1EH6A 3WTSC 3QPTA 2CFXA 2EB7A 3EDPA 4I98B 2L54A 2GZWA 4AIHA 1HKTA 5AONA 2VN2A 2XAGA 4UV8A 4G7OF 1ZGAA 1ZGJA 2QQ9A 5E18F 2BEOA 3ML6A 2BYVE 4LK0F 5L3CA 3ISPA 1IZ1A 5DUIA 3WTWC 2V79A 2QQBA 1U8RA 2MBFA 2JTVA 4BAYA 3TDZC 1HW5A 3DV8A 5LBQA 3L00A 1S7OA 1YW7A 1B6AA 2MH2A 3PQJA 5CYVA 3S2WA 3R0AA 3EYIA 2LSOA 2FA5A 1ZLKA 5CVJA 1FPQA 1XGMA 1MDMA 1ZHFA 1P4AA 3KZYA 1SD5A 3QU6A 5E8GA 4CGZA 1IN5A 1K78B 1LNWA 4AVPA 4RAYA 2D1HA 2O3FA 1HKQA 3W6KB 1J0RA 3R61A 2DTRA 1MD0A 1W5TA 1LDJA 2LKPA 3KFWX 4N9IA 2HGCA 1D8JA 5E1WA 5HS8A 4Y15A 3JSOA 1KU9A 4G6QA 1U5TB 3M7GA 2MH9A 1B9MA 3GZ6A 4RGRA 2A3SA 1PUEE 3FM3A 4KFCA 3GXOA 1YS6A 2W57A 4LB6B 3DKWA 1R00A 1SD6A 2XRNA 4M6YA 5J8FA 3QP6A 2ZCWA 2EA4A 1R1VA 5HVQC 3WTXC 2V6CA 4U7DA 2K02A 1I1GA 5F64A 2ELHA 3JAMK 2HKXA 3HTUA 4U0YA 1O3RA 4U0WA 1FYMA 2O6GE 3E6BA 5JR3A 2UZKA 2NAZA 1VTNC 1O3TA 3ELKA 5FFZA 4KDPA 4NHJA 1EH8A 3LWFA 4R1HA 4I01A 1AWCA 2IRFG 1LVAA 3T1BA 1S6LA 1R36A 5D8LB 3E97A 4LFUA 3RKWA 2JPCA 3U1DA 2M30A 1P4WA 2W24A 4PDKA 1WI9A 2EFWA 3H3ZA 2FNPA 5DD4A 1DUXC 3E6DA 4D0PA 3GF2A 4YFNF 4MNUA 3GFMA 4KIFA 1TW2A 1KYWA 3KE2A 5CVIA 1O3QA 1QBJA 5A2QK 3WGGA 2F5EA 5DDGA 4GO1A 3K1PA 5J6XA 1ODDA 2HTSA 3BJAA 2Q8KA 4HW0A 2P6TA 4L9TA 3ZPLA 3SZPA 5DCMA 3ZP5A 3FMQA 1F4KA 4U7BA 2MA3A 4IRIA 1Q1HA 3WTTC 1WQ2A 3EQLF 2A61A 5ICCA 1ZH5A 1IW7F 1ZG3A 3BP8A 2QUFA 3LQRA 3WTYC 1FT9A 4ZH4F 4F7ZA 2L4AA 1ZREA 1KQ9A 1IN8A 1FBSA 2NYXA 5IT3A 2PJPA 3LFKA 1SMYF 4BYYA 1CGPA 3E6MA 3KEQA 2A6EF 2ACJA 1PP8F 1S7AA 3JW4A 1ZRDA 1ZG1A 1QO0D 2VONA 4I02A 4KIBA 4GCVA 4BHBA 2OZUA 5F6FA 3HHGA 2QWWA 1UCRA 5FLXZ 2COMA 4KICA 3CUQC 4EM2A 4L5IA 3DXJF 2AXLA 1HKSA 4M9SA 2ZNYA 3E3VA 2YX4A 1FSHA 1GXPA 4HX7A 4RGSA 4UVCA 2KIUA 3O3KA 2FF4A 4KUMA 3GZ5A 2NRAC 1J59A 5F1RA 1S29A 4ZYHA 2Z3YA 3TDUC 5L3EA 3CDHA 4JBAA 2MLKA 1ZLJA 4BQAA 4Z2YA 1DPUA 3V8LA 1BC7C 2EV5A 3R6SA 1Z1DA 5FD5A 2VC0A 3V7SA 4OINF 3DFGA 2M1BA 3VOEA 5LHIA 3WTZA 4FX0A 3DPLC 2EWNA 1KYZA 4B09A 1RZ4A 1W4MA 4P9FA 5EEGA 4HF0A 4DQ2A 3GLXA 4YFKF 5FO5A 4IF4A 5DUKA 4LG0B 1K78A 3C18A 3OOPA 4WF2A 3T8RA 4IRGA 3P9CA 3BDDA 1YG2A 3SHFA 2PMUA 1FYKA 2EA2A 1YQAA 2VXZA 4UHTA 4PCQA 2CGPA 3SXYA 1HQCA 3T8TA 4YIIA 4I0BA 1RUNA 4XRFA 3CO6C 5ED4A 2K4JA 4Q5SF 3R60A 4ESFA 3QRFF 2V1UA 3CO7C 2J5OA 2HWVA 1S3JA 3R4KA 4NQWA 3WG9A 1SFEA 4HDVA 2JZYA 5HOOA 5LGTA 3KP4A 2CO5A 4EV0A 3HRMA 1IUYA 1XDSA 3F23A 5LGUA 5L3DA 3EETA 5L3GA 1ZARA 2E7XA 3P9KA 1G3YA 3LA2A 2OQGA 2P6SA 1YW9A 2C6YA 3J81K 3GVAA 2FMYA 3FX3A 5HDNA 5EEHA 1KGSA 4CXFA 1S8NA 4JQFA 4LD5A 4L5JA 4IXAA 2VC1A 2VT2A 3ABUA 1C0WA 1FZPB 4KA4A 4G7ZF 1ZRFA 1Z91A 2OQRA 3T5XA 1PP7U 4G6DA 2QENA 4MTDA 3LSTA 1Z9CA 2VE8A 3C7JA 1B59A 2O61A 1W7PD 1YS7A 4CICA 2PN6A 1ULYA 2OD5A 2H27A 2FRHA 2HYFA 1JE8A 4RGUA 4IPAA 3BPVA 3F21A 3KP7A 3IC7A 3HRTA 4EM0B 2FMLA 4IJAA 2GA2A 5HDKA 1Y0UA 2K4BA 1YW8A 3G73A 3MFKA 2GWRA 4UV9A 1STZA 3L09A 3KLOA 3C1DA 3SQNA 3CLOA 4UVBA 3CJNA 2KJCA 4U88A 2KJBA 3RYRA 1XGSA 4WWCA 5LRRA 2A69F 2EFOA 1YYVA 2KIFA 2UWMA 1W5SA 3E5XA 2XAQA 2ISZA 3GUDA 2UXXA 5ICFA 1HSTA 2W85A 2WC2A 3M8EA 1IRFA 5A2QZ 2LF8A 5E1ZB 4BHCA 2L4MA 3TO7A 4PGGA 1QGPA 3IL2A 1LEAA 2XROA 1W7PB 4UXNA 3ULQB 4FHTA 5K5QA 3V7CA 2HTJA 1U2WA 4RB1A 2IA1A 4LMYA 3TO6A 2H6CA 1TTYA 4EJVA 2VBYA 3ECOA 1LDKB 5LEKA 2QLZA 3U9GA 1D3YA 4YIFA 1YTYA 1FBUA 3J80K 1TNTA 4KYWA 3F22A 3K9TA 5FGMA 2M87A 5HLGA 2B0LA 2V1DA 1TQPA 4ESJA 2HQNA 4GXOA 1KQ0A 1KQ8A 3GFIA 3LAJA 1XSDA 2HYGD 3ZMZA 1D5VA 1LDDA 4EQQA 2G7UA 2XKPA 4BNCA 2STTA 2H94A 1LJ9A 4S05A 5AIPA 3FHZA 3FXQA 2Z99A 4RGXA 2WWYA 4OIQF 2PG4A 3MZYA 3F72A 2K86A 1T38A 1ZRCA 1BI0A 1SFXA 1R5HA 4LJZF 4LB5A 1LQ1A 3DEUA 3LAPA 1OYYA 1IN4A 5BPDA 3GYHX 4M9ZA 4IHSA 1UHMA 1UFMA 2PFBA 4G8XA 3Q9SA 2Y75A 5D8KB 2DQRA 4L18B 1O7FA 2W25A 4O3MA 3FMRA 3L2CA 4ZYGA 1OKRA 1XMKA 1EV7A 3HYIA 3V8JA 2XIGA 3RKYA 4CYDA 4MTEA 4ON0A 1TW3A 3QU3A 1Z6TA 1TQMA 3W6JB 4G7HF 4YFXF 2DU9A 4BHPA 1I1SA 2R7DA 4ETSA 3GX4X 3I71A 2TDXA 1T0FA 5CVRA 2DQLA 2E1CA 1I27A 2YPRA 4CDGA 4PGHA 2F5DA 3DQVC 3H3UA 4LG0A 1ON1A 1IXSB 1OMIA 3F8BA 1X3UA 1MGTA 1KU2A 4A2UA 1BM9A 2PBIA 2RC4A 4HLXA 4WK8F 3NQOA 3ROUA 3GO5A 3ZN1A 2IJLA 1J9IA 4JK1X 4U0VA 4OMYA 4ZYDA 3BWGA 4XBFA 2CWEA 4L9NA 5IT9K 4HV5A 5H6QA 5CVUA 2X0LA 4OU0A 4EJUA 1CF7B 4IHTA 5HS9A 1P6RA 4O5VA 3NEUA 1WRJA 3MEXA 4O6JA 2Y0MA 1ONVA 1BI2A 2GAUA 1XB4A 1F1ZA 4MEYF 2Q0OA 3GWZA 3HOSA 1DPRA 1GXQA 3IWFA 5JFRA 1ZN2A 5JVTA 2FBHA 1WKMA 4M73A 2RQPA 3EYYA 1QZYA 1SFUA 1IXCA 2V1XA 3RPUA 1JGSA 2W84A 3CTAA 3K2ZA 3FM5A 2VBZA 4S04A 1J75A 4DNCA 1LEBA 2HS5A 1U5TC 2RNJA 1NHAA 3K69A 1RIOH 3ZMTA 3F3XA 3BJOA 2ZNZA 2K27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G4D A;  2NNY A;  2E7W A;  2GXB A;  2DI3 A;  3QAH A;  2KKO A;  2DK5 A;  3MAJ A;  2FBK A;  1FYL A;  5D5U B;  2MD5 A;  2HEO A;  4EJO A;  2IVM A;  3IRQ A;  3NRV A;  4HA8 A;  1OYW A;  2L3D A;  3FXR A;  2WTE A;  1P4X A;  1SD7 A;  3I4P A;  1R5G A;  2NNN A;  3RIR A;  1HSJ A;  1FLI A;  4HBL A;  3J7A O;  5E17 F;  2O8X A;  4G9Y A;  5K5R A;  3V8K A;  4AIK A;  1R22 A;  1USS A;  1K79 A;  3MZH A;  1UST A;  4HQE A;  4EVI A;  3TO9 A;  2KRF A;  4UVA A;  1O7L A;  1W7P A;  2EJR A;  1BIB A;  2D1V A;  5JHU A;  3I64 A;  3PQK A;  2JT1 A;  3GFJ A;  2A5Y B;  3I5U A;  2OBP A;  2BE5 F;  3J80 Z;  2G7H A;  3HTS B;  3D5L A;  2FBI A;  5D4S A;  1T98 A;  2IW5 A;  2HZT A;  1YLF A;  2DLL A;  2LF7 A;  4MQ9 F;  1UB9 A;  4M6X A;  4CHU A;  1V4R A;  4I09 A;  4FT8 A;  4N0B A;  2V9V A;  5HLH A;  3HHH A;  1I6X A;  3DPT A;  3FMS A;  4ESB A;  1QZZ A;  3QPH A;  2ZO4 A;  1XSV A;  3WE2 A;  3K1M A;  1P92 A;  4AIJ A;  4K2E A;  4L9J A;  4HYE A;  1FNN A;  2OU2 A;  2XKO A;  3DP7 A;  4H0E A;  4ENN A;  1H9T A;  3QOP A;  2RKH A;  2CYY A;  3ECH A;  2RN7 A;  5DEQ A;  4MQV A;  1IF1 A;  3P9I A;  2JPB A;  2YX7 A;  4A0Z A;  2P8T A;  5J8C A;  2EV0 A;  2FEZ A;  2R3S A;  4TV7 A;  3RJP A;  1E17 A;  4ASN A;  4A0Y A;  2DBB A;  2F5C A;  4EJT A;  3JSP A;  2QVO A;  1IXR C;  2PMH A;  2IP2 A;  4M74 A;  1XCB A;  2CSO A;  3L9F A;  2Q2E A;  4R8H A;  1GHC A;  2CQK A;  4L9V A;  1XN7 A;  3KCC A;  5H6R A;  2OA4 A;  1R1T A;  3GEZ A;  2DFI A;  3JAM Z;  3DF8 A;  5LLQ A;  2ESN A;  4RB0 A;  1FC3 A;  4MGR A;  5LEJ A;  3F8F A;  3LQQ A;  5HS7 A;  3WOD F;  1R7J A;  3TOB A;  4BXU A;  1J2X A;  4AWX B;  1R23 A;  4A6E A;  2HFH A;  4XLP F;  5DYM A;  4M9X A;  3CUO A;  3CUQ A;  2GIV A;  1LB2 A;  4MHG A;  5E8I A;  1REP C;  2BBY A;  1B1B A;  3HSR A;  5FFX A;  3HOT A;  1B9N A;  1XMA A;  2XHK A;  4KN4 X;  3TQN A;  5TRD A;  5E1X A;  3WU0 A;  4KMF A;  4UNO A;  1BI1 A;  5ERI A;  3IHU A;  3E5Q A;  5HLI A;  4HV6 A;  2FU4 A;  4BH9 A;  2GQQ A;  3QP5 A;  4HQM A;  2AS5 F;  1FP2 A;  2CW0 F;  3ZMD A;  1G3S A;  5FLX K;  2QM3 A;  2P7C B;  2NS0 A;  2DT5 A;  5ICE A;  1CF7 A;  1OYI A;  3M1E A;  1SAX A;  4OIP F;  1FWZ A;  2XAJ A;  3F6V A;  4ENK A;  1IAW A;  4E70 A;  5L3F A;  2RGV A;  3TGN A;  1H0M A;  2ZME B;  2MC3 A;  5CVV A;  1BIA A;  1J5Y A;  3KEO A;  4ENM A;  2EFQ A;  2O03 A;  4HOB A;  4PZJ A;  5CJ9 A;  4HZF A;  3G3Z A;  1B4A A;  4Q47 A;  3O6B B;  2FOK A;  2FQ3 A;  3OV8 A;  2ZBK A;  1JHH A;  2FNA A;  2OZ6 A;  5K1Y A;  1JHF A;  2IA0 A;  2JRT A;  1O3S A;  5BS6 A;  4RB3 C;  1ON2 A;  2P5V A;  2XAH A;  4LLG F;  1RUO A;  2YU3 A;  2EFP A;  1TLH B;  1KU3 A;  1EH7 A;  5E20 A;  3N97 A;  3M8F A;  3I0T A;  3V4G A;  3LA7 A;  2J5P A;  5D5V B;  1BN5 A;  4P96 A;  2LNB A;  5L3B A;  1L3L A;  4KMU X;  4KT5 C;  1O57 A;  2VE9 A;  4IVN A;  2QBY B;  2JSC A;  3I59 B;  1U3E M;  4HF2 A;  2P4W A;  3KP5 A;  4LLN A;  1F9N A;  3KET A;  3KP6 A;  5AIQ A;  1XCV A;  5HDG A;  4XSX F;  1QNT A;  4XLN F;  5D6F A;  4LK1 F;  3WU1 B;  4ENJ A;  3WGI A;  3FF5 A;  1MJB A;  3F8M A;  2KIM A;  2O0Y A;  2ISY A;  4L0Z B;  3SFZ A;  3RI4 A;  1Z7U A;  2RVC A;  2D2W A;  3R0J A;  1PDN C;  5BOX A;  4KIG A;  2LDU A;  3WE3 A;  3D0S A;  3I54 A;  3ABT A;  2XAS A;  1JXS A;  3PFI A;  4KN7 X;  3CUQ B;  2ZJ2 A;  2ADU A;  3I58 A;  4N9H A;  4OIO F;  2BV6 A;  1MZB A;  1DP7 P;  3P7N A;  1WSU A;  4WXH A;  3N4M A;  2DPD A;  2XGX A;  1HW2 A;  2DPU A;  3I53 A;  4I7H A;  5TJJ A;  5BQT A;  2CG4 A;  3BZ6 A;  1T2K A;  5ILS A;  3VOD A;  3GFL A;  3KP2 A;  2FE3 A;  1ZG5 A;  2VT3 A;  2Z9O A;  4L0Y B;  2QZ8 A;  2STW A;  1FX7 A;  2IA2 A;  3ZQ7 A;  3K0L A;  4UUV A;  4P9U A;  1IN6 A;  4EGZ A;  1KU7 A;  5JI6 A;  2F5F A;  1BI3 A;  3C3W A;  3RKX A;  3F8N A;  2EV6 A;  5KVR A;  3F6O A;  4CO8 A;  4WXC A;  5LHH A;  2HQR A;  1TBX A;  4HX4 A;  4NB5 A;  1V3F A;  4A6D A;  2DAO A;  1YFH A;  4YG2 F;  2IT0 A;  3RPQ A;  1SD4 A;  2RDP A;  2PLY A;  4ZYE A;  4HAM A;  1BJA A;  4RAZ A;  3E6C C;  3Q5F A;  3BPX A;  4XSZ F;  3HRU A;  3J81 Z;  1E2X A;  2OAZ A;  3MQ0 A;  5ILU A;  4G94 A;  2M8E A;  2P5K A;  3TOA A;  2Z5U A;  5FD6 A;  2M5W A;  3HRS A;  2EK5 A;  1WWX A;  4B8X A;  3BJ6 A;  3FXU A;  2EFN A;  5LHG A;  4OOI A;  3TKY A;  2PEX A;  1R58 A;  1YO5 C;  1KA8 A;  5ILV A;  1K6O A;  4RB2 C;  1D8K A;  4A0X A;  1MDM B;  3B73 A;  5D5W B;  1ZAO A;  5LGN A;  1HBX G;  1MJ9 A;  5D4R A;  4KNY A;  1BBY A;  6PAX A;  3REO A;  1XDU A;  4HLY A;  4Q48 A;  3IKV A;  1UHW A;  4FX4 A;  1DDN A;  4EJW A;  3WGH A;  1QPM A;  2HR3 A;  3IKT A;  1QQI A;  1G3T A;  1AOY A;  2MLG A;  1IN7 A;  4RS8 A;  2WV0 A;  4WXD A;  3IRR A;  2PQ8 A;  5KK1 A;  1TQI A;  3WTU C;  3RYP A;  1K7A A;  3WTV C;  4Y17 A;  3K1N A;  1G3W A;  4OIR F;  2PI0 A;  3ZN0 A;  3SZT A;  1G6N A;  4I2O A;  2ZXJ A;  2FSW A;  4M71 A;  3Q9V A;  2P5L C;  2ZME A;  3MWM A;  1BOA A;  1XD7 A;  4AD9 A;  3MCZ A;  2YSR A;  1T39 A;  4GYI A;  3V7R A;  3KZZ A;  3RTR A;  2GA1 A;  2XAF A;  2RV8 A;  4A5N A;  1IRG A;  4I0A A;  4EMS A;  5BMZ A;  2XUB A;  1HW1 A;  1GVJ A;  3BOQ A;  1FSE A;  3KLN A;  4OMZ A;  5DD8 A;  1T6S A;  3ZMV A;  3M9A A;  1OPC A;  5D5X B;  5BPI A;  3JTH A;  2DK8 A;  4MEX F;  3JTG A;  2ESH A;  2VOO A;  4EGY A;  2E1N A;  2VBW A;  3VFZ A;  1FBQ A;  5DCF A;  4WCG A;  2X4H A;  3KP3 A;  2BGC A;  2DO7 A;  1YIO A;  1XGO A;  4QLC U;  4A5M A;  2A6H F;  1U6G A;  3ZMS A;  2YR2 A;  2VBX A;  5K5O A;  4P55 A;  4Y13 A;  2QYO A;  2QBY A;  2K7L A;  4ZZL A;  3I59 A;  4R79 A;  3F8C A;  5CLS A;  1F5T A;  1J7K A;  1U5T A;  3COA C;  2GXG A;  1L0O C;  4IRH A;  3ZMU A;  4HX8 A;  5LRS A;  1I5Z A;  2L01 A;  3HSE A;  2F2E A;  2G9W A;  1FP1 D;  2P7V B;  4HF1 A;  1MKM A;  1Z6R A;  3BRO A;  2DW4 A;  5ICG A;  3LA3 A;  1A04 A;  2FXA A;  2HKO A;  3VEP A;  2Z33 A;  5DCM B;  2HOE A;  2D45 A;  4Q4Z F;  1RI7 A;  1R1U A;  3IWZ A;  3T0Y A;  1RNL A;  1BC8 C;  5DV5 A;  2ETH A;  4CZZ A;  3B02 A;  2A68 F;  3VB2 A;  1U78 A;  5FB2 A;  2H09 A;  3O2P E;  3H92 A;  4QWQ A;  4GYG A;  2XV4 S;  1FOK A;  1H9G A;  4A12 A;  2L02 A;  1P2F A;  2M45 A;  2ZFW A;  2H6B A;  2IPQ X;  3FZV A;  1OR7 A;  3E5U A;  2UXN A;  2A07 F;  2VOP A;  1ZYR F;  3FWE A;  2ZKZ A;  4HDU A;  1TNS A;  2R7F A;  4GGG A;  4WX9 A;  1XGN A;  2XVC A;  1FY7 A;  5H20 A;  4M72 A;  3U2R A;  3GW2 A;  3ERE D;  3RDI A;  4LGW A;  2Y48 A;  5D6E A;  1HXD A;  1SMT A;  2QQA A;  5IT9 Z;  3HUG A;  3AAF A;  4P5O A;  2VOD A;  3HIF A;  3L7W A;  3BY6 A;  1MJA A;  3HSF A;  1XSX A;  2HDC A;  1Z05 A;  3EUH A;  4ZZD A;  4LLL A;  4EM1 A;  1EH6 A;  3WTS C;  3QPT A;  2CFX A;  2EB7 A;  3EDP A;  4I98 B;  2L54 A;  2GZW A;  4AIH A;  1HKT A;  5AON A;  2VN2 A;  2XAG A;  4UV8 A;  4G7O F;  1ZGA A;  1ZGJ A;  2QQ9 A;  5E18 F;  2BEO A;  3ML6 A;  2BYV E;  4LK0 F;  5L3C A;  3ISP A;  1IZ1 A;  5DUI A;  3WTW C;  2V79 A;  2QQB A;  1U8R A;  2MBF A;  2JTV A;  4BAY A;  3TDZ C;  1HW5 A;  3DV8 A;  5LBQ A;  3L00 A;  1S7O A;  1YW7 A;  1B6A A;  2MH2 A;  3PQJ A;  5CYV A;  3S2W A;  3R0A A;  3EYI A;  2LSO A;  2FA5 A;  1ZLK A;  5CVJ A;  1FPQ A;  1XGM A;  1MDM A;  1ZHF A;  1P4A A;  3KZY A;  1SD5 A;  3QU6 A;  5E8G A;  4CGZ A;  1IN5 A;  1K78 B;  1LNW A;  4AVP A;  4RAY A;  2D1H A;  2O3F A;  1HKQ A;  3W6K B;  1J0R A;  3R61 A;  2DTR A;  1MD0 A;  1W5T A;  1LDJ A;  2LKP A;  3KFW X;  4N9I A;  2HGC A;  1D8J A;  5E1W A;  5HS8 A;  4Y15 A;  3JSO A;  1KU9 A;  4G6Q A;  1U5T B;  3M7G A;  2MH9 A;  1B9M A;  3GZ6 A;  4RGR A;  2A3S A;  1PUE E;  3FM3 A;  4KFC A;  3GXO A;  1YS6 A;  2W57 A;  4LB6 B;  3DKW A;  1R00 A;  1SD6 A;  2XRN A;  4M6Y A;  5J8F A;  3QP6 A;  2ZCW A;  2EA4 A;  1R1V A;  5HVQ C;  3WTX C;  2V6C A;  4U7D A;  2K02 A;  1I1G A;  5F64 A;  2ELH A;  3JAM K;  2HKX A;  3HTU A;  4U0Y A;  1O3R A;  4U0W A;  1FYM A;  2O6G E;  3E6B A;  5JR3 A;  2UZK A;  2NAZ A;  1VTN C;  1O3T A;  3ELK A;  5FFZ A;  4KDP A;  4NHJ A;  1EH8 A;  3LWF A;  4R1H A;  4I01 A;  1AWC A;  2IRF G;  1LVA A;  3T1B A;  1S6L A;  1R36 A;  5D8L B;  3E97 A;  4LFU A;  3RKW A;  2JPC A;  3U1D A;  2M30 A;  1P4W A;  2W24 A;  4PDK A;  1WI9 A;  2EFW A;  3H3Z A;  2FNP A;  5DD4 A;  1DUX C;  3E6D A;  4D0P A;  3GF2 A;  4YFN F;  4MNU A;  3GFM A;  4KIF A;  1TW2 A;  1KYW A;  3KE2 A;  5CVI A;  1O3Q A;  1QBJ A;  5A2Q K;  3WGG A;  2F5E A;  5DDG A;  4GO1 A;  3K1P A;  5J6X A;  1ODD A;  2HTS A;  3BJA A;  2Q8K A;  4HW0 A;  2P6T A;  4L9T A;  3ZPL A;  3SZP A;  5DCM A;  3ZP5 A;  3FMQ A;  1F4K A;  4U7B A;  2MA3 A;  4IRI A;  1Q1H A;  3WTT C;  1WQ2 A;  3EQL F;  2A61 A;  5ICC A;  1ZH5 A;  1IW7 F;  1ZG3 A;  3BP8 A;  2QUF A;  3LQR A;  3WTY C;  1FT9 A;  4ZH4 F;  4F7Z A;  2L4A A;  1ZRE A;  1KQ9 A;  1IN8 A;  1FBS A;  2NYX A;  5IT3 A;  2PJP A;  3LFK A;  1SMY F;  4BYY A;  1CGP A;  3E6M A;  3KEQ A;  2A6E F;  2ACJ A;  1PP8 F;  1S7A A;  3JW4 A;  1ZRD A;  1ZG1 A;  1QO0 D;  2VON A;  4I02 A;  4KIB A;  4GCV A;  4BHB A;  2OZU A;  5F6F A;  3HHG A;  2QWW A;  1UCR A;  5FLX Z;  2COM A;  4KIC A;  3CUQ C;  4EM2 A;  4L5I A;  3DXJ F;  2AXL A;  1HKS A;  4M9S A;  2ZNY A;  3E3V A;  2YX4 A;  1FSH A;  1GXP A;  4HX7 A;  4RGS A;  4UVC A;  2KIU A;  3O3K A;  2FF4 A;  4KUM A;  3GZ5 A;  2NRA C;  1J59 A;  5F1R A;  1S29 A;  4ZYH A;  2Z3Y A;  3TDU C;  5L3E A;  3CDH A;  4JBA A;  2MLK A;  1ZLJ A;  4BQA A;  4Z2Y A;  1DPU A;  3V8L A;  1BC7 C;  2EV5 A;  3R6S A;  1Z1D A;  5FD5 A;  2VC0 A;  3V7S A;  4OIN F;  3DFG A;  2M1B A;  3VOE A;  5LHI A;  3WTZ A;  4FX0 A;  3DPL C;  2EWN A;  1KYZ A;  4B09 A;  1RZ4 A;  1W4M A;  4P9F A;  5EEG A;  4HF0 A;  4DQ2 A;  3GLX A;  4YFK F;  5FO5 A;  4IF4 A;  5DUK A;  4LG0 B;  1K78 A;  3C18 A;  3OOP A;  4WF2 A;  3T8R A;  4IRG A;  3P9C A;  3BDD A;  1YG2 A;  3SHF A;  2PMU A;  1FYK A;  2EA2 A;  1YQA A;  2VXZ A;  4UHT A;  4PCQ A;  2CGP A;  3SXY A;  1HQC A;  3T8T A;  4YII A;  4I0B A;  1RUN A;  4XRF A;  3CO6 C;  5ED4 A;  2K4J A;  4Q5S F;  3R60 A;  4ESF A;  3QRF F;  2V1U A;  3CO7 C;  2J5O A;  2HWV A;  1S3J A;  3R4K A;  4NQW A;  3WG9 A;  1SFE A;  4HDV A;  2JZY A;  5HOO A;  5LGT A;  3KP4 A;  2CO5 A;  4EV0 A;  3HRM A;  1IUY A;  1XDS A;  3F23 A;  5LGU A;  5L3D A;  3EET A;  5L3G A;  1ZAR A;  2E7X A;  3P9K A;  1G3Y A;  3LA2 A;  2OQG A;  2P6S A;  1YW9 A;  2C6Y A;  3J81 K;  3GVA A;  2FMY A;  3FX3 A;  5HDN A;  5EEH A;  1KGS A;  4CXF A;  1S8N A;  4JQF A;  4LD5 A;  4L5J A;  4IXA A;  2VC1 A;  2VT2 A;  3ABU A;  1C0W A;  1FZP B;  4KA4 A;  4G7Z F;  1ZRF A;  1Z91 A;  2OQR A;  3T5X A;  1PP7 U;  4G6D A;  2QEN A;  4MTD A;  3LST A;  1Z9C A;  2VE8 A;  3C7J A;  1B59 A;  2O61 A;  1W7P D;  1YS7 A;  4CIC A;  2PN6 A;  1ULY A;  2OD5 A;  2H27 A;  2FRH A;  2HYF A;  1JE8 A;  4RGU A;  4IPA A;  3BPV A;  3F21 A;  3KP7 A;  3IC7 A;  3HRT A;  4EM0 B;  2FML A;  4IJA A;  2GA2 A;  5HDK A;  1Y0U A;  2K4B A;  1YW8 A;  3G73 A;  3MFK A;  2GWR A;  4UV9 A;  1STZ A;  3L09 A;  3KLO A;  3C1D A;  3SQN A;  3CLO A;  4UVB A;  3CJN A;  2KJC A;  4U88 A;  2KJB A;  3RYR A;  1XGS A;  4WWC A;  5LRR A;  2A69 F;  2EFO A;  1YYV A;  2KIF A;  2UWM A;  1W5S A;  3E5X A;  2XAQ A;  2ISZ A;  3GUD A;  2UXX A;  5ICF A;  1HST A;  2W85 A;  2WC2 A;  3M8E A;  1IRF A;  5A2Q Z;  2LF8 A;  5E1Z B;  4BHC A;  2L4M A;  3TO7 A;  4PGG A;  1QGP A;  3IL2 A;  1LEA A;  2XRO A;  1W7P B;  4UXN A;  3ULQ B;  4FHT A;  5K5Q A;  3V7C A;  2HTJ A;  1U2W A;  4RB1 A;  2IA1 A;  4LMY A;  3TO6 A;  2H6C A;  1TTY A;  4EJV A;  2VBY A;  3ECO A;  1LDK B;  5LEK A;  2QLZ A;  3U9G A;  1D3Y A;  4YIF A;  1YTY A;  1FBU A;  3J80 K;  1TNT A;  4KYW A;  3F22 A;  3K9T A;  5FGM A;  2M87 A;  5HLG A;  2B0L A;  2V1D A;  1TQP A;  4ESJ A;  2HQN A;  4GXO A;  1KQ0 A;  1KQ8 A;  3GFI A;  3LAJ A;  1XSD A;  2HYG D;  3ZMZ A;  1D5V A;  1LDD A;  4EQQ A;  2G7U A;  2XKP A;  4BNC A;  2STT A;  2H94 A;  1LJ9 A;  4S05 A;  5AIP A;  3FHZ A;  3FXQ A;  2Z99 A;  4RGX A;  2WWY A;  4OIQ F;  2PG4 A;  3MZY A;  3F72 A;  2K86 A;  1T38 A;  1ZRC A;  1BI0 A;  1SFX A;  1R5H A;  4LJZ F;  4LB5 A;  1LQ1 A;  3DEU A;  3LAP A;  1OYY A;  1IN4 A;  5BPD A;  3GYH X;  4M9Z A;  4IHS A;  1UHM A;  1UFM A;  2PFB A;  4G8X A;  3Q9S A;  2Y75 A;  5D8K B;  2DQR A;  4L18 B;  1O7F A;  2W25 A;  4O3M A;  3FMR A;  3L2C A;  4ZYG A;  1OKR A;  1XMK A;  1EV7 A;  3HYI A;  3V8J A;  2XIG A;  3RKY A;  4CYD A;  4MTE A;  4ON0 A;  1TW3 A;  3QU3 A;  1Z6T A;  1TQM A;  3W6J B;  4G7H F;  4YFX F;  2DU9 A;  4BHP A;  1I1S A;  2R7D A;  4ETS A;  3GX4 X;  3I71 A;  2TDX A;  1T0F A;  5CVR A;  2DQL A;  2E1C A;  1I27 A;  2YPR A;  4CDG A;  4PGH A;  2F5D A;  3DQV C;  3H3U A;  4LG0 A;  1ON1 A;  1IXS B;  1OMI A;  3F8B A;  1X3U A;  1MGT A;  1KU2 A;  4A2U A;  1BM9 A;  2PBI A;  2RC4 A;  4HLX A;  4WK8 F;  3NQO A;  3ROU A;  3GO5 A;  3ZN1 A;  2IJL A;  1J9I A;  4JK1 X;  4U0V A;  4OMY A;  4ZYD A;  3BWG A;  4XBF A;  2CWE A;  4L9N A;  5IT9 K;  4HV5 A;  5H6Q A;  5CVU A;  2X0L A;  4OU0 A;  4EJU A;  1CF7 B;  4IHT A;  5HS9 A;  1P6R A;  4O5V A;  3NEU A;  1WRJ A;  3MEX A;  4O6J A;  2Y0M A;  1ONV A;  1BI2 A;  2GAU A;  1XB4 A;  1F1Z A;  4MEY F;  2Q0O A;  3GWZ A;  3HOS A;  1DPR A;  1GXQ A;  3IWF A;  5JFR A;  1ZN2 A;  5JVT A;  2FBH A;  1WKM A;  4M73 A;  2RQP A;  3EYY A;  1QZY A;  1SFU A;  1IXC A;  2V1X A;  3RPU A;  1JGS A;  2W84 A;  3CTA A;  3K2Z A;  3FM5 A;  2VBZ A;  4S04 A;  1J75 A;  4DNC A;  1LEB A;  2HS5 A;  1U5T C;  2RNJ A;  1NHA A;  3K69 A;  1RIO H;  3ZMT A;  3F3X A;  3BJO A;  2ZNZ A;  2K27 A; 
#chains in the Genus database with same CATH topology
 1G4D A;  2NNY A;  1V5G A;  4NC7 A;  1FTT A;  2E7W A;  2GXB A;  3L2Q A;  2TRT A;  2DI3 A;  1X1A A;  3QAH A;  2ZSI B;  4RMN A;  2KKO A;  2E1M B;  5EZG A;  4XRM A;  2DK5 A;  3MAJ A;  2FBK A;  4DW6 A;  1FYL A;  2L9V A;  2LP0 A;  4C2T A;  5D5U B;  2EIM H;  4BXF A;  2MD5 A;  2HEO A;  2CQN A;  2IVM A;  2ME0 A;  4BKX A;  4EJO A;  3IRQ A;  4XOT A;  3NRV A;  5HLT A;  4HA8 A;  1OYW A;  2L3D A;  3JCU C;  2E5N A;  4A3B J;  3FXR A;  4E7J A;  4RAG A;  4L5E A;  2WTE A;  3VPR A;  1P4X A;  1SD7 A;  5C44 J;  4W1U A;  3G4S I;  1YRN A;  3BR0 A;  3I4P A;  3VDX A;  2W4S A;  2H8W A;  4BGD A;  1R5G A;  2NNN A;  3RIR A;  3F0C A;  1LE8 A;  3OYD A;  3S8P A;  1HSJ A;  2E36 A;  4LIT A;  2M9H A;  3SJM A;  1FLI A;  4HBL A;  1AA7 A;  3J7A O;  3L2W A;  3BG9 A;  3CP8 A;  5E17 F;  2O8X A;  4G9Y A;  2X9D A;  5K5R A;  3V8K A;  3A01 A;  3BR1 A;  3J7Y J;  4CSW A;  4AIK A;  2XRL A;  2CMP A;  1R22 A;  1USS A;  3HPH A;  1K79 A;  3MZH A;  4PK4 A;  1UST A;  4NUB A;  2ME6 A;  4Y4R A;  4HQE A;  3DLL F;  4EVI A;  3AL0 C;  2E1O A;  4BY1 J;  3TO9 A;  2LK2 A;  3M07 A;  3JRH A;  2KRF A;  4UVA A;  3MKZ A;  2GXA A;  1O7L A;  1MND A;  3H35 A;  1W7P A;  2EJR A;  1BIB A;  2D1V A;  5JHU A;  1ACI A;  3I64 A;  3KYL A;  3PQK A;  4YIR X;  1EKE A;  3AFH A;  1X3W B;  4IKF A;  3H1C A;  3LSM A;  2JT1 A;  4A3G J;  3GFJ A;  2A5Y B;  3FIW A;  3I5U A;  2LFB A;  4A3K J;  2R5Y B;  4W97 A;  3ERM A;  2OBP A;  3CJR B;  1VQ9 I;  2VIX A;  4CCL A;  2BE5 F;  3EUH C;  4PUS A;  5HNF A;  3ABK H;  4PJJ A;  1Y6I A;  3FK7 A;  3OYL A;  3OOU A;  2WY7 Q;  3J80 Z;  5DM6 F;  2G7H A;  3H9Q A;  3HTS B;  3D5L A;  1JTX A;  2FBI A;  4DBR A;  5D4S A;  1T98 A;  2PMZ N;  3OYJ A;  2VXD A;  2IW5 A;  2HZT A;  1MSE C;  1YLF A;  2DLL A;  2LF7 A;  4NC6 A;  4MQ9 F;  2JA5 J;  1UB9 A;  4IOC F;  5IOY A;  4FIS A;  4M6X A;  1RKT A;  1V4R A;  4I09 A;  2E2H J;  4FT8 A;  4N0B A;  2V9V A;  5HLH A;  4CHU A;  2JA8 J;  1H8A C;  3HHH A;  1I6X A;  4E7S A;  3DPT A;  5IYB J;  2HXI A;  3FMS A;  2XSD C;  3W2V A;  1QZZ A;  4ESB A;  3RPU D;  4BL0 B;  3QPH A;  2ZO4 A;  1XSV A;  3K1M A;  3WE2 A;  1K61 A;  1P92 A;  4AIJ A;  4K2E A;  4L9J A;  3I56 I;  1WPK A;  4HYE A;  1NG6 A;  2XF7 A;  3PNY A;  5GPC A;  1FNN A;  3K2A A;  1QU3 A;  3H9J A;  4FE4 A;  1HC8 A;  2OU2 A;  3OSF A;  2HPM A;  3S1R J;  2XKO A;  1E0E A;  1UG2 A;  3DP7 A;  3LNQ A;  4H0E A;  4ENN A;  1H9T A;  2HDW A;  3CCL I;  3QOP A;  2RKH A;  1DU6 A;  3ZQI A;  2CYY A;  4PJ0 C;  3DBR B;  3ECH A;  2RN7 A;  2M34 A;  2JSP A;  5DEQ A;  1ZGW A;  4MQV A;  2GM4 A;  2VJJ A;  1CQT A;  2IBD A;  1IF1 A;  2QA4 I;  3P9I A;  1QHH D;  2JPB A;  1X19 A;  1MBF A;  2YX7 A;  4A0Z A;  3JR9 A;  1WCM J;  2P8T A;  3BR5 A;  1HOM A;  5J8C A;  1FOW A;  2EV0 A;  2F4O B;  2FEZ A;  1OQY A;  2R3S A;  3H5N A;  4TV7 A;  1G8X A;  1LFP A;  3BQZ A;  3A0B C;  1MBJ A;  2DFH A;  3RJP A;  5EF6 A;  2LD5 A;  4ASN A;  4A0Y A;  2DBB A;  1E17 A;  2F5C A;  2WBM A;  4EJT A;  3JSP A;  2QVO A;  4M3G A;  3S15 J;  3CC4 I;  1IXR C;  2PMH A;  1OCO H;  2IP2 A;  4M74 A;  1XCB A;  2K9L A;  3GTQ J;  5IP7 J;  2CSO A;  2W48 A;  3L9F A;  2R7T A;  3OIO A;  2X1D A;  2Q2E A;  4R8H A;  1GHC A;  1Y8R B;  2CQK A;  2WAQ A;  1TT5 B;  1GV5 A;  1D0X A;  3FKI J;  4L9V A;  3RQI A;  1XN7 A;  3KCC A;  5H6R A;  3OYN A;  3I55 I;  3S3M A;  3FDY A;  1MBG A;  2OA4 A;  4RAF A;  4AU7 A;  3S93 A;  4FET A;  2ZC2 A;  4E7H A;  1R1T A;  2F48 A;  3BZC A;  3GEZ A;  3B6A A;  2MFZ A;  2DFI A;  3JAM Z;  4N4N B;  3K4N A;  5CPR B;  3SYT A;  3DF8 A;  5LLQ A;  2ESN A;  3E1S A;  4RB0 A;  1FC3 A;  4MGR A;  5LEJ A;  3F8F A;  5F0C A;  1QZE A;  2HQ5 A;  3LQQ A;  4B4C A;  5HS7 A;  3DKX A;  3WOD F;  1R7J A;  3VWB A;  5F0H A;  2M0M A;  4DYC A;  3TOB A;  2LY9 A;  4BXU A;  1O4X A;  4A93 J;  1J2X A;  5F08 A;  3N05 A;  4X1E A;  1R23 A;  4A6E A;  2FUG 2;  2HFH A;  4AWX B;  4F92 B;  4XLP F;  4BJ6 C;  5DYM A;  4M9X A;  3CUO A;  3CUQ A;  2GIV A;  1LB2 A;  4MHG A;  5E8I A;  1QVU A;  1REP C;  2QF7 A;  2BBY A;  1B1B A;  3HSR A;  2L5Q A;  5FFX A;  3HOT A;  1B9N A;  1XMA A;  2R4G A;  3ZQF A;  2ZJR F;  1W36 D;  2XHK A;  4KN4 X;  3TQN A;  5TRD A;  2LBF A;  2HI3 A;  4X0G A;  2IS6 A;  5E1X A;  3WU0 A;  4KMF A;  4UNO A;  1BI1 A;  4JYK A;  2XF5 A;  5ERI A;  3DBL B;  2M3A A;  3S1M J;  3IHU A;  4E4H A;  3E5Q A;  5HLI A;  4HV6 A;  2FU4 A;  1DGW Y;  4MFE A;  4CYC B;  4BH9 A;  1K4T A;  3MVP A;  1NTC A;  2Z16 A;  4I6Z A;  3K4B A;  2DMU A;  2GQQ A;  3QP5 A;  2CH0 A;  4HQM A;  3FXL A;  2AS5 F;  1FP2 A;  2JK3 A;  3G1O A;  3CC2 I;  5BNG A;  2CW0 F;  3TL4 X;  3ZMD A;  1BW6 A;  4QPO A;  3HOY J;  1G3S A;  2DA4 A;  2QM3 A;  5FLX K;  2P7C B;  3UR3 C;  4BQN A;  2NS0 A;  2DT5 A;  1TL8 A;  4IHW A;  1A6Q A;  4HNT A;  5ICE A;  1CF7 A;  1JTY A;  1T0F C;  5IP6 A;  1OYI A;  3AG3 H;  1D1A A;  3M1E A;  1SAX A;  4B44 A;  4AM3 A;  3RSN A;  2B7E A;  1UZC A;  4PSX A;  4OIP F;  1FWZ A;  2XAJ A;  2AQE A;  5GAD J;  4QSH A;  2CUE A;  3F6V A;  4ENK A;  1IAW A;  2PJR A;  4E70 A;  1WJD A;  5L3F A;  3GCM A;  1JKP C;  2RGV A;  3TGN A;  3FIS A;  1H0M A;  2BOL A;  2ZME B;  2Y30 A;  1G2H A;  2MC3 A;  3V42 A;  5CVV A;  1BIA A;  1J5Y A;  3KEO A;  3FHN A;  1D1B A;  2NXN B;  2Y0S A;  4ENM A;  5IYD J;  2EFQ A;  1VQK I;  2O03 A;  4HOB A;  4PZJ A;  5CJ9 A;  4C3H J;  4HZF A;  4XN3 A;  3G3Z A;  2Q1Z B;  3FXO A;  1B4A A;  2X48 A;  4Q47 A;  2VI6 A;  3O6B B;  1XMX A;  4Y33 A;  2DA3 A;  2Y31 A;  2FOK A;  3NWT A;  1WJC A;  2FQ3 A;  1LUJ B;  3UNG C;  3OV8 A;  1QRY A;  2XPU A;  3VYS B;  2DOD A;  4JX4 A;  4BAC A;  2ZBK A;  1JHH A;  3G2B A;  2FNA A;  2OC6 A;  2OZ6 A;  2V7F A;  5K1Y A;  1JHF A;  1Y0N A;  2HYJ A;  2IA0 A;  1MMG A;  2JRT A;  2O7O A;  1O3S A;  1XTA A;  2CQX A;  5BS6 A;  4RB3 C;  1ON2 A;  3SEQ A;  2P5V A;  1WJB A;  2XAH A;  3OYA A;  4LLG F;  1RUO A;  2YU3 A;  3LOC A;  1KZH A;  2EFP A;  4E7I A;  5KCM A;  1TLH B;  1R5I D;  1KU3 A;  1EH7 A;  2FQ4 A;  4B48 A;  1WGX A;  2KT0 A;  5E20 A;  3N97 A;  3M8F A;  3GTJ J;  3CDI A;  3I0T A;  1RPW A;  3V4G A;  3LA7 A;  4LIU A;  2M4G A;  2XPV A;  3WU2 C;  3ZGK A;  2J5P A;  3F9K A;  5D5V B;  1DP3 A;  1BN5 A;  4P96 A;  4CH7 A;  1ETY A;  2LNB A;  5L3B A;  4OAZ A;  2FX0 A;  1L3L A;  4KMU X;  4KT5 C;  2B63 J;  1O57 A;  3CLQ A;  3DU6 A;  2COB A;  2VE9 A;  2GBY A;  4DJA A;  3ASO H;  3G1M A;  1SFK A;  1VF9 A;  4IVN A;  2QBY B;  2JSC A;  3PO3 J;  3I59 B;  1U3E M;  3DEE A;  4HF2 A;  2P4W A;  3KP5 A;  4LLN A;  3H3V K;  1F9N A;  3KET A;  3UKG A;  4A3J J;  2ID3 A;  3KP6 A;  5AIQ A;  1XCV A;  5HDG A;  4XSX F;  1QNT A;  4XLN F;  5D6F A;  2L7F P;  4BY7 J;  3QYB A;  4LK1 F;  4QTR A;  3WU1 B;  1ITY A;  1VND A;  5B3S H;  4ENJ A;  2XPW A;  4GDF A;  4XLH A;  2BZT A;  2DJN A;  4II2 A;  3LSI A;  3WGI A;  1T08 B;  1MJB A;  3FF5 A;  3F8M A;  2KIM A;  3M4O J;  2O0Y A;  2ISY A;  2F6C A;  2E2J J;  3ESW B;  4L0Z B;  4O5V A;  2KMU A;  3SFZ A;  1M1E B;  4CCJ A;  2H1K A;  3A02 A;  4D5C A;  1YOV B;  5IP9 J;  3RI4 A;  1OCR H;  3HGY A;  2KLO A;  5HNH A;  1Z7U A;  1Z21 A;  2RVC A;  1D1C A;  2D2W A;  3R0J A;  5IOZ A;  2CQQ A;  1DGR M;  1PDN C;  5BOX A;  2R5Y A;  1WH5 A;  2KDZ A;  3GTK J;  1SC7 A;  1V5E A;  4KIG A;  2LDU A;  3WE3 A;  2EIJ H;  3DEW A;  3D0S A;  3D5R C;  1IJW C;  4BJ5 C;  3ABM H;  1Z0X A;  3I54 A;  3ABT A;  2XAS A;  3IUO A;  2K9N A;  5IPA A;  1TP4 A;  1JXS A;  1X1P A;  3PFI A;  1LFU P;  1ETV A;  2E60 A;  4KN7 X;  3CUQ B;  3JRD A;  5E3O A;  2ZJ2 A;  2WB1 N;  2X6W A;  2ADU A;  3I58 A;  4N9H A;  3ZQC A;  4OIO F;  3OWT A;  2PMZ A;  2BV6 A;  1MZB A;  2LRE A;  1LVK A;  1DP7 P;  3P7N A;  1TWA J;  2HVS A;  1WSU A;  4ZTF A;  4WXH A;  4Z6Y A;  3N4M A;  2DPD A;  2KPM A;  3TP0 A;  2R7O A;  1SVL A;  2XGX A;  1SVO A;  3K4C A;  3QWL A;  4IHY A;  4XKW A;  3OY9 A;  1HW2 A;  3G1L A;  1A5J A;  4BU2 A;  2DPU A;  1Y1V J;  3I53 A;  2CUJ A;  4I7H A;  5TJJ A;  5BQT A;  2CG4 A;  3BZ6 A;  2W7N A;  1T2K A;  5ILS A;  3VOD A;  2HOS A;  1X1C A;  4ABZ A;  4XRS G;  3HEF A;  3GFL A;  3KP2 A;  2FE3 A;  1ZG5 A;  2IS2 A;  2VT3 A;  1IDY A;  1BW5 A;  2Z9O A;  2QEX I;  4L0Y B;  4GRI A;  2O9L A;  2QZ8 A;  3BC8 A;  2DJI A;  3LSK A;  2STW A;  2OUM A;  1FX7 A;  2IA2 A;  2UV1 A;  3ZQ7 A;  3K0L A;  4X6A J;  4UUV A;  4P9U A;  1IN6 A;  4EGZ A;  2K85 A;  1HA8 A;  1VQM I;  3S1Q J;  2QSF X;  1H89 C;  2CJJ A;  2AHQ A;  1KU7 A;  2ZJQ F;  5JI6 A;  1QA6 A;  2F5F A;  1BI3 A;  1R49 A;  3C3W A;  1JUM A;  3RKX A;  1YJ9 I;  2X85 A;  3F8N A;  4DYQ A;  2EV6 A;  2OV7 A;  5KVR A;  3HOV J;  3F6O A;  3TMO A;  4CO8 A;  4WXC A;  5LHH A;  2HQR A;  2LKX A;  5J3L A;  1TBX A;  2EIL H;  2PJR B;  3OR1 C;  4HX4 A;  2WAD A;  1V3F A;  2OJE D;  4NB5 A;  4A6D A;  2DAO A;  2FOW A;  1YFH A;  2MD0 A;  4YG2 F;  4ZDP A;  2IT0 A;  4A3C J;  3RPQ A;  1SD4 A;  5FKN A;  2WAF A;  1X2M A;  2RDP A;  3S3O A;  3CMY A;  4B3A A;  2PLY A;  2VQL A;  5JLW A;  4IX7 A;  4ZYE A;  4HAM A;  1BJA A;  1YJN I;  4RAZ A;  3E6C C;  3Q5F A;  3VSL A;  3BPX A;  1FMV A;  4XSZ F;  3FBN B;  3HRU A;  3J81 Z;  1E2X A;  3CP2 A;  4J19 A;  2OAZ A;  3MQ0 A;  2R93 J;  4U87 A;  1JKO C;  5ILU A;  1ETQ A;  1EF4 A;  4G94 A;  2M8E A;  2P5K A;  3TOA A;  2Z5U A;  5F27 A;  2EZI A;  1T56 A;  2M5W A;  3HRS A;  3ZXS A;  5FD6 A;  4XIC A;  2EK5 A;  1WWX A;  2M8G X;  4OAY A;  4B8X A;  3BJ6 A;  2NVQ J;  3S2D J;  3FXU A;  2EFN A;  4C2U A;  3GBG A;  3AKZ A;  2DOF A;  2RQQ A;  4XQF A;  2IGN A;  5J4V A;  3SFI A;  1B72 A;  2DA7 A;  3TW7 A;  2JA2 A;  1IC8 A;  1HLV A;  5LHG A;  3QOE A;  4V19 K;  4OOI A;  2NVY J;  3TKY A;  3CCM I;  1XG1 A;  2H8R A;  2PEX A;  1AU7 A;  1R58 A;  1YO5 C;  2EPF A;  1KA8 A;  4II3 A;  5ILV A;  4M6V A;  2LYC A;  2HVQ A;  1D8K A;  4A0X A;  4KIT B;  4RB2 C;  1K6O A;  4Y7N J;  1MDM B;  3B73 A;  4C2M J;  3Q3S A;  5D5W B;  1GT0 C;  1ZAO A;  4H4K C;  5LGN A;  2KP6 A;  1HBX G;  1MJ9 A;  3LMM A;  5D4R A;  4KNY A;  1BBY A;  3K70 C;  1S7E A;  2YUS A;  6PAX A;  3REO A;  1XDU A;  4HLY A;  4Q48 A;  3IKV A;  1G59 A;  4CYC A;  1Z77 A;  1UHW A;  1Z7L A;  2LRD A;  4FX4 A;  3ABL H;  4EJW A;  1DDN A;  2E71 A;  3WGH A;  3IP4 B;  3PSI A;  1QPM A;  1SAU A;  5LFA A;  2HR3 A;  3IKT A;  1MMD A;  1QQI A;  2DDA A;  1G3T A;  1AOY A;  4A3F J;  5CQE A;  3KEY A;  3S1N J;  2MLG A;  2CV1 A;  1IN7 A;  4RS8 A;  3OYG A;  2W82 A;  3HOZ J;  1PYV A;  2CW7 A;  2BHZ A;  2WV0 A;  4WXD A;  3IRR A;  2PQ8 A;  5KK1 A;  3L2V A;  3PNT A;  1R71 A;  1TQI A;  3WTU C;  3RYP A;  1K7A A;  3WTV C;  4Y17 A;  3K1N A;  3DLA A;  3Q0W A;  1G3W A;  4OIR F;  2PI0 A;  2MW8 A;  1UEL B;  3ZN0 A;  2K3P A;  3VYT B;  3JRC A;  3SZT A;  5H2F C;  1IV8 A;  1G6N A;  2ZXI A;  1OJL A;  4I2O A;  1MBK A;  3CF5 F;  2JUG A;  1D0Y A;  1NH3 A;  2ZXJ A;  2FSW A;  3AG1 H;  4M71 A;  4DBQ A;  3Q9V A;  1XX5 A;  2P5L C;  2ZME A;  3MWM A;  3RCO A;  4BJT A;  1SEU A;  5E79 C;  1WVR A;  1BOA A;  3W2A A;  2LY2 A;  2HXO A;  1XD7 A;  2QCO A;  4AD9 A;  3MCZ A;  2YSR A;  1T39 A;  4GYI A;  2ZFU A;  3V7R A;  3KZZ A;  4N4O B;  1XC5 A;  3RTR A;  1U9O A;  2GA1 A;  2FJ1 A;  2XAF A;  2RV8 A;  3IH3 A;  3GZN B;  4A5N A;  1IRG A;  5M3F J;  4F3Q A;  2BY2 A;  4I0A A;  1XS9 A;  4EMS A;  5BMZ A;  4BBR J;  2XUB A;  1HW1 A;  1GVJ A;  3BOQ A;  4RDU A;  1FSE A;  3KLN A;  4OMZ A;  5DD8 A;  1T6S A;  3ZMV A;  1T8I A;  3M9A A;  4HG2 A;  2XDV A;  3KYC B;  2XGC A;  1OPC A;  5D5X B;  4UB8 C;  3JTH A;  5BPI A;  1R4M B;  2DK8 A;  2VLA A;  5FRN A;  1QVT A;  4MEX F;  1E3P A;  3ZR8 X;  2ESH A;  3LSJ A;  3S32 A;  3JTG A;  2VOO A;  3S2H J;  2NS7 A;  4EGY A;  2YU9 J;  2BW3 B;  2E1N A;  5B1B H;  3VSK A;  2VBW A;  3VFZ A;  1FBQ A;  2F4I A;  5DCF A;  4XID A;  1ETK A;  2Z2S B;  2D5V A;  3VYU B;  4WCG A;  3OYH A;  2X4H A;  1TWH J;  4V2G A;  3KP3 A;  1P7I A;  2WV1 A;  2BGC A;  2DO7 A;  1YIO A;  1XGO A;  4M3E A;  4QLC U;  1MH4 A;  4A5M A;  2E2I J;  1IUF A;  1VI0 A;  1Q1V A;  1IGN A;  1VQ6 I;  2A6H F;  2ELJ A;  1ZR2 A;  1U6G A;  3ZMS A;  2YR2 A;  2IXS A;  2VBX A;  5K5O A;  2DYR H;  4MLO A;  1A35 A;  1VQ4 I;  4P55 A;  1MW7 A;  4Y13 A;  1HDP A;  2QYO A;  3Q0V A;  2QBY A;  2K7L A;  4ZZL A;  3I59 A;  4QPQ A;  4R79 A;  2L9R A;  2F4M B;  3W3C A;  3F8C A;  5CLS A;  4DYR A;  1F5T A;  1UMQ A;  5C3E J;  1J7K A;  2BHY A;  2I8D A;  3K7A J;  3TP3 A;  4XN0 A;  1U5T A;  1OFC X;  2R7Z J;  3COA C;  2GXG A;  1BJZ A;  1L0O C;  4IRH A;  3ZMU A;  4HX8 A;  2KIS A;  2E1M C;  2OF7 A;  5LRS A;  2Y9Z A;  4D9J A;  3MZ8 A;  1V55 H;  2QGU A;  3BT9 A;  1I5Z A;  2L01 A;  3CCV I;  3HSE A;  2F2E A;  2G9W A;  2KFD A;  1FP1 D;  3KPH A;  2P7V B;  3A0H C;  4HF1 A;  5E3M A;  3BRO A;  1MKM A;  1Z6R A;  2DW4 A;  5ICG A;  3LA3 A;  1A04 A;  2FXA A;  4BEH B;  2HKO A;  3VEP A;  2DMT A;  1QPI A;  2Z33 A;  3FXM A;  5DCM B;  1OCZ H;  3D5S C;  2HOE A;  2YS9 A;  2IGO A;  4XLA A;  2D45 A;  4Q4Z F;  1RI7 A;  1R1U A;  4V2F A;  3IWZ A;  1FJL A;  4ZC3 A;  3DCF A;  3T0Y A;  1RNL A;  1BC8 C;  5DV5 A;  2ETH A;  4CZZ A;  3S17 J;  1S5L C;  2EH3 A;  3B02 A;  2A68 F;  3VB2 A;  4M3B A;  1U78 A;  5J1U A;  2XSJ C;  5FB2 A;  1OLT A;  2H09 A;  3O2P E;  2WA0 A;  3H92 A;  4QWQ A;  3DTI A;  1VQ8 I;  1GUU A;  5GTH C;  1BR4 A;  2JUC A;  3I4N J;  2ECB A;  3CJQ B;  2NOG A;  1YI2 I;  4GYG A;  2XV4 S;  1FOK A;  2RAE A;  1H9G A;  4A12 A;  2L02 A;  4F93 B;  1P2F A;  2M45 A;  4YEJ A;  2ZFW A;  2H6B A;  5J4Y A;  2IPQ X;  2ZB9 A;  3FZV A;  4DOZ A;  3PIO F;  3OS2 A;  3L2R A;  1OR7 A;  3E5U A;  2UXN A;  4CCN A;  2A07 F;  2BY0 A;  1GDT A;  2WB1 A;  2VOP A;  1ZYR F;  5J1Y A;  3BG6 A;  3FWE A;  4G12 A;  3CZ6 A;  3MMY B;  2ZKZ A;  4HDU A;  3BCB A;  1TNS A;  2DMP A;  2R7F A;  2GLO A;  3X2Q H;  4GGG A;  2BY3 A;  2X51 A;  3ZRG A;  4WX9 A;  3OYC A;  1XGN A;  2XVC A;  3PO2 J;  4ZDO A;  2JVG A;  3TW6 A;  1FY7 A;  5H20 A;  4M72 A;  4KT6 A;  4A3L J;  5KNL A;  1RKW A;  4FTH A;  5E3N A;  2WY8 Q;  3U2R A;  5J40 A;  3EPZ A;  3GW2 A;  4MIM A;  3S16 J;  3ERE D;  2DN0 A;  3RDI A;  1J09 A;  4LGW A;  1N77 A;  2RNG A;  3OYF A;  4LOC A;  2Y48 A;  3CQZ J;  2KL4 A;  5D6E A;  5FKL A;  5F04 A;  1HXD A;  1SMT A;  2QQA A;  3M8J A;  5IT9 Z;  4XNF A;  2O5R A;  1HDD C;  3HUG A;  3AAF A;  4P5O A;  2BXZ A;  1YJW I;  2VOD A;  3HIF A;  3A1Y A;  3L7W A;  3BY6 A;  1MJA A;  3HSF A;  1XSX A;  5JVG F;  2M2E A;  1BR1 A;  5C4J J;  2HDC A;  1RC9 A;  1Z05 A;  2VKH A;  2EZK A;  3JRE A;  4QIW N;  5KAF C;  3FBI B;  3HDD A;  3EUH A;  4ZZD A;  4RM3 A;  4LLL A;  3GTM J;  2OCC H;  3BTL A;  4D7N A;  1EH6 A;  4EM1 A;  5F1J A;  3WTS C;  3QPT A;  3A2K A;  2E19 A;  1P9Q C;  2CFX A;  2EB7 A;  3EDP A;  4I98 B;  4OWR B;  2L54 A;  2GZW A;  4AIH A;  1HKT A;  5AON A;  2VN2 A;  2ECC A;  2XAG A;  4BQO A;  3OIQ A;  1K83 J;  3H5A A;  4UV8 A;  4BDY A;  4XOP A;  2QSG X;  4G7O F;  1ZGA A;  4EEF G;  1K4S A;  1IG7 A;  4E6K G;  1ZGJ A;  2QQ9 A;  5E18 F;  2VJ4 A;  1VQP I;  1POG A;  4AVZ A;  3PUF A;  2BEO A;  3ML6 A;  4UUS B;  2BYV E;  2XB5 A;  2DDB A;  4LK0 F;  5L3C A;  1YX5 A;  3ISP A;  3DWL E;  2A5W A;  1A6I A;  1IZ1 A;  5DUI A;  3MKY B;  3WTW C;  4B3X A;  4ZJZ A;  4A3I J;  3Q0U A;  2V79 A;  3A03 A;  2QQB A;  1U8R A;  2MBF A;  1MSF C;  4ITV A;  3RKQ A;  2JTV A;  4BAY A;  5FLV A;  3TDZ C;  1TC3 C;  4A3E J;  3GME A;  1HW5 A;  3DV8 A;  5LBQ A;  1YIT I;  2MSY A;  3L00 A;  1S7O A;  1SVM A;  1YW7 A;  1ERD A;  1B6A A;  2MH2 A;  3PQJ A;  5CYV A;  3HC7 A;  1T95 A;  3MKL A;  1X58 A;  3S2W A;  3R0A A;  3EYI A;  2LSO A;  2FA5 A;  1ZLK A;  5CVJ A;  3DBH B;  1D5Y A;  2B9S A;  4XOR A;  2ELK A;  1FPQ A;  1XGM A;  4IO9 F;  1MDM A;  1ZHF A;  2Y2Z A;  4XLC A;  1I6H J;  1P4A A;  2OPT A;  1VQN I;  2JA7 J;  2CU7 A;  3KZY A;  4XMY A;  3HB9 A;  1WI3 A;  1SD5 A;  2H1L A;  3QU6 A;  1F36 A;  3HOX J;  1ENH A;  1DQU A;  1OIS A;  5E8G A;  1LPQ A;  4CGZ A;  1IN5 A;  3PJR A;  1K78 B;  1LNW A;  4AVP A;  1YE9 A;  2CW8 A;  3PSF A;  2LOO A;  4RAY A;  2D1H A;  2O3F A;  1HKQ A;  3W6K B;  1J0R A;  4HST A;  3R61 A;  2ID6 A;  2KRH A;  2DTR A;  1MD0 A;  1W5T A;  1W0T A;  1LDJ A;  2LKP A;  3KFW X;  1MNE A;  4N9I A;  1N78 A;  2HGC A;  2R7X A;  1V54 H;  2AXT C;  3L1P A;  1IRZ A;  2KRC A;  1FOY A;  1D8J A;  1JI8 A;  1MBH A;  5E1W A;  5HS8 A;  3HOU J;  4MFD A;  4Y15 A;  4JX6 A;  3JSO A;  2HNH A;  1KU9 A;  4G6Q A;  1U5T B;  2JJ7 A;  3M7G A;  2MH9 A;  1B9M A;  3GZ6 A;  4Y52 J;  4RGR A;  1H88 C;  2A3S A;  4ZDL A;  1PUE E;  1KON A;  2XGE A;  3FM3 A;  4UY8 I;  4XK4 A;  1NG7 A;  4NQW B;  5GAG J;  2NOJ B;  4KFC A;  3GXO A;  1MMS A;  1YS6 A;  5B5E C;  2W57 A;  4LB6 B;  3DKW A;  2CFO A;  1R00 A;  1SD6 A;  3BTI A;  9ANT A;  4A69 C;  2AQF A;  2LKS A;  2XRN A;  4XKB A;  4M6Y A;  1PUF B;  2IAI A;  2DMN A;  1JUS A;  2VKE A;  5J8F A;  1GVD A;  3JRI A;  3MN2 A;  2HPI A;  2VL8 A;  3QP6 A;  3EUK L;  2ZCW A;  4CZC A;  3EUA A;  3JRG A;  2EA4 A;  1R1V A;  2L7M P;  5HVQ C;  3WTX C;  3BLY A;  2V6C A;  5EYR A;  4CUG A;  4U7D A;  2X6X A;  2DA2 A;  2K02 A;  1I1G A;  2EIK H;  4YEL A;  5F64 A;  2ELH A;  3WHC A;  4IQJ A;  3JAM K;  2HKX A;  3HTU A;  4U0Y A;  1O3R A;  4U0W A;  4A3D J;  1FYM A;  2O6G E;  3E6B A;  5JR3 A;  2UZK A;  4XL9 A;  2NAZ A;  1VTN C;  1O3T A;  3ELK A;  1AHD P;  5FFZ A;  3RZD J;  5K7F A;  1FTZ A;  4KDP A;  1D0Z A;  1I3Q J;  2HOT A;  4NHJ A;  1EH8 A;  2CS3 A;  3LWF A;  2EZL A;  4R1H A;  4I01 A;  1AWC A;  2IRF G;  1LVA A;  5GAE J;  1GLN A;  3T1B A;  1S6L A;  1R36 A;  3H0G J;  2R5Z B;  5D8L B;  3E97 A;  1JT6 A;  3U21 A;  3BTC A;  4LFU A;  3RKW A;  1RR7 A;  2JPC A;  3U1D A;  2M30 A;  2BW3 A;  5F0F A;  1P4W A;  3HBL A;  2OTL I;  2W24 A;  4PDK A;  1W36 C;  1WI9 A;  2EFW A;  2EQR A;  1FIP A;  4XRS A;  4RBO A;  3H3Z A;  3AL0 B;  2FNP A;  5DD4 A;  1DUX C;  3SDB A;  3CC7 I;  1WJ5 A;  3E6D A;  2JN6 A;  4AID A;  2Y9Y A;  1TZL A;  5EG0 B;  4D0P A;  4XR6 A;  1B8I B;  3GF2 A;  2K40 A;  1IRX A;  4IOA F;  2L9S A;  3CF2 A;  4YFN F;  1RR8 C;  4MNU A;  4UUT A;  3HUG B;  5M5Y J;  3GFM A;  2DA6 A;  4KIF A;  3I4M J;  1TW2 A;  3E7L A;  1X1B A;  3H36 A;  1KYW A;  2N8G A;  3KE2 A;  2XGD A;  2V26 A;  5CVI A;  5GP9 A;  2Y69 H;  1VQL I;  2QKL B;  3HL2 A;  1O3Q A;  4DZJ A;  2G0E A;  2K9Q A;  1QBJ A;  3HPG A;  5A2Q K;  2O8K A;  3WGG A;  1I39 A;  1VQO I;  5EGO B;  2F5E A;  3AG4 H;  4F55 A;  4GO1 A;  5DDG A;  3K1P A;  3M1C A;  3CCS I;  2MGQ A;  5J6X A;  1BOB A;  1ODD A;  2HTS A;  3OIP A;  4UB6 C;  3BJA A;  2Q8K A;  2A6T A;  3CCJ I;  4HW0 A;  2E34 A;  2IGK A;  1W0U A;  2EIN H;  2P6T A;  1I3A A;  4ZTJ A;  2PX9 A;  4BEH A;  4YRV A;  3CMA I;  4L9T A;  1WFX A;  2VB6 A;  3SZP A;  5DCM A;  3ZPL A;  4IEJ A;  3ZP5 A;  3FMQ A;  1F4K A;  3M3Y J;  2VJ5 A;  3KZI C;  1VZ0 A;  4U7B A;  2MA3 A;  1ZKG A;  4A3M J;  2CV2 A;  4IRI A;  2TCT A;  1Q1H A;  3WTT C;  1WQ2 A;  2MYS A;  1JKQ C;  3EQL F;  4NBQ A;  5FKM A;  1Y39 A;  5C4X J;  1MIJ A;  2A61 A;  5ICC A;  1ZH5 A;  1K6Y A;  1IW7 F;  1ZG3 A;  3BP8 A;  2QUF A;  3LQR A;  5B1A H;  2DOE A;  1FT9 A;  3WTY C;  4ZH4 F;  2OTJ I;  3LFU A;  4F7Z A;  3PL8 A;  2L4A A;  3IAS 2;  1ZRE A;  4AUX A;  1KQ9 A;  1IN8 A;  1FBS A;  2NYX A;  5IT3 A;  2PJP A;  3BR2 A;  2VQG A;  3LFK A;  1SMY F;  4BYY A;  1CGP A;  3E6M A;  3OS1 A;  2DXI A;  2K5C A;  3KEQ A;  1U9N A;  3CCE I;  2A6E F;  2ACJ A;  1NK2 P;  1PP8 F;  1S7A A;  3JW4 A;  1ZRD A;  1ZG1 A;  1QO0 D;  2VON A;  2IEK A;  3HKZ A;  4I02 A;  4KIB A;  1OCP A;  4GCV A;  1ETX A;  3OR2 C;  4Y3O A;  4BHB A;  3H0D A;  3I9V 2;  4XLF A;  2HU9 A;  2OZU A;  4C9Y A;  4HPQ A;  3P5J A;  4C3I J;  1TWG J;  5F6F A;  3HHG A;  4BDZ A;  2KZV A;  1LKX A;  5HOD A;  2QWW A;  2JMW A;  1UJ8 A;  1UCR A;  4HNV A;  5FLX Z;  3H9G A;  1E3H A;  3QYF A;  2COM A;  4KIC A;  3CUQ C;  4NDL A;  5M5X J;  4EM2 A;  5CKT A;  3MKW B;  1Z3X A;  2ZXW H;  4L5I A;  3DXJ F;  1OR7 C;  4IQ4 A;  2AXL A;  1HKS A;  3BZK A;  3BCA A;  1EA3 A;  4M9S A;  4B47 A;  4I99 C;  2ZNY A;  3E3V A;  5FLM J;  2YX4 A;  2NVT J;  1FSH A;  1GXP A;  5FRO A;  4HNU A;  3KX2 A;  3JRB A;  1VQ7 I;  4HX7 A;  4RGS A;  4UVC A;  3K4K A;  2VPL A;  2KIU A;  3O3K A;  1TWF J;  2FF4 A;  1P7J A;  4KUM A;  3LSP A;  3GZ5 A;  4PJL A;  2JVH A;  5TGT A;  2NRA C;  2KZG A;  1J59 A;  2A05 A;  2XF6 A;  3ONQ A;  5F1R A;  1S29 A;  4MO7 A;  4ZYH A;  4UUS A;  2Z3Y A;  2I10 A;  3TDU C;  2KDO A;  5J47 A;  1DU0 A;  4AYB N;  5L3E A;  3ZOB A;  3CDH A;  4HSR A;  4JBA A;  1FOX A;  1N75 A;  2MLK A;  5J1R A;  1AKH B;  1ZLJ A;  2DT6 A;  4BQA A;  3OL3 A;  3JRA A;  4PFP A;  4Z2Y A;  1DPU A;  4IZZ A;  3V8L A;  3S14 J;  3O8H A;  4M3D A;  1BC7 C;  4PFO A;  2EV5 A;  5FKO A;  1U8B A;  4C3J J;  3R6S A;  1Z1D A;  5FD5 A;  2VC0 A;  3V7S A;  4OIN F;  1BL0 A;  4DZP A;  5M3M J;  3DFG A;  2OCE A;  5IYC J;  2M1B A;  3VOE A;  2MAB A;  5LHI A;  3WTZ A;  1X1D A;  4FX0 A;  3DPL C;  5DM7 F;  3IH2 A;  1TWC J;  3KYD B;  2EWN A;  3H5R A;  1KYZ A;  4B09 A;  1RZ4 A;  1W4M A;  4LIV A;  4P9F A;  5EEG A;  3GLL A;  1X4O A;  2LLK A;  1ZTR A;  4EAT A;  4HF0 A;  2F5V A;  5B66 C;  4DQ2 A;  3QOD A;  3S3N A;  3GLX A;  2DA1 A;  4YFK F;  5FO5 A;  2JQ7 A;  2NVX J;  2R7U A;  4IF4 A;  5DUK A;  4BE0 A;  1WH7 A;  4LG0 B;  2IS1 A;  1K78 A;  3AG2 H;  3C18 A;  5K7H A;  3OOP A;  1UAA A;  4WF2 A;  1RES A;  2HDD A;  3BTJ A;  4IRG A;  3T8R A;  3P9C A;  3BDD A;  1YG2 A;  3MD2 A;  3SHF A;  2PMU A;  4RLF A;  1ETW A;  1FYK A;  2VUM J;  2M0C A;  2EA2 A;  1YQA A;  2VXZ A;  1WJE A;  3BG5 A;  3DPU A;  4UHT A;  1MBE A;  1MMN A;  4PCQ A;  4F91 B;  2CGP A;  1NK3 P;  3SXY A;  1FIA A;  1HQC A;  3T8T A;  3PFY A;  2VQC A;  1MH3 A;  2LVS A;  4YII A;  2CRG A;  2XB0 X;  2GOM A;  3LSG A;  2R7R A;  4I0B A;  3TED A;  4AC0 A;  4XRF A;  3CO6 C;  1RUN A;  1X2N A;  2LTP A;  5ED4 A;  2K4J A;  4Q5S F;  3R60 A;  4ESF A;  1EJ9 A;  4ZYA A;  3QRF F;  1Y1W J;  1R9T J;  2V1U A;  2M7A A;  3FXJ A;  5DTD A;  2J5O A;  2HWV A;  3CO7 C;  3VYR B;  1S3J A;  2R7W A;  2DTZ A;  4IHX A;  3R4K A;  1WJA A;  3ASN H;  3OL4 A;  3LSH A;  4NQW A;  3CCU I;  1YHQ I;  4FAS D;  3GTP J;  3WG9 A;  1SFE A;  2ZJP F;  1IV6 A;  4HDV A;  2JZY A;  4XLE A;  5HOO A;  2DCE A;  1R6R A;  2VQH A;  3A4C A;  5LGT A;  3KP4 A;  2CO5 A;  4EV0 A;  1PJR A;  2LY1 A;  3HRM A;  4RM2 A;  1PUF A;  1IUY A;  2NVU B;  3QPL A;  1Y56 A;  5EZH A;  1XDS A;  4ANJ A;  3F23 A;  5LGU A;  5L3D A;  3EET A;  5TIS C;  5L3G A;  1ZAR A;  3WHB A;  5GTI C;  3U1K A;  2E7X A;  3P9K A;  1WHU A;  2EBI A;  1G3Y A;  3LA2 A;  1ZEL A;  1IDZ A;  2OQG A;  2P6S A;  4CA0 A;  1Y8Q B;  1YW9 A;  2L0K A;  4KJZ A;  2C6Y A;  3J81 K;  5FJ8 J;  3GVA A;  2FMY A;  3PIP F;  1SFO J;  3FX3 A;  2XAU A;  5HDN A;  5EEH A;  1KGS A;  5LD2 C;  4CXF A;  1S8N A;  2BVL A;  1MMA A;  2Z1D A;  4JQF A;  3CCQ I;  4LD5 A;  4L5J A;  4IXA A;  2R92 J;  2VC1 A;  2VT2 A;  3ABU A;  1C0W A;  1BR2 A;  4XKC A;  1FZP B;  4KA4 A;  3LSR A;  4G7Z F;  1ZRF A;  1Z91 A;  2L7K A;  2OQR A;  3T5X A;  1W1W E;  5GPA A;  1PP7 U;  4G6D A;  2QEN A;  4MTD A;  2WAE A;  3HKZ N;  2M4K A;  3HXL A;  3W6V A;  5JHF A;  4D1Q A;  2R5Z A;  2E35 A;  3QQA A;  3LST A;  1Z9C A;  2VE8 A;  4P1W A;  3C7J A;  3SEZ A;  1B59 A;  2O61 A;  1W7P D;  3K4M A;  1YS7 A;  4CIC A;  2LR8 A;  2PN6 A;  1ULY A;  2OD5 A;  3JRF A;  4BBS J;  3E0J B;  2H27 A;  2FRH A;  3OYE A;  1JKR C;  2HYF A;  3OMY A;  1JE8 A;  1JGG A;  2IS4 A;  2DYS H;  4G6T B;  1LFB A;  4BE2 A;  3CDL A;  2CUF A;  4IPA A;  4RGU A;  3BPV A;  3F21 A;  2X1E A;  4BXX J;  1IO2 A;  2ZXH A;  3KP7 A;  5EG0 A;  1E3O C;  3IC7 A;  3HRT A;  3HOW J;  1GV2 A;  4E7K A;  1B8I A;  4EM0 B;  2FML A;  2GOX B;  4IJA A;  2GA2 A;  5HDK A;  1Y0U A;  3IV5 A;  2K4B A;  1YW8 A;  3G73 A;  3MFK A;  1WJF A;  2GWR A;  4UV9 A;  1STZ A;  1N25 A;  1YRN B;  3L09 A;  2VKV A;  1RET A;  3BG7 A;  3KLO A;  3ZQL A;  3BR6 A;  3K6G A;  3C1D A;  3SDG A;  3SQN A;  2LMD A;  3CLO A;  4UVB A;  3CJN A;  2KJC A;  1YX3 A;  1SAN A;  4U88 A;  3G71 I;  1LE8 B;  2KJB A;  3RYR A;  1XGS A;  2ZSH B;  4WWC A;  3ZQQ A;  3OSG A;  1ETO A;  2A69 F;  5LRR A;  2EFO A;  2LG4 A;  5KHD A;  1YYV A;  2KIF A;  3C2H A;  2UWM A;  1W5S A;  4J00 A;  2L7Z A;  3NAU A;  2FD5 A;  3E5X A;  2XAQ A;  2ISZ A;  3A01 B;  3GUD A;  2UXX A;  2QKM B;  4RLQ A;  5ICF A;  1HST A;  2W85 A;  5EGO A;  2WC2 A;  3M8E A;  1IRF A;  5A2Q Z;  3G6E I;  5GAH J;  2LF8 A;  4GFB A;  5E1Z B;  4BHC A;  1T33 A;  2L4M A;  3CCY A;  2VPR A;  3TO7 A;  3J7A Y;  4PGG A;  2DFF A;  1U0J A;  1QGP A;  4RA2 A;  3IL2 A;  3O8G A;  1LEA A;  4JX5 A;  5K7Z A;  2XRO A;  4FCY A;  5KAI C;  2QSH X;  1W7P B;  2I5U A;  4UXN A;  1HF0 A;  3BG3 A;  4HEA 2;  2BVM A;  3ULQ B;  3PUB A;  3HM5 A;  4FHT A;  3V7C A;  5K5Q A;  1A31 A;  2V9K A;  2HTJ A;  3B6C A;  5IY5 H;  1U2W A;  2E5Z A;  2IA1 A;  3ZCO A;  4RB1 A;  4LMY A;  3TO6 A;  2P81 A;  2H6C A;  2R7V A;  1TTY A;  4EJV A;  2VBY A;  3ECO A;  1LDK B;  1ZK8 A;  4FQG A;  5LEK A;  3OYK A;  3OYI A;  2QLZ A;  3U9G A;  4J01 A;  1B72 B;  1Z3Y A;  1D3Y A;  4YIF A;  2IGM A;  4C30 A;  1YTY A;  1FBU A;  3J80 K;  2JRM A;  1MNM C;  3FXK A;  3QPS A;  1TNT A;  4KYW A;  3F22 A;  3DTE A;  3K9T A;  3D1N I;  3K10 A;  3WG7 H;  5FGM A;  5DS9 A;  2M87 A;  5HLG A;  2B0L A;  2V1D A;  2KQR A;  1TQP A;  4ESJ A;  2HQN A;  4GXO A;  1KQ0 A;  1KQ8 A;  3GFI A;  2X1C A;  3LAJ A;  1XSD A;  2K9S A;  5CQG A;  2HYG D;  1JJ6 C;  1OCT C;  3ZMZ A;  5M5W J;  1D5V A;  2HQA A;  1F43 A;  2BY1 A;  3K4J A;  3GTG J;  2HVR A;  1LDD A;  4IL6 C;  4PJM A;  4S0H B;  3RQ4 A;  2KIQ A;  3HZJ A;  4EQQ A;  3CJT B;  1QHG A;  2DOA A;  3K70 D;  1APL C;  2CQ7 A;  2G7U A;  3HJE A;  4FE7 A;  1VQ5 I;  2XKP A;  1JT0 A;  2HZD A;  3KIO A;  4BNC A;  1JUP A;  2V6E A;  3J7Z I;  2STT A;  1XPX A;  2H94 A;  1LJ9 A;  4S05 A;  5AIP A;  3FHZ A;  3FXQ A;  2Z99 A;  4BS9 A;  2JWT A;  4RGX A;  4DIQ A;  2WWY A;  1BA5 A;  2R0Q C;  4OIQ F;  2PG4 A;  3MZY A;  3F72 A;  3CME I;  2VAS A;  2K86 A;  4F52 A;  2DA5 A;  2ICW G;  3K4L A;  1WZ2 A;  1T38 A;  4DGW B;  1ZRC A;  4BUP A;  1OCC H;  1BI0 A;  1SFX A;  1R5H A;  4LJZ F;  4CCK A;  4LB5 A;  1LQ1 A;  3RZO J;  3DEU A;  3LAP A;  1OYY A;  1A36 A;  1IN4 A;  3CES A;  4XON A;  3DTK A;  5BPD A;  3GYH X;  1YIJ I;  4M9Z A;  2WAQ N;  4IHS A;  1UHM A;  1UFM A;  2PFB A;  4G8X A;  4IHV A;  3W2W A;  3Q9S A;  4B43 A;  2Y75 A;  5D8K B;  2DQR A;  2Q2E B;  2R7Q A;  4L18 B;  3OS0 A;  1O7F A;  2LH9 A;  2W25 A;  4O3M A;  3OYB A;  4BQQ A;  3C2B A;  1AKH A;  1VFC A;  3FMR A;  1ZR4 A;  3SZG A;  3L2C A;  3NAR A;  3ZQH A;  4ZYG A;  3NWS A;  3PM1 A;  4I76 A;  4AYB A;  1OKR A;  2MC4 A;  1XMK A;  1EV7 A;  1ORK A;  2W1O A;  2CV0 A;  1UG0 A;  3QYE A;  3HYI A;  3V8J A;  3TBI A;  2XIG A;  3RKY A;  4CYD A;  2NS8 A;  4NNJ A;  4MTE A;  4ON0 A;  2JA6 J;  1TW3 A;  3QU3 A;  1Z67 A;  1Z6T A;  4CCM A;  1TQM A;  3W6J B;  4G7H F;  4M3F A;  4YFX F;  2DU9 A;  4BHP A;  3CD6 I;  1I1S A;  2R7D A;  4ETS A;  3GX4 X;  3I71 A;  2XC7 A;  3GTL J;  2TDX A;  1T0F A;  1TT0 A;  1PVE A;  1S72 I;  5CVR A;  1FMW A;  2ZME C;  2DQL A;  2E1C A;  1I27 A;  2VJI A;  2YPR A;  4D7M A;  4CDG A;  1S9H A;  4PGH A;  5EDN A;  3BQY A;  2F5D A;  3DQV C;  4E7Z A;  3H3U A;  2LBF B;  4LG0 A;  1ON1 A;  1IXS B;  1OMI A;  3F8B A;  1X3U A;  3CCR I;  3PNV A;  1MGT A;  2DT7 B;  1KU2 A;  2GIZ A;  2VKD A;  4A2U A;  1BM9 A;  2PBI A;  1I50 J;  2RC4 A;  4HLX A;  4LG3 A;  4WK8 F;  3C2G A;  1FEX A;  3I3L A;  3NQO A;  3ROU A;  3GO5 A;  2M7B A;  3ZN1 A;  2IJL A;  2R7S A;  3FK6 A;  4JOM A;  1J9I A;  4JK1 X;  4U0V A;  4OMY A;  1V5F A;  4ZYD A;  5FKK A;  3BWG A;  4HRI A;  2KHM A;  4XBF A;  2CWE A;  4L9N A;  5IT9 K;  2L2O A;  5E3L A;  4HV5 A;  2BXY A;  3FKJ A;  4XM3 A;  5H6Q A;  5CVU A;  2MG4 A;  2X0L A;  5JLX A;  1UHS A;  3L2U A;  4OU0 A;  2X6Y A;  4EJU A;  3HG9 A;  5EJC A;  1W5C C;  1CF7 B;  4IHT A;  5HS9 A;  4XKV A;  1P6R A;  3BR3 A;  3IH4 A;  3HGG A;  4JP0 A;  2LC2 A;  1WRJ A;  2EZH A;  2RRE A;  3DU5 A;  3NEU A;  3MEX A;  4O6J A;  3OYM A;  2Y0M A;  1ONV A;  4KIS A;  1BI2 A;  2GAU A;  4CCO A;  2HOA A;  2V4J C;  1XB4 A;  1F1Z A;  4MEY F;  2Q0O A;  3GWZ A;  1X4P A;  3HOS A;  1HCR A;  1DPR A;  1GXQ A;  3IWF A;  5JFR A;  1ZN2 A;  5JVT A;  3GTO J;  2FBH A;  1WKM A;  4M73 A;  2K3F A;  5FRM A;  2RQP A;  3EYY A;  1QZY A;  1SFU A;  2L9N A;  1IXC A;  2Y0S N;  2V1X A;  2K9M A;  2DFE A;  4B1R A;  2V1N A;  1ZQ3 P;  2V9P A;  2W00 A;  2UUZ A;  3RPU A;  1JGS A;  2DMQ A;  2W84 A;  3LL7 A;  3CTA A;  3K2Z A;  3FM5 A;  2VBZ A;  3ZQG A;  4D5F A;  4S04 A;  1R4N B;  2P0W A;  1J75 A;  4PSW A;  1JJ8 C;  4DNC A;  4E7L A;  1LEB A;  2CUZ A;  2HS5 A;  1U5T C;  2RNJ A;  1NHA A;  2QQ8 A;  1X3Z B;  4NC8 A;  4PJN A;  2AO9 A;  3K69 A;  1RIO H;  3ZMT A;  4BE1 A;  5EEA A;  3F3X A;  3BJO A;  3IAM 2;  2ZNZ A;  3CMM A;  2X6O A;  1RRJ A;  3DKY A;  2K27 A; 
#chains in the Genus database with same CATH homology
 1G4D A;  2NNY A;  2E7W A;  2GXB A;  2DI3 A;  3QAH A;  2KKO A;  2DK5 A;  3MAJ A;  2FBK A;  1FYL A;  5D5U B;  2MD5 A;  2HEO A;  4EJO A;  2IVM A;  3IRQ A;  3NRV A;  4HA8 A;  1OYW A;  2L3D A;  3FXR A;  2WTE A;  1P4X A;  1SD7 A;  3I4P A;  1R5G A;  2NNN A;  3RIR A;  1HSJ A;  1FLI A;  4HBL A;  3J7A O;  5E17 F;  2O8X A;  4G9Y A;  5K5R A;  3V8K A;  4AIK A;  1R22 A;  1USS A;  1K79 A;  3MZH A;  1UST A;  4HQE A;  4EVI A;  3TO9 A;  2KRF A;  4UVA A;  1O7L A;  1W7P A;  2EJR A;  1BIB A;  2D1V A;  5JHU A;  3I64 A;  3PQK A;  2JT1 A;  3GFJ A;  2A5Y B;  3I5U A;  2OBP A;  2BE5 F;  3J80 Z;  2G7H A;  3HTS B;  3D5L A;  2FBI A;  5D4S A;  1T98 A;  2IW5 A;  2HZT A;  1YLF A;  2DLL A;  2LF7 A;  4MQ9 F;  1UB9 A;  4M6X A;  4CHU A;  1V4R A;  4I09 A;  4FT8 A;  4N0B A;  2V9V A;  5HLH A;  3HHH A;  1I6X A;  3DPT A;  3FMS A;  4ESB A;  1QZZ A;  3QPH A;  2ZO4 A;  1XSV A;  3WE2 A;  3K1M A;  1P92 A;  4AIJ A;  4K2E A;  4L9J A;  4HYE A;  1FNN A;  2OU2 A;  2XKO A;  3DP7 A;  4H0E A;  4ENN A;  1H9T A;  3QOP A;  2RKH A;  2CYY A;  3ECH A;  2RN7 A;  5DEQ A;  4MQV A;  1IF1 A;  3P9I A;  2JPB A;  2YX7 A;  4A0Z A;  2P8T A;  5J8C A;  2EV0 A;  2FEZ A;  2R3S A;  4TV7 A;  3RJP A;  1E17 A;  4ASN A;  4A0Y A;  2DBB A;  2F5C A;  4EJT A;  3JSP A;  2QVO A;  1IXR C;  2PMH A;  2IP2 A;  4M74 A;  1XCB A;  2CSO A;  3L9F A;  2Q2E A;  4R8H A;  1GHC A;  2CQK A;  4L9V A;  1XN7 A;  3KCC A;  5H6R A;  2OA4 A;  1R1T A;  3GEZ A;  2DFI A;  3JAM Z;  3DF8 A;  5LLQ A;  2ESN A;  4RB0 A;  1FC3 A;  4MGR A;  5LEJ A;  3F8F A;  3LQQ A;  5HS7 A;  3WOD F;  1R7J A;  3TOB A;  4BXU A;  1J2X A;  4AWX B;  1R23 A;  4A6E A;  2HFH A;  4XLP F;  5DYM A;  4M9X A;  3CUO A;  3CUQ A;  2GIV A;  1LB2 A;  4MHG A;  5E8I A;  1REP C;  2BBY A;  1B1B A;  3HSR A;  5FFX A;  3HOT A;  1B9N A;  1XMA A;  2XHK A;  4KN4 X;  3TQN A;  5TRD A;  5E1X A;  3WU0 A;  4KMF A;  4UNO A;  1BI1 A;  5ERI A;  3IHU A;  3E5Q A;  5HLI A;  4HV6 A;  2FU4 A;  4BH9 A;  2GQQ A;  3QP5 A;  4HQM A;  2AS5 F;  1FP2 A;  2CW0 F;  3ZMD A;  1G3S A;  5FLX K;  2QM3 A;  2P7C B;  2NS0 A;  2DT5 A;  5ICE A;  1CF7 A;  1OYI A;  3M1E A;  1SAX A;  4OIP F;  1FWZ A;  2XAJ A;  3F6V A;  4ENK A;  1IAW A;  4E70 A;  5L3F A;  2RGV A;  3TGN A;  1H0M A;  2ZME B;  2MC3 A;  5CVV A;  1BIA A;  1J5Y A;  3KEO A;  4ENM A;  2EFQ A;  2O03 A;  4HOB A;  4PZJ A;  5CJ9 A;  4HZF A;  3G3Z A;  1B4A A;  4Q47 A;  3O6B B;  2FOK A;  2FQ3 A;  3OV8 A;  2ZBK A;  1JHH A;  2FNA A;  2OZ6 A;  5K1Y A;  1JHF A;  2IA0 A;  2JRT A;  1O3S A;  5BS6 A;  4RB3 C;  1ON2 A;  2P5V A;  2XAH A;  4LLG F;  1RUO A;  2YU3 A;  2EFP A;  1TLH B;  1KU3 A;  1EH7 A;  5E20 A;  3N97 A;  3M8F A;  3I0T A;  3V4G A;  3LA7 A;  2J5P A;  5D5V B;  1BN5 A;  4P96 A;  2LNB A;  5L3B A;  1L3L A;  4KMU X;  4KT5 C;  1O57 A;  2VE9 A;  4IVN A;  2QBY B;  2JSC A;  3I59 B;  1U3E M;  4HF2 A;  2P4W A;  3KP5 A;  4LLN A;  1F9N A;  3KET A;  3KP6 A;  5AIQ A;  1XCV A;  5HDG A;  4XSX F;  1QNT A;  4XLN F;  5D6F A;  4LK1 F;  3WU1 B;  4ENJ A;  3WGI A;  3FF5 A;  1MJB A;  3F8M A;  2KIM A;  2O0Y A;  2ISY A;  4L0Z B;  3SFZ A;  3RI4 A;  1Z7U A;  2RVC A;  2D2W A;  3R0J A;  1PDN C;  5BOX A;  4KIG A;  2LDU A;  3WE3 A;  3D0S A;  3I54 A;  3ABT A;  2XAS A;  1JXS A;  3PFI A;  4KN7 X;  3CUQ B;  2ZJ2 A;  2ADU A;  3I58 A;  4N9H A;  4OIO F;  2BV6 A;  1MZB A;  1DP7 P;  3P7N A;  1WSU A;  4WXH A;  3N4M A;  2DPD A;  2XGX A;  1HW2 A;  2DPU A;  3I53 A;  4I7H A;  5TJJ A;  5BQT A;  2CG4 A;  3BZ6 A;  1T2K A;  5ILS A;  3VOD A;  3GFL A;  3KP2 A;  2FE3 A;  1ZG5 A;  2VT3 A;  2Z9O A;  4L0Y B;  2QZ8 A;  2STW A;  1FX7 A;  2IA2 A;  3ZQ7 A;  3K0L A;  4UUV A;  4P9U A;  1IN6 A;  4EGZ A;  1KU7 A;  5JI6 A;  2F5F A;  1BI3 A;  3C3W A;  3RKX A;  3F8N A;  2EV6 A;  5KVR A;  3F6O A;  4CO8 A;  4WXC A;  5LHH A;  2HQR A;  1TBX A;  4HX4 A;  4NB5 A;  1V3F A;  4A6D A;  2DAO A;  1YFH A;  4YG2 F;  2IT0 A;  3RPQ A;  1SD4 A;  2RDP A;  2PLY A;  4ZYE A;  4HAM A;  1BJA A;  4RAZ A;  3E6C C;  3Q5F A;  3BPX A;  4XSZ F;  3HRU A;  3J81 Z;  1E2X A;  2OAZ A;  3MQ0 A;  5ILU A;  4G94 A;  2M8E A;  2P5K A;  3TOA A;  2Z5U A;  5FD6 A;  2M5W A;  3HRS A;  2EK5 A;  1WWX A;  4B8X A;  3BJ6 A;  3FXU A;  2EFN A;  5LHG A;  4OOI A;  3TKY A;  2PEX A;  1R58 A;  1YO5 C;  1KA8 A;  5ILV A;  1K6O A;  4RB2 C;  1D8K A;  4A0X A;  1MDM B;  3B73 A;  5D5W B;  1ZAO A;  5LGN A;  1HBX G;  1MJ9 A;  5D4R A;  4KNY A;  1BBY A;  6PAX A;  3REO A;  1XDU A;  4HLY A;  4Q48 A;  3IKV A;  1UHW A;  4FX4 A;  1DDN A;  4EJW A;  3WGH A;  1QPM A;  2HR3 A;  3IKT A;  1QQI A;  1G3T A;  1AOY A;  2MLG A;  1IN7 A;  4RS8 A;  2WV0 A;  4WXD A;  3IRR A;  2PQ8 A;  5KK1 A;  1TQI A;  3WTU C;  3RYP A;  1K7A A;  3WTV C;  4Y17 A;  3K1N A;  1G3W A;  4OIR F;  2PI0 A;  3ZN0 A;  3SZT A;  1G6N A;  4I2O A;  2ZXJ A;  2FSW A;  4M71 A;  3Q9V A;  2P5L C;  2ZME A;  3MWM A;  1BOA A;  1XD7 A;  4AD9 A;  3MCZ A;  2YSR A;  1T39 A;  4GYI A;  3V7R A;  3KZZ A;  3RTR A;  2GA1 A;  2XAF A;  2RV8 A;  4A5N A;  1IRG A;  4I0A A;  4EMS A;  5BMZ A;  2XUB A;  1HW1 A;  1GVJ A;  3BOQ A;  1FSE A;  3KLN A;  4OMZ A;  5DD8 A;  1T6S A;  3ZMV A;  3M9A A;  1OPC A;  5D5X B;  5BPI A;  3JTH A;  2DK8 A;  4MEX F;  3JTG A;  2ESH A;  2VOO A;  4EGY A;  2E1N A;  2VBW A;  3VFZ A;  1FBQ A;  5DCF A;  4WCG A;  2X4H A;  3KP3 A;  2BGC A;  2DO7 A;  1YIO A;  1XGO A;  4QLC U;  4A5M A;  2A6H F;  1U6G A;  3ZMS A;  2YR2 A;  2VBX A;  5K5O A;  4P55 A;  4Y13 A;  2QYO A;  2QBY A;  2K7L A;  4ZZL A;  3I59 A;  4R79 A;  3F8C A;  5CLS A;  1F5T A;  1J7K A;  1U5T A;  3COA C;  2GXG A;  1L0O C;  4IRH A;  3ZMU A;  4HX8 A;  5LRS A;  1I5Z A;  2L01 A;  3HSE A;  2F2E A;  2G9W A;  1FP1 D;  2P7V B;  4HF1 A;  1MKM A;  1Z6R A;  3BRO A;  2DW4 A;  5ICG A;  3LA3 A;  1A04 A;  2FXA A;  2HKO A;  3VEP A;  2Z33 A;  5DCM B;  2HOE A;  2D45 A;  4Q4Z F;  1RI7 A;  1R1U A;  3IWZ A;  3T0Y A;  1RNL A;  1BC8 C;  5DV5 A;  2ETH A;  4CZZ A;  3B02 A;  2A68 F;  3VB2 A;  1U78 A;  5FB2 A;  2H09 A;  3O2P E;  3H92 A;  4QWQ A;  4GYG A;  2XV4 S;  1FOK A;  1H9G A;  4A12 A;  2L02 A;  1P2F A;  2M45 A;  2ZFW A;  2H6B A;  2IPQ X;  3FZV A;  1OR7 A;  3E5U A;  2UXN A;  2A07 F;  2VOP A;  1ZYR F;  3FWE A;  2ZKZ A;  4HDU A;  1TNS A;  2R7F A;  4GGG A;  4WX9 A;  1XGN A;  2XVC A;  1FY7 A;  5H20 A;  4M72 A;  3U2R A;  3GW2 A;  3ERE D;  3RDI A;  4LGW A;  2Y48 A;  5D6E A;  1HXD A;  1SMT A;  2QQA A;  5IT9 Z;  3HUG A;  3AAF A;  4P5O A;  2VOD A;  3HIF A;  3L7W A;  3BY6 A;  1MJA A;  3HSF A;  1XSX A;  2HDC A;  1Z05 A;  3EUH A;  4ZZD A;  4LLL A;  4EM1 A;  1EH6 A;  3WTS C;  3QPT A;  2CFX A;  2EB7 A;  3EDP A;  4I98 B;  2L54 A;  2GZW A;  4AIH A;  1HKT A;  5AON A;  2VN2 A;  2XAG A;  4UV8 A;  4G7O F;  1ZGA A;  1ZGJ A;  2QQ9 A;  5E18 F;  2BEO A;  3ML6 A;  2BYV E;  4LK0 F;  5L3C A;  3ISP A;  1IZ1 A;  5DUI A;  3WTW C;  2V79 A;  2QQB A;  1U8R A;  2MBF A;  2JTV A;  4BAY A;  3TDZ C;  1HW5 A;  3DV8 A;  5LBQ A;  3L00 A;  1S7O A;  1YW7 A;  1B6A A;  2MH2 A;  3PQJ A;  5CYV A;  3S2W A;  3R0A A;  3EYI A;  2LSO A;  2FA5 A;  1ZLK A;  5CVJ A;  1FPQ A;  1XGM A;  1MDM A;  1ZHF A;  1P4A A;  3KZY A;  1SD5 A;  3QU6 A;  5E8G A;  4CGZ A;  1IN5 A;  1K78 B;  1LNW A;  4AVP A;  4RAY A;  2D1H A;  2O3F A;  1HKQ A;  3W6K B;  1J0R A;  3R61 A;  2DTR A;  1MD0 A;  1W5T A;  1LDJ A;  2LKP A;  3KFW X;  4N9I A;  2HGC A;  1D8J A;  5E1W A;  5HS8 A;  4Y15 A;  3JSO A;  1KU9 A;  4G6Q A;  1U5T B;  3M7G A;  2MH9 A;  1B9M A;  3GZ6 A;  4RGR A;  2A3S A;  1PUE E;  3FM3 A;  4KFC A;  3GXO A;  1YS6 A;  2W57 A;  4LB6 B;  3DKW A;  1R00 A;  1SD6 A;  2XRN A;  4M6Y A;  5J8F A;  3QP6 A;  2ZCW A;  2EA4 A;  1R1V A;  5HVQ C;  3WTX C;  2V6C A;  4U7D A;  2K02 A;  1I1G A;  5F64 A;  2ELH A;  3JAM K;  2HKX A;  3HTU A;  4U0Y A;  1O3R A;  4U0W A;  1FYM A;  2O6G E;  3E6B A;  5JR3 A;  2UZK A;  2NAZ A;  1VTN C;  1O3T A;  3ELK A;  5FFZ A;  4KDP A;  4NHJ A;  1EH8 A;  3LWF A;  4R1H A;  4I01 A;  1AWC A;  2IRF G;  1LVA A;  3T1B A;  1S6L A;  1R36 A;  5D8L B;  3E97 A;  4LFU A;  3RKW A;  2JPC A;  3U1D A;  2M30 A;  1P4W A;  2W24 A;  4PDK A;  1WI9 A;  2EFW A;  3H3Z A;  2FNP A;  5DD4 A;  1DUX C;  3E6D A;  4D0P A;  3GF2 A;  4YFN F;  4MNU A;  3GFM A;  4KIF A;  1TW2 A;  1KYW A;  3KE2 A;  5CVI A;  1O3Q A;  1QBJ A;  5A2Q K;  3WGG A;  2F5E A;  5DDG A;  4GO1 A;  3K1P A;  5J6X A;  1ODD A;  2HTS A;  3BJA A;  2Q8K A;  4HW0 A;  2P6T A;  4L9T A;  3ZPL A;  3SZP A;  5DCM A;  3ZP5 A;  3FMQ A;  1F4K A;  4U7B A;  2MA3 A;  4IRI A;  1Q1H A;  3WTT C;  1WQ2 A;  3EQL F;  2A61 A;  5ICC A;  1ZH5 A;  1IW7 F;  1ZG3 A;  3BP8 A;  2QUF A;  3LQR A;  3WTY C;  1FT9 A;  4ZH4 F;  4F7Z A;  2L4A A;  1ZRE A;  1KQ9 A;  1IN8 A;  1FBS A;  2NYX A;  5IT3 A;  2PJP A;  3LFK A;  1SMY F;  4BYY A;  1CGP A;  3E6M A;  3KEQ A;  2A6E F;  2ACJ A;  1PP8 F;  1S7A A;  3JW4 A;  1ZRD A;  1ZG1 A;  1QO0 D;  2VON A;  4I02 A;  4KIB A;  4GCV A;  4BHB A;  2OZU A;  5F6F A;  3HHG A;  2QWW A;  1UCR A;  5FLX Z;  2COM A;  4KIC A;  3CUQ C;  4EM2 A;  4L5I A;  3DXJ F;  2AXL A;  1HKS A;  4M9S A;  2ZNY A;  3E3V A;  2YX4 A;  1FSH A;  1GXP A;  4HX7 A;  4RGS A;  4UVC A;  2KIU A;  3O3K A;  2FF4 A;  4KUM A;  3GZ5 A;  2NRA C;  1J59 A;  5F1R A;  1S29 A;  4ZYH A;  2Z3Y A;  3TDU C;  5L3E A;  3CDH A;  4JBA A;  2MLK A;  1ZLJ A;  4BQA A;  4Z2Y A;  1DPU A;  3V8L A;  1BC7 C;  2EV5 A;  3R6S A;  1Z1D A;  5FD5 A;  2VC0 A;  3V7S A;  4OIN F;  3DFG A;  2M1B A;  3VOE A;  5LHI A;  3WTZ A;  4FX0 A;  3DPL C;  2EWN A;  1KYZ A;  4B09 A;  1RZ4 A;  1W4M A;  4P9F A;  5EEG A;  4HF0 A;  4DQ2 A;  3GLX A;  4YFK F;  5FO5 A;  4IF4 A;  5DUK A;  4LG0 B;  1K78 A;  3C18 A;  3OOP A;  4WF2 A;  3T8R A;  4IRG A;  3P9C A;  3BDD A;  1YG2 A;  3SHF A;  2PMU A;  1FYK A;  2EA2 A;  1YQA A;  2VXZ A;  4UHT A;  4PCQ A;  2CGP A;  3SXY A;  1HQC A;  3T8T A;  4YII A;  4I0B A;  1RUN A;  4XRF A;  3CO6 C;  5ED4 A;  2K4J A;  4Q5S F;  3R60 A;  4ESF A;  3QRF F;  2V1U A;  3CO7 C;  2J5O A;  2HWV A;  1S3J A;  3R4K A;  4NQW A;  3WG9 A;  1SFE A;  4HDV A;  2JZY A;  5HOO A;  5LGT A;  3KP4 A;  2CO5 A;  4EV0 A;  3HRM A;  1IUY A;  1XDS A;  3F23 A;  5LGU A;  5L3D A;  3EET A;  5L3G A;  1ZAR A;  2E7X A;  3P9K A;  1G3Y A;  3LA2 A;  2OQG A;  2P6S A;  1YW9 A;  2C6Y A;  3J81 K;  3GVA A;  2FMY A;  3FX3 A;  5HDN A;  5EEH A;  1KGS A;  4CXF A;  1S8N A;  4JQF A;  4LD5 A;  4L5J A;  4IXA A;  2VC1 A;  2VT2 A;  3ABU A;  1C0W A;  1FZP B;  4KA4 A;  4G7Z F;  1ZRF A;  1Z91 A;  2OQR A;  3T5X A;  1PP7 U;  4G6D A;  2QEN A;  4MTD A;  3LST A;  1Z9C A;  2VE8 A;  3C7J A;  1B59 A;  2O61 A;  1W7P D;  1YS7 A;  4CIC A;  2PN6 A;  1ULY A;  2OD5 A;  2H27 A;  2FRH A;  2HYF A;  1JE8 A;  4RGU A;  4IPA A;  3BPV A;  3F21 A;  3KP7 A;  3IC7 A;  3HRT A;  4EM0 B;  2FML A;  4IJA A;  2GA2 A;  5HDK A;  1Y0U A;  2K4B A;  1YW8 A;  3G73 A;  3MFK A;  2GWR A;  4UV9 A;  1STZ A;  3L09 A;  3KLO A;  3C1D A;  3SQN A;  3CLO A;  4UVB A;  3CJN A;  2KJC A;  4U88 A;  2KJB A;  3RYR A;  1XGS A;  4WWC A;  5LRR A;  2A69 F;  2EFO A;  1YYV A;  2KIF A;  2UWM A;  1W5S A;  3E5X A;  2XAQ A;  2ISZ A;  3GUD A;  2UXX A;  5ICF A;  1HST A;  2W85 A;  2WC2 A;  3M8E A;  1IRF A;  5A2Q Z;  2LF8 A;  5E1Z B;  4BHC A;  2L4M A;  3TO7 A;  4PGG A;  1QGP A;  3IL2 A;  1LEA A;  2XRO A;  1W7P B;  4UXN A;  3ULQ B;  4FHT A;  5K5Q A;  3V7C A;  2HTJ A;  1U2W A;  4RB1 A;  2IA1 A;  4LMY A;  3TO6 A;  2H6C A;  1TTY A;  4EJV A;  2VBY A;  3ECO A;  1LDK B;  5LEK A;  2QLZ A;  3U9G A;  1D3Y A;  4YIF A;  1YTY A;  1FBU A;  3J80 K;  1TNT A;  4KYW A;  3F22 A;  3K9T A;  5FGM A;  2M87 A;  5HLG A;  2B0L A;  2V1D A;  1TQP A;  4ESJ A;  2HQN A;  4GXO A;  1KQ0 A;  1KQ8 A;  3GFI A;  3LAJ A;  1XSD A;  2HYG D;  3ZMZ A;  1D5V A;  1LDD A;  4EQQ A;  2G7U A;  2XKP A;  4BNC A;  2STT A;  2H94 A;  1LJ9 A;  4S05 A;  5AIP A;  3FHZ A;  3FXQ A;  2Z99 A;  4RGX A;  2WWY A;  4OIQ F;  2PG4 A;  3MZY A;  3F72 A;  2K86 A;  1T38 A;  1ZRC A;  1BI0 A;  1SFX A;  1R5H A;  4LJZ F;  4LB5 A;  1LQ1 A;  3DEU A;  3LAP A;  1OYY A;  1IN4 A;  5BPD A;  3GYH X;  4M9Z A;  4IHS A;  1UHM A;  1UFM A;  2PFB A;  4G8X A;  3Q9S A;  2Y75 A;  5D8K B;  2DQR A;  4L18 B;  1O7F A;  2W25 A;  4O3M A;  3FMR A;  3L2C A;  4ZYG A;  1OKR A;  1XMK A;  1EV7 A;  3HYI A;  3V8J A;  2XIG A;  3RKY A;  4CYD A;  4MTE A;  4ON0 A;  1TW3 A;  3QU3 A;  1Z6T A;  1TQM A;  3W6J B;  4G7H F;  4YFX F;  2DU9 A;  4BHP A;  1I1S A;  2R7D A;  4ETS A;  3GX4 X;  3I71 A;  2TDX A;  1T0F A;  5CVR A;  2DQL A;  2E1C A;  1I27 A;  2YPR A;  4CDG A;  4PGH A;  2F5D A;  3DQV C;  3H3U A;  4LG0 A;  1ON1 A;  1IXS B;  1OMI A;  3F8B A;  1X3U A;  1MGT A;  1KU2 A;  4A2U A;  1BM9 A;  2PBI A;  2RC4 A;  4HLX A;  4WK8 F;  3NQO A;  3ROU A;  3GO5 A;  3ZN1 A;  2IJL A;  1J9I A;  4JK1 X;  4U0V A;  4OMY A;  4ZYD A;  3BWG A;  4XBF A;  2CWE A;  4L9N A;  5IT9 K;  4HV5 A;  5H6Q A;  5CVU A;  2X0L A;  4OU0 A;  4EJU A;  1CF7 B;  4IHT A;  5HS9 A;  1P6R A;  4O5V A;  3NEU A;  1WRJ A;  3MEX A;  4O6J A;  2Y0M A;  1ONV A;  1BI2 A;  2GAU A;  1XB4 A;  1F1Z A;  4MEY F;  2Q0O A;  3GWZ A;  3HOS A;  1DPR A;  1GXQ A;  3IWF A;  5JFR A;  1ZN2 A;  5JVT A;  2FBH A;  1WKM A;  4M73 A;  2RQP A;  3EYY A;  1QZY A;  1SFU A;  1IXC A;  2V1X A;  3RPU A;  1JGS A;  2W84 A;  3CTA A;  3K2Z A;  3FM5 A;  2VBZ A;  4S04 A;  1J75 A;  4DNC A;  1LEB A;  2HS5 A;  1U5T C;  2RNJ A;  1NHA A;  3K69 A;  1RIO H;  3ZMT A;  3F3X A;  3BJO A;  2ZNZ A;  2K27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...