3T8RA

Crystal structure of staphylococcus aureus cymr
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
126
structure length
122
Chain Sequence
STKGRYGLTLMISLAKKEGQGCISLKSIAEENNLSDLYLEQLVGPLRNAGLIRSVRGAKGGYQLRVPAEEISAGDIIRLLEGPESIESEPPAQKQLWIRMRDAVRDVLDNTTLKYLAEYVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Staphylococcus aureus CymR Is a New Thiol-based Oxidation-sensing Regulator of Stress Resistance and Oxidative Response.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Unknown function
molecule keywords Staphylococcus aureus CymR
total genus 43
structure length 122
sequence length 126
ec nomenclature
pdb deposition date 2011-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02082 Rrf2 Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3t8rA00
2Z33A 2CWEA 4A12A 1P92A 3HTSB 2IRFG 5JVTA 1BIAA 2P7VB 4MTEA 2MLKA 4GYGA 2EWNA 4LLGF 4CYDA 3KLOA 3ZMVA 3GWZA 4G7OF 4I02A 2RC4A 2FU4A 3L9FA 4R79A 3T8RA 1EH7A 4EQQA 3LWFA 1FLIA 3K1MA 2COMA 3ZMTA 1U78A 2E7XA 2XROA 3HSFA 4PDKA 3T8TA 3WTTC 3WGGA 1XSDA 2E7WA 3IRQA 5F64A 1EV7A 2EV0A 2XGXA 3C18A 2XHKA 2LF7A 4EGYA 1RIOH 2MH9A 5CLSA 4M9XA 2PJPA 3R0JA 2OBPA 4HV5A 5IT9Z 4CZZA 4Q5SF 5L3FA 3KEQA 1R58A 1USSA 4ZYGA 2XV4S 3J81Z 1DPUA 1R5GA 1G4DA 3I58A 1K7AA 3LAPA 4OU0A 4WF2A 1J0RA 4LD5A 1O3TA 2ZXJA 2PBIA 4GXOA 1AOYA 2GAUA 1SD4A 3EETA 3FF5A 5ILSA 4XLPF 1STZA 2HQRA 2ACJA 1TQMA 3SQNA 1RI7A 4UVBA 1S29A 2GZWA 1YO5C 1YTYA 5AONA 1FYLA 4MEXF 4I0AA 3R61A 2HQNA 1KA8A 3FM5A 1YQAA 4LLLA 2K86A 2ZMEB 4G7ZF 2QM3A 4WXHA 3H92A 2FBIA 4A6EA 2A68F 2QZ8A 2QUFA 3GZ5A 5FGMA 3N4MA 3C7JA 2VONA 1QO0D 2IT0A 4OIOF 1ODDA 4ESFA 5ICFA 5FLXZ 1FP2A 2PN6A 1G3SA 3RKXA 1OPCA 4AIKA 2AS5F 2KIUA 4CGZA 2NAZA 2MH2A 5J8CA 4ENNA 3LA3A 5E1WA 3L09A 2A61A 3FMQA 2GQQA 4LK0F 1IZ1A 5K1YA 4ZYDA 5F6FA 3DQVC 4RB3C 1P4WA 2ISZA 4U0WA 5IT3A 3NEUA 3R6SA 2IA2A 3DV8A 4DNCA 1KU7A 2BYVE 2O6GE 4G94A 1UHWA 2IA0A 1ZLJA 2ISYA 1KU9A 1BI0A 1QNTA 1XB4A 1E2XA 1HW1A 3BP8A 1XMAA 3E5XA 2DPDA 4KFCA 1HSJA 1Z9CA 1ZN2A 2Q0OA 3WTUC 4IJAA 4A2UA 3TKYA 5DEQA 5J8FA 1W4MA 2Z99A 3PFIA 4O5VA 2H6BA 2GA1A 2RQPA 1P6RA 4EMSA 3IKVA 4ETSA 2FE3A 1K6OA 4LJZF 2ZNYA 3QAHA 2VE9A 3FMRA 4L5JA 1W5TA 2DQLA 3KP6A 1TQPA 3BY6A 4EV0A 4BQAA 2H27A 2VBZA 1U5TC 4HBLA 3TOBA 1FYKA 1V3FA 3VFZA 3AAFA 3N97A 2OZ6A 4HDVA 5DUIA 1Z7UA 1JGSA 2DLLA 1S7AA 5LRSA 3EUHA 5CJ9A 4YFKF 4XLNF 1DUXC 3KFWX 4M9ZA 1T2KA 1I1SA 1BOAA 2DK8A 1K79A 3RYRA 3DFGA 1YW9A 1YS6A 2YX7A 5FLXK 1ZG1A 1FBQA 1TLHB 5JI6A 3IL2A 3IHUA 4LG0A 4BYYA 3HRTA 2PI0A 1QBJA 4UV8A 5DD4A 5FD5A 4A0YA 1FX7A 1G3WA 2JSCA 2QLZA 2K02A 2FMLA 1G3TA 3WODF 2P6SA 3D5LA 5LGUA 5TRDA 4IHTA 2CFXA 2ETHA 2DTRA 4GYIA 5BQTA 1WRJA 3E97A 1PP8F 2WWYA 3VB2A 2RKHA 2EJRA 3KP2A 1YG2A 3K1PA 1PDNC 2XAGA 3V4GA 3KP3A 2L3DA 1FZPB 4ZYHA 1HKTA 1B9NA 4FT8A 4ZH4F 2MA3A 1KYZA 2VBYA 1IF1A 2XVCA 2XUBA 3WGIA 2MLGA 3GFIA 3I54A 3GO5A 1IRGA 1I6XA 2XIGA 1U2WA 3M9AA 2K4JA 3MCZA 4HF2A 2HDCA 1T0FA 2HGCA 2BEOA 2KKOA 1YS7A 3KZZA 3TDZC 3ZMDA 1TBXA 2P7CB 3QPTA 5D5VB 3DF8A 3QPHA 4L5IA 4R1HA 2STWA 2Y75A 2G9WA 2V1UA 4HW0A 4EJVA 5EEHA 2OD5A 4P9UA 1GXQA 3GW2A 1F5TA 3T5XA 3VEPA 2DBBA 4U7DA 2FBKA 1XSXA 3L7WA 4HAMA 1XCBA 3CUQC 5K5OA 3HUGA 1H9GA 3L2CA 4UVAA 1Y0UA 3RPQA 1ZGJA 3QRFF 4IRIA 5F1RA 4KDPA 3VOEA 1WWXA 1B9MA 1HBXG 3M8FA 1W5SA 1G3YA 3FHZA 3WTSC 1T39A 4R8HA 3GZ6A 1HQCA 2DFIA 1WKMA 3JSOA 1T38A 1OYYA 3TOAA 2GWRA 2IW5A 4GCVA 3CUQB 2M8EA 3CDHA 1Z1DA 4WXCA 4HZFA 2HWVA 4P55A 1S7OA 3BZ6A 1YLFA 5D4SA 2RDPA 1QPMA 3WE3A 3E6DA 2G7HA 1OKRA 1KGSA 3F8BA 4RB2C 4KN4X 2M87A 1U5TA 4XSZF 1P4XA 5J6XA 2EV6A 3U1DA 4CHUA 5D4RA 2IJLA 5E1ZB 3TDUC 3ECOA 2CO5A 3CLOA 4YFXF 2K7LA 1I27A 3V8LA 4RS8A 4XSXF 1Q1HA 4KT5C 3RDIA 5HS8A 3BJOA 1W7PA 3V7SA 2IP2A 4M6XA 4PCQA 3IKTA 2XRNA 4ESBA 1LDKB 3HTUA 2A69F 1FP1D 2JRTA 2R7FA 5FD6A 1KU3A 1BI1A 3F8NA 2FF4A 3RKWA 4D0PA 2P5LC 3ZMZA 3HSRA 2X4HA 3HHHA 1U8RA 3C3WA 2KJCA 5IT9K 1TNTA 4UHTA 1DDNA 3HOSA 2O61A 4LB5A 3FMSA 3TGNA 1ZRCA 4EJUA 4L9TA 1LVAA 1SD6A 2W84A 3MQ0A 2O03A 4MQ9F 2UXXA 3E6CC 4O6JA 2VT3A 2M30A 3U9GA 2KIFA 1TW2A 3EYYA 4ON0A 3DEUA 4LGWA 3I5UA 5JR3A 2MBFA 5CYVA 3CO6C 3COAC 5K5QA 3F23A 1CGPA 2H6CA 3K1NA 2UXNA 3HSEA 1L0OC 4HQMA 3WU0A 3WGHA 2WV0A 3I59A 2BGCA 1HXDA 2UWMA 3WTXC 5ED4A 4HF0A 1MJAA 1ULYA 4OMYA 2J5OA 2F2EA 3F8FA 1W7PD 1FBUA 2YPRA 5LGTA 5ILUA 6PAXA 3MZYA 1K78A 2HEOA 5HDGA 1H0MA 2VBXA 3K9TA 2A3SA 1BC7C 3ZPLA 3KP4A 3J80Z 3OOPA 2WC2A 4ENMA 4BHCA 4I09A 2EB7A 3DPTA 4UVCA 4P5OA 3HRMA 3ML6A 4EM1A 5L3GA 3PQJA 2LKPA 2VN2A 5ICEA 3GLXA 3MWMA 1KYWA 2EFWA 3WTVC 3FX3A 1B1BA 5AIPA 3KCCA 5HLHA 4M6YA 5ERIA 3P9IA 3JTGA 4P9FA 1ZYRF 2UZKA 4HF1A 3I59B 1QZZA 1ZGAA 1LDJA 1XDUA 1ZH5A 4EM2A 3P9KA 3IWFA 2EFNA 1WSUA 2J5PA 1YIOA 4I98B 1R22A 1MD0A 2D2WA 4RB0A 5D6FA 2GIVA 2QWWA 3E3VA 4HDUA 1ZRFA 5E8GA 2VT2A 1O57A 3JAMZ 1NHAA 1V4RA 1IN8A 1H9TA 2Z9OA 5KK1A 4RGUA 4A0ZA 2M1BA 2FRHA 4QWQA 1SFXA 2BBYA 3F72A 1B6AA 5DD8A 2XAHA 1E17A 5JHUA 2QQBA 2D45A 3GXOA 5L3BA 3ERED 4PGGA 5DUKA 1ZHFA 1FOKA 1TNSA 4WCGA 3ULQB 1BN5A 1YW8A 1LQ1A 3BDDA 1XGNA 1LEBA 5ILVA 2YSRA 1IRFA 1U5TB 2QVOA 1SMTA 1ZG3A 5L3DA 4LMYA 2L4AA 4UXNA 5EEGA 2VOOA 3LSTA 1BI3A 2EV5A 2WTEA 1I1GA 2L54A 2P5VA 4P96A 4I01A 3E5QA 3FXQA 1D5VA 2DAOA 2IVMA 4MGRA 4XRFA 5HS7A 2STTA 2F5FA 2P4WA 2DPUA 1QZYA 3O3KA 3GFLA 2DK5A 2OQRA 2FBHA 4IRGA 3RKYA 1XGOA 3WE2A 2HYGD 3HRSA 3KP5A 1TTYA 2DI3A 1BJAA 1ZAOA 2Y0MA 2Z3YA 3ZN1A 4CXFA 3S2WA 4ZZLA 2PQ8A 2HYFA 4KMUX 2P8TA 3W6KB 4HLXA 2AXLA 5A2QK 1KU2A 2FMYA 3R4KA 4EJTA 4G9YA 5FB2A 2OU2A 1CF7B 2DU9A 3I64A 4IVNA 5FFZA 1Z6RA 5DYMA 2JZYA 3RTRA 1HW2A 3Q9VA 2A07F 1XD7A 1IN4A 2E1NA 5D5UB 1YYVA 2NYXA 4Y13A 2W57A 2P6TA 1O3QA 5D6EA 4KIGA 2VC0A 3KEOA 4NQWA 5CVVA 2OA4A 2RN7A 5L3CA 3P9CA 4FHTA 2A5YB 1HKQA 1D8KA 3RYPA 3GX4X 3ZMSA 1YFHA 3MEXA 4KIFA 2P5KA 2XKOA 3ELKA 4AWXB 4H0EA 3CJNA 1LDDA 5DV5A 4OIPF 3GUDA 5E8IA 1SD7A 1R36A 1JXSA 2RGVA 2YR2A 3GEZA 1XSVA 3DPLC 3T1BA 2F5CA 3QU6A 2XASA 4L9VA 2QYOA 2NS0A 1FPQA 1CF7A 1IN6A 2ZFWA 5CVRA 2D1HA 4N9HA 2DQRA 2ZCWA 4WWCA 4B8XA 3FXUA 3Q9SA 4B09A 2ESHA 5BPDA 3ISPA 3TQNA 1ON2A 4N0BA 1ON1A 5K5RA 1R1VA 4JK1X 3QP5A 3F3XA 1HKSA 4Z2YA 3LFKA 4KICA 4LG0B 3SHFA 4G7HF 2HTJA 2V9VA 4WK8F 4EM0B 4YG2F 4A0XA 1O3RA 2FA5A 5DCFA 5ICCA 1U3EM 2YX4A 2LF8A 4IRHA 2VOPA 4EVIA 1O3SA 1UB9A 5H6QA 4HA8A 1WQ2A 4XBFA 2OZUA 4IPAA 2QBYB 1UCRA 2BE5F 4EJWA 4CICA 3V8JA 4M73A 4PZJA 1SAXA 1MZBA 5CVJA 1R00A 3CUQA 2A6HF 2RV8A 3ECHA 2L02A 4ZYEA 2HS5A 4BH9A 1HW5A 3I0TA 4MEYF 1LB2A 1BBYA 5LRRA 4IXAA 2QQ9A 3L00A 2EA4A 2VBWA 2MD5A 4M74A 3DKWA 3MFKA 1A04A 4NB5A 1OYIA 4TV7A 2W85A 4HQEA 1BM9A 1F9NA 3BPXA 4KUMA 5LLQA 4A5NA 3NQOA 3MAJA 4MQVA 3BWGA 3ZN0A 1JHFA 3D0SA 4A5MA 2CW0F 2EA2A 3JSPA 1GHCA 3G3ZA 5D8KB 2O0YA 3SZPA 4HX7A 3V8KA 3BJ6A 3ABUA 2CG4A 3KLNA 2HOEA 1FSHA 1ZLKA 2XAFA 2X0LA 1USTA 4U7BA 1TW3A 2KIMA 3O2PE 4OINF 2CSOA 2IPQX 1MDMB 1SFUA 3IWZA 2QENA 3NRVA 2FXAA 1RUOA 4IF4A 1KQ8A 2VE8A 2Q8KA 2FQ3A 3ABTA 2CYYA 4U0YA 1BC8C 4M72A 1O7FA 2O3FA 4KNYA 2ZKZA 2PMUA 1GXPA 2TDXA 2QQAA 5LEKA 1TQIA 3SZTA 3B02A 3ZP5A 5CVUA 3ZMUA 3WG9A 4GGGA 2R3SA 3OV8A 4HOBA 1GVJA 1B4AA 1R23A 2EFPA 4KN7X 4OOIA 3O6BB 4Y15A 5D5WB 4I0BA 2F5DA 4G6DA 1PUEE 5HS9A 4YIFA 2DW4A 4L0YB 5LEJA 3CUOA 4KYWA 1T98A 2R7DA 1T6SA 2Y48A 5A2QZ 2O8XA 1XGSA 3IC7A 1OYWA 1PP7U 3BROA 4U88A 3EQLF 2QBYA 3M7GA 1D8JA 2L4MA 2V1DA 1SMYF 1J5YA 3DXJF 2FSWA 3LAJA 3GFJA 2BV6A 2PLYA 1JE8A 5E20A 2HKXA 4IHSA 1OR7A 2V6CA 1IN5A 2HZTA 3TO7A 1P2FA 2ESNA 3QOPA 4N9IA 5DCMB 3SFZA 4NHJA 2FEZA 5DDGA 2B0LA 3F21A 1B59A 5HOOA 4ESJA 1OMIA 2NRAC 4UV9A 4LB6B 3F6OA 2XAJA 4I7HA 1XDSA 2G7UA 5H20A 3BOQA 4ZZDA 2CQKA 5E17F 2K4BA 3KE2A 4S05A 3HHGA 2FOKA 4O3MA 3M8EA 1FY7A 2V79A 4Y17A 3M1EA 1MJBA 1JHHA 4CDGA 4ENKA 4KMFA 2M45A 2XAQA 5FFXA 4I2OA 3KP7A 5TJJA 1R7JA 4G6QA 2IA1A 2HR3A 2JT1A 1XGMA 5BPIA 4L18B 4FX4A 2GA2A 1RNLA 1XN7A 2ZO4A 3G73A 1J9IA 2M5WA 3F8MA 2ZBKA 3F8CA 5FO5A 4BHPA 1J75A 5LHGA 3TO9A 2LDUA 1D3YA 1Z05A 4KA4A 1I5ZA 1Z91A 2ELHA 3H3UA 4UUVA 1S3JA 1YW7A 3K69A 3J80K 3QP6A 2E1CA 3E6MA 2MC3A 3I71A 3K0LA 2DT5A 3LA2A 3HIFA 3WTZA 1MDMA 3W6JB 1FNNA 4M9SA 2GXGA 4E70A 5H6RA 3PQKA 3HYIA 2JPBA 4BXUA 1IN7A 3IRRA 1XCVA 4AIJA 3C1DA 4ENJA 3J81K 4HYEA 4QLCU 1EH8A 2NNYA 2PMHA 4AVPA 3R0AA 3KZYA 1J59A 1SD5A 4RGXA 3QU3A 2YU3A 4Q4ZF 4JBAA 2PG4A 4F7ZA 1MJ9A 3FZVA 2HTSA 3GFMA 3MZHA 5D5XB 3EYIA 5E18F 4OMZA 1DP7P 3GF2A 1O7LA 4HLYA 1MKMA 4MHGA 4AD9A 1IW7F 5HDKA 2OAZA 2V1XA 4L0ZB 3RPUA 3LQQA 4YIIA 3BJAA 2KJBA 4MTDA 3RIRA 3JAMK 3FXRA 4U0VA 1EH6A 2FNAA 3BPVA 4MNUA 1BIBA 1J2XA 1LJ9A 1L3LA 1IXCA 1IUYA 4K2EA 2GXBA 1S6LA 2ZJ2A 1UHMA 3LA7A 3Q5FA 4L9JA 4RGSA 5E1XA 2DO7A 2PFBA 1QGPA 1R5HA 1FT9A 4LFUA 3F6VA 5ICGA 1XMKA 1KQ0A 4S04A 2LNBA 3E6BA 2LSOA 4EJOA 1LNWA 1R1TA 3JTHA 5HVQC 1R1UA 5LHHA 5HLGA 2H09A 2C6YA 2JTVA 3CO7C 4RB1A 3H3ZA 5CVIA 3ZQ7A 5JFRA 4LK1F 3U2RA 1K78B 3ROUA 2FNPA 4OIQF 2VODA 1RUNA 1P4AA 4UNOA 3P7NA 2Q2EA 4EGZA 4FX0A 4HX4A 2XKPA 2A6EF 1VTNC 3WTWC 4ASNA 1SFEA 4PGHA 1DPRA 1MGTA 4M71A 5BS6A 3HRUA 2RVCA 1WI9A 3SXYA 2Z5UA 1ZARA 2OQGA 1FWZA 1C0WA 3HOTA 1QQIA 4RGRA 1FYMA 4Q48A 2L01A 2K27A 2KRFA 4RAZA 4HV6A 1AWCA 4G8XA 3WTYC 1KQ9A 3GYHX 3T0YA 5D8LB 4Q47A 5DCMA 1F4KA 2ZNZA 2EFOA 2D1VA 3JW4A 5AIQA 3J7AO 4RAYA 2EK5A 3WU1B 3FWEA 1RZ4A 3TO6A 3DP7A 4BNCA 2EFQA 4YFNF 2PEXA 5LBQA 2ADUA 4DQ2A 1ZRDA 3V7RA 1IXSB 3R60A 4AIHA 2NNNA 4LLNA 5KVRA 2ZMEA 1IAWA 4JQFA 4WX9A 4WXDA 3E5UA 2F5EA 1Z6TA 1LEAA 2VXZA 1FSEA 3I53A 4OIRF 4CO8A 3GVAA 3REOA 3EDPA 2HFHA 3FM3A 4HX8A 3RI4A 1U6GA 1IXRC 2CGPA 5LHIA 1G6NA 1BI2A 2W25A 3I4PA 3VODA 5LGNA 1FBSA 2HKOA 1X3UA 5L3EA 3B73A 3K2ZA 1J7KA 2RNJA 4GO1A 5BMZA 1F1ZA 5BOXA 2W24A 3V7CA 4BHBA 3KETA 4BAYA 1ONVA 5HDNA 1W7PB 1REPC 1UFMA 3F22A 4L9NA 3LQRA 1S8NA 3CTAA 1FC3A 1HSTA 2H94A 1ZG5A 4A6DA 2JPCA 2VC1A 4KIBA 3RJPA 5HLIA 1ZREA
chains in the Genus database with same CATH superfamily
2Z33A 2CWEA 2VQHA 3UNGC 4A12A 4A3JJ 1P92A 3HTSB 2IRFG 4CCJA 5KHDA 5JLWA 3S93A 4PJJA 3GTJJ 2XSDC 5JVTA 3OS0A 1W36C 1BIAA 2P7VB 1MSFC 4MTEA 2K9QA 2DDBA 1W1WE 2QEXI 2MLKA 3GTQJ 3Q0WA 2VXDA 3G71I 1ETYA 2EWNA 4GYGA 4LLGF 3IH4A 3FISA 2LMDA 3SYTA 4CYDA 3KLOA 3ZMVA 2IAIA 3FXOA 3GWZA 4G7OF 4LIVA 3S15J 4I02A 2RC4A 4BE1A 1JUPA 1RKTA 1JJ8C 2Q1ZB 3ZR8X 2LYCA 2OCEA 2FU4A 3L9FA 4R79A 2F5VA 3T8RA 1EH7A 1UG0A 2DT7B 2MSYA 4G6TB 3GTMJ 4EQQA 5FKLA 5DM7F 3Q0UA 3BR1A 3JRDA 1X2MA 3LWFA 4DZJA 2KZVA 1FLIA 2JA7J 3K4KA 3K1MA 2COMA 3LSHA 3ZMTA 5F08A 2IS6A 3HPGA 1NTCA 2DJNA 1EF4A 1U78A 2E7XA 1F36A 2XROA 1WPKA 2OUMA 3TP3A 1WH7A 5GADJ 3HSFA 1SFOJ 4PDKA 3T8TA 3WTTC 2I5UA 4AC0A 4RDUA 3WGGA 2CW7A 1XSDA 1MBEA 3QQAA 2AHQA 2E7WA 3IRQA 5F64A 2KRHA 2NXNB 1EV7A 2QF7A 2LY1A 4BL0B 3ABKH 2EV0A 2XGXA 3C18A 2DMPA 2XHKA 2LF7A 3H35A 1GV2A 2R5YA 4EGYA 1RIOH 3X2QH 4EATA 2MH9A 3L2WA 2VLAA 5CLSA 1W0UA 4PSWA 4ZJZA 4M9XA 3CMEI 3HKZN 2PJPA 3R0JA 2OBPA 2L9SA 4HV5A 3BZCA 4CZZA 5IT9Z 4Q5SF 5L3FA 3KEQA 1R58A 1USSA 1Y1VJ 3OMYA 4ZYGA 2XV4S 3J81Z 2L2OA 5GAHJ 4M3EA 1YIJI 5IYDJ 5GPCA 3FDYA 1SVLA 1R5GA 1DPUA 1G4DA 3GCMA 3I58A 1K7AA 3LAPA 4OU0A 4PFOA 4WF2A 1J0RA 4LD5A 1O3TA 2ZXJA 2PBIA 4GXOA 1AOYA 1FOYA 2GAUA 2IGOA 1SD4A 3EETA 3FF5A 5ILSA 4XLPF 1STZA 2HQRA 4V2GA 1UG2A 2ACJA 1TQMA 3SQNA 1HCRA 1RI7A 4NQWB 4UVBA 1S29A 2GZWA 4FQGA 1YO5C 1YTYA 1AHDP 1YJWI 5AONA 1FYLA 4MEXF 4I0AA 3R61A 2XPUA 2HQNA 1KA8A 3FM5A 4BQQA 1YQAA 2Z1DA 3OYIA 4LLLA 2E60A 2K86A 2ZMEB 3K4JA 4G7ZF 2IGMA 1JUSA 1U8BA 4B48A 2QM3A 3LMMA 3LSIA 2E1OA 4WXHA 3OYLA 2R93J 2DJIA 3H92A 4IQJA 2FBIA 4CYCB 4A6EA 2A68F 4N4OB 2QZ8A 2QUFA 1TT0A 2QCOA 3DEEA 3GZ5A 4XKVA 5FGMA 1DGRM 3QYEA 3N4MA 3ZQQA 3C7JA 3HUGB 2VONA 1QO0D 2IT0A 5GAEJ 2WA0A 4OIOF 1ODDA 4ESFA 3FHNA 4HSTA 5ICFA 5FLXZ 1UJ8A 1FP2A 1TZLA 3GTOJ 2PN6A 3OS2A 3UKGA 1G3SA 1ETQA 3RKXA 1P9QC 2OV7A 1I3QJ 1OPCA 4AIKA 2AS5F 4HRIA 4FE7A 2KIUA 5KAFC 5HODA 4CGZA 2XPVA 4MO7A 4E7KA 2NAZA 2MH2A 3KZIC 5J8CA 4ENNA 3LA3A 2WB1N 5E1WA 5DTDA 2V4JC 1A36A 1V55H 3D5SC 3L09A 2A61A 3FMQA 2GQQA 4LK0F 2O9LA 3A2KA 1IZ1A 5K1YA 1VQ7I 1HC8A 3HM5A 4ZYDA 5F6FA 3DQVC 4RB3C 1P4WA 5B5EC 4U0WA 2ISZA 3S1QJ 2ZB9A 5IT3A 2ZMEC 3NEUA 5F0CA 3R6SA 1UHSA 2IA2A 3CF2A 4F93B 2MC4A 4CCNA 3OS1A 1U0JA 2KISA 1NK2P 1R49A 1SFKA 2X48A 3DV8A 3F9KA 1BR1A 3TW6A 4DNCA 1IRZA 1KU7A 2BYVE 4XOPA 5FLMJ 2EIJH 2HPMA 4G94A 5JLXA 2O6GE 4AIDA 5CQEA 3L1PA 1W5CC 3CESA 1UHWA 2IA0A 1Z7LA 1ZLJA 1EJ9A 2ISYA 1KU9A 1BI0A 1QNTA 1XB4A 3H3VK 2CQQA 1E2XA 1HW1A 2LH9A 3BP8A 1XMAA 3E5XA 2MYSA 2DPDA 5EEAA 3ZQIA 5K7ZA 4E7LA 4KFCA 4D7MA 2R5ZA 2R4GA 2X6YA 3H5AA 1HSJA 1QZEA 1Z9CA 2LFBA 1ZN2A 2D5VA 2Q0OA 2ME6A 3WTUC 4IJAA 2GOMA 4J00A 3DWLE 4A2UA 2HXOA 3TKYA 5DEQA 4H4KC 3VDXA 5J8FA 1W4MA 3CMAI 2Z99A 3PFIA 2ELKA 3A0BC 4RMNA 4O5VA 2H6BA 1S72I 3K7AJ 2GA1A 2RQPA 1P6RA 4EMSA 3GTKJ 1X1DA 3IKVA 2DMTA 4ETSA 2FE3A 5M5YJ 1K6OA 4LJZF 2ZNYA 3QAHA 1FTZA 2VE9A 3FMRA 4L5JA 4XR6A 4HPQA 3DKXA 5B1BH 3K70D 3E0JB 2JMWA 1LFPA 1W5TA 2FUG2 1YE9A 3G2BA 1RR8C 2DQLA 3KP6A 1TQPA 3BY6A 3H0DA 4EV0A 4BQAA 2H27A 5M5WJ 2VBZA 3L2VA 1U5TC 2DFHA 2VPRA 2Y2ZA 4HBLA 4HG2A 3TOBA 1FYKA 2LC2A 3CMMA 3DU5A 2ECCA 1V3FA 3VFZA 3AAFA 2OF7A 4JP0A 3N97A 4BDYA 2OZ6A 4HDVA 4RAFA 2X1CA 5DUIA 3CDLA 1Z7UA 2X85A 1JGSA 2DLLA 3E7LA 1S7AA 5LRSA 3EUHA 2Z2SB 5CJ9A 3ESWB 4XLNF 4YFKF 4XORA 3KFWX 1DUXC 4M9ZA 1T2KA 1I1SA 2ELJA 1BOAA 3OYGA 1UELB 2DK8A 1K79A 3RYRA 3DFGA 1YW9A 1YS6A 2YX7A 5FLXK 3CJRB 2V6EA 1ZG1A 2VL8A 4IOAF 1VQPI 2E5ZA 2KHMA 1FBQA 3A03A 1TLHB 1JI8A 5JI6A 5FJ8J 3IL2A 3IHUA 2WAQN 2CV1A 1QVUA 1GT0C 4LG0A 2BOLA 4BYYA 2R7WA 3FIWA 2R7QA 3LSKA 3HRTA 2PI0A 1QBJA 4UV8A 5DD4A 1MBKA 5FD5A 2ZC2A 4A0YA 1XC5A 1FX7A 2VJ4A 2XB5A 4DZPA 1G3WA 2HOSA 2JSCA 1ITYA 2XGDA 3EUHC 2QLZA 5CQGA 3ZQGA 5GPAA 2K02A 2FMLA 1G3TA 3BG9A 4CYCA 3WODF 2P6SA 3PNVA 3D5LA 5LGUA 5TRDA 2OTLI 4IHTA 1RETA 2CFXA 1AU7A 2IXSA 1JKPC 3GTPJ 3CJTB 2WB1A 5LD2C 2QKMB 1R9TJ 3CMYA 1CQTA 2ETHA 2DTRA 2ICWG 1ZTRA 2Y30A 3CCSI 4GYIA 3DLLF 5BQTA 1OCOH 1WRJA 1TP4A 2ZXIA 3E97A 1PP8F 3BR0A 2DA5A 4RLQA 1E0EA 2WWYA 3VB2A 2RKHA 3PO2J 3VYSB 2EJRA 1PUFB 3KP2A 1G2HA 1YG2A 3K1PA 1PDNC 2XAGA 1RESA 1RC9A 5JHFA 4IL6C 3V4GA 5C44J 3DEWA 3KP3A 3OSFA 3S14J 2L7FP 2L3DA 3CP2A 1ETXA 1FZPB 4ZYHA 1HKTA 2AQFA 1B9NA 2OJED 4FT8A 5TGTA 1BW6A 2GOXB 4ZYAA 4QPOA 4ZH4F 2VQCA 3DLAA 5FKNA 1LUJB 2MA3A 2KQRA 1KYZA 2VBYA 4JX5A 5GTIC 2R7XA 1G8XA 1R4MB 4P1WA 1IF1A 2XVCA 4D1QA 1IUFA 2XUBA 3WGIA 2MLGA 3GFIA 3OYCA 2DA7A 3I54A 3GO5A 1B72B 1IRGA 4X0GA 1I6XA 2GLOA 1R4NB 2XIGA 4M6VA 1U2WA 3M9AA 2M7AA 4W1UA 2DA2A 4V2FA 3OY9A 2K4JA 3MCZA 1D1AA 1WI3A 4QIWN 1Z3XA 4HF2A 2A6TA 2HDCA 2F4OB 1D0XA 3S16J 3VWBA 2R7VA 2BY0A 2NVQJ 1GUUA 1T0FA 4BJ6C 2HGCA 3L2UA 2Q2EB 2DA1A 2BEOA 2KKOA 1YS7A 4AYBN 3KZZA 3TDZC 4Y33A 3ZMDA 1TBXA 2P7CB 3QPTA 1X19A 1I50J 5D5VB 3SZGA 2JA2A 2VJIA 3DF8A 3QPHA 2MW8A 4XLEA 4L5IA 4R1HA 3H9QA 2STWA 2Y75A 2G9WA 4HW0A 1X4OA 2V1UA 4EJVA 5EEHA 1YRNA 2OD5A 4EEFG 4BBRJ 4P9UA 1GXQA 3GW2A 1F5TA 1ZGWA 3T5XA 2DODA 2BVMA 3RSNA 2ME0A 2K40A 3VEPA 2CS3A 2DBBA 4U7DA 2DDAA 2LRDA 2LG4A 2FBKA 1YX3A 1N75A 1XSXA 1BR2A 2ID6A 3L7WA 5H2FC 4HAMA 3QPSA 3OYHA 1XCBA 1MH3A 3CUQC 5K5OA 1WFXA 3HUGA 1H9GA 2A5WA 3JRBA 3L2CA 4UVAA 1Y0UA 3RPQA 3HZJA 1IC8A 1ZGJA 3KX2A 3QRFF 4IRIA 1MBFA 5F1RA 4KDPA 3VOEA 1WWXA 3CQZJ 1B9MA 1HBXG 3M8FA 1W5SA 1G3YA 3FHZA 2X9DA 3WTSC 4FTHA 3VPRA 2VQGA 2LLKA 2I8DA 1T39A 1T95A 4R8HA 2XF7A 3GZ6A 2EZHA 1HQCA 3DKYA 1KONA 2DFIA 2JUGA 1TWGJ 1FTTA 4OAYA 5FKOA 1WKMA 3PIOF 3RZDJ 4MFEA 3OYAA 3JSOA 4HNUA 1T38A 1OYYA 1QHGA 3TOAA 2GWRA 2IW5A 4GCVA 3CUQB 2M8EA 2CUZA 3FXKA 1MMGA 3CDHA 2DA4A 3OSGA 1Z1DA 2EZLA 4WXCA 3QYFA 4DYRA 4HZFA 2HWVA 1P7JA 1S7OA 3BZ6A 4P55A 4CCKA 3PO3J 1MBHA 1YLFA 3K2AA 3BTIA 5D4SA 3GLLA 2RDPA 1QPMA 3WE3A 3E6DA 5J1RA 1XTAA 4RM3A 2G7HA 1OKRA 5C4JJ 1X1CA 1KGSA 3V42A 3F8BA 1JTYA 2ZXHA 1V5GA 4L5EA 4RB2C 1HOMA 4KN4X 2A05A 2M87A 1U5TA 4XSZF 1P4XA 5J6XA 2EV6A 2XPWA 3BT9A 4A3BJ 4BY1J 5J3LA 3SDBA 4QTRA 2VI6A 2CQNA 3U1DA 1WZ2A 1VF9A 4UY8I 1T0FC 5GTHC 4CHUA 3TL4X 1WGXA 5D4RA 3MMYB 2IJLA 5E1ZB 4BE2A 3TDUC 3K10A 3HOZJ 2XB0X 3A0HC 3ECOA 2CO5A 1A6IA 3CLOA 4YFXF 2K7LA 1X58A 1R5ID 4A3KJ 3S3MA 1I27A 3V8LA 3PSIA 4RS8A 2JRMA 4XSXF 2LD5A 1Q1HA 3H36A 2V1NA 4KT5C 4PJ0C 3RDIA 5HS8A 3BJOA 1ACIA 1W7PA 3V7SA 3CF5F 1B8IA 2IP2A 4M6XA 3FK6A 4PCQA 2JVGA 3IKTA 2XRNA 2KL4A 4RA2A 3ZQFA 4ESBA 4YELA 1OJLA 3PNYA 1LDKB 3CCRI 1IO2A 4BJTA 4FE4A 3HTUA 1X4PA 1Z3YA 3J7AY 2A69F 1EKEA 2QA4I 1FP1D 1I39A 2JRTA 2R7FA 3RCOA 5FD6A 1FOXA 1POGA 1OCRH 2ZJPF 1KU3A 1WJFA 1BI1A 1IDZA 1VQLI 1HA8A 3QPLA 5F1JA 2EH3A 3F8NA 2FF4A 3RKWA 3LSGA 4FASD 4D0PA 2P5LC 4OAZA 3ZMZA 4MFDA 2PMZA 3HSRA 4F52A 2X4HA 3N05A 3HHHA 1U8RA 1WJBA 3AFHA 4DOZA 5C4XJ 2BW3B 3C3WA 2KJCA 1V5EA 2M34A 5IT9K 1TNTA 4UHTA 1DDNA 3HOSA 4QSHA 2O61A 1S5LC 4LB5A 3FMSA 3TGNA 2TCTA 4EJUA 1ZRCA 4L9TA 3FXMA 1LVAA 1SD6A 2W84A 3BCBA 3MQ0A 3G6EI 1FIAA 2O03A 4MQ9F 3CDIA 2UXXA 4BDZA 3E6CC 4O6JA 1OCPA 2VT3A 2BY2A 2UUZA 1QPIA 2M30A 2FQ4A 5HNHA 3JRFA 3U9GA 2KIFA 2BXYA 5IY5H 1TW2A 5GP9A 3EYYA 3I9V2 4ON0A 3DEUA 2IGNA 2E2IJ 4DBRA 2PJRB 3GMEA 2LR8A 3FKJA 3PIPF 2MGQA 3I5UA 2OTJI 5JR3A 2MBFA 2K9MA 2V26A 5CYVA 2WY7Q 1PJRA 2EZIA 4CCLA 3CO6C 3COAC 5K5QA 3F23A 1CGPA 1OCCH 2H6CA 2DMQA 1D5YA 2E1MB 3K1NA 4RM2A 1S9HA 2UXNA 4PSXA 5J4VA 3HSEA 2E36A 2MABA 2NVUB 1L0OC 4HQMA 1FEXA 3WU0A 1SVMA 3WGHA 2WV0A 3I59A 3CC7I 2BGCA 1HXDA 2JVHA 1BA5A 2UWMA 3WTXC 2LP0A 5ED4A 3RQ4A 1JJ6C 4HF0A 3FKIJ 3A01B 1LFUP 1MJAA 1ULYA 3D1NI 4OMYA 3PSFA 5J4YA 4DYCA 3S2DJ 2J5OA 2QGUA 1N78A 2F2EA 3F8FA 3JRAA 1R71A 3PM1A 1W7PD 3S1RJ 1FBUA 2PJRA 1LKXA 2YPRA 4NUBA 3MKLA 2KP6A 5LGTA 5ILUA 5IOYA 6PAXA 3MZYA 4JX4A 1K78A 2HEOA 3VSKA 3MKWB 5HDGA 1H0MA 2VBXA 4XK4A 3K4LA 2R5ZB 3LL7A 4XICA 1PYVA 4A3FJ 3K9TA 3DBRB 2A3SA 2EINH 2HI3A 3KYCB 1BC7C 5EGOA 3CCUI 1BOBA 3KP4A 3J80Z 3ZPLA 3OOPA 1XG1A 2B7EA 4V19K 3BZKA 3B6AA 2ZJQF 2WC2A 5KNLA 2DOAA 5FRNA 1SC7A 4ENMA 4II2A 3CJQB 3F0CA 4ZC3A 3H5RA 4BHCA 1F43A 3OL3A 4I09A 2LY9A 2EB7A 3DPTA 4UVCA 1JT6A 1J09A 1VI0A 4P5OA 2ZXWH 3HRMA 3ML6A 4EM1A 5L3GA 2O7OA 3PQJA 1NG7A 2LKPA 2VN2A 5ICEA 3GLXA 3MWMA 2L0KA 1KYWA 1A35A 3ZRGA 2HZDA 4ANJA 2EFWA 3WTVC 3FX3A 1B1BA 5AIPA 3KCCA 5HLHA 4M6YA 5ERIA 9ANTA 3P9IA 3JTGA 4C3HJ 3AL0C 2MG4A 4P9FA 3DBHB 1ETWA 5K7HA 3OYDA 1ZYRF 2CJJA 2XDVA 3NWSA 2UZKA 4HF1A 3I59B 1QZZA 1P7IA 4UB6C 1ZGAA 1LDJA 1XDUA 1ZH5A 4D7NA 2XAUA 4EM2A 3FBNB 3CC4I 4XL9A 3DU6A 3P9KA 4KISA 3IWFA 3PUBA 1TWCJ 2EFNA 1WSUA 4PJNA 1NG6A 1OCZH 2J5PA 4XQFA 1YIOA 1XPXA 1HF0A 4I98B 1R22A 1MD0A 2D2WA 2WV1A 4RB0A 5D6FA 5E79C 2GIVA 2YU9J 2QWWA 3CCVI 3E3VA 4HDUA 1ZRFA 2BHZA 5E8GA 1VQKI 3VYUB 2VT2A 3S8PA 2PMZN 4XKCA 1O57A 2RREA 4KJZA 1MNDA 3JAMZ 1NHAA 1V4RA 1IN8A 4F92B 1H9TA 2Z9OA 5IP6A 5JVGF 5KK1A 3PFYA 3QWLA 3VSLA 2Z16A 2EIMH 4A3GJ 4RGUA 4A0ZA 1YITI 2E19A 2M1BA 3GZNB 2FRHA 2Y0SA 4QWQA 4UUSB 1SFXA 2BBYA 3F72A 2VUMJ 1B6AA 3WHBA 2VKHA 5EG0A 2VIXA 4XKBA 5DD8A 2JJ7A 2XAHA 1APLC 2HQ5A 1E17A 3BQYA 3KEYA 2VB6A 2CH0A 3MN2A 5JHUA 3H9JA 2QQBA 2D45A 3GXOA 2H1KA 5L3BA 3ERED 2L5QA 1IDYA 4PGGA 1Y8RB 1VQ6I 2R7SA 3TMOA 2XSJC 5DUKA 4B44A 2WAEA 4DIQA 5B66C 4C2TA 1ZHFA 5F0HA 2YS9A 1FOKA 1TNSA 4WCGA 3ULQB 1BN5A 1YW8A 1LQ1A 3BDDA 3OR2C 4B3AA 1X2NA 4RAGA 1XGNA 1LEBA 5ILVA 3CD6I 1PUFA 2QKLB 2CV0A 2JWTA 2OC6A 2NVYJ 2YSRA 2NS7A 4M3DA 1IRFA 1U5TB 4DW6A 2QVOA 1SMTA 1ZG3A 3W2VA 2KLOA 5L3DA 4LMYA 2L4AA 1MMDA 4UXNA 1WJAA 5EEGA 2VOOA 1TWFJ 2OCCH 1BI3A 3LSTA 2AO9A 2EV5A 3P5JA 2WTEA 3S32A 4II3A 1I1GA 2L54A 1GDTA 2R7UA 2P5VA 4P96A 4I01A 2BXZA 2E2JJ 3E5QA 1QRYA 3FXQA 1D5VA 4PK4A 2DAOA 2IVMA 1IG7A 4MGRA 1U9OA 4XRFA 5IYBJ 5HS7A 2STTA 2F5FA 2P4WA 3QYBA 2DPUA 5BNGA 1QZYA 1TWAJ 4AVZA 3GTLJ 3O3KA 3GFLA 2DK5A 3OL4A 2Y9ZA 2OQRA 3CC2I 5EZGA 1VQ4I 2FBHA 4IRGA 3RKYA 2WBMA 1XGOA 5TISC 3S3NA 3BTJA 5E3MA 3WE2A 2HYGD 1XX5A 3HRSA 3CCMI 2R7OA 1QHHD 3H1CA 2I10A 3KP5A 3SDGA 1TTYA 3LSRA 4I6ZA 2L7KA 2DI3A 3BLYA 1BJAA 1VQ5I 1ZAOA 2Y0MA 3K70C 4IQ4A 2Z3YA 4KITB 1Z67A 1B8IB 2E34A 3ZN1A 4CXFA 3S2WA 1T33A 4ZZLA 2PQ8A 2HYFA 4KMUX 2P8TA 3AG1H 3J7YJ 3W6KB 4HLXA 4HNVA 2AXLA 5A2QK 3ZXSA 2XF6A 1EA3A 1D0YA 1KU2A 2O5RA 2FMYA 3R4KA 4EJTA 2W7NA 4G9YA 5FB2A 2OU2A 2VKVA 1CF7B 2DU9A 3I64A 2UV1A 5E3NA 4IVNA 5FFZA 2W1OA 1Z6RA 5DYMA 2JZYA 2K9NA 3RTRA 1HW2A 3AG2H 3Q9VA 2P81A 2A07F 1XD7A 2HQAA 2H8RA 1IN4A 2E1NA 4LOCA 5D5UB 3RKQA 1YYVA 2G0EA 2WY8Q 3FXLA 2K9LA 2M9HA 2NYXA 1W36D 4BXXJ 5GAGJ 4Y13A 1ETKA 1X1BA 2W57A 3OIQA 2P6TA 1O3QA 5D6EA 1BW5A 4CA0A 4B43A 3E1SA 4KIGA 2VC0A 3KEOA 3OOUA 4NQWA 1BJZA 5CVVA 2JN6A 2OA4A 3OYFA 2RN7A 5L3CA 3P9CA 4FHTA 2A5YB 3HKZA 4Z6YA 1HKQA 2DOEA 4C9YA 2CFOA 1D8KA 1OCTC 5IP7J 3RYPA 3GX4X 2VQLA 3ZMSA 5CPRB 1YFHA 3MEXA 2ECBA 4KIFA 2XF5A 2P5KA 2XKOA 3ELKA 4RLFA 4AWXB 4AM3A 4H0EA 3CJNA 1LDDA 5DV5A 4OIPF 3GUDA 1K61A 5CKTA 5E8IA 1ETOA 1SD7A 3LOCA 1R36A 1JXSA 1VQMI 2V9KA 2RGVA 2B63J 4IX7A 2H8WA 4B4CA 1AKHB 2YR2A 3GEZA 1ZELA 2DMNA 2YUSA 2HVRA 3HEFA 1XSVA 4A3EJ 3DPLC 4Y7NJ 3T1BA 1Z21A 4C2MJ 2F5CA 3QU6A 5F04A 3JCUC 2DFFA 2FD5A 2GM4A 2XASA 4L9VA 2L9RA 2QYOA 2NS0A 1W0TA 1G59A 1FPQA 4PUSA 1YI2I 1MSEC 1H8AC 1CF7A 1IN6A 2ZFWA 2OPTA 3LNQA 5CVRA 2D1HA 5HLIA 1ZR4A 3DTIA 1X1PA 4N9HA 3HBLA 3H9GA 2DQRA 2ZCWA 4WWCA 4B8XA 3FXUA 3Q9SA 3ASOH 3SFIA 4B09A 4D5FA 4BE0A 2ESHA 2DTZA 1ETVA 3ZQHA 5BPDA 2W4SA 2RQQA 2F4IA 3ISPA 3FK7A 2NVXJ 3TQNA 3I56I 3A01A 1ON2A 2DYSH 4N0BA 3MKZA 2R7TA 5K7FA 1H88C 2HU9A 3NARA 3JREA 1ON1A 5K5RA 2R7RA 1YJNI 1R1VA 3O8HA 4JK1X 3QP5A 3S1NJ 2VKEA 3F3XA 2WAFA 1E3PA 2VJ5A 1HKSA 4Z2YA 3LFKA 4KICA 3BR6A 5EJCA 3PNTA 5IPAA 3BTLA 2CQXA 3OYMA 3SHFA 4G7HF 2Y0SN 1KZHA 4LG0B 2HTJA 2V9VA 2BHYA 3BR2A 4WK8F 4EM0B 4I76A 4YG2F 1JKOC 4A0XA 1QVTA 1O3RA 1OFCX 1UMQA 2FA5A 4DYQA 2EILH 3AKZA 4A3CJ 5DCFA 5ICCA 4NNJA 4XRSA 1U3EM 2YX4A 5F27A 4ZTJA 2LF8A 4YIRX 2ZSIB 4IRHA 2VOPA 1A5JA 4EVIA 1TC3C 2ZJRF 1O3SA 1UB9A 1AKHA 2MFZA 4HA8A 5H6QA 3ZQLA 4QPQA 3BG5A 2X6OA 5EZHA 3ZOBA 1WQ2A 1YX5A 2DXIA 4XBFA 2OZUA 4IPAA 2IS1A 1ZR2A 3ZQCA 4C3JJ 2QBYB 4CZCA 1MMSA 4FCYA 1OQYA 2X6WA 3VYTB 1VZ0A 1UCRA 3C2HA 5E3LA 2BE5F 2COBA 3A02A 4EJWA 4CICA 3V8JA 4E7SA 4M73A 4PZJA 3HOWJ 2W48A 1A6QA 1SAXA 4C2UA 2XGCA 1MZBA 2L9VA 3QOEA 4NBQA 1R00A 5CVJA 3CUQA 3OIOA 3Q3SA 2KFDA 4XM3A 4S0HB 2A6HF 3LSPA 2FJ1A 2E5NA 2RV8A 3ECHA 2L02A 1MMAA 1Y1WJ 2B9SA 4ZYEA 2HS5A 1A31A 4BH9A 2E71A 1HW5A 3M1CA 2LBFA 3I0TA 4MEYF 1LB2A 3AL0B 2XGEA 1BBYA 3ONQA 3HGGA 2IS4A 5LRRA 3CZ6A 4IXAA 2QQ9A 3L00A 1JGGA 2EA4A 1T08B 2VBWA 2MD5A 4M74A 3DKWA 3MFKA 1A04A 4NB5A 1OYIA 4TV7A 2RAEA 5M3MJ 2W85A 4XLCA 4HQEA 1BM9A 1MIJA 1F9NA 3BR5A 4NC6A 2CRGA 1UZCA 3BPXA 4KUMA 3L2QA 5LLQA 4A5NA 3NQOA 3GTGJ 4B3XA 4KT6A 4X1EA 3MAJA 4MQVA 3BWGA 3ZN0A 4F91B 1K83J 1JHFA 3ASNH 3D0SA 4N4NB 5EF6A 1ZQ3P 3FXJA 4A5MA 3DTEA 2CW0F 3BC8A 3O8GA 2EA2A 3JSPA 1GHCA 1PVEA 1OR7C 1GVDA 3B6CA 2O0YA 3G3ZA 5D8KB 2W00A 3SZPA 4XRSG 1LE8A 3HOXJ 2IEKA 4HX7A 3V8KA 3BJ6A 2M4GA 3ZGKA 2FX0A 3ABUA 2CG4A 2ZSHB 3KLNA 3HL2A 2K5CA 3J7ZI 5FROA 2HOEA 1NK3P 1FSHA 1ZLKA 2XAFA 2X0LA 1USTA 4U7BA 3M8JA 3WG7H 1TW3A 2DFEA 4D5CA 2KIMA 4XNFA 3OWTA 1HLVA 3O2PE 4OINF 2IS2A 2CSOA 2IPQX 1MDMB 1SFUA 3IWZA 2QENA 1Y39A 3NRVA 4ZDOA 2FXAA 1RUOA 4IF4A 2XC7A 1JKRC 2VE8A 3K4MA 1KQ8A 4XRMA 3K6GA 2Q8KA 2FQ3A 2KRCA 4BU2A 2EZKA 5IOZA 4E7JA 3ABTA 2CYYA 2K9SA 1HDPA 3EUKL 2LK2A 4U0YA 1BC8C 5DM6F 3H0GJ 4M72A 2CW8A 3HOVJ 2DA6A 2M2EA 4OWRB 1O7FA 2O3FA 4KNYA 4M3FA 2ZKZA 3W2WA 2PMUA 3I4MJ 1GXPA 3PL8A 2TDXA 2QQAA 4ZDLA 3IH2A 2DT6A 5LEKA 3OYJA 2HOTA 1D1CA 3KPHA 1TQIA 3SZTA 1N25A 2Y69H 3B02A 5CVUA 4B1RA 3ZMUA 3ZP5A 3WG9A 3UR3C 4GGGA 2R3SA 2WAQA 3OV8A 4XIDA 3FBIB 1VQOI 5FRMA 4HOBA 1MBJA 1GVJA 3RPUD 2V7FA 2CV2A 1B4AA 1DP3A 1TL8A 2VASA 1R23A 2EFPA 2AQEA 4KN7X 4OOIA 1K4TA 1SAUA 2HOAA 3O6BB 4Y15A 5D5WB 4I0BA 2F5DA 1JKQC 4XOTA 1YJ9I 4G6DA 1FMWA 3TBIA 4HSRA 2P0WA 1Z0XA 5HS9A 2DW4A 4YIFA 4I99C 1PUEE 4IKFA 3EPZA 5KCMA 4L0YB 4UUSA 1WJDA 3K4NA 5LEJA 5KAIC 4A3DJ 3W2AA 3CUOA 2M7BA 4KYWA 3JRGA 1ZK8A 1DQUA 3W3CA 4LG3A 3SJMA 1T98A 2R7DA 1T6SA 2Y48A 5A2QZ 1K4SA 1XMXA 2O8XA 1BR4A 1DU6A 1XGSA 1WH5A 1VNDA 2X51A 2X1EA 2X6XA 3IC7A 3D5RC 1OYWA 4BQOA 3BROA 1PP7U 4BUPA 4C30A 4IHXA 4U88A 2HDDA 3EQLF 3BG7A 4DBQA 2QBYA 3M7GA 1D8JA 3MZ8A 2L4MA 2V1DA 4UUTA 1SMYF 1J5YA 5EG0B 3DXJF 2FSWA 3OR1C 3VYRB 3LAJA 3GFJA 2BV6A 4UB8C 2PLYA 4CCMA 3BTCA 1JE8A 2HKXA 5E20A 4IHSA 4ABZA 4A93J 1OR7A 4F55A 1WCMJ 2V6CA 1IN5A 1Z77A 1WJ5A 5B1AH 1QU3A 1M1EB 3HJEA 2HDWA 3IP4B 2HZTA 2LKSA 3MD2A 4G12A 1P2FA 2ESNA 3QOPA 4N9IA 5DCMB 3TO7A 4CH7A 3SFZA 3U1KA 4NHJA 2FEZA 2MD0A 1IGNA 5DDGA 2E35A 2NS8A 3Q0VA 3TW7A 3CCQI 4LITA 2B0LA 2DN0A 3F21A 1B59A 5HOOA 2K3PA 1YOVB 1MNEA 4AU7A 4ESJA 3HXLA 1V5FA 2V9PA 2NVTJ 2XRLA 1OMIA 2NRAC 4UV9A 1K6YA 2BY1A 3F6OA 4LB6B 2XAJA 4I7HA 1XDSA 2G7UA 4XLAA 5H20A 3BOQA 2ID3A 4M3BA 4ZZDA 2CQKA 5E17F 2K4BA 3KE2A 4S05A 4FETA 3HHGA 2FOKA 4O3MA 3M8EA 5J1YA 1FY7A 2V79A 4Y17A 1HDDC 3M1EA 1MJBA 1JHHA 3NAUA 2R92J 1IV8A 3CLQA 4CDGA 3CCEI 1FOWA 4E7IA 4ENKA 3HOYJ 4J01A 5J1UA 3EUAA 3DTKA 2K85A 4KMFA 5IYCJ 4XLFA 3A1YA 2M45A 3MKYB 2XAQA 5FFXA 4I2OA 3KP7A 1Y8QB 2QSHX 3ZCOA 5TJJA 1R7JA 3HPHA 4G6QA 4XMYA 2IA1A 2HR3A 2JT1A 2WADA 3SEZA 3I3LA 2LY2A 1XGMA 5BPIA 4L18B 4BKXA 4FX4A 2GA2A 1RNLA 2ZO4A 1XN7A 3G73A 2JSPA 1J9IA 2JA5J 3C2GA 1E3HA 4X6AJ 2M5WA 3HG9A 4NC8A 3F8MA 2ZBKA 3F8CA 5FO5A 4A3MJ 4BHPA 2BVLA 1J75A 5LHGA 1LFBA 3TO9A 2LDUA 2IBDA 1IV6A 1D3YA 1Z05A 4KA4A 1OISA 1I5ZA 1Z91A 2ELHA 3KIOA 3H3UA 2JA6J 4UUVA 3S2HJ 4IOCF 2QSFX 1H89C 4FISA 1S3JA 1YW7A 3K69A 2W82A 3J80K 3QP6A 3LFUA 2E1CA 4XN0A 3E6MA 2MC3A 1MW7A 3I71A 3K0LA 1D0ZA 2DT5A 3BCAA 3CCJI 4IHWA 3LA2A 3HIFA 3WTZA 1MDMA 1ERDA 3W6JB 3HOUJ 1FNNA 4M9SA 2GXGA 4E70A 4CUGA 5H6RA 5EYRA 4CSWA 3PQKA 3HYIA 2JPBA 4E4HA 4GDFA 1T8IA 4BXUA 2X1DA 1IN7A 3ABLH 3IV5A 2CMPA 3PUFA 4IEJA 4DJAA 3IRRA 1XCVA 3H5NA 2LTPA 3S3OA 4AIJA 3C1DA 4DGWB 4ENJA 4YEJA 2LKXA 3J81K 4HYEA 4JX6A 4A3LJ 3G1OA 4F3QA 4QLCU 4IO9F 1EH8A 2KT0A 2NNYA 4M3GA 5B3SH 2PMHA 4AVPA 1NH3A 4GRIA 3R0AA 3TP0A 3KZYA 1J59A 1SD5A 4RGXA 3NWTA 3QU3A 2YU3A 4Q4ZF 3BG6A 3U21A 3JRHA 1ENHA 4JBAA 2PG4A 4RBOA 4F7ZA 4B47A 1MJ9A 2KDOA 1TWHJ 3BR3A 3FZVA 2HTSA 5E3OA 2JK3A 3GFMA 2EIKH 3S17J 4XLHA 3MZHA 2HNHA 2KPMA 5D5XB 1VFCA 2GXAA 3EYIA 4J19A 3I55I 5E18F 2E2HJ 1YHQI 4OMZA 4C3IJ 4Y4RA 1DP7P 3GBGA 1ZKGA 2HYJA 2QSGX 3GF2A 4LIUA 1O7LA 3OYKA 4HLYA 2M3AA 1MKMA 1X3WB 4MHGA 4AD9A 1IW7F 5HDKA 1X3ZB 2OAZA 2V1XA 1DGWY 3SEQA 4ITVA 4L0ZB 3RPUA 2NOGA 3LQQA 4XKWA 5J47A 2KIQA 2HVSA 4Y52J 3AG4H 1YRNB 4YIIA 3BJAA 1X1AA 2KJBA 2HVQA 3I4NJ 2KDZA 5FKMA 1V54H 4AUXA 2N8GA 4BACA 4MTDA 1U9NA 4PJMA 3HC7A 3RIRA 3JAMK 2DMUA 3FXRA 4U0VA 1EH6A 2FNAA 3PJRA 1WJCA 4BS9A 3BPVA 4MNUA 1BIBA 1Y6IA 2F4MB 1J2XA 1LJ9A 1L3LA 3DPUA 1IXCA 4HEA2 3M3YJ 4K2EA 4BEHB 1IUYA 2GXBA 2Y31A 1S6LA 3ABMH 3IH3A 2ZJ2A 1UHMA 2JUCA 3LA7A 1LPQA 2HPIA 1WJEA 4MLOA 4L9JA 3Q5FA 3G4SI 1XS9A 4BGDA 4RGSA 4W97A 4JYKA 2M8GX 4NC7A 5E1XA 5LFAA 2DO7A 2PFBA 2E1MC 1QGPA 1R5HA 1FT9A 4E6KG 5FKKA 4LFUA 3F6VA 2IGKA 5FLVA 5ICGA 1XMKA 1KQ0A 4S04A 3OYNA 5IP9J 1QA6A 3LSMA 2LNBA 5M5XJ 3E6BA 2LSOA 4EJOA 1LNWA 1AA7A 1R1TA 3KYLA 2GIZA 4A69C 3JTHA 2CU7A 2R0QC 5HVQC 1R1UA 5LHHA 3W6VA 2CUEA 2F6CA 5HLGA 1Q1VA 2H09A 4BQNA 5EDNA 3CCLI 3AG3H 2C6YA 4Y3OA 2JQ7A 3HB9A 2EBIA 2AXTC 1T56A 2JTVA 3CO7C 1N77A 4RB1A 3H3ZA 4JOMA 4YRVA 2F48A 5J40A 2ZFUA 1DU0A 5CVIA 3ZQ7A 5JFRA 4LK1F 3U2RA 1K78B 3ROUA 2FNPA 4OIQF 3K4BA 4ZTFA 1RUNA 2EPFA 2VODA 1P4AA 3WU2C 4UNOA 3P7NA 2LOOA 1FMVA 2Q2EA 2PX9A 3IAM2 1VQ8I 4EGZA 4FX0A 4HX4A 2XKPA 2A6EF 1VTNC 1VQNI 3M07A 3WTWC 4ASNA 1JUMA 3KYDB 1SFEA 4PGHA 4AYBA 1DPRA 1MGTA 1MMNA 3DCFA 4M71A 5BS6A 3HRUA 2GBYA 2RVCA 1WI9A 1RKWA 3LSJA 3SXYA 2Z5UA 1ZARA 3HGYA 3RQIA 1WHUA 2M4KA 2OQGA 1I3AA 1FWZA 1GLNA 1C0WA 2DCEA 2DYRH 3HOTA 1QQIA 2DOFA 3CCYA 4BXFA 4RGRA 4IHVA 1BL0A 4HNTA 5HLTA 1FYMA 1RPWA 4Q48A 3CP8A 2FOWA 1TT5B 1MNMC 2L01A 3L2RA 1E3OC 3S1MJ 2K27A 5HNFA 2KRFA 3IAS2 1SEUA 4RAZA 1R6RA 4HV6A 1AWCA 4G8XA 2VKDA 2BY3A 3TEDA 3WTYC 2M0CA 1O4XA 1KQ9A 4BBSJ 3GYHX 3T0YA 5D8LB 1RR7A 4Q47A 5DCMA 1F4KA 2DA3A 2ZNZA 1Y0NA 2EFOA 2RNGA 4NDLA 2D1VA 3JW4A 3OIPA 5AIQA 3J7AO 4RAYA 2EK5A 1IJWC 3WU1B 2CUJA 3BG3A 3FWEA 4XN3A 1JTXA 1SVOA 3OYEA 4IZZA 2QQ8A 2CUFA 3WHCA 1RZ4A 3TO6A 3DP7A 2K3FA 4BNCA 2NOJB 1I6HJ 2EFQA 2LVSA 2VJJA 4YFNF 2PEXA 3OYBA 5LBQA 2ADUA 4DQ2A 1ZRDA 3V7RA 1VQ9I 2M0MA 1IXSB 3R60A 4A3IJ 4AIHA 3K4CA 2BW3A 2NNNA 1LE8B 4E7HA 4LLNA 1IRXA 1MH4A 5KVRA 2ZMEA 4U87A 1B72A 1IAWA 3ERMA 4JQFA 4WX9A 3JRCA 4WXDA 3E5UA 4BJ5C 2F5EA 3JRIA 1Z6TA 1LEAA 2VPLA 2VXZA 1FSEA 2EQRA 2L7MP 2L9NA 4IHYA 2KMUA 1JT0A 3I53A 4CCOA 4OIRF 1RRJA 4CO8A 3GVAA 3REOA 3EDPA 1LVKA 2LREA 3G1LA 4MIMA 2JA8J 4BY7J 1MBGA 2HFHA 2KZGA 1UAAA 3FM3A 3JR9A 4HX8A 3A4CA 4PJLA 3RI4A 3G1MA 4GFBA 1U6GA 2HXIA 1IXRC 3DBLB 5M3FJ 1FJLA 2CGPA 5LHIA 1G6NA 4PFPA 2LBFB 5C3EJ 1BI2A 2W25A 4BEHA 1OLTA 3I4PA 3VODA 5LGNA 1FBSA 2HKOA 2H1LA 1X3UA 2TRTA 5L3EA 4XONA 3B73A 1FIPA 1J7KA 3K2ZA 4D9JA 1ORKA 2RNJA 2BZTA 4GO1A 1GV5A 1Y56A 2CQ7A 5BMZA 1F1ZA 5BOXA 2W24A 1S7EA 3V7CA 3HDDA 3BQZA 3IUOA 4BHBA 3KETA 3C2BA 4BAYA 3M4OJ 1ONVA 5F0FA 2O8KA 4E7ZA 5HDNA 1W7PB 1REPC 1UFMA 2R7ZJ 3MVPA 3F22A 4L9NA 5EGOB 5DS9A 2L7ZA 2R5YB 3LQRA 4ZDPA 1S8NA 2Y9YA 1D1BA 3CTAA 1FC3A 1HSTA 3QODA 1WVRA 2H94A 1ZG5A 3RZOJ 4A6DA 2JPCA 2VC1A 4KIBA 3RJPA 4LGWA 1SANA 1ZREA
chains in the Genus database with same CATH topology
2Z33A 2CWEA 4A12A 1P92A 3HTSB 2IRFG 5JVTA 1BIAA 2P7VB 4MTEA 2MLKA 4GYGA 2EWNA 4LLGF 4CYDA 3KLOA 3ZMVA 3GWZA 4G7OF 4I02A 2RC4A 2FU4A 3L9FA 4R79A 3T8RA 1EH7A 4EQQA 3LWFA 1FLIA 3K1MA 2COMA 3ZMTA 1U78A 2E7XA 2XROA 3HSFA 4PDKA 3T8TA 3WTTC 3WGGA 1XSDA 2E7WA 3IRQA 5F64A 1EV7A 2EV0A 2XGXA 3C18A 2XHKA 2LF7A 4EGYA 1RIOH 2MH9A 5CLSA 4M9XA 2PJPA 3R0JA 2OBPA 4HV5A 5IT9Z 4CZZA 4Q5SF 5L3FA 3KEQA 1R58A 1USSA 4ZYGA 2XV4S 3J81Z 1DPUA 1R5GA 1G4DA 3I58A 1K7AA 3LAPA 4OU0A 4WF2A 1J0RA 4LD5A 1O3TA 2ZXJA 2PBIA 4GXOA 1AOYA 2GAUA 1SD4A 3EETA 3FF5A 5ILSA 4XLPF 1STZA 2HQRA 2ACJA 1TQMA 3SQNA 1RI7A 4UVBA 1S29A 2GZWA 1YO5C 1YTYA 5AONA 1FYLA 4MEXF 4I0AA 3R61A 2HQNA 1KA8A 3FM5A 1YQAA 4LLLA 2K86A 2ZMEB 4G7ZF 2QM3A 4WXHA 3H92A 2FBIA 4A6EA 2A68F 2QZ8A 2QUFA 3GZ5A 5FGMA 3N4MA 3C7JA 2VONA 1QO0D 2IT0A 4OIOF 1ODDA 4ESFA 5ICFA 5FLXZ 1FP2A 2PN6A 1G3SA 3RKXA 1OPCA 4AIKA 2AS5F 2KIUA 4CGZA 2NAZA 2MH2A 5J8CA 4ENNA 3LA3A 5E1WA 3L09A 2A61A 3FMQA 2GQQA 4LK0F 1IZ1A 5K1YA 4ZYDA 5F6FA 3DQVC 4RB3C 1P4WA 2ISZA 4U0WA 5IT3A 3NEUA 3R6SA 2IA2A 3DV8A 4DNCA 1KU7A 2BYVE 2O6GE 4G94A 1UHWA 2IA0A 1ZLJA 2ISYA 1KU9A 1BI0A 1QNTA 1XB4A 1E2XA 1HW1A 3BP8A 1XMAA 3E5XA 2DPDA 4KFCA 1HSJA 1Z9CA 1ZN2A 2Q0OA 3WTUC 4IJAA 4A2UA 3TKYA 5DEQA 5J8FA 1W4MA 2Z99A 3PFIA 4O5VA 2H6BA 2GA1A 2RQPA 1P6RA 4EMSA 3IKVA 4ETSA 2FE3A 1K6OA 4LJZF 2ZNYA 3QAHA 2VE9A 3FMRA 4L5JA 1W5TA 2DQLA 3KP6A 1TQPA 3BY6A 4EV0A 4BQAA 2H27A 2VBZA 1U5TC 4HBLA 3TOBA 1FYKA 1V3FA 3VFZA 3AAFA 3N97A 2OZ6A 4HDVA 5DUIA 1Z7UA 1JGSA 2DLLA 1S7AA 5LRSA 3EUHA 5CJ9A 4YFKF 4XLNF 1DUXC 3KFWX 4M9ZA 1T2KA 1I1SA 1BOAA 2DK8A 1K79A 3RYRA 3DFGA 1YW9A 1YS6A 2YX7A 5FLXK 1ZG1A 1FBQA 1TLHB 5JI6A 3IL2A 3IHUA 4LG0A 4BYYA 3HRTA 2PI0A 1QBJA 4UV8A 5DD4A 5FD5A 4A0YA 1FX7A 1G3WA 2JSCA 2QLZA 2K02A 2FMLA 1G3TA 3WODF 2P6SA 3D5LA 5LGUA 5TRDA 4IHTA 2CFXA 2ETHA 2DTRA 4GYIA 5BQTA 1WRJA 3E97A 1PP8F 2WWYA 3VB2A 2RKHA 2EJRA 3KP2A 1YG2A 3K1PA 1PDNC 2XAGA 3V4GA 3KP3A 2L3DA 1FZPB 4ZYHA 1HKTA 1B9NA 4FT8A 4ZH4F 2MA3A 1KYZA 2VBYA 1IF1A 2XVCA 2XUBA 3WGIA 2MLGA 3GFIA 3I54A 3GO5A 1IRGA 1I6XA 2XIGA 1U2WA 3M9AA 2K4JA 3MCZA 4HF2A 2HDCA 1T0FA 2HGCA 2BEOA 2KKOA 1YS7A 3KZZA 3TDZC 3ZMDA 1TBXA 2P7CB 3QPTA 5D5VB 3DF8A 3QPHA 4L5IA 4R1HA 2STWA 2Y75A 2G9WA 2V1UA 4HW0A 4EJVA 5EEHA 2OD5A 4P9UA 1GXQA 3GW2A 1F5TA 3T5XA 3VEPA 2DBBA 4U7DA 2FBKA 1XSXA 3L7WA 4HAMA 1XCBA 3CUQC 5K5OA 3HUGA 1H9GA 3L2CA 4UVAA 1Y0UA 3RPQA 1ZGJA 3QRFF 4IRIA 5F1RA 4KDPA 3VOEA 1WWXA 1B9MA 1HBXG 3M8FA 1W5SA 1G3YA 3FHZA 3WTSC 1T39A 4R8HA 3GZ6A 1HQCA 2DFIA 1WKMA 3JSOA 1T38A 1OYYA 3TOAA 2GWRA 2IW5A 4GCVA 3CUQB 2M8EA 3CDHA 1Z1DA 4WXCA 4HZFA 2HWVA 4P55A 1S7OA 3BZ6A 1YLFA 5D4SA 2RDPA 1QPMA 3WE3A 3E6DA 2G7HA 1OKRA 1KGSA 3F8BA 4RB2C 4KN4X 2M87A 1U5TA 4XSZF 1P4XA 5J6XA 2EV6A 3U1DA 4CHUA 5D4RA 2IJLA 5E1ZB 3TDUC 3ECOA 2CO5A 3CLOA 4YFXF 2K7LA 1I27A 3V8LA 4RS8A 4XSXF 1Q1HA 4KT5C 3RDIA 5HS8A 3BJOA 1W7PA 3V7SA 2IP2A 4M6XA 4PCQA 3IKTA 2XRNA 4ESBA 1LDKB 3HTUA 2A69F 1FP1D 2JRTA 2R7FA 5FD6A 1KU3A 1BI1A 3F8NA 2FF4A 3RKWA 4D0PA 2P5LC 3ZMZA 3HSRA 2X4HA 3HHHA 1U8RA 3C3WA 2KJCA 5IT9K 1TNTA 4UHTA 1DDNA 3HOSA 2O61A 4LB5A 3FMSA 3TGNA 1ZRCA 4EJUA 4L9TA 1LVAA 1SD6A 2W84A 3MQ0A 2O03A 4MQ9F 2UXXA 3E6CC 4O6JA 2VT3A 2M30A 3U9GA 2KIFA 1TW2A 3EYYA 4ON0A 3DEUA 4LGWA 3I5UA 5JR3A 2MBFA 5CYVA 3CO6C 3COAC 5K5QA 3F23A 1CGPA 2H6CA 3K1NA 2UXNA 3HSEA 1L0OC 4HQMA 3WU0A 3WGHA 2WV0A 3I59A 2BGCA 1HXDA 2UWMA 3WTXC 5ED4A 4HF0A 1MJAA 1ULYA 4OMYA 2J5OA 2F2EA 3F8FA 1W7PD 1FBUA 2YPRA 5LGTA 5ILUA 6PAXA 3MZYA 1K78A 2HEOA 5HDGA 1H0MA 2VBXA 3K9TA 2A3SA 1BC7C 3ZPLA 3KP4A 3J80Z 3OOPA 2WC2A 4ENMA 4BHCA 4I09A 2EB7A 3DPTA 4UVCA 4P5OA 3HRMA 3ML6A 4EM1A 5L3GA 3PQJA 2LKPA 2VN2A 5ICEA 3GLXA 3MWMA 1KYWA 2EFWA 3WTVC 3FX3A 1B1BA 5AIPA 3KCCA 5HLHA 4M6YA 5ERIA 3P9IA 3JTGA 4P9FA 1ZYRF 2UZKA 4HF1A 3I59B 1QZZA 1ZGAA 1LDJA 1XDUA 1ZH5A 4EM2A 3P9KA 3IWFA 2EFNA 1WSUA 2J5PA 1YIOA 4I98B 1R22A 1MD0A 2D2WA 4RB0A 5D6FA 2GIVA 2QWWA 3E3VA 4HDUA 1ZRFA 5E8GA 2VT2A 1O57A 3JAMZ 1NHAA 1V4RA 1IN8A 1H9TA 2Z9OA 5KK1A 4RGUA 4A0ZA 2M1BA 2FRHA 4QWQA 1SFXA 2BBYA 3F72A 1B6AA 5DD8A 2XAHA 1E17A 5JHUA 2QQBA 2D45A 3GXOA 5L3BA 3ERED 4PGGA 5DUKA 1ZHFA 1FOKA 1TNSA 4WCGA 3ULQB 1BN5A 1YW8A 1LQ1A 3BDDA 1XGNA 1LEBA 5ILVA 2YSRA 1IRFA 1U5TB 2QVOA 1SMTA 1ZG3A 5L3DA 4LMYA 2L4AA 4UXNA 5EEGA 2VOOA 3LSTA 1BI3A 2EV5A 2WTEA 1I1GA 2L54A 2P5VA 4P96A 4I01A 3E5QA 3FXQA 1D5VA 2DAOA 2IVMA 4MGRA 4XRFA 5HS7A 2STTA 2F5FA 2P4WA 2DPUA 1QZYA 3O3KA 3GFLA 2DK5A 2OQRA 2FBHA 4IRGA 3RKYA 1XGOA 3WE2A 2HYGD 3HRSA 3KP5A 1TTYA 2DI3A 1BJAA 1ZAOA 2Y0MA 2Z3YA 3ZN1A 4CXFA 3S2WA 4ZZLA 2PQ8A 2HYFA 4KMUX 2P8TA 3W6KB 4HLXA 2AXLA 5A2QK 1KU2A 2FMYA 3R4KA 4EJTA 4G9YA 5FB2A 2OU2A 1CF7B 2DU9A 3I64A 4IVNA 5FFZA 1Z6RA 5DYMA 2JZYA 3RTRA 1HW2A 3Q9VA 2A07F 1XD7A 1IN4A 2E1NA 5D5UB 1YYVA 2NYXA 4Y13A 2W57A 2P6TA 1O3QA 5D6EA 4KIGA 2VC0A 3KEOA 4NQWA 5CVVA 2OA4A 2RN7A 5L3CA 3P9CA 4FHTA 2A5YB 1HKQA 1D8KA 3RYPA 3GX4X 3ZMSA 1YFHA 3MEXA 4KIFA 2P5KA 2XKOA 3ELKA 4AWXB 4H0EA 3CJNA 1LDDA 5DV5A 4OIPF 3GUDA 5E8IA 1SD7A 1R36A 1JXSA 2RGVA 2YR2A 3GEZA 1XSVA 3DPLC 3T1BA 2F5CA 3QU6A 2XASA 4L9VA 2QYOA 2NS0A 1FPQA 1CF7A 1IN6A 2ZFWA 5CVRA 2D1HA 4N9HA 2DQRA 2ZCWA 4WWCA 4B8XA 3FXUA 3Q9SA 4B09A 2ESHA 5BPDA 3ISPA 3TQNA 1ON2A 4N0BA 1ON1A 5K5RA 1R1VA 4JK1X 3QP5A 3F3XA 1HKSA 4Z2YA 3LFKA 4KICA 4LG0B 3SHFA 4G7HF 2HTJA 2V9VA 4WK8F 4EM0B 4YG2F 4A0XA 1O3RA 2FA5A 5DCFA 5ICCA 1U3EM 2YX4A 2LF8A 4IRHA 2VOPA 4EVIA 1O3SA 1UB9A 5H6QA 4HA8A 1WQ2A 4XBFA 2OZUA 4IPAA 2QBYB 1UCRA 2BE5F 4EJWA 4CICA 3V8JA 4M73A 4PZJA 1SAXA 1MZBA 5CVJA 1R00A 3CUQA 2A6HF 2RV8A 3ECHA 2L02A 4ZYEA 2HS5A 4BH9A 1HW5A 3I0TA 4MEYF 1LB2A 1BBYA 5LRRA 4IXAA 2QQ9A 3L00A 2EA4A 2VBWA 2MD5A 4M74A 3DKWA 3MFKA 1A04A 4NB5A 1OYIA 4TV7A 2W85A 4HQEA 1BM9A 1F9NA 3BPXA 4KUMA 5LLQA 4A5NA 3NQOA 3MAJA 4MQVA 3BWGA 3ZN0A 1JHFA 3D0SA 4A5MA 2CW0F 2EA2A 3JSPA 1GHCA 3G3ZA 5D8KB 2O0YA 3SZPA 4HX7A 3V8KA 3BJ6A 3ABUA 2CG4A 3KLNA 2HOEA 1FSHA 1ZLKA 2XAFA 2X0LA 1USTA 4U7BA 1TW3A 2KIMA 3O2PE 4OINF 2CSOA 2IPQX 1MDMB 1SFUA 3IWZA 2QENA 3NRVA 2FXAA 1RUOA 4IF4A 1KQ8A 2VE8A 2Q8KA 2FQ3A 3ABTA 2CYYA 4U0YA 1BC8C 4M72A 1O7FA 2O3FA 4KNYA 2ZKZA 2PMUA 1GXPA 2TDXA 2QQAA 5LEKA 1TQIA 3SZTA 3B02A 3ZP5A 5CVUA 3ZMUA 3WG9A 4GGGA 2R3SA 3OV8A 4HOBA 1GVJA 1B4AA 1R23A 2EFPA 4KN7X 4OOIA 3O6BB 4Y15A 5D5WB 4I0BA 2F5DA 4G6DA 1PUEE 5HS9A 4YIFA 2DW4A 4L0YB 5LEJA 3CUOA 4KYWA 1T98A 2R7DA 1T6SA 2Y48A 5A2QZ 2O8XA 1XGSA 3IC7A 1OYWA 1PP7U 3BROA 4U88A 3EQLF 2QBYA 3M7GA 1D8JA 2L4MA 2V1DA 1SMYF 1J5YA 3DXJF 2FSWA 3LAJA 3GFJA 2BV6A 2PLYA 1JE8A 5E20A 2HKXA 4IHSA 1OR7A 2V6CA 1IN5A 2HZTA 3TO7A 1P2FA 2ESNA 3QOPA 4N9IA 5DCMB 3SFZA 4NHJA 2FEZA 5DDGA 2B0LA 3F21A 1B59A 5HOOA 4ESJA 1OMIA 2NRAC 4UV9A 4LB6B 3F6OA 2XAJA 4I7HA 1XDSA 2G7UA 5H20A 3BOQA 4ZZDA 2CQKA 5E17F 2K4BA 3KE2A 4S05A 3HHGA 2FOKA 4O3MA 3M8EA 1FY7A 2V79A 4Y17A 3M1EA 1MJBA 1JHHA 4CDGA 4ENKA 4KMFA 2M45A 2XAQA 5FFXA 4I2OA 3KP7A 5TJJA 1R7JA 4G6QA 2IA1A 2HR3A 2JT1A 1XGMA 5BPIA 4L18B 4FX4A 2GA2A 1RNLA 1XN7A 2ZO4A 3G73A 1J9IA 2M5WA 3F8MA 2ZBKA 3F8CA 5FO5A 4BHPA 1J75A 5LHGA 3TO9A 2LDUA 1D3YA 1Z05A 4KA4A 1I5ZA 1Z91A 2ELHA 3H3UA 4UUVA 1S3JA 1YW7A 3K69A 3J80K 3QP6A 2E1CA 3E6MA 2MC3A 3I71A 3K0LA 2DT5A 3LA2A 3HIFA 3WTZA 1MDMA 3W6JB 1FNNA 4M9SA 2GXGA 4E70A 5H6RA 3PQKA 3HYIA 2JPBA 4BXUA 1IN7A 3IRRA 1XCVA 4AIJA 3C1DA 4ENJA 3J81K 4HYEA 4QLCU 1EH8A 2NNYA 2PMHA 4AVPA 3R0AA 3KZYA 1J59A 1SD5A 4RGXA 3QU3A 2YU3A 4Q4ZF 4JBAA 2PG4A 4F7ZA 1MJ9A 3FZVA 2HTSA 3GFMA 3MZHA 5D5XB 3EYIA 5E18F 4OMZA 1DP7P 3GF2A 1O7LA 4HLYA 1MKMA 4MHGA 4AD9A 1IW7F 5HDKA 2OAZA 2V1XA 4L0ZB 3RPUA 3LQQA 4YIIA 3BJAA 2KJBA 4MTDA 3RIRA 3JAMK 3FXRA 4U0VA 1EH6A 2FNAA 3BPVA 4MNUA 1BIBA 1J2XA 1LJ9A 1L3LA 1IXCA 1IUYA 4K2EA 2GXBA 1S6LA 2ZJ2A 1UHMA 3LA7A 3Q5FA 4L9JA 4RGSA 5E1XA 2DO7A 2PFBA 1QGPA 1R5HA 1FT9A 4LFUA 3F6VA 5ICGA 1XMKA 1KQ0A 4S04A 2LNBA 3E6BA 2LSOA 4EJOA 1LNWA 1R1TA 3JTHA 5HVQC 1R1UA 5LHHA 5HLGA 2H09A 2C6YA 2JTVA 3CO7C 4RB1A 3H3ZA 5CVIA 3ZQ7A 5JFRA 4LK1F 3U2RA 1K78B 3ROUA 2FNPA 4OIQF 2VODA 1RUNA 1P4AA 4UNOA 3P7NA 2Q2EA 4EGZA 4FX0A 4HX4A 2XKPA 2A6EF 1VTNC 3WTWC 4ASNA 1SFEA 4PGHA 1DPRA 1MGTA 4M71A 5BS6A 3HRUA 2RVCA 1WI9A 3SXYA 2Z5UA 1ZARA 2OQGA 1FWZA 1C0WA 3HOTA 1QQIA 4RGRA 1FYMA 4Q48A 2L01A 2K27A 2KRFA 4RAZA 4HV6A 1AWCA 4G8XA 3WTYC 1KQ9A 3GYHX 3T0YA 5D8LB 4Q47A 5DCMA 1F4KA 2ZNZA 2EFOA 2D1VA 3JW4A 5AIQA 3J7AO 4RAYA 2EK5A 3WU1B 3FWEA 1RZ4A 3TO6A 3DP7A 4BNCA 2EFQA 4YFNF 2PEXA 5LBQA 2ADUA 4DQ2A 1ZRDA 3V7RA 1IXSB 3R60A 4AIHA 2NNNA 4LLNA 5KVRA 2ZMEA 1IAWA 4JQFA 4WX9A 4WXDA 3E5UA 2F5EA 1Z6TA 1LEAA 2VXZA 1FSEA 3I53A 4OIRF 4CO8A 3GVAA 3REOA 3EDPA 2HFHA 3FM3A 4HX8A 3RI4A 1U6GA 1IXRC 2CGPA 5LHIA 1G6NA 1BI2A 2W25A 3I4PA 3VODA 5LGNA 1FBSA 2HKOA 1X3UA 5L3EA 3B73A 3K2ZA 1J7KA 2RNJA 4GO1A 5BMZA 1F1ZA 5BOXA 2W24A 3V7CA 4BHBA 3KETA 4BAYA 1ONVA 5HDNA 1W7PB 1REPC 1UFMA 3F22A 4L9NA 3LQRA 1S8NA 3CTAA 1FC3A 1HSTA 2H94A 1ZG5A 4A6DA 2JPCA 2VC1A 4KIBA 3RJPA 5HLIA 1ZREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z33 A;  2CWE A;  4A12 A;  1P92 A;  3HTS B;  2IRF G;  5JVT A;  1BIA A;  2P7V B;  4MTE A;  2MLK A;  4GYG A;  2EWN A;  4LLG F;  4CYD A;  3KLO A;  3ZMV A;  3GWZ A;  4G7O F;  4I02 A;  2RC4 A;  2FU4 A;  3L9F A;  4R79 A;  3T8R A;  1EH7 A;  4EQQ A;  3LWF A;  1FLI A;  3K1M A;  2COM A;  3ZMT A;  1U78 A;  2E7X A;  2XRO A;  3HSF A;  4PDK A;  3T8T A;  3WTT C;  3WGG A;  1XSD A;  2E7W A;  3IRQ A;  5F64 A;  1EV7 A;  2EV0 A;  2XGX A;  3C18 A;  2XHK A;  2LF7 A;  4EGY A;  1RIO H;  2MH9 A;  5CLS A;  4M9X A;  2PJP A;  3R0J A;  2OBP A;  4HV5 A;  5IT9 Z;  4CZZ A;  4Q5S F;  5L3F A;  3KEQ A;  1R58 A;  1USS A;  4ZYG A;  2XV4 S;  3J81 Z;  1DPU A;  1R5G A;  1G4D A;  3I58 A;  1K7A A;  3LAP A;  4OU0 A;  4WF2 A;  1J0R A;  4LD5 A;  1O3T A;  2ZXJ A;  2PBI A;  4GXO A;  1AOY A;  2GAU A;  1SD4 A;  3EET A;  3FF5 A;  5ILS A;  4XLP F;  1STZ A;  2HQR A;  2ACJ A;  1TQM A;  3SQN A;  1RI7 A;  4UVB A;  1S29 A;  2GZW A;  1YO5 C;  1YTY A;  5AON A;  1FYL A;  4MEX F;  4I0A A;  3R61 A;  2HQN A;  1KA8 A;  3FM5 A;  1YQA A;  4LLL A;  2K86 A;  2ZME B;  4G7Z F;  2QM3 A;  4WXH A;  3H92 A;  2FBI A;  4A6E A;  2A68 F;  2QZ8 A;  2QUF A;  3GZ5 A;  5FGM A;  3N4M A;  3C7J A;  2VON A;  1QO0 D;  2IT0 A;  4OIO F;  1ODD A;  4ESF A;  5ICF A;  5FLX Z;  1FP2 A;  2PN6 A;  1G3S A;  3RKX A;  1OPC A;  4AIK A;  2AS5 F;  2KIU A;  4CGZ A;  2NAZ A;  2MH2 A;  5J8C A;  4ENN A;  3LA3 A;  5E1W A;  3L09 A;  2A61 A;  3FMQ A;  2GQQ A;  4LK0 F;  1IZ1 A;  5K1Y A;  4ZYD A;  5F6F A;  3DQV C;  4RB3 C;  1P4W A;  2ISZ A;  4U0W A;  5IT3 A;  3NEU A;  3R6S A;  2IA2 A;  3DV8 A;  4DNC A;  1KU7 A;  2BYV E;  2O6G E;  4G94 A;  1UHW A;  2IA0 A;  1ZLJ A;  2ISY A;  1KU9 A;  1BI0 A;  1QNT A;  1XB4 A;  1E2X A;  1HW1 A;  3BP8 A;  1XMA A;  3E5X A;  2DPD A;  4KFC A;  1HSJ A;  1Z9C A;  1ZN2 A;  2Q0O A;  3WTU C;  4IJA A;  4A2U A;  3TKY A;  5DEQ A;  5J8F A;  1W4M A;  2Z99 A;  3PFI A;  4O5V A;  2H6B A;  2GA1 A;  2RQP A;  1P6R A;  4EMS A;  3IKV A;  4ETS A;  2FE3 A;  1K6O A;  4LJZ F;  2ZNY A;  3QAH A;  2VE9 A;  3FMR A;  4L5J A;  1W5T A;  2DQL A;  3KP6 A;  1TQP A;  3BY6 A;  4EV0 A;  4BQA A;  2H27 A;  2VBZ A;  1U5T C;  4HBL A;  3TOB A;  1FYK A;  1V3F A;  3VFZ A;  3AAF A;  3N97 A;  2OZ6 A;  4HDV A;  5DUI A;  1Z7U A;  1JGS A;  2DLL A;  1S7A A;  5LRS A;  3EUH A;  5CJ9 A;  4YFK F;  4XLN F;  1DUX C;  3KFW X;  4M9Z A;  1T2K A;  1I1S A;  1BOA A;  2DK8 A;  1K79 A;  3RYR A;  3DFG A;  1YW9 A;  1YS6 A;  2YX7 A;  5FLX K;  1ZG1 A;  1FBQ A;  1TLH B;  5JI6 A;  3IL2 A;  3IHU A;  4LG0 A;  4BYY A;  3HRT A;  2PI0 A;  1QBJ A;  4UV8 A;  5DD4 A;  5FD5 A;  4A0Y A;  1FX7 A;  1G3W A;  2JSC A;  2QLZ A;  2K02 A;  2FML A;  1G3T A;  3WOD F;  2P6S A;  3D5L A;  5LGU A;  5TRD A;  4IHT A;  2CFX A;  2ETH A;  2DTR A;  4GYI A;  5BQT A;  1WRJ A;  3E97 A;  1PP8 F;  2WWY A;  3VB2 A;  2RKH A;  2EJR A;  3KP2 A;  1YG2 A;  3K1P A;  1PDN C;  2XAG A;  3V4G A;  3KP3 A;  2L3D A;  1FZP B;  4ZYH A;  1HKT A;  1B9N A;  4FT8 A;  4ZH4 F;  2MA3 A;  1KYZ A;  2VBY A;  1IF1 A;  2XVC A;  2XUB A;  3WGI A;  2MLG A;  3GFI A;  3I54 A;  3GO5 A;  1IRG A;  1I6X A;  2XIG A;  1U2W A;  3M9A A;  2K4J A;  3MCZ A;  4HF2 A;  2HDC A;  1T0F A;  2HGC A;  2BEO A;  2KKO A;  1YS7 A;  3KZZ A;  3TDZ C;  3ZMD A;  1TBX A;  2P7C B;  3QPT A;  5D5V B;  3DF8 A;  3QPH A;  4L5I A;  4R1H A;  2STW A;  2Y75 A;  2G9W A;  2V1U A;  4HW0 A;  4EJV A;  5EEH A;  2OD5 A;  4P9U A;  1GXQ A;  3GW2 A;  1F5T A;  3T5X A;  3VEP A;  2DBB A;  4U7D A;  2FBK A;  1XSX A;  3L7W A;  4HAM A;  1XCB A;  3CUQ C;  5K5O A;  3HUG A;  1H9G A;  3L2C A;  4UVA A;  1Y0U A;  3RPQ A;  1ZGJ A;  3QRF F;  4IRI A;  5F1R A;  4KDP A;  3VOE A;  1WWX A;  1B9M A;  1HBX G;  3M8F A;  1W5S A;  1G3Y A;  3FHZ A;  3WTS C;  1T39 A;  4R8H A;  3GZ6 A;  1HQC A;  2DFI A;  1WKM A;  3JSO A;  1T38 A;  1OYY A;  3TOA A;  2GWR A;  2IW5 A;  4GCV A;  3CUQ B;  2M8E A;  3CDH A;  1Z1D A;  4WXC A;  4HZF A;  2HWV A;  4P55 A;  1S7O A;  3BZ6 A;  1YLF A;  5D4S A;  2RDP A;  1QPM A;  3WE3 A;  3E6D A;  2G7H A;  1OKR A;  1KGS A;  3F8B A;  4RB2 C;  4KN4 X;  2M87 A;  1U5T A;  4XSZ F;  1P4X A;  5J6X A;  2EV6 A;  3U1D A;  4CHU A;  5D4R A;  2IJL A;  5E1Z B;  3TDU C;  3ECO A;  2CO5 A;  3CLO A;  4YFX F;  2K7L A;  1I27 A;  3V8L A;  4RS8 A;  4XSX F;  1Q1H A;  4KT5 C;  3RDI A;  5HS8 A;  3BJO A;  1W7P A;  3V7S A;  2IP2 A;  4M6X A;  4PCQ A;  3IKT A;  2XRN A;  4ESB A;  1LDK B;  3HTU A;  2A69 F;  1FP1 D;  2JRT A;  2R7F A;  5FD6 A;  1KU3 A;  1BI1 A;  3F8N A;  2FF4 A;  3RKW A;  4D0P A;  2P5L C;  3ZMZ A;  3HSR A;  2X4H A;  3HHH A;  1U8R A;  3C3W A;  2KJC A;  5IT9 K;  1TNT A;  4UHT A;  1DDN A;  3HOS A;  2O61 A;  4LB5 A;  3FMS A;  3TGN A;  1ZRC A;  4EJU A;  4L9T A;  1LVA A;  1SD6 A;  2W84 A;  3MQ0 A;  2O03 A;  4MQ9 F;  2UXX A;  3E6C C;  4O6J A;  2VT3 A;  2M30 A;  3U9G A;  2KIF A;  1TW2 A;  3EYY A;  4ON0 A;  3DEU A;  4LGW A;  3I5U A;  5JR3 A;  2MBF A;  5CYV A;  3CO6 C;  3COA C;  5K5Q A;  3F23 A;  1CGP A;  2H6C A;  3K1N A;  2UXN A;  3HSE A;  1L0O C;  4HQM A;  3WU0 A;  3WGH A;  2WV0 A;  3I59 A;  2BGC A;  1HXD A;  2UWM A;  3WTX C;  5ED4 A;  4HF0 A;  1MJA A;  1ULY A;  4OMY A;  2J5O A;  2F2E A;  3F8F A;  1W7P D;  1FBU A;  2YPR A;  5LGT A;  5ILU A;  6PAX A;  3MZY A;  1K78 A;  2HEO A;  5HDG A;  1H0M A;  2VBX A;  3K9T A;  2A3S A;  1BC7 C;  3ZPL A;  3KP4 A;  3J80 Z;  3OOP A;  2WC2 A;  4ENM A;  4BHC A;  4I09 A;  2EB7 A;  3DPT A;  4UVC A;  4P5O A;  3HRM A;  3ML6 A;  4EM1 A;  5L3G A;  3PQJ A;  2LKP A;  2VN2 A;  5ICE A;  3GLX A;  3MWM A;  1KYW A;  2EFW A;  3WTV C;  3FX3 A;  1B1B A;  5AIP A;  3KCC A;  5HLH A;  4M6Y A;  5ERI A;  3P9I A;  3JTG A;  4P9F A;  1ZYR F;  2UZK A;  4HF1 A;  3I59 B;  1QZZ A;  1ZGA A;  1LDJ A;  1XDU A;  1ZH5 A;  4EM2 A;  3P9K A;  3IWF A;  2EFN A;  1WSU A;  2J5P A;  1YIO A;  4I98 B;  1R22 A;  1MD0 A;  2D2W A;  4RB0 A;  5D6F A;  2GIV A;  2QWW A;  3E3V A;  4HDU A;  1ZRF A;  5E8G A;  2VT2 A;  1O57 A;  3JAM Z;  1NHA A;  1V4R A;  1IN8 A;  1H9T A;  2Z9O A;  5KK1 A;  4RGU A;  4A0Z A;  2M1B A;  2FRH A;  4QWQ A;  1SFX A;  2BBY A;  3F72 A;  1B6A A;  5DD8 A;  2XAH A;  1E17 A;  5JHU A;  2QQB A;  2D45 A;  3GXO A;  5L3B A;  3ERE D;  4PGG A;  5DUK A;  1ZHF A;  1FOK A;  1TNS A;  4WCG A;  3ULQ B;  1BN5 A;  1YW8 A;  1LQ1 A;  3BDD A;  1XGN A;  1LEB A;  5ILV A;  2YSR A;  1IRF A;  1U5T B;  2QVO A;  1SMT A;  1ZG3 A;  5L3D A;  4LMY A;  2L4A A;  4UXN A;  5EEG A;  2VOO A;  3LST A;  1BI3 A;  2EV5 A;  2WTE A;  1I1G A;  2L54 A;  2P5V A;  4P96 A;  4I01 A;  3E5Q A;  3FXQ A;  1D5V A;  2DAO A;  2IVM A;  4MGR A;  4XRF A;  5HS7 A;  2STT A;  2F5F A;  2P4W A;  2DPU A;  1QZY A;  3O3K A;  3GFL A;  2DK5 A;  2OQR A;  2FBH A;  4IRG A;  3RKY A;  1XGO A;  3WE2 A;  2HYG D;  3HRS A;  3KP5 A;  1TTY A;  2DI3 A;  1BJA A;  1ZAO A;  2Y0M A;  2Z3Y A;  3ZN1 A;  4CXF A;  3S2W A;  4ZZL A;  2PQ8 A;  2HYF A;  4KMU X;  2P8T A;  3W6K B;  4HLX A;  2AXL A;  5A2Q K;  1KU2 A;  2FMY A;  3R4K A;  4EJT A;  4G9Y A;  5FB2 A;  2OU2 A;  1CF7 B;  2DU9 A;  3I64 A;  4IVN A;  5FFZ A;  1Z6R A;  5DYM A;  2JZY A;  3RTR A;  1HW2 A;  3Q9V A;  2A07 F;  1XD7 A;  1IN4 A;  2E1N A;  5D5U B;  1YYV A;  2NYX A;  4Y13 A;  2W57 A;  2P6T A;  1O3Q A;  5D6E A;  4KIG A;  2VC0 A;  3KEO A;  4NQW A;  5CVV A;  2OA4 A;  2RN7 A;  5L3C A;  3P9C A;  4FHT A;  2A5Y B;  1HKQ A;  1D8K A;  3RYP A;  3GX4 X;  3ZMS A;  1YFH A;  3MEX A;  4KIF A;  2P5K A;  2XKO A;  3ELK A;  4AWX B;  4H0E A;  3CJN A;  1LDD A;  5DV5 A;  4OIP F;  3GUD A;  5E8I A;  1SD7 A;  1R36 A;  1JXS A;  2RGV A;  2YR2 A;  3GEZ A;  1XSV A;  3DPL C;  3T1B A;  2F5C A;  3QU6 A;  2XAS A;  4L9V A;  2QYO A;  2NS0 A;  1FPQ A;  1CF7 A;  1IN6 A;  2ZFW A;  5CVR A;  2D1H A;  4N9H A;  2DQR A;  2ZCW A;  4WWC A;  4B8X A;  3FXU A;  3Q9S A;  4B09 A;  2ESH A;  5BPD A;  3ISP A;  3TQN A;  1ON2 A;  4N0B A;  1ON1 A;  5K5R A;  1R1V A;  4JK1 X;  3QP5 A;  3F3X A;  1HKS A;  4Z2Y A;  3LFK A;  4KIC A;  4LG0 B;  3SHF A;  4G7H F;  2HTJ A;  2V9V A;  4WK8 F;  4EM0 B;  4YG2 F;  4A0X A;  1O3R A;  2FA5 A;  5DCF A;  5ICC A;  1U3E M;  2YX4 A;  2LF8 A;  4IRH A;  2VOP A;  4EVI A;  1O3S A;  1UB9 A;  5H6Q A;  4HA8 A;  1WQ2 A;  4XBF A;  2OZU A;  4IPA A;  2QBY B;  1UCR A;  2BE5 F;  4EJW A;  4CIC A;  3V8J A;  4M73 A;  4PZJ A;  1SAX A;  1MZB A;  5CVJ A;  1R00 A;  3CUQ A;  2A6H F;  2RV8 A;  3ECH A;  2L02 A;  4ZYE A;  2HS5 A;  4BH9 A;  1HW5 A;  3I0T A;  4MEY F;  1LB2 A;  1BBY A;  5LRR A;  4IXA A;  2QQ9 A;  3L00 A;  2EA4 A;  2VBW A;  2MD5 A;  4M74 A;  3DKW A;  3MFK A;  1A04 A;  4NB5 A;  1OYI A;  4TV7 A;  2W85 A;  4HQE A;  1BM9 A;  1F9N A;  3BPX A;  4KUM A;  5LLQ A;  4A5N A;  3NQO A;  3MAJ A;  4MQV A;  3BWG A;  3ZN0 A;  1JHF A;  3D0S A;  4A5M A;  2CW0 F;  2EA2 A;  3JSP A;  1GHC A;  3G3Z A;  5D8K B;  2O0Y A;  3SZP A;  4HX7 A;  3V8K A;  3BJ6 A;  3ABU A;  2CG4 A;  3KLN A;  2HOE A;  1FSH A;  1ZLK A;  2XAF A;  2X0L A;  1UST A;  4U7B A;  1TW3 A;  2KIM A;  3O2P E;  4OIN F;  2CSO A;  2IPQ X;  1MDM B;  1SFU A;  3IWZ A;  2QEN A;  3NRV A;  2FXA A;  1RUO A;  4IF4 A;  1KQ8 A;  2VE8 A;  2Q8K A;  2FQ3 A;  3ABT A;  2CYY A;  4U0Y A;  1BC8 C;  4M72 A;  1O7F A;  2O3F A;  4KNY A;  2ZKZ A;  2PMU A;  1GXP A;  2TDX A;  2QQA A;  5LEK A;  1TQI A;  3SZT A;  3B02 A;  3ZP5 A;  5CVU A;  3ZMU A;  3WG9 A;  4GGG A;  2R3S A;  3OV8 A;  4HOB A;  1GVJ A;  1B4A A;  1R23 A;  2EFP A;  4KN7 X;  4OOI A;  3O6B B;  4Y15 A;  5D5W B;  4I0B A;  2F5D A;  4G6D A;  1PUE E;  5HS9 A;  4YIF A;  2DW4 A;  4L0Y B;  5LEJ A;  3CUO A;  4KYW A;  1T98 A;  2R7D A;  1T6S A;  2Y48 A;  5A2Q Z;  2O8X A;  1XGS A;  3IC7 A;  1OYW A;  1PP7 U;  3BRO A;  4U88 A;  3EQL F;  2QBY A;  3M7G A;  1D8J A;  2L4M A;  2V1D A;  1SMY F;  1J5Y A;  3DXJ F;  2FSW A;  3LAJ A;  3GFJ A;  2BV6 A;  2PLY A;  1JE8 A;  5E20 A;  2HKX A;  4IHS A;  1OR7 A;  2V6C A;  1IN5 A;  2HZT A;  3TO7 A;  1P2F A;  2ESN A;  3QOP A;  4N9I A;  5DCM B;  3SFZ A;  4NHJ A;  2FEZ A;  5DDG A;  2B0L A;  3F21 A;  1B59 A;  5HOO A;  4ESJ A;  1OMI A;  2NRA C;  4UV9 A;  4LB6 B;  3F6O A;  2XAJ A;  4I7H A;  1XDS A;  2G7U A;  5H20 A;  3BOQ A;  4ZZD A;  2CQK A;  5E17 F;  2K4B A;  3KE2 A;  4S05 A;  3HHG A;  2FOK A;  4O3M A;  3M8E A;  1FY7 A;  2V79 A;  4Y17 A;  3M1E A;  1MJB A;  1JHH A;  4CDG A;  4ENK A;  4KMF A;  2M45 A;  2XAQ A;  5FFX A;  4I2O A;  3KP7 A;  5TJJ A;  1R7J A;  4G6Q A;  2IA1 A;  2HR3 A;  2JT1 A;  1XGM A;  5BPI A;  4L18 B;  4FX4 A;  2GA2 A;  1RNL A;  1XN7 A;  2ZO4 A;  3G73 A;  1J9I A;  2M5W A;  3F8M A;  2ZBK A;  3F8C A;  5FO5 A;  4BHP A;  1J75 A;  5LHG A;  3TO9 A;  2LDU A;  1D3Y A;  1Z05 A;  4KA4 A;  1I5Z A;  1Z91 A;  2ELH A;  3H3U A;  4UUV A;  1S3J A;  1YW7 A;  3K69 A;  3J80 K;  3QP6 A;  2E1C A;  3E6M A;  2MC3 A;  3I71 A;  3K0L A;  2DT5 A;  3LA2 A;  3HIF A;  3WTZ A;  1MDM A;  3W6J B;  1FNN A;  4M9S A;  2GXG A;  4E70 A;  5H6R A;  3PQK A;  3HYI A;  2JPB A;  4BXU A;  1IN7 A;  3IRR A;  1XCV A;  4AIJ A;  3C1D A;  4ENJ A;  3J81 K;  4HYE A;  4QLC U;  1EH8 A;  2NNY A;  2PMH A;  4AVP A;  3R0A A;  3KZY A;  1J59 A;  1SD5 A;  4RGX A;  3QU3 A;  2YU3 A;  4Q4Z F;  4JBA A;  2PG4 A;  4F7Z A;  1MJ9 A;  3FZV A;  2HTS A;  3GFM A;  3MZH A;  5D5X B;  3EYI A;  5E18 F;  4OMZ A;  1DP7 P;  3GF2 A;  1O7L A;  4HLY A;  1MKM A;  4MHG A;  4AD9 A;  1IW7 F;  5HDK A;  2OAZ A;  2V1X A;  4L0Z B;  3RPU A;  3LQQ A;  4YII A;  3BJA A;  2KJB A;  4MTD A;  3RIR A;  3JAM K;  3FXR A;  4U0V A;  1EH6 A;  2FNA A;  3BPV A;  4MNU A;  1BIB A;  1J2X A;  1LJ9 A;  1L3L A;  1IXC A;  1IUY A;  4K2E A;  2GXB A;  1S6L A;  2ZJ2 A;  1UHM A;  3LA7 A;  3Q5F A;  4L9J A;  4RGS A;  5E1X A;  2DO7 A;  2PFB A;  1QGP A;  1R5H A;  1FT9 A;  4LFU A;  3F6V A;  5ICG A;  1XMK A;  1KQ0 A;  4S04 A;  2LNB A;  3E6B A;  2LSO A;  4EJO A;  1LNW A;  1R1T A;  3JTH A;  5HVQ C;  1R1U A;  5LHH A;  5HLG A;  2H09 A;  2C6Y A;  2JTV A;  3CO7 C;  4RB1 A;  3H3Z A;  5CVI A;  3ZQ7 A;  5JFR A;  4LK1 F;  3U2R A;  1K78 B;  3ROU A;  2FNP A;  4OIQ F;  2VOD A;  1RUN A;  1P4A A;  4UNO A;  3P7N A;  2Q2E A;  4EGZ A;  4FX0 A;  4HX4 A;  2XKP A;  2A6E F;  1VTN C;  3WTW C;  4ASN A;  1SFE A;  4PGH A;  1DPR A;  1MGT A;  4M71 A;  5BS6 A;  3HRU A;  2RVC A;  1WI9 A;  3SXY A;  2Z5U A;  1ZAR A;  2OQG A;  1FWZ A;  1C0W A;  3HOT A;  1QQI A;  4RGR A;  1FYM A;  4Q48 A;  2L01 A;  2K27 A;  2KRF A;  4RAZ A;  4HV6 A;  1AWC A;  4G8X A;  3WTY C;  1KQ9 A;  3GYH X;  3T0Y A;  5D8L B;  4Q47 A;  5DCM A;  1F4K A;  2ZNZ A;  2EFO A;  2D1V A;  3JW4 A;  5AIQ A;  3J7A O;  4RAY A;  2EK5 A;  3WU1 B;  3FWE A;  1RZ4 A;  3TO6 A;  3DP7 A;  4BNC A;  2EFQ A;  4YFN F;  2PEX A;  5LBQ A;  2ADU A;  4DQ2 A;  1ZRD A;  3V7R A;  1IXS B;  3R60 A;  4AIH A;  2NNN A;  4LLN A;  5KVR A;  2ZME A;  1IAW A;  4JQF A;  4WX9 A;  4WXD A;  3E5U A;  2F5E A;  1Z6T A;  1LEA A;  2VXZ A;  1FSE A;  3I53 A;  4OIR F;  4CO8 A;  3GVA A;  3REO A;  3EDP A;  2HFH A;  3FM3 A;  4HX8 A;  3RI4 A;  1U6G A;  1IXR C;  2CGP A;  5LHI A;  1G6N A;  1BI2 A;  2W25 A;  3I4P A;  3VOD A;  5LGN A;  1FBS A;  2HKO A;  1X3U A;  5L3E A;  3B73 A;  3K2Z A;  1J7K A;  2RNJ A;  4GO1 A;  5BMZ A;  1F1Z A;  5BOX A;  2W24 A;  3V7C A;  4BHB A;  3KET A;  4BAY A;  1ONV A;  5HDN A;  1W7P B;  1REP C;  1UFM A;  3F22 A;  4L9N A;  3LQR A;  1S8N A;  3CTA A;  1FC3 A;  1HST A;  2H94 A;  1ZG5 A;  4A6D A;  2JPC A;  2VC1 A;  4KIB A;  3RJP A;  5HLI A;  1ZRE A; 
#chains in the Genus database with same CATH topology
 2Z33 A;  2CWE A;  2VQH A;  3UNG C;  4A12 A;  4A3J J;  1P92 A;  3HTS B;  2IRF G;  4CCJ A;  5KHD A;  5JLW A;  3S93 A;  4PJJ A;  3GTJ J;  2XSD C;  5JVT A;  3OS0 A;  1W36 C;  1BIA A;  2P7V B;  1MSF C;  4MTE A;  2K9Q A;  2DDB A;  1W1W E;  2QEX I;  2MLK A;  3GTQ J;  3Q0W A;  2VXD A;  3G71 I;  1ETY A;  2EWN A;  4GYG A;  4LLG F;  3IH4 A;  3FIS A;  2LMD A;  3SYT A;  4CYD A;  3KLO A;  3ZMV A;  2IAI A;  3FXO A;  3GWZ A;  4G7O F;  4LIV A;  3S15 J;  4I02 A;  2RC4 A;  4BE1 A;  1JUP A;  1RKT A;  1JJ8 C;  2Q1Z B;  3ZR8 X;  2LYC A;  2OCE A;  2FU4 A;  3L9F A;  4R79 A;  2F5V A;  3T8R A;  1EH7 A;  1UG0 A;  2DT7 B;  2MSY A;  4G6T B;  3GTM J;  4EQQ A;  5FKL A;  5DM7 F;  3Q0U A;  3BR1 A;  3JRD A;  1X2M A;  3LWF A;  4DZJ A;  2KZV A;  1FLI A;  2JA7 J;  3K4K A;  3K1M A;  2COM A;  3LSH A;  3ZMT A;  5F08 A;  2IS6 A;  3HPG A;  1NTC A;  2DJN A;  1EF4 A;  1U78 A;  2E7X A;  1F36 A;  2XRO A;  1WPK A;  2OUM A;  3TP3 A;  1WH7 A;  5GAD J;  3HSF A;  1SFO J;  4PDK A;  3T8T A;  3WTT C;  2I5U A;  4AC0 A;  4RDU A;  3WGG A;  2CW7 A;  1XSD A;  1MBE A;  3QQA A;  2AHQ A;  2E7W A;  3IRQ A;  5F64 A;  2KRH A;  2NXN B;  1EV7 A;  2QF7 A;  2LY1 A;  4BL0 B;  3ABK H;  2EV0 A;  2XGX A;  3C18 A;  2DMP A;  2XHK A;  2LF7 A;  3H35 A;  1GV2 A;  2R5Y A;  4EGY A;  1RIO H;  3X2Q H;  4EAT A;  2MH9 A;  3L2W A;  2VLA A;  5CLS A;  1W0U A;  4PSW A;  4ZJZ A;  4M9X A;  3CME I;  3HKZ N;  2PJP A;  3R0J A;  2OBP A;  2L9S A;  4HV5 A;  3BZC A;  4CZZ A;  5IT9 Z;  4Q5S F;  5L3F A;  3KEQ A;  1R58 A;  1USS A;  1Y1V J;  3OMY A;  4ZYG A;  2XV4 S;  3J81 Z;  2L2O A;  5GAH J;  4M3E A;  1YIJ I;  5IYD J;  5GPC A;  3FDY A;  1SVL A;  1R5G A;  1DPU A;  1G4D A;  3GCM A;  3I58 A;  1K7A A;  3LAP A;  4OU0 A;  4PFO A;  4WF2 A;  1J0R A;  4LD5 A;  1O3T A;  2ZXJ A;  2PBI A;  4GXO A;  1AOY A;  1FOY A;  2GAU A;  2IGO A;  1SD4 A;  3EET A;  3FF5 A;  5ILS A;  4XLP F;  1STZ A;  2HQR A;  4V2G A;  1UG2 A;  2ACJ A;  1TQM A;  3SQN A;  1HCR A;  1RI7 A;  4NQW B;  4UVB A;  1S29 A;  2GZW A;  4FQG A;  1YO5 C;  1YTY A;  1AHD P;  1YJW I;  5AON A;  1FYL A;  4MEX F;  4I0A A;  3R61 A;  2XPU A;  2HQN A;  1KA8 A;  3FM5 A;  4BQQ A;  1YQA A;  2Z1D A;  3OYI A;  4LLL A;  2E60 A;  2K86 A;  2ZME B;  3K4J A;  4G7Z F;  2IGM A;  1JUS A;  1U8B A;  4B48 A;  2QM3 A;  3LMM A;  3LSI A;  2E1O A;  4WXH A;  3OYL A;  2R93 J;  2DJI A;  3H92 A;  4IQJ A;  2FBI A;  4CYC B;  4A6E A;  2A68 F;  4N4O B;  2QZ8 A;  2QUF A;  1TT0 A;  2QCO A;  3DEE A;  3GZ5 A;  4XKV A;  5FGM A;  1DGR M;  3QYE A;  3N4M A;  3ZQQ A;  3C7J A;  3HUG B;  2VON A;  1QO0 D;  2IT0 A;  5GAE J;  2WA0 A;  4OIO F;  1ODD A;  4ESF A;  3FHN A;  4HST A;  5ICF A;  5FLX Z;  1UJ8 A;  1FP2 A;  1TZL A;  3GTO J;  2PN6 A;  3OS2 A;  3UKG A;  1G3S A;  1ETQ A;  3RKX A;  1P9Q C;  2OV7 A;  1I3Q J;  1OPC A;  4AIK A;  2AS5 F;  4HRI A;  4FE7 A;  2KIU A;  5KAF C;  5HOD A;  4CGZ A;  2XPV A;  4MO7 A;  4E7K A;  2NAZ A;  2MH2 A;  3KZI C;  5J8C A;  4ENN A;  3LA3 A;  2WB1 N;  5E1W A;  5DTD A;  2V4J C;  1A36 A;  1V55 H;  3D5S C;  3L09 A;  2A61 A;  3FMQ A;  2GQQ A;  4LK0 F;  2O9L A;  3A2K A;  1IZ1 A;  5K1Y A;  1VQ7 I;  1HC8 A;  3HM5 A;  4ZYD A;  5F6F A;  3DQV C;  4RB3 C;  1P4W A;  5B5E C;  4U0W A;  2ISZ A;  3S1Q J;  2ZB9 A;  5IT3 A;  2ZME C;  3NEU A;  5F0C A;  3R6S A;  1UHS A;  2IA2 A;  3CF2 A;  4F93 B;  2MC4 A;  4CCN A;  3OS1 A;  1U0J A;  2KIS A;  1NK2 P;  1R49 A;  1SFK A;  2X48 A;  3DV8 A;  3F9K A;  1BR1 A;  3TW6 A;  4DNC A;  1IRZ A;  1KU7 A;  2BYV E;  4XOP A;  5FLM J;  2EIJ H;  2HPM A;  4G94 A;  5JLX A;  2O6G E;  4AID A;  5CQE A;  3L1P A;  1W5C C;  3CES A;  1UHW A;  2IA0 A;  1Z7L A;  1ZLJ A;  1EJ9 A;  2ISY A;  1KU9 A;  1BI0 A;  1QNT A;  1XB4 A;  3H3V K;  2CQQ A;  1E2X A;  1HW1 A;  2LH9 A;  3BP8 A;  1XMA A;  3E5X A;  2MYS A;  2DPD A;  5EEA A;  3ZQI A;  5K7Z A;  4E7L A;  4KFC A;  4D7M A;  2R5Z A;  2R4G A;  2X6Y A;  3H5A A;  1HSJ A;  1QZE A;  1Z9C A;  2LFB A;  1ZN2 A;  2D5V A;  2Q0O A;  2ME6 A;  3WTU C;  4IJA A;  2GOM A;  4J00 A;  3DWL E;  4A2U A;  2HXO A;  3TKY A;  5DEQ A;  4H4K C;  3VDX A;  5J8F A;  1W4M A;  3CMA I;  2Z99 A;  3PFI A;  2ELK A;  3A0B C;  4RMN A;  4O5V A;  2H6B A;  1S72 I;  3K7A J;  2GA1 A;  2RQP A;  1P6R A;  4EMS A;  3GTK J;  1X1D A;  3IKV A;  2DMT A;  4ETS A;  2FE3 A;  5M5Y J;  1K6O A;  4LJZ F;  2ZNY A;  3QAH A;  1FTZ A;  2VE9 A;  3FMR A;  4L5J A;  4XR6 A;  4HPQ A;  3DKX A;  5B1B H;  3K70 D;  3E0J B;  2JMW A;  1LFP A;  1W5T A;  2FUG 2;  1YE9 A;  3G2B A;  1RR8 C;  2DQL A;  3KP6 A;  1TQP A;  3BY6 A;  3H0D A;  4EV0 A;  4BQA A;  2H27 A;  5M5W J;  2VBZ A;  3L2V A;  1U5T C;  2DFH A;  2VPR A;  2Y2Z A;  4HBL A;  4HG2 A;  3TOB A;  1FYK A;  2LC2 A;  3CMM A;  3DU5 A;  2ECC A;  1V3F A;  3VFZ A;  3AAF A;  2OF7 A;  4JP0 A;  3N97 A;  4BDY A;  2OZ6 A;  4HDV A;  4RAF A;  2X1C A;  5DUI A;  3CDL A;  1Z7U A;  2X85 A;  1JGS A;  2DLL A;  3E7L A;  1S7A A;  5LRS A;  3EUH A;  2Z2S B;  5CJ9 A;  3ESW B;  4XLN F;  4YFK F;  4XOR A;  3KFW X;  1DUX C;  4M9Z A;  1T2K A;  1I1S A;  2ELJ A;  1BOA A;  3OYG A;  1UEL B;  2DK8 A;  1K79 A;  3RYR A;  3DFG A;  1YW9 A;  1YS6 A;  2YX7 A;  5FLX K;  3CJR B;  2V6E A;  1ZG1 A;  2VL8 A;  4IOA F;  1VQP I;  2E5Z A;  2KHM A;  1FBQ A;  3A03 A;  1TLH B;  1JI8 A;  5JI6 A;  5FJ8 J;  3IL2 A;  3IHU A;  2WAQ N;  2CV1 A;  1QVU A;  1GT0 C;  4LG0 A;  2BOL A;  4BYY A;  2R7W A;  3FIW A;  2R7Q A;  3LSK A;  3HRT A;  2PI0 A;  1QBJ A;  4UV8 A;  5DD4 A;  1MBK A;  5FD5 A;  2ZC2 A;  4A0Y A;  1XC5 A;  1FX7 A;  2VJ4 A;  2XB5 A;  4DZP A;  1G3W A;  2HOS A;  2JSC A;  1ITY A;  2XGD A;  3EUH C;  2QLZ A;  5CQG A;  3ZQG A;  5GPA A;  2K02 A;  2FML A;  1G3T A;  3BG9 A;  4CYC A;  3WOD F;  2P6S A;  3PNV A;  3D5L A;  5LGU A;  5TRD A;  2OTL I;  4IHT A;  1RET A;  2CFX A;  1AU7 A;  2IXS A;  1JKP C;  3GTP J;  3CJT B;  2WB1 A;  5LD2 C;  2QKM B;  1R9T J;  3CMY A;  1CQT A;  2ETH A;  2DTR A;  2ICW G;  1ZTR A;  2Y30 A;  3CCS I;  4GYI A;  3DLL F;  5BQT A;  1OCO H;  1WRJ A;  1TP4 A;  2ZXI A;  3E97 A;  1PP8 F;  3BR0 A;  2DA5 A;  4RLQ A;  1E0E A;  2WWY A;  3VB2 A;  2RKH A;  3PO2 J;  3VYS B;  2EJR A;  1PUF B;  3KP2 A;  1G2H A;  1YG2 A;  3K1P A;  1PDN C;  2XAG A;  1RES A;  1RC9 A;  5JHF A;  4IL6 C;  3V4G A;  5C44 J;  3DEW A;  3KP3 A;  3OSF A;  3S14 J;  2L7F P;  2L3D A;  3CP2 A;  1ETX A;  1FZP B;  4ZYH A;  1HKT A;  2AQF A;  1B9N A;  2OJE D;  4FT8 A;  5TGT A;  1BW6 A;  2GOX B;  4ZYA A;  4QPO A;  4ZH4 F;  2VQC A;  3DLA A;  5FKN A;  1LUJ B;  2MA3 A;  2KQR A;  1KYZ A;  2VBY A;  4JX5 A;  5GTI C;  2R7X A;  1G8X A;  1R4M B;  4P1W A;  1IF1 A;  2XVC A;  4D1Q A;  1IUF A;  2XUB A;  3WGI A;  2MLG A;  3GFI A;  3OYC A;  2DA7 A;  3I54 A;  3GO5 A;  1B72 B;  1IRG A;  4X0G A;  1I6X A;  2GLO A;  1R4N B;  2XIG A;  4M6V A;  1U2W A;  3M9A A;  2M7A A;  4W1U A;  2DA2 A;  4V2F A;  3OY9 A;  2K4J A;  3MCZ A;  1D1A A;  1WI3 A;  4QIW N;  1Z3X A;  4HF2 A;  2A6T A;  2HDC A;  2F4O B;  1D0X A;  3S16 J;  3VWB A;  2R7V A;  2BY0 A;  2NVQ J;  1GUU A;  1T0F A;  4BJ6 C;  2HGC A;  3L2U A;  2Q2E B;  2DA1 A;  2BEO A;  2KKO A;  1YS7 A;  4AYB N;  3KZZ A;  3TDZ C;  4Y33 A;  3ZMD A;  1TBX A;  2P7C B;  3QPT A;  1X19 A;  1I50 J;  5D5V B;  3SZG A;  2JA2 A;  2VJI A;  3DF8 A;  3QPH A;  2MW8 A;  4XLE A;  4L5I A;  4R1H A;  3H9Q A;  2STW A;  2Y75 A;  2G9W A;  4HW0 A;  1X4O A;  2V1U A;  4EJV A;  5EEH A;  1YRN A;  2OD5 A;  4EEF G;  4BBR J;  4P9U A;  1GXQ A;  3GW2 A;  1F5T A;  1ZGW A;  3T5X A;  2DOD A;  2BVM A;  3RSN A;  2ME0 A;  2K40 A;  3VEP A;  2CS3 A;  2DBB A;  4U7D A;  2DDA A;  2LRD A;  2LG4 A;  2FBK A;  1YX3 A;  1N75 A;  1XSX A;  1BR2 A;  2ID6 A;  3L7W A;  5H2F C;  4HAM A;  3QPS A;  3OYH A;  1XCB A;  1MH3 A;  3CUQ C;  5K5O A;  1WFX A;  3HUG A;  1H9G A;  2A5W A;  3JRB A;  3L2C A;  4UVA A;  1Y0U A;  3RPQ A;  3HZJ A;  1IC8 A;  1ZGJ A;  3KX2 A;  3QRF F;  4IRI A;  1MBF A;  5F1R A;  4KDP A;  3VOE A;  1WWX A;  3CQZ J;  1B9M A;  1HBX G;  3M8F A;  1W5S A;  1G3Y A;  3FHZ A;  2X9D A;  3WTS C;  4FTH A;  3VPR A;  2VQG A;  2LLK A;  2I8D A;  1T39 A;  1T95 A;  4R8H A;  2XF7 A;  3GZ6 A;  2EZH A;  1HQC A;  3DKY A;  1KON A;  2DFI A;  2JUG A;  1TWG J;  1FTT A;  4OAY A;  5FKO A;  1WKM A;  3PIO F;  3RZD J;  4MFE A;  3OYA A;  3JSO A;  4HNU A;  1T38 A;  1OYY A;  1QHG A;  3TOA A;  2GWR A;  2IW5 A;  4GCV A;  3CUQ B;  2M8E A;  2CUZ A;  3FXK A;  1MMG A;  3CDH A;  2DA4 A;  3OSG A;  1Z1D A;  2EZL A;  4WXC A;  3QYF A;  4DYR A;  4HZF A;  2HWV A;  1P7J A;  1S7O A;  3BZ6 A;  4P55 A;  4CCK A;  3PO3 J;  1MBH A;  1YLF A;  3K2A A;  3BTI A;  5D4S A;  3GLL A;  2RDP A;  1QPM A;  3WE3 A;  3E6D A;  5J1R A;  1XTA A;  4RM3 A;  2G7H A;  1OKR A;  5C4J J;  1X1C A;  1KGS A;  3V42 A;  3F8B A;  1JTY A;  2ZXH A;  1V5G A;  4L5E A;  4RB2 C;  1HOM A;  4KN4 X;  2A05 A;  2M87 A;  1U5T A;  4XSZ F;  1P4X A;  5J6X A;  2EV6 A;  2XPW A;  3BT9 A;  4A3B J;  4BY1 J;  5J3L A;  3SDB A;  4QTR A;  2VI6 A;  2CQN A;  3U1D A;  1WZ2 A;  1VF9 A;  4UY8 I;  1T0F C;  5GTH C;  4CHU A;  3TL4 X;  1WGX A;  5D4R A;  3MMY B;  2IJL A;  5E1Z B;  4BE2 A;  3TDU C;  3K10 A;  3HOZ J;  2XB0 X;  3A0H C;  3ECO A;  2CO5 A;  1A6I A;  3CLO A;  4YFX F;  2K7L A;  1X58 A;  1R5I D;  4A3K J;  3S3M A;  1I27 A;  3V8L A;  3PSI A;  4RS8 A;  2JRM A;  4XSX F;  2LD5 A;  1Q1H A;  3H36 A;  2V1N A;  4KT5 C;  4PJ0 C;  3RDI A;  5HS8 A;  3BJO A;  1ACI A;  1W7P A;  3V7S A;  3CF5 F;  1B8I A;  2IP2 A;  4M6X A;  3FK6 A;  4PCQ A;  2JVG A;  3IKT A;  2XRN A;  2KL4 A;  4RA2 A;  3ZQF A;  4ESB A;  4YEL A;  1OJL A;  3PNY A;  1LDK B;  3CCR I;  1IO2 A;  4BJT A;  4FE4 A;  3HTU A;  1X4P A;  1Z3Y A;  3J7A Y;  2A69 F;  1EKE A;  2QA4 I;  1FP1 D;  1I39 A;  2JRT A;  2R7F A;  3RCO A;  5FD6 A;  1FOX A;  1POG A;  1OCR H;  2ZJP F;  1KU3 A;  1WJF A;  1BI1 A;  1IDZ A;  1VQL I;  1HA8 A;  3QPL A;  5F1J A;  2EH3 A;  3F8N A;  2FF4 A;  3RKW A;  3LSG A;  4FAS D;  4D0P A;  2P5L C;  4OAZ A;  3ZMZ A;  4MFD A;  2PMZ A;  3HSR A;  4F52 A;  2X4H A;  3N05 A;  3HHH A;  1U8R A;  1WJB A;  3AFH A;  4DOZ A;  5C4X J;  2BW3 B;  3C3W A;  2KJC A;  1V5E A;  2M34 A;  5IT9 K;  1TNT A;  4UHT A;  1DDN A;  3HOS A;  4QSH A;  2O61 A;  1S5L C;  4LB5 A;  3FMS A;  3TGN A;  2TCT A;  4EJU A;  1ZRC A;  4L9T A;  3FXM A;  1LVA A;  1SD6 A;  2W84 A;  3BCB A;  3MQ0 A;  3G6E I;  1FIA A;  2O03 A;  4MQ9 F;  3CDI A;  2UXX A;  4BDZ A;  3E6C C;  4O6J A;  1OCP A;  2VT3 A;  2BY2 A;  2UUZ A;  1QPI A;  2M30 A;  2FQ4 A;  5HNH A;  3JRF A;  3U9G A;  2KIF A;  2BXY A;  5IY5 H;  1TW2 A;  5GP9 A;  3EYY A;  3I9V 2;  4ON0 A;  3DEU A;  2IGN A;  2E2I J;  4DBR A;  2PJR B;  3GME A;  2LR8 A;  3FKJ A;  3PIP F;  2MGQ A;  3I5U A;  2OTJ I;  5JR3 A;  2MBF A;  2K9M A;  2V26 A;  5CYV A;  2WY7 Q;  1PJR A;  2EZI A;  4CCL A;  3CO6 C;  3COA C;  5K5Q A;  3F23 A;  1CGP A;  1OCC H;  2H6C A;  2DMQ A;  1D5Y A;  2E1M B;  3K1N A;  4RM2 A;  1S9H A;  2UXN A;  4PSX A;  5J4V A;  3HSE A;  2E36 A;  2MAB A;  2NVU B;  1L0O C;  4HQM A;  1FEX A;  3WU0 A;  1SVM A;  3WGH A;  2WV0 A;  3I59 A;  3CC7 I;  2BGC A;  1HXD A;  2JVH A;  1BA5 A;  2UWM A;  3WTX C;  2LP0 A;  5ED4 A;  3RQ4 A;  1JJ6 C;  4HF0 A;  3FKI J;  3A01 B;  1LFU P;  1MJA A;  1ULY A;  3D1N I;  4OMY A;  3PSF A;  5J4Y A;  4DYC A;  3S2D J;  2J5O A;  2QGU A;  1N78 A;  2F2E A;  3F8F A;  3JRA A;  1R71 A;  3PM1 A;  1W7P D;  3S1R J;  1FBU A;  2PJR A;  1LKX A;  2YPR A;  4NUB A;  3MKL A;  2KP6 A;  5LGT A;  5ILU A;  5IOY A;  6PAX A;  3MZY A;  4JX4 A;  1K78 A;  2HEO A;  3VSK A;  3MKW B;  5HDG A;  1H0M A;  2VBX A;  4XK4 A;  3K4L A;  2R5Z B;  3LL7 A;  4XIC A;  1PYV A;  4A3F J;  3K9T A;  3DBR B;  2A3S A;  2EIN H;  2HI3 A;  3KYC B;  1BC7 C;  5EGO A;  3CCU I;  1BOB A;  3KP4 A;  3J80 Z;  3ZPL A;  3OOP A;  1XG1 A;  2B7E A;  4V19 K;  3BZK A;  3B6A A;  2ZJQ F;  2WC2 A;  5KNL A;  2DOA A;  5FRN A;  1SC7 A;  4ENM A;  4II2 A;  3CJQ B;  3F0C A;  4ZC3 A;  3H5R A;  4BHC A;  1F43 A;  3OL3 A;  4I09 A;  2LY9 A;  2EB7 A;  3DPT A;  4UVC A;  1JT6 A;  1J09 A;  1VI0 A;  4P5O A;  2ZXW H;  3HRM A;  3ML6 A;  4EM1 A;  5L3G A;  2O7O A;  3PQJ A;  1NG7 A;  2LKP A;  2VN2 A;  5ICE A;  3GLX A;  3MWM A;  2L0K A;  1KYW A;  1A35 A;  3ZRG A;  2HZD A;  4ANJ A;  2EFW A;  3WTV C;  3FX3 A;  1B1B A;  5AIP A;  3KCC A;  5HLH A;  4M6Y A;  5ERI A;  9ANT A;  3P9I A;  3JTG A;  4C3H J;  3AL0 C;  2MG4 A;  4P9F A;  3DBH B;  1ETW A;  5K7H A;  3OYD A;  1ZYR F;  2CJJ A;  2XDV A;  3NWS A;  2UZK A;  4HF1 A;  3I59 B;  1QZZ A;  1P7I A;  4UB6 C;  1ZGA A;  1LDJ A;  1XDU A;  1ZH5 A;  4D7N A;  2XAU A;  4EM2 A;  3FBN B;  3CC4 I;  4XL9 A;  3DU6 A;  3P9K A;  4KIS A;  3IWF A;  3PUB A;  1TWC J;  2EFN A;  1WSU A;  4PJN A;  1NG6 A;  1OCZ H;  2J5P A;  4XQF A;  1YIO A;  1XPX A;  1HF0 A;  4I98 B;  1R22 A;  1MD0 A;  2D2W A;  2WV1 A;  4RB0 A;  5D6F A;  5E79 C;  2GIV A;  2YU9 J;  2QWW A;  3CCV I;  3E3V A;  4HDU A;  1ZRF A;  2BHZ A;  5E8G A;  1VQK I;  3VYU B;  2VT2 A;  3S8P A;  2PMZ N;  4XKC A;  1O57 A;  2RRE A;  4KJZ A;  1MND A;  3JAM Z;  1NHA A;  1V4R A;  1IN8 A;  4F92 B;  1H9T A;  2Z9O A;  5IP6 A;  5JVG F;  5KK1 A;  3PFY A;  3QWL A;  3VSL A;  2Z16 A;  2EIM H;  4A3G J;  4RGU A;  4A0Z A;  1YIT I;  2E19 A;  2M1B A;  3GZN B;  2FRH A;  2Y0S A;  4QWQ A;  4UUS B;  1SFX A;  2BBY A;  3F72 A;  2VUM J;  1B6A A;  3WHB A;  2VKH A;  5EG0 A;  2VIX A;  4XKB A;  5DD8 A;  2JJ7 A;  2XAH A;  1APL C;  2HQ5 A;  1E17 A;  3BQY A;  3KEY A;  2VB6 A;  2CH0 A;  3MN2 A;  5JHU A;  3H9J A;  2QQB A;  2D45 A;  3GXO A;  2H1K A;  5L3B A;  3ERE D;  2L5Q A;  1IDY A;  4PGG A;  1Y8R B;  1VQ6 I;  2R7S A;  3TMO A;  2XSJ C;  5DUK A;  4B44 A;  2WAE A;  4DIQ A;  5B66 C;  4C2T A;  1ZHF A;  5F0H A;  2YS9 A;  1FOK A;  1TNS A;  4WCG A;  3ULQ B;  1BN5 A;  1YW8 A;  1LQ1 A;  3BDD A;  3OR2 C;  4B3A A;  1X2N A;  4RAG A;  1XGN A;  1LEB A;  5ILV A;  3CD6 I;  1PUF A;  2QKL B;  2CV0 A;  2JWT A;  2OC6 A;  2NVY J;  2YSR A;  2NS7 A;  4M3D A;  1IRF A;  1U5T B;  4DW6 A;  2QVO A;  1SMT A;  1ZG3 A;  3W2V A;  2KLO A;  5L3D A;  4LMY A;  2L4A A;  1MMD A;  4UXN A;  1WJA A;  5EEG A;  2VOO A;  1TWF J;  2OCC H;  1BI3 A;  3LST A;  2AO9 A;  2EV5 A;  3P5J A;  2WTE A;  3S32 A;  4II3 A;  1I1G A;  2L54 A;  1GDT A;  2R7U A;  2P5V A;  4P96 A;  4I01 A;  2BXZ A;  2E2J J;  3E5Q A;  1QRY A;  3FXQ A;  1D5V A;  4PK4 A;  2DAO A;  2IVM A;  1IG7 A;  4MGR A;  1U9O A;  4XRF A;  5IYB J;  5HS7 A;  2STT A;  2F5F A;  2P4W A;  3QYB A;  2DPU A;  5BNG A;  1QZY A;  1TWA J;  4AVZ A;  3GTL J;  3O3K A;  3GFL A;  2DK5 A;  3OL4 A;  2Y9Z A;  2OQR A;  3CC2 I;  5EZG A;  1VQ4 I;  2FBH A;  4IRG A;  3RKY A;  2WBM A;  1XGO A;  5TIS C;  3S3N A;  3BTJ A;  5E3M A;  3WE2 A;  2HYG D;  1XX5 A;  3HRS A;  3CCM I;  2R7O A;  1QHH D;  3H1C A;  2I10 A;  3KP5 A;  3SDG A;  1TTY A;  3LSR A;  4I6Z A;  2L7K A;  2DI3 A;  3BLY A;  1BJA A;  1VQ5 I;  1ZAO A;  2Y0M A;  3K70 C;  4IQ4 A;  2Z3Y A;  4KIT B;  1Z67 A;  1B8I B;  2E34 A;  3ZN1 A;  4CXF A;  3S2W A;  1T33 A;  4ZZL A;  2PQ8 A;  2HYF A;  4KMU X;  2P8T A;  3AG1 H;  3J7Y J;  3W6K B;  4HLX A;  4HNV A;  2AXL A;  5A2Q K;  3ZXS A;  2XF6 A;  1EA3 A;  1D0Y A;  1KU2 A;  2O5R A;  2FMY A;  3R4K A;  4EJT A;  2W7N A;  4G9Y A;  5FB2 A;  2OU2 A;  2VKV A;  1CF7 B;  2DU9 A;  3I64 A;  2UV1 A;  5E3N A;  4IVN A;  5FFZ A;  2W1O A;  1Z6R A;  5DYM A;  2JZY A;  2K9N A;  3RTR A;  1HW2 A;  3AG2 H;  3Q9V A;  2P81 A;  2A07 F;  1XD7 A;  2HQA A;  2H8R A;  1IN4 A;  2E1N A;  4LOC A;  5D5U B;  3RKQ A;  1YYV A;  2G0E A;  2WY8 Q;  3FXL A;  2K9L A;  2M9H A;  2NYX A;  1W36 D;  4BXX J;  5GAG J;  4Y13 A;  1ETK A;  1X1B A;  2W57 A;  3OIQ A;  2P6T A;  1O3Q A;  5D6E A;  1BW5 A;  4CA0 A;  4B43 A;  3E1S A;  4KIG A;  2VC0 A;  3KEO A;  3OOU A;  4NQW A;  1BJZ A;  5CVV A;  2JN6 A;  2OA4 A;  3OYF A;  2RN7 A;  5L3C A;  3P9C A;  4FHT A;  2A5Y B;  3HKZ A;  4Z6Y A;  1HKQ A;  2DOE A;  4C9Y A;  2CFO A;  1D8K A;  1OCT C;  5IP7 J;  3RYP A;  3GX4 X;  2VQL A;  3ZMS A;  5CPR B;  1YFH A;  3MEX A;  2ECB A;  4KIF A;  2XF5 A;  2P5K A;  2XKO A;  3ELK A;  4RLF A;  4AWX B;  4AM3 A;  4H0E A;  3CJN A;  1LDD A;  5DV5 A;  4OIP F;  3GUD A;  1K61 A;  5CKT A;  5E8I A;  1ETO A;  1SD7 A;  3LOC A;  1R36 A;  1JXS A;  1VQM I;  2V9K A;  2RGV A;  2B63 J;  4IX7 A;  2H8W A;  4B4C A;  1AKH B;  2YR2 A;  3GEZ A;  1ZEL A;  2DMN A;  2YUS A;  2HVR A;  3HEF A;  1XSV A;  4A3E J;  3DPL C;  4Y7N J;  3T1B A;  1Z21 A;  4C2M J;  2F5C A;  3QU6 A;  5F04 A;  3JCU C;  2DFF A;  2FD5 A;  2GM4 A;  2XAS A;  4L9V A;  2L9R A;  2QYO A;  2NS0 A;  1W0T A;  1G59 A;  1FPQ A;  4PUS A;  1YI2 I;  1MSE C;  1H8A C;  1CF7 A;  1IN6 A;  2ZFW A;  2OPT A;  3LNQ A;  5CVR A;  2D1H A;  5HLI A;  1ZR4 A;  3DTI A;  1X1P A;  4N9H A;  3HBL A;  3H9G A;  2DQR A;  2ZCW A;  4WWC A;  4B8X A;  3FXU A;  3Q9S A;  3ASO H;  3SFI A;  4B09 A;  4D5F A;  4BE0 A;  2ESH A;  2DTZ A;  1ETV A;  3ZQH A;  5BPD A;  2W4S A;  2RQQ A;  2F4I A;  3ISP A;  3FK7 A;  2NVX J;  3TQN A;  3I56 I;  3A01 A;  1ON2 A;  2DYS H;  4N0B A;  3MKZ A;  2R7T A;  5K7F A;  1H88 C;  2HU9 A;  3NAR A;  3JRE A;  1ON1 A;  5K5R A;  2R7R A;  1YJN I;  1R1V A;  3O8H A;  4JK1 X;  3QP5 A;  3S1N J;  2VKE A;  3F3X A;  2WAF A;  1E3P A;  2VJ5 A;  1HKS A;  4Z2Y A;  3LFK A;  4KIC A;  3BR6 A;  5EJC A;  3PNT A;  5IPA A;  3BTL A;  2CQX A;  3OYM A;  3SHF A;  4G7H F;  2Y0S N;  1KZH A;  4LG0 B;  2HTJ A;  2V9V A;  2BHY A;  3BR2 A;  4WK8 F;  4EM0 B;  4I76 A;  4YG2 F;  1JKO C;  4A0X A;  1QVT A;  1O3R A;  1OFC X;  1UMQ A;  2FA5 A;  4DYQ A;  2EIL H;  3AKZ A;  4A3C J;  5DCF A;  5ICC A;  4NNJ A;  4XRS A;  1U3E M;  2YX4 A;  5F27 A;  4ZTJ A;  2LF8 A;  4YIR X;  2ZSI B;  4IRH A;  2VOP A;  1A5J A;  4EVI A;  1TC3 C;  2ZJR F;  1O3S A;  1UB9 A;  1AKH A;  2MFZ A;  4HA8 A;  5H6Q A;  3ZQL A;  4QPQ A;  3BG5 A;  2X6O A;  5EZH A;  3ZOB A;  1WQ2 A;  1YX5 A;  2DXI A;  4XBF A;  2OZU A;  4IPA A;  2IS1 A;  1ZR2 A;  3ZQC A;  4C3J J;  2QBY B;  4CZC A;  1MMS A;  4FCY A;  1OQY A;  2X6W A;  3VYT B;  1VZ0 A;  1UCR A;  3C2H A;  5E3L A;  2BE5 F;  2COB A;  3A02 A;  4EJW A;  4CIC A;  3V8J A;  4E7S A;  4M73 A;  4PZJ A;  3HOW J;  2W48 A;  1A6Q A;  1SAX A;  4C2U A;  2XGC A;  1MZB A;  2L9V A;  3QOE A;  4NBQ A;  1R00 A;  5CVJ A;  3CUQ A;  3OIO A;  3Q3S A;  2KFD A;  4XM3 A;  4S0H B;  2A6H F;  3LSP A;  2FJ1 A;  2E5N A;  2RV8 A;  3ECH A;  2L02 A;  1MMA A;  1Y1W J;  2B9S A;  4ZYE A;  2HS5 A;  1A31 A;  4BH9 A;  2E71 A;  1HW5 A;  3M1C A;  2LBF A;  3I0T A;  4MEY F;  1LB2 A;  3AL0 B;  2XGE A;  1BBY A;  3ONQ A;  3HGG A;  2IS4 A;  5LRR A;  3CZ6 A;  4IXA A;  2QQ9 A;  3L00 A;  1JGG A;  2EA4 A;  1T08 B;  2VBW A;  2MD5 A;  4M74 A;  3DKW A;  3MFK A;  1A04 A;  4NB5 A;  1OYI A;  4TV7 A;  2RAE A;  5M3M J;  2W85 A;  4XLC A;  4HQE A;  1BM9 A;  1MIJ A;  1F9N A;  3BR5 A;  4NC6 A;  2CRG A;  1UZC A;  3BPX A;  4KUM A;  3L2Q A;  5LLQ A;  4A5N A;  3NQO A;  3GTG J;  4B3X A;  4KT6 A;  4X1E A;  3MAJ A;  4MQV A;  3BWG A;  3ZN0 A;  4F91 B;  1K83 J;  1JHF A;  3ASN H;  3D0S A;  4N4N B;  5EF6 A;  1ZQ3 P;  3FXJ A;  4A5M A;  3DTE A;  2CW0 F;  3BC8 A;  3O8G A;  2EA2 A;  3JSP A;  1GHC A;  1PVE A;  1OR7 C;  1GVD A;  3B6C A;  2O0Y A;  3G3Z A;  5D8K B;  2W00 A;  3SZP A;  4XRS G;  1LE8 A;  3HOX J;  2IEK A;  4HX7 A;  3V8K A;  3BJ6 A;  2M4G A;  3ZGK A;  2FX0 A;  3ABU A;  2CG4 A;  2ZSH B;  3KLN A;  3HL2 A;  2K5C A;  3J7Z I;  5FRO A;  2HOE A;  1NK3 P;  1FSH A;  1ZLK A;  2XAF A;  2X0L A;  1UST A;  4U7B A;  3M8J A;  3WG7 H;  1TW3 A;  2DFE A;  4D5C A;  2KIM A;  4XNF A;  3OWT A;  1HLV A;  3O2P E;  4OIN F;  2IS2 A;  2CSO A;  2IPQ X;  1MDM B;  1SFU A;  3IWZ A;  2QEN A;  1Y39 A;  3NRV A;  4ZDO A;  2FXA A;  1RUO A;  4IF4 A;  2XC7 A;  1JKR C;  2VE8 A;  3K4M A;  1KQ8 A;  4XRM A;  3K6G A;  2Q8K A;  2FQ3 A;  2KRC A;  4BU2 A;  2EZK A;  5IOZ A;  4E7J A;  3ABT A;  2CYY A;  2K9S A;  1HDP A;  3EUK L;  2LK2 A;  4U0Y A;  1BC8 C;  5DM6 F;  3H0G J;  4M72 A;  2CW8 A;  3HOV J;  2DA6 A;  2M2E A;  4OWR B;  1O7F A;  2O3F A;  4KNY A;  4M3F A;  2ZKZ A;  3W2W A;  2PMU A;  3I4M J;  1GXP A;  3PL8 A;  2TDX A;  2QQA A;  4ZDL A;  3IH2 A;  2DT6 A;  5LEK A;  3OYJ A;  2HOT A;  1D1C A;  3KPH A;  1TQI A;  3SZT A;  1N25 A;  2Y69 H;  3B02 A;  5CVU A;  4B1R A;  3ZMU A;  3ZP5 A;  3WG9 A;  3UR3 C;  4GGG A;  2R3S A;  2WAQ A;  3OV8 A;  4XID A;  3FBI B;  1VQO I;  5FRM A;  4HOB A;  1MBJ A;  1GVJ A;  3RPU D;  2V7F A;  2CV2 A;  1B4A A;  1DP3 A;  1TL8 A;  2VAS A;  1R23 A;  2EFP A;  2AQE A;  4KN7 X;  4OOI A;  1K4T A;  1SAU A;  2HOA A;  3O6B B;  4Y15 A;  5D5W B;  4I0B A;  2F5D A;  1JKQ C;  4XOT A;  1YJ9 I;  4G6D A;  1FMW A;  3TBI A;  4HSR A;  2P0W A;  1Z0X A;  5HS9 A;  2DW4 A;  4YIF A;  4I99 C;  1PUE E;  4IKF A;  3EPZ A;  5KCM A;  4L0Y B;  4UUS A;  1WJD A;  3K4N A;  5LEJ A;  5KAI C;  4A3D J;  3W2A A;  3CUO A;  2M7B A;  4KYW A;  3JRG A;  1ZK8 A;  1DQU A;  3W3C A;  4LG3 A;  3SJM A;  1T98 A;  2R7D A;  1T6S A;  2Y48 A;  5A2Q Z;  1K4S A;  1XMX A;  2O8X A;  1BR4 A;  1DU6 A;  1XGS A;  1WH5 A;  1VND A;  2X51 A;  2X1E A;  2X6X A;  3IC7 A;  3D5R C;  1OYW A;  4BQO A;  3BRO A;  1PP7 U;  4BUP A;  4C30 A;  4IHX A;  4U88 A;  2HDD A;  3EQL F;  3BG7 A;  4DBQ A;  2QBY A;  3M7G A;  1D8J A;  3MZ8 A;  2L4M A;  2V1D A;  4UUT A;  1SMY F;  1J5Y A;  5EG0 B;  3DXJ F;  2FSW A;  3OR1 C;  3VYR B;  3LAJ A;  3GFJ A;  2BV6 A;  4UB8 C;  2PLY A;  4CCM A;  3BTC A;  1JE8 A;  2HKX A;  5E20 A;  4IHS A;  4ABZ A;  4A93 J;  1OR7 A;  4F55 A;  1WCM J;  2V6C A;  1IN5 A;  1Z77 A;  1WJ5 A;  5B1A H;  1QU3 A;  1M1E B;  3HJE A;  2HDW A;  3IP4 B;  2HZT A;  2LKS A;  3MD2 A;  4G12 A;  1P2F A;  2ESN A;  3QOP A;  4N9I A;  5DCM B;  3TO7 A;  4CH7 A;  3SFZ A;  3U1K A;  4NHJ A;  2FEZ A;  2MD0 A;  1IGN A;  5DDG A;  2E35 A;  2NS8 A;  3Q0V A;  3TW7 A;  3CCQ I;  4LIT A;  2B0L A;  2DN0 A;  3F21 A;  1B59 A;  5HOO A;  2K3P A;  1YOV B;  1MNE A;  4AU7 A;  4ESJ A;  3HXL A;  1V5F A;  2V9P A;  2NVT J;  2XRL A;  1OMI A;  2NRA C;  4UV9 A;  1K6Y A;  2BY1 A;  3F6O A;  4LB6 B;  2XAJ A;  4I7H A;  1XDS A;  2G7U A;  4XLA A;  5H20 A;  3BOQ A;  2ID3 A;  4M3B A;  4ZZD A;  2CQK A;  5E17 F;  2K4B A;  3KE2 A;  4S05 A;  4FET A;  3HHG A;  2FOK A;  4O3M A;  3M8E A;  5J1Y A;  1FY7 A;  2V79 A;  4Y17 A;  1HDD C;  3M1E A;  1MJB A;  1JHH A;  3NAU A;  2R92 J;  1IV8 A;  3CLQ A;  4CDG A;  3CCE I;  1FOW A;  4E7I A;  4ENK A;  3HOY J;  4J01 A;  5J1U A;  3EUA A;  3DTK A;  2K85 A;  4KMF A;  5IYC J;  4XLF A;  3A1Y A;  2M45 A;  3MKY B;  2XAQ A;  5FFX A;  4I2O A;  3KP7 A;  1Y8Q B;  2QSH X;  3ZCO A;  5TJJ A;  1R7J A;  3HPH A;  4G6Q A;  4XMY A;  2IA1 A;  2HR3 A;  2JT1 A;  2WAD A;  3SEZ A;  3I3L A;  2LY2 A;  1XGM A;  5BPI A;  4L18 B;  4BKX A;  4FX4 A;  2GA2 A;  1RNL A;  2ZO4 A;  1XN7 A;  3G73 A;  2JSP A;  1J9I A;  2JA5 J;  3C2G A;  1E3H A;  4X6A J;  2M5W A;  3HG9 A;  4NC8 A;  3F8M A;  2ZBK A;  3F8C A;  5FO5 A;  4A3M J;  4BHP A;  2BVL A;  1J75 A;  5LHG A;  1LFB A;  3TO9 A;  2LDU A;  2IBD A;  1IV6 A;  1D3Y A;  1Z05 A;  4KA4 A;  1OIS A;  1I5Z A;  1Z91 A;  2ELH A;  3KIO A;  3H3U A;  2JA6 J;  4UUV A;  3S2H J;  4IOC F;  2QSF X;  1H89 C;  4FIS A;  1S3J A;  1YW7 A;  3K69 A;  2W82 A;  3J80 K;  3QP6 A;  3LFU A;  2E1C A;  4XN0 A;  3E6M A;  2MC3 A;  1MW7 A;  3I71 A;  3K0L A;  1D0Z A;  2DT5 A;  3BCA A;  3CCJ I;  4IHW A;  3LA2 A;  3HIF A;  3WTZ A;  1MDM A;  1ERD A;  3W6J B;  3HOU J;  1FNN A;  4M9S A;  2GXG A;  4E70 A;  4CUG A;  5H6R A;  5EYR A;  4CSW A;  3PQK A;  3HYI A;  2JPB A;  4E4H A;  4GDF A;  1T8I A;  4BXU A;  2X1D A;  1IN7 A;  3ABL H;  3IV5 A;  2CMP A;  3PUF A;  4IEJ A;  4DJA A;  3IRR A;  1XCV A;  3H5N A;  2LTP A;  3S3O A;  4AIJ A;  3C1D A;  4DGW B;  4ENJ A;  4YEJ A;  2LKX A;  3J81 K;  4HYE A;  4JX6 A;  4A3L J;  3G1O A;  4F3Q A;  4QLC U;  4IO9 F;  1EH8 A;  2KT0 A;  2NNY A;  4M3G A;  5B3S H;  2PMH A;  4AVP A;  1NH3 A;  4GRI A;  3R0A A;  3TP0 A;  3KZY A;  1J59 A;  1SD5 A;  4RGX A;  3NWT A;  3QU3 A;  2YU3 A;  4Q4Z F;  3BG6 A;  3U21 A;  3JRH A;  1ENH A;  4JBA A;  2PG4 A;  4RBO A;  4F7Z A;  4B47 A;  1MJ9 A;  2KDO A;  1TWH J;  3BR3 A;  3FZV A;  2HTS A;  5E3O A;  2JK3 A;  3GFM A;  2EIK H;  3S17 J;  4XLH A;  3MZH A;  2HNH A;  2KPM A;  5D5X B;  1VFC A;  2GXA A;  3EYI A;  4J19 A;  3I55 I;  5E18 F;  2E2H J;  1YHQ I;  4OMZ A;  4C3I J;  4Y4R A;  1DP7 P;  3GBG A;  1ZKG A;  2HYJ A;  2QSG X;  3GF2 A;  4LIU A;  1O7L A;  3OYK A;  4HLY A;  2M3A A;  1MKM A;  1X3W B;  4MHG A;  4AD9 A;  1IW7 F;  5HDK A;  1X3Z B;  2OAZ A;  2V1X A;  1DGW Y;  3SEQ A;  4ITV A;  4L0Z B;  3RPU A;  2NOG A;  3LQQ A;  4XKW A;  5J47 A;  2KIQ A;  2HVS A;  4Y52 J;  3AG4 H;  1YRN B;  4YII A;  3BJA A;  1X1A A;  2KJB A;  2HVQ A;  3I4N J;  2KDZ A;  5FKM A;  1V54 H;  4AUX A;  2N8G A;  4BAC A;  4MTD A;  1U9N A;  4PJM A;  3HC7 A;  3RIR A;  3JAM K;  2DMU A;  3FXR A;  4U0V A;  1EH6 A;  2FNA A;  3PJR A;  1WJC A;  4BS9 A;  3BPV A;  4MNU A;  1BIB A;  1Y6I A;  2F4M B;  1J2X A;  1LJ9 A;  1L3L A;  3DPU A;  1IXC A;  4HEA 2;  3M3Y J;  4K2E A;  4BEH B;  1IUY A;  2GXB A;  2Y31 A;  1S6L A;  3ABM H;  3IH3 A;  2ZJ2 A;  1UHM A;  2JUC A;  3LA7 A;  1LPQ A;  2HPI A;  1WJE A;  4MLO A;  4L9J A;  3Q5F A;  3G4S I;  1XS9 A;  4BGD A;  4RGS A;  4W97 A;  4JYK A;  2M8G X;  4NC7 A;  5E1X A;  5LFA A;  2DO7 A;  2PFB A;  2E1M C;  1QGP A;  1R5H A;  1FT9 A;  4E6K G;  5FKK A;  4LFU A;  3F6V A;  2IGK A;  5FLV A;  5ICG A;  1XMK A;  1KQ0 A;  4S04 A;  3OYN A;  5IP9 J;  1QA6 A;  3LSM A;  2LNB A;  5M5X J;  3E6B A;  2LSO A;  4EJO A;  1LNW A;  1AA7 A;  1R1T A;  3KYL A;  2GIZ A;  4A69 C;  3JTH A;  2CU7 A;  2R0Q C;  5HVQ C;  1R1U A;  5LHH A;  3W6V A;  2CUE A;  2F6C A;  5HLG A;  1Q1V A;  2H09 A;  4BQN A;  5EDN A;  3CCL I;  3AG3 H;  2C6Y A;  4Y3O A;  2JQ7 A;  3HB9 A;  2EBI A;  2AXT C;  1T56 A;  2JTV A;  3CO7 C;  1N77 A;  4RB1 A;  3H3Z A;  4JOM A;  4YRV A;  2F48 A;  5J40 A;  2ZFU A;  1DU0 A;  5CVI A;  3ZQ7 A;  5JFR A;  4LK1 F;  3U2R A;  1K78 B;  3ROU A;  2FNP A;  4OIQ F;  3K4B A;  4ZTF A;  1RUN A;  2EPF A;  2VOD A;  1P4A A;  3WU2 C;  4UNO A;  3P7N A;  2LOO A;  1FMV A;  2Q2E A;  2PX9 A;  3IAM 2;  1VQ8 I;  4EGZ A;  4FX0 A;  4HX4 A;  2XKP A;  2A6E F;  1VTN C;  1VQN I;  3M07 A;  3WTW C;  4ASN A;  1JUM A;  3KYD B;  1SFE A;  4PGH A;  4AYB A;  1DPR A;  1MGT A;  1MMN A;  3DCF A;  4M71 A;  5BS6 A;  3HRU A;  2GBY A;  2RVC A;  1WI9 A;  1RKW A;  3LSJ A;  3SXY A;  2Z5U A;  1ZAR A;  3HGY A;  3RQI A;  1WHU A;  2M4K A;  2OQG A;  1I3A A;  1FWZ A;  1GLN A;  1C0W A;  2DCE A;  2DYR H;  3HOT A;  1QQI A;  2DOF A;  3CCY A;  4BXF A;  4RGR A;  4IHV A;  1BL0 A;  4HNT A;  5HLT A;  1FYM A;  1RPW A;  4Q48 A;  3CP8 A;  2FOW A;  1TT5 B;  1MNM C;  2L01 A;  3L2R A;  1E3O C;  3S1M J;  2K27 A;  5HNF A;  2KRF A;  3IAS 2;  1SEU A;  4RAZ A;  1R6R A;  4HV6 A;  1AWC A;  4G8X A;  2VKD A;  2BY3 A;  3TED A;  3WTY C;  2M0C A;  1O4X A;  1KQ9 A;  4BBS J;  3GYH X;  3T0Y A;  5D8L B;  1RR7 A;  4Q47 A;  5DCM A;  1F4K A;  2DA3 A;  2ZNZ A;  1Y0N A;  2EFO A;  2RNG A;  4NDL A;  2D1V A;  3JW4 A;  3OIP A;  5AIQ A;  3J7A O;  4RAY A;  2EK5 A;  1IJW C;  3WU1 B;  2CUJ A;  3BG3 A;  3FWE A;  4XN3 A;  1JTX A;  1SVO A;  3OYE A;  4IZZ A;  2QQ8 A;  2CUF A;  3WHC A;  1RZ4 A;  3TO6 A;  3DP7 A;  2K3F A;  4BNC A;  2NOJ B;  1I6H J;  2EFQ A;  2LVS A;  2VJJ A;  4YFN F;  2PEX A;  3OYB A;  5LBQ A;  2ADU A;  4DQ2 A;  1ZRD A;  3V7R A;  1VQ9 I;  2M0M A;  1IXS B;  3R60 A;  4A3I J;  4AIH A;  3K4C A;  2BW3 A;  2NNN A;  1LE8 B;  4E7H A;  4LLN A;  1IRX A;  1MH4 A;  5KVR A;  2ZME A;  4U87 A;  1B72 A;  1IAW A;  3ERM A;  4JQF A;  4WX9 A;  3JRC A;  4WXD A;  3E5U A;  4BJ5 C;  2F5E A;  3JRI A;  1Z6T A;  1LEA A;  2VPL A;  2VXZ A;  1FSE A;  2EQR A;  2L7M P;  2L9N A;  4IHY A;  2KMU A;  1JT0 A;  3I53 A;  4CCO A;  4OIR F;  1RRJ A;  4CO8 A;  3GVA A;  3REO A;  3EDP A;  1LVK A;  2LRE A;  3G1L A;  4MIM A;  2JA8 J;  4BY7 J;  1MBG A;  2HFH A;  2KZG A;  1UAA A;  3FM3 A;  3JR9 A;  4HX8 A;  3A4C A;  4PJL A;  3RI4 A;  3G1M A;  4GFB A;  1U6G A;  2HXI A;  1IXR C;  3DBL B;  5M3F J;  1FJL A;  2CGP A;  5LHI A;  1G6N A;  4PFP A;  2LBF B;  5C3E J;  1BI2 A;  2W25 A;  4BEH A;  1OLT A;  3I4P A;  3VOD A;  5LGN A;  1FBS A;  2HKO A;  2H1L A;  1X3U A;  2TRT A;  5L3E A;  4XON A;  3B73 A;  1FIP A;  1J7K A;  3K2Z A;  4D9J A;  1ORK A;  2RNJ A;  2BZT A;  4GO1 A;  1GV5 A;  1Y56 A;  2CQ7 A;  5BMZ A;  1F1Z A;  5BOX A;  2W24 A;  1S7E A;  3V7C A;  3HDD A;  3BQZ A;  3IUO A;  4BHB A;  3KET A;  3C2B A;  4BAY A;  3M4O J;  1ONV A;  5F0F A;  2O8K A;  4E7Z A;  5HDN A;  1W7P B;  1REP C;  1UFM A;  2R7Z J;  3MVP A;  3F22 A;  4L9N A;  5EGO B;  5DS9 A;  2L7Z A;  2R5Y B;  3LQR A;  4ZDP A;  1S8N A;  2Y9Y A;  1D1B A;  3CTA A;  1FC3 A;  1HST A;  3QOD A;  1WVR A;  2H94 A;  1ZG5 A;  3RZO J;  4A6D A;  2JPC A;  2VC1 A;  4KIB A;  3RJP A;  4LGW A;  1SAN A;  1ZRE A; 
#chains in the Genus database with same CATH homology
 2Z33 A;  2CWE A;  4A12 A;  1P92 A;  3HTS B;  2IRF G;  5JVT A;  1BIA A;  2P7V B;  4MTE A;  2MLK A;  4GYG A;  2EWN A;  4LLG F;  4CYD A;  3KLO A;  3ZMV A;  3GWZ A;  4G7O F;  4I02 A;  2RC4 A;  2FU4 A;  3L9F A;  4R79 A;  3T8R A;  1EH7 A;  4EQQ A;  3LWF A;  1FLI A;  3K1M A;  2COM A;  3ZMT A;  1U78 A;  2E7X A;  2XRO A;  3HSF A;  4PDK A;  3T8T A;  3WTT C;  3WGG A;  1XSD A;  2E7W A;  3IRQ A;  5F64 A;  1EV7 A;  2EV0 A;  2XGX A;  3C18 A;  2XHK A;  2LF7 A;  4EGY A;  1RIO H;  2MH9 A;  5CLS A;  4M9X A;  2PJP A;  3R0J A;  2OBP A;  4HV5 A;  5IT9 Z;  4CZZ A;  4Q5S F;  5L3F A;  3KEQ A;  1R58 A;  1USS A;  4ZYG A;  2XV4 S;  3J81 Z;  1DPU A;  1R5G A;  1G4D A;  3I58 A;  1K7A A;  3LAP A;  4OU0 A;  4WF2 A;  1J0R A;  4LD5 A;  1O3T A;  2ZXJ A;  2PBI A;  4GXO A;  1AOY A;  2GAU A;  1SD4 A;  3EET A;  3FF5 A;  5ILS A;  4XLP F;  1STZ A;  2HQR A;  2ACJ A;  1TQM A;  3SQN A;  1RI7 A;  4UVB A;  1S29 A;  2GZW A;  1YO5 C;  1YTY A;  5AON A;  1FYL A;  4MEX F;  4I0A A;  3R61 A;  2HQN A;  1KA8 A;  3FM5 A;  1YQA A;  4LLL A;  2K86 A;  2ZME B;  4G7Z F;  2QM3 A;  4WXH A;  3H92 A;  2FBI A;  4A6E A;  2A68 F;  2QZ8 A;  2QUF A;  3GZ5 A;  5FGM A;  3N4M A;  3C7J A;  2VON A;  1QO0 D;  2IT0 A;  4OIO F;  1ODD A;  4ESF A;  5ICF A;  5FLX Z;  1FP2 A;  2PN6 A;  1G3S A;  3RKX A;  1OPC A;  4AIK A;  2AS5 F;  2KIU A;  4CGZ A;  2NAZ A;  2MH2 A;  5J8C A;  4ENN A;  3LA3 A;  5E1W A;  3L09 A;  2A61 A;  3FMQ A;  2GQQ A;  4LK0 F;  1IZ1 A;  5K1Y A;  4ZYD A;  5F6F A;  3DQV C;  4RB3 C;  1P4W A;  2ISZ A;  4U0W A;  5IT3 A;  3NEU A;  3R6S A;  2IA2 A;  3DV8 A;  4DNC A;  1KU7 A;  2BYV E;  2O6G E;  4G94 A;  1UHW A;  2IA0 A;  1ZLJ A;  2ISY A;  1KU9 A;  1BI0 A;  1QNT A;  1XB4 A;  1E2X A;  1HW1 A;  3BP8 A;  1XMA A;  3E5X A;  2DPD A;  4KFC A;  1HSJ A;  1Z9C A;  1ZN2 A;  2Q0O A;  3WTU C;  4IJA A;  4A2U A;  3TKY A;  5DEQ A;  5J8F A;  1W4M A;  2Z99 A;  3PFI A;  4O5V A;  2H6B A;  2GA1 A;  2RQP A;  1P6R A;  4EMS A;  3IKV A;  4ETS A;  2FE3 A;  1K6O A;  4LJZ F;  2ZNY A;  3QAH A;  2VE9 A;  3FMR A;  4L5J A;  1W5T A;  2DQL A;  3KP6 A;  1TQP A;  3BY6 A;  4EV0 A;  4BQA A;  2H27 A;  2VBZ A;  1U5T C;  4HBL A;  3TOB A;  1FYK A;  1V3F A;  3VFZ A;  3AAF A;  3N97 A;  2OZ6 A;  4HDV A;  5DUI A;  1Z7U A;  1JGS A;  2DLL A;  1S7A A;  5LRS A;  3EUH A;  5CJ9 A;  4YFK F;  4XLN F;  1DUX C;  3KFW X;  4M9Z A;  1T2K A;  1I1S A;  1BOA A;  2DK8 A;  1K79 A;  3RYR A;  3DFG A;  1YW9 A;  1YS6 A;  2YX7 A;  5FLX K;  1ZG1 A;  1FBQ A;  1TLH B;  5JI6 A;  3IL2 A;  3IHU A;  4LG0 A;  4BYY A;  3HRT A;  2PI0 A;  1QBJ A;  4UV8 A;  5DD4 A;  5FD5 A;  4A0Y A;  1FX7 A;  1G3W A;  2JSC A;  2QLZ A;  2K02 A;  2FML A;  1G3T A;  3WOD F;  2P6S A;  3D5L A;  5LGU A;  5TRD A;  4IHT A;  2CFX A;  2ETH A;  2DTR A;  4GYI A;  5BQT A;  1WRJ A;  3E97 A;  1PP8 F;  2WWY A;  3VB2 A;  2RKH A;  2EJR A;  3KP2 A;  1YG2 A;  3K1P A;  1PDN C;  2XAG A;  3V4G A;  3KP3 A;  2L3D A;  1FZP B;  4ZYH A;  1HKT A;  1B9N A;  4FT8 A;  4ZH4 F;  2MA3 A;  1KYZ A;  2VBY A;  1IF1 A;  2XVC A;  2XUB A;  3WGI A;  2MLG A;  3GFI A;  3I54 A;  3GO5 A;  1IRG A;  1I6X A;  2XIG A;  1U2W A;  3M9A A;  2K4J A;  3MCZ A;  4HF2 A;  2HDC A;  1T0F A;  2HGC A;  2BEO A;  2KKO A;  1YS7 A;  3KZZ A;  3TDZ C;  3ZMD A;  1TBX A;  2P7C B;  3QPT A;  5D5V B;  3DF8 A;  3QPH A;  4L5I A;  4R1H A;  2STW A;  2Y75 A;  2G9W A;  2V1U A;  4HW0 A;  4EJV A;  5EEH A;  2OD5 A;  4P9U A;  1GXQ A;  3GW2 A;  1F5T A;  3T5X A;  3VEP A;  2DBB A;  4U7D A;  2FBK A;  1XSX A;  3L7W A;  4HAM A;  1XCB A;  3CUQ C;  5K5O A;  3HUG A;  1H9G A;  3L2C A;  4UVA A;  1Y0U A;  3RPQ A;  1ZGJ A;  3QRF F;  4IRI A;  5F1R A;  4KDP A;  3VOE A;  1WWX A;  1B9M A;  1HBX G;  3M8F A;  1W5S A;  1G3Y A;  3FHZ A;  3WTS C;  1T39 A;  4R8H A;  3GZ6 A;  1HQC A;  2DFI A;  1WKM A;  3JSO A;  1T38 A;  1OYY A;  3TOA A;  2GWR A;  2IW5 A;  4GCV A;  3CUQ B;  2M8E A;  3CDH A;  1Z1D A;  4WXC A;  4HZF A;  2HWV A;  4P55 A;  1S7O A;  3BZ6 A;  1YLF A;  5D4S A;  2RDP A;  1QPM A;  3WE3 A;  3E6D A;  2G7H A;  1OKR A;  1KGS A;  3F8B A;  4RB2 C;  4KN4 X;  2M87 A;  1U5T A;  4XSZ F;  1P4X A;  5J6X A;  2EV6 A;  3U1D A;  4CHU A;  5D4R A;  2IJL A;  5E1Z B;  3TDU C;  3ECO A;  2CO5 A;  3CLO A;  4YFX F;  2K7L A;  1I27 A;  3V8L A;  4RS8 A;  4XSX F;  1Q1H A;  4KT5 C;  3RDI A;  5HS8 A;  3BJO A;  1W7P A;  3V7S A;  2IP2 A;  4M6X A;  4PCQ A;  3IKT A;  2XRN A;  4ESB A;  1LDK B;  3HTU A;  2A69 F;  1FP1 D;  2JRT A;  2R7F A;  5FD6 A;  1KU3 A;  1BI1 A;  3F8N A;  2FF4 A;  3RKW A;  4D0P A;  2P5L C;  3ZMZ A;  3HSR A;  2X4H A;  3HHH A;  1U8R A;  3C3W A;  2KJC A;  5IT9 K;  1TNT A;  4UHT A;  1DDN A;  3HOS A;  2O61 A;  4LB5 A;  3FMS A;  3TGN A;  1ZRC A;  4EJU A;  4L9T A;  1LVA A;  1SD6 A;  2W84 A;  3MQ0 A;  2O03 A;  4MQ9 F;  2UXX A;  3E6C C;  4O6J A;  2VT3 A;  2M30 A;  3U9G A;  2KIF A;  1TW2 A;  3EYY A;  4ON0 A;  3DEU A;  4LGW A;  3I5U A;  5JR3 A;  2MBF A;  5CYV A;  3CO6 C;  3COA C;  5K5Q A;  3F23 A;  1CGP A;  2H6C A;  3K1N A;  2UXN A;  3HSE A;  1L0O C;  4HQM A;  3WU0 A;  3WGH A;  2WV0 A;  3I59 A;  2BGC A;  1HXD A;  2UWM A;  3WTX C;  5ED4 A;  4HF0 A;  1MJA A;  1ULY A;  4OMY A;  2J5O A;  2F2E A;  3F8F A;  1W7P D;  1FBU A;  2YPR A;  5LGT A;  5ILU A;  6PAX A;  3MZY A;  1K78 A;  2HEO A;  5HDG A;  1H0M A;  2VBX A;  3K9T A;  2A3S A;  1BC7 C;  3ZPL A;  3KP4 A;  3J80 Z;  3OOP A;  2WC2 A;  4ENM A;  4BHC A;  4I09 A;  2EB7 A;  3DPT A;  4UVC A;  4P5O A;  3HRM A;  3ML6 A;  4EM1 A;  5L3G A;  3PQJ A;  2LKP A;  2VN2 A;  5ICE A;  3GLX A;  3MWM A;  1KYW A;  2EFW A;  3WTV C;  3FX3 A;  1B1B A;  5AIP A;  3KCC A;  5HLH A;  4M6Y A;  5ERI A;  3P9I A;  3JTG A;  4P9F A;  1ZYR F;  2UZK A;  4HF1 A;  3I59 B;  1QZZ A;  1ZGA A;  1LDJ A;  1XDU A;  1ZH5 A;  4EM2 A;  3P9K A;  3IWF A;  2EFN A;  1WSU A;  2J5P A;  1YIO A;  4I98 B;  1R22 A;  1MD0 A;  2D2W A;  4RB0 A;  5D6F A;  2GIV A;  2QWW A;  3E3V A;  4HDU A;  1ZRF A;  5E8G A;  2VT2 A;  1O57 A;  3JAM Z;  1NHA A;  1V4R A;  1IN8 A;  1H9T A;  2Z9O A;  5KK1 A;  4RGU A;  4A0Z A;  2M1B A;  2FRH A;  4QWQ A;  1SFX A;  2BBY A;  3F72 A;  1B6A A;  5DD8 A;  2XAH A;  1E17 A;  5JHU A;  2QQB A;  2D45 A;  3GXO A;  5L3B A;  3ERE D;  4PGG A;  5DUK A;  1ZHF A;  1FOK A;  1TNS A;  4WCG A;  3ULQ B;  1BN5 A;  1YW8 A;  1LQ1 A;  3BDD A;  1XGN A;  1LEB A;  5ILV A;  2YSR A;  1IRF A;  1U5T B;  2QVO A;  1SMT A;  1ZG3 A;  5L3D A;  4LMY A;  2L4A A;  4UXN A;  5EEG A;  2VOO A;  3LST A;  1BI3 A;  2EV5 A;  2WTE A;  1I1G A;  2L54 A;  2P5V A;  4P96 A;  4I01 A;  3E5Q A;  3FXQ A;  1D5V A;  2DAO A;  2IVM A;  4MGR A;  4XRF A;  5HS7 A;  2STT A;  2F5F A;  2P4W A;  2DPU A;  1QZY A;  3O3K A;  3GFL A;  2DK5 A;  2OQR A;  2FBH A;  4IRG A;  3RKY A;  1XGO A;  3WE2 A;  2HYG D;  3HRS A;  3KP5 A;  1TTY A;  2DI3 A;  1BJA A;  1ZAO A;  2Y0M A;  2Z3Y A;  3ZN1 A;  4CXF A;  3S2W A;  4ZZL A;  2PQ8 A;  2HYF A;  4KMU X;  2P8T A;  3W6K B;  4HLX A;  2AXL A;  5A2Q K;  1KU2 A;  2FMY A;  3R4K A;  4EJT A;  4G9Y A;  5FB2 A;  2OU2 A;  1CF7 B;  2DU9 A;  3I64 A;  4IVN A;  5FFZ A;  1Z6R A;  5DYM A;  2JZY A;  3RTR A;  1HW2 A;  3Q9V A;  2A07 F;  1XD7 A;  1IN4 A;  2E1N A;  5D5U B;  1YYV A;  2NYX A;  4Y13 A;  2W57 A;  2P6T A;  1O3Q A;  5D6E A;  4KIG A;  2VC0 A;  3KEO A;  4NQW A;  5CVV A;  2OA4 A;  2RN7 A;  5L3C A;  3P9C A;  4FHT A;  2A5Y B;  1HKQ A;  1D8K A;  3RYP A;  3GX4 X;  3ZMS A;  1YFH A;  3MEX A;  4KIF A;  2P5K A;  2XKO A;  3ELK A;  4AWX B;  4H0E A;  3CJN A;  1LDD A;  5DV5 A;  4OIP F;  3GUD A;  5E8I A;  1SD7 A;  1R36 A;  1JXS A;  2RGV A;  2YR2 A;  3GEZ A;  1XSV A;  3DPL C;  3T1B A;  2F5C A;  3QU6 A;  2XAS A;  4L9V A;  2QYO A;  2NS0 A;  1FPQ A;  1CF7 A;  1IN6 A;  2ZFW A;  5CVR A;  2D1H A;  4N9H A;  2DQR A;  2ZCW A;  4WWC A;  4B8X A;  3FXU A;  3Q9S A;  4B09 A;  2ESH A;  5BPD A;  3ISP A;  3TQN A;  1ON2 A;  4N0B A;  1ON1 A;  5K5R A;  1R1V A;  4JK1 X;  3QP5 A;  3F3X A;  1HKS A;  4Z2Y A;  3LFK A;  4KIC A;  4LG0 B;  3SHF A;  4G7H F;  2HTJ A;  2V9V A;  4WK8 F;  4EM0 B;  4YG2 F;  4A0X A;  1O3R A;  2FA5 A;  5DCF A;  5ICC A;  1U3E M;  2YX4 A;  2LF8 A;  4IRH A;  2VOP A;  4EVI A;  1O3S A;  1UB9 A;  5H6Q A;  4HA8 A;  1WQ2 A;  4XBF A;  2OZU A;  4IPA A;  2QBY B;  1UCR A;  2BE5 F;  4EJW A;  4CIC A;  3V8J A;  4M73 A;  4PZJ A;  1SAX A;  1MZB A;  5CVJ A;  1R00 A;  3CUQ A;  2A6H F;  2RV8 A;  3ECH A;  2L02 A;  4ZYE A;  2HS5 A;  4BH9 A;  1HW5 A;  3I0T A;  4MEY F;  1LB2 A;  1BBY A;  5LRR A;  4IXA A;  2QQ9 A;  3L00 A;  2EA4 A;  2VBW A;  2MD5 A;  4M74 A;  3DKW A;  3MFK A;  1A04 A;  4NB5 A;  1OYI A;  4TV7 A;  2W85 A;  4HQE A;  1BM9 A;  1F9N A;  3BPX A;  4KUM A;  5LLQ A;  4A5N A;  3NQO A;  3MAJ A;  4MQV A;  3BWG A;  3ZN0 A;  1JHF A;  3D0S A;  4A5M A;  2CW0 F;  2EA2 A;  3JSP A;  1GHC A;  3G3Z A;  5D8K B;  2O0Y A;  3SZP A;  4HX7 A;  3V8K A;  3BJ6 A;  3ABU A;  2CG4 A;  3KLN A;  2HOE A;  1FSH A;  1ZLK A;  2XAF A;  2X0L A;  1UST A;  4U7B A;  1TW3 A;  2KIM A;  3O2P E;  4OIN F;  2CSO A;  2IPQ X;  1MDM B;  1SFU A;  3IWZ A;  2QEN A;  3NRV A;  2FXA A;  1RUO A;  4IF4 A;  1KQ8 A;  2VE8 A;  2Q8K A;  2FQ3 A;  3ABT A;  2CYY A;  4U0Y A;  1BC8 C;  4M72 A;  1O7F A;  2O3F A;  4KNY A;  2ZKZ A;  2PMU A;  1GXP A;  2TDX A;  2QQA A;  5LEK A;  1TQI A;  3SZT A;  3B02 A;  3ZP5 A;  5CVU A;  3ZMU A;  3WG9 A;  4GGG A;  2R3S A;  3OV8 A;  4HOB A;  1GVJ A;  1B4A A;  1R23 A;  2EFP A;  4KN7 X;  4OOI A;  3O6B B;  4Y15 A;  5D5W B;  4I0B A;  2F5D A;  4G6D A;  1PUE E;  5HS9 A;  4YIF A;  2DW4 A;  4L0Y B;  5LEJ A;  3CUO A;  4KYW A;  1T98 A;  2R7D A;  1T6S A;  2Y48 A;  5A2Q Z;  2O8X A;  1XGS A;  3IC7 A;  1OYW A;  1PP7 U;  3BRO A;  4U88 A;  3EQL F;  2QBY A;  3M7G A;  1D8J A;  2L4M A;  2V1D A;  1SMY F;  1J5Y A;  3DXJ F;  2FSW A;  3LAJ A;  3GFJ A;  2BV6 A;  2PLY A;  1JE8 A;  5E20 A;  2HKX A;  4IHS A;  1OR7 A;  2V6C A;  1IN5 A;  2HZT A;  3TO7 A;  1P2F A;  2ESN A;  3QOP A;  4N9I A;  5DCM B;  3SFZ A;  4NHJ A;  2FEZ A;  5DDG A;  2B0L A;  3F21 A;  1B59 A;  5HOO A;  4ESJ A;  1OMI A;  2NRA C;  4UV9 A;  4LB6 B;  3F6O A;  2XAJ A;  4I7H A;  1XDS A;  2G7U A;  5H20 A;  3BOQ A;  4ZZD A;  2CQK A;  5E17 F;  2K4B A;  3KE2 A;  4S05 A;  3HHG A;  2FOK A;  4O3M A;  3M8E A;  1FY7 A;  2V79 A;  4Y17 A;  3M1E A;  1MJB A;  1JHH A;  4CDG A;  4ENK A;  4KMF A;  2M45 A;  2XAQ A;  5FFX A;  4I2O A;  3KP7 A;  5TJJ A;  1R7J A;  4G6Q A;  2IA1 A;  2HR3 A;  2JT1 A;  1XGM A;  5BPI A;  4L18 B;  4FX4 A;  2GA2 A;  1RNL A;  1XN7 A;  2ZO4 A;  3G73 A;  1J9I A;  2M5W A;  3F8M A;  2ZBK A;  3F8C A;  5FO5 A;  4BHP A;  1J75 A;  5LHG A;  3TO9 A;  2LDU A;  1D3Y A;  1Z05 A;  4KA4 A;  1I5Z A;  1Z91 A;  2ELH A;  3H3U A;  4UUV A;  1S3J A;  1YW7 A;  3K69 A;  3J80 K;  3QP6 A;  2E1C A;  3E6M A;  2MC3 A;  3I71 A;  3K0L A;  2DT5 A;  3LA2 A;  3HIF A;  3WTZ A;  1MDM A;  3W6J B;  1FNN A;  4M9S A;  2GXG A;  4E70 A;  5H6R A;  3PQK A;  3HYI A;  2JPB A;  4BXU A;  1IN7 A;  3IRR A;  1XCV A;  4AIJ A;  3C1D A;  4ENJ A;  3J81 K;  4HYE A;  4QLC U;  1EH8 A;  2NNY A;  2PMH A;  4AVP A;  3R0A A;  3KZY A;  1J59 A;  1SD5 A;  4RGX A;  3QU3 A;  2YU3 A;  4Q4Z F;  4JBA A;  2PG4 A;  4F7Z A;  1MJ9 A;  3FZV A;  2HTS A;  3GFM A;  3MZH A;  5D5X B;  3EYI A;  5E18 F;  4OMZ A;  1DP7 P;  3GF2 A;  1O7L A;  4HLY A;  1MKM A;  4MHG A;  4AD9 A;  1IW7 F;  5HDK A;  2OAZ A;  2V1X A;  4L0Z B;  3RPU A;  3LQQ A;  4YII A;  3BJA A;  2KJB A;  4MTD A;  3RIR A;  3JAM K;  3FXR A;  4U0V A;  1EH6 A;  2FNA A;  3BPV A;  4MNU A;  1BIB A;  1J2X A;  1LJ9 A;  1L3L A;  1IXC A;  1IUY A;  4K2E A;  2GXB A;  1S6L A;  2ZJ2 A;  1UHM A;  3LA7 A;  3Q5F A;  4L9J A;  4RGS A;  5E1X A;  2DO7 A;  2PFB A;  1QGP A;  1R5H A;  1FT9 A;  4LFU A;  3F6V A;  5ICG A;  1XMK A;  1KQ0 A;  4S04 A;  2LNB A;  3E6B A;  2LSO A;  4EJO A;  1LNW A;  1R1T A;  3JTH A;  5HVQ C;  1R1U A;  5LHH A;  5HLG A;  2H09 A;  2C6Y A;  2JTV A;  3CO7 C;  4RB1 A;  3H3Z A;  5CVI A;  3ZQ7 A;  5JFR A;  4LK1 F;  3U2R A;  1K78 B;  3ROU A;  2FNP A;  4OIQ F;  2VOD A;  1RUN A;  1P4A A;  4UNO A;  3P7N A;  2Q2E A;  4EGZ A;  4FX0 A;  4HX4 A;  2XKP A;  2A6E F;  1VTN C;  3WTW C;  4ASN A;  1SFE A;  4PGH A;  1DPR A;  1MGT A;  4M71 A;  5BS6 A;  3HRU A;  2RVC A;  1WI9 A;  3SXY A;  2Z5U A;  1ZAR A;  2OQG A;  1FWZ A;  1C0W A;  3HOT A;  1QQI A;  4RGR A;  1FYM A;  4Q48 A;  2L01 A;  2K27 A;  2KRF A;  4RAZ A;  4HV6 A;  1AWC A;  4G8X A;  3WTY C;  1KQ9 A;  3GYH X;  3T0Y A;  5D8L B;  4Q47 A;  5DCM A;  1F4K A;  2ZNZ A;  2EFO A;  2D1V A;  3JW4 A;  5AIQ A;  3J7A O;  4RAY A;  2EK5 A;  3WU1 B;  3FWE A;  1RZ4 A;  3TO6 A;  3DP7 A;  4BNC A;  2EFQ A;  4YFN F;  2PEX A;  5LBQ A;  2ADU A;  4DQ2 A;  1ZRD A;  3V7R A;  1IXS B;  3R60 A;  4AIH A;  2NNN A;  4LLN A;  5KVR A;  2ZME A;  1IAW A;  4JQF A;  4WX9 A;  4WXD A;  3E5U A;  2F5E A;  1Z6T A;  1LEA A;  2VXZ A;  1FSE A;  3I53 A;  4OIR F;  4CO8 A;  3GVA A;  3REO A;  3EDP A;  2HFH A;  3FM3 A;  4HX8 A;  3RI4 A;  1U6G A;  1IXR C;  2CGP A;  5LHI A;  1G6N A;  1BI2 A;  2W25 A;  3I4P A;  3VOD A;  5LGN A;  1FBS A;  2HKO A;  1X3U A;  5L3E A;  3B73 A;  3K2Z A;  1J7K A;  2RNJ A;  4GO1 A;  5BMZ A;  1F1Z A;  5BOX A;  2W24 A;  3V7C A;  4BHB A;  3KET A;  4BAY A;  1ONV A;  5HDN A;  1W7P B;  1REP C;  1UFM A;  3F22 A;  4L9N A;  3LQR A;  1S8N A;  3CTA A;  1FC3 A;  1HST A;  2H94 A;  1ZG5 A;  4A6D A;  2JPC A;  2VC1 A;  4KIB A;  3RJP A;  5HLI A;  1ZRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...