3T90A

Crystal structure of glucosamine-6-phosphate n-acetyltransferase from arabidopsis thaliana
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
147
structure length
147
Chain Sequence
ETFKIRKLEISDKRKGFIELLGQLTVTGSVTDEEFDRRFEEIRSYGDDHVICVIEEETSGKIAATGSVMIEKKFLRNCGKAGHIEDVVVDSRFRGKQLGKKVVEFLMDHCKSMGCYKVILDCSVENKVFYEKCGMSNKSIQMSKYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose-6-phosphate acetyltransferase 1
publication title Crystal structure and functional characterization of a glucosamine-6-phosphate N-acetyltransferase from Arabidopsis thaliana.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 40
structure length 147
sequence length 147
ec nomenclature ec 2.3.1.4: Glucosamine-phosphate N-acetyltransferase.
pdb deposition date 2011-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3t90A00
2AE6A 3DR8A 3T90A 1VHSA 4MY3A 3V8IA 1YVKA 1K4JA 1PU9A 4ORFA 1IICA 4MHDA 4FD5A 2CNMA 4KOSA 4KUAA 4E0AA 2BSWA 2B5GB 1IB1E 2BUEA 1YR0A 2Q4VA 4OLLA 1S60A 2FT0A 5KTDA 2HQYA 4KOXA 4NSQA 1NSLA 4X5KA 1S7LA 4F0YA 4IF5A 4ONUA 3TO7A 2J8NA 2VXKA 3IWGA 4Y49B 2CNTA 4OADA 5F49A 1KZFA 1WWZA 2J8MA 4R3LA 4NF1A 3H4QA 2ATRA 3D2PA 5GCNA 1PUAA 4CAWA 2REEA 1J4JA 4NCZA 2PR8A 2VZZA 3WR7A 2CY2A 2VI7A 4Y49C 2B58A 3QAHA 2R98A 2Q44A 3TT2A 3R1KA 3FXTA 2Q7BA 4R9MA 2KCWA 3EO4A 2G3TA 4AB7A 4CRZB 3JVNA 2EVNA 4AVCA 3EXNA 3TCVA 2P6EA 4PSWA 3T9YA 4XNHC 3SHPA 4HNXB 1Y9WA 4HNYB 4E8OA 4BMHA 2C27A 1I21A 4LUAA 1IYKA 2BL1A 2I00A 1M4GA 4L8AA 2ARHA 4QC6A 1S7FA 2ZW6A 4CRYB 4QB9A 4OAEA 2FXFA 3TE4A 2RC4A 4LX9A 1MJAA 2FS5A 2QMLA 4HNWB 2FIWA 2Z10A 4JXQA 4F6AA 4YFJA 5EC4A 3GY9A 3FRMA 2O28A 3JUWA 4KZTA 1YLEA 5IV0A 2GE3A 2EUIA 3P2HA 1QSNA 1IYLA 4UA3A 2WPWA 4JJXA 1YX0A 3G8WA 4CAVA 5FVJA 5H86A 3IGRA 3E0KA 4KOTA 3R95A 5C82A 2ZW7A 2B4DA 2Z11A 1SQHA 4AVAA 4EVYA 3LODA 4KORA 3EFAA 4J3GA 1Y7RA 1LRZA 2JDDA 4B5OA 2R7HA 2B4BA 3BJ8A 1S7KA 2NMTA 4U9YA 3BJ7A 3I9SA 2ZW5A 3D2MA 3DSBA 5IX3A 3EC4A 1QSTA 3W6SA 3TTHA 2CNSA 4KVME 2JEVA 4PSXA 3S6HA 1YVOA 1RO5A 3G3SA 4NEXA 2PQ8A 3R9FA 2ZPAA 2JLMA 3PZJA 3FNCA 4KUBA 2FL4A 2OZUA 3B8GA 4NXYA 4CAXA 2B3UA 2QIRA 5DWNA 3S6FA 1Z4RA 3K9UA 1U6MA 1B87A 1Y9KA 4UBRA 1XEBA 1OZPA 3RYOA 2QECA 5F47A 1KUYA 1Z9UA 3FBUA 3TO6A 4L89A 2REFA 3PP9A 4YRHA 1KUXA 1CJWA 1L0CA 4H6ZA 2B4DB 4E2AA 4MBUA 2VZYA 1B6BA 3F5BA 4KOVA 4II9A 2ZXVA 4U5YA 3SXNA 5I0CA 2BEIA 3W91A 4R3KA 2A4NA 1V0CA 5EBVA 3OWCA 1NE9A 1Z4EA 1XF8A 4I49A 1MK4A 2R8VA 3TO9A 1P4NA 3F8KA 4QUSA 3DNSA 1QSMA 3UY5A 2R1IA 1XMTA 4JLYA 2PSWA 2FCKA 3TFYA 3R9GA 3D8PA 1VKCA 4AVBA 2OH1A 2Z0ZA 1YREA 4R87A 1I1DA 5KTCA 2PDOA 3FYNA 1Q2YA 1XE4A 4IUSA 5H84A 3KKWA 2WPXA 3QB8A 2PRBA 3S6GA 5F48A 1GHEA 1BOBA 2I79A 4AG7A 2FIAA 4MI4A 4UWJA 4XPLA 1P0HA 2Q04A 4KOYA 3S6KA 2HUZA 2P0WA 3SXOA 4KOUA 4KOWA 2P6FA 5CNPA 4FD6A 1M1DA 4R57A 2HV2A 1BO4A 1XIXA 2JDCA 2OB0A 4U9ZA 1QSRA 4JWPA 4B5PB 5J8FA 2IL4A 4YGOA 4AG9A 4XPKA 5IB0A 3R96A 1RXTA 2K5TA 2OZHA 2AJ6A 3W6XA 4QVTA 4QBJA 3CXPA 4MJ8A 4FD4A 1M4DA 1S3ZA 1QSOA 2F5IA 2FE7A 4K30A 4ZBGA 4JXRA 4XPDB 5ISVA 1KUVA 5HH1A 5DWMA 1ON0A 1YK3A 3D3SA 5F46A 3C26A 3VWEA 4M3SA 4CS0B 1Q2CA 2Q0YA 2Y0MA 3ZJ0A 5HMNA 3MGDA 1FY7A 2VEZA 3P2FA 2D4PA 3TOAA 2PR1A 1M44A 4M85A 3I3GA 4JD6A 4XNHB 4KLVA 4B5PA 3GKRA 4XPDC 5E96A 2B5GA 1TIQA 2PC1A 4GS4A 4H6UA 2DXQA 3DR6A 4PV6A 5KTAA 4KLWA 3TOBA 3F0AA 3GYAA 1YGHA 2GANA 4KVXA 3DDDA 2B3VA 2H5MA 1R57A 2FSRA 1IIDA 1WK4A 4H89A 3FIXA 4DNCA 5J8CA 5JPHA 1CM0A 3CXQA 3NE7A 4KVOE 4PK2A 4RS2A 1Q2DA 2OU2A 2ZW4A 2GIVA 2VBQA 1MJBA 3CXSA 3N7ZA 2D4OA 3ZZIA 2G3AA 2P6GA 2VQYA 1N71A 4UWIA 1S7NA 1MJ9A 5C88A 2G0BA 4PK3A 3LD2A 1NMTA 4MY0A 1I12A 2X7BA 3BLNA 2OZGA 2Q4YA 3FB3A 3PGPA 3R9EA 3EY5A 3VWDA 1S5KA 5JQ4A 1M4IA 4HKFA 4RI1A 2J8RA 4FD7A 1UFHA
chains in the Genus database with same CATH superfamily
2AE6A 3DR8A 3T90A 1VHSA 5K8PA 4MY3A 4R8FA 5AG6A 3V8IA 4C7HA 1YVKA 1K4JA 1PU9A 4ORFA 2O4HA 1IICA 4MHDA 2PJBA 1Y7EA 1LFWA 4FD5A 2Z3OA 4NGQA 2Z3LA 1H8LA 2CNMA 1UWYA 4KOSA 4KUAA 4E0AA 2BSWA 2XEFA 4LQ6A 2B5GB 2C6PA 2PJ9A 1JQGA 4DJLA 1IB1E 2GLJA 4A94A 3KR5A 2BUEA 1YR0A 2Q4VA 2QVPA 2VL1A 4OLLA 4UEFA 3S9MA 3B7IA 1S60A 2FT0A 4H2KA 5KTDA 2HQYA 4KOXA 4NSQA 1NSLA 1Q7LA 4X5KA 2GLFA 1S7LA 2PRQA 3NE8A 4B14A 4F0YA 4IF5A 4ONUA 3FECA 3KASA 3NH4A 4ZY0A 3KI9A 1IGBA 2HC9A 3TO7A 1ZG9A 3D68A 2J8NA 3LACA 3B3CA 2EO8A 2VXKA 3IWGA 4NGPA 4Y49B 3SI1A 2QJ8A 4F8ZA 2C6CA 2C1CA 4B11A 2CNTA 1BAVA 3L2NA 1TF9A 4OADA 5F49A 5K8NA 3S9NA 1KZFA 1YMEA 1WWZA 2J8MA 1BLLE 2Q4ZA 4HPSA 4MHNA 4R3LA 4JZ0A 2PJ3A 1YW6A 1QMUA 2OOTA 2GREA 2XEJA 3D7FA 3PBEA 3QAYA 2V8HA 4ZY2A 4P4DA 4NF1A 5LRGA 1TKHA 3H4QA 2XEIA 3BI1A 3SJXA 4FBEA 2ATRA 3D2PA 8CPAA 5GCNA 1PUAA 4CYQA 2OR4A 4CAWA 1RTQA 3RO0A 4R6TA 2REEA 1J4JA 6CPAA 2PJAA 3BI0A 4NCZA 2PJ1A 4UF4A 5HVHA 2PR8A 2I3CA 2VZZA 3WR7A 2CY2A 3KHXA 2VI7A 2CIJA 2ZEHA 4Y49C 2B58A 2YNCA 3QAHA 4NGSA 1F57A 2R98A 2PVVA 2Q44A 5AG7A 3TT2A 3LWUA 3R1KA 2Q51A 3FXTA 4UCPA 1CBXA 4R9MA 2KCWA 3EO4A 2Q7BA 4UIBA 4CPAA 1Z2LA 1F2PA 3D4UA 1FT7A 4UFVA 2G3TA 3IU1A 4PXBA 3JVNA 4A30A 3MN8A 4AB7A 4MFJA 2EK9A 3HLPA 2EVNA 4CRZB 2IQ6A 5JM6A 4AVCA 5HVGA 3EXNA 2EWBA 3TCVA 2P6EA 4PSWA 4PXCA 1AYEA 3DLJA 3T9YA 4XNHC 3SHPA 2CXAA 4HNXB 3RAMA 4BBHA 2BO9A 1Y9WA 5K8MA 1BPNA 4HNYB 5AG5A 3IFEA 4E8OA 4BMHA 1YQEA 4NJRA 2PIZA 2C27A 3SJGA 1I21A 4ZX9A 3RZAA 4LUAA 3PBBA 1IYKA 2BL1A 2PVWA 2I00A 4LQGA 1M4GA 4L8AA 4B6ZA 2ARHA 4QC6A 1S7FA 2ZEGA 3LMSA 4NJQA 4ZGYB 2ZW6A 4CRYB 4KSIA 2PJ2A 4QB9A 3FH4A 4MCQA 4OAEA 1VIXA 2FXFA 4MCRA 3HUVA 3TE4A 2DF5A 3FEDA 1Z5RA 2PJ5A 2RC4A 4CGNA 5BWAB 3NA6A 3FJUA 3WC7A 4LX9A 4CAEA 3SJEA 1KWMA 1MJAA 2FS5A 3PB4X 2QMLA 4HNWB 2FIWA 2Z10A 3D7DA 4JXQA 4F6AA 2ZEPA 4C2ZA 4YFJA 4EWTA 3FX6A 1Z8XA 4PXDA 5EC4A 3GY9A 1Z8LA 3IIBA 4OIWA 1TXRA 3FRMA 4A32A 1ELMP 3K2KA 2O28A 4P44A 3JUWA 4MFKA 4OC3A 4KZTA 1YLEA 5IV0A 2GE3A 2EUIA 3P2HA 1QSNA 5G22A 2CTBA 1CP7A 5THWA 1IYLA 4UA3A 2WPWA 1HDQA 4JJXA 1HDUA 1VGYA 1YX0A 3G8WA 2RFHA 4CAVA 4P4BA 4DYOA 2DPSA 5FVJA 4WJBA 2Z3MA 5H86A 2CF4A 3IGRA 2Q7SA 3E0KA 3V38A 4PXEA 2WYRA 4KOTA 3R95A 5C82A 4C2XA 2ZW7A 5AGEA 4CGLA 2PJ0A 4UCNA 2B4DA 1LOKA 4UEEA 3JTKA 2Z11A 4OC0A 1SQHA 4ZY1A 4AVAA 4EVYA 3BXMA 1TKFA 3LODA 4KORA 4GM5A 5LRJA 4B12A 3EFAA 4MFLA 2YGWA 3BHXA 4J3GA 5ELYA 5LYFA 2PJ8A 1Y7RA 2V8GA 3IC1A 3DGVA 1LRZA 4P45A 2BOAA 2JDDA 4B5OA 2R7HA 3B3VA 1ZO0A 2B4BA 2V8DA 1S7KA 1AMPA 3BJ8A 2NMTA 4U9YA 3H8GA 3BJ7A 2ZEOA 3I9SA 2ZW5A 3PEIA 3D2MA 3DSBA 2AFSA 4UEZA 1PCAA 5IX3A 2JBJA 3EC4A 1QSTA 3W6SA 3CDXA 3TTHA 2EBJA 1M4LA 2XEGA 2O53A 2CNSA 4KVME 4ZYQA 1VHEA 4CGPA 2JEVA 2J9AA 1JWQA 4PSXA 3FVLA 3S6HA 5D29A 5LYIA 1YVOA 1ZLIA 4X3RA 4X2TA 4NGMA 1RO5A 3G3SA 3WC5A 4NEXA 2PQ8A 3R9FA 2ZPAA 2JLMA 2G9DA 3PZJA 3WC6A 3FNCA 4KUBA 2V77A 4YWYA 3NFZA 2FL4A 2OZUA 3B8GA 3K9TA 5G20A 1ELLP 5JGFA 4A39A 1XFOA 1LAMA 4DUKA 2ZENA 4IK2A 4KSFA 4NXYA 3D7GA 4CAXA 5G21A 2B3UA 2QIRA 4MXUA 5DWNA 3S6FA 3WT4A 2DPTA 1YSJA 1GYTA 4CGMA 7CPAA 2AFWA 3PRTA 3B35A 1Z4RA 3K9UA 2GU2A 1U6MA 1B87A 1XJOA 1Y9KA 4UBRA 3SI2A 2Q43A 1XEBA 1ZLHA 2F8HA 1LAPA 1OZPA 1IY7A 3RYOA 2QECA 5F47A 4KS9A 5JH9A 1KUYA 1Z9UA 3FBUA 2ZELA 3TO6A 4BD9A 4FUUA 4P10A 4L89A 2REFA 5LYLA 3V7ZA 3PP9A 3CPAA 4YRHA 3KR4A 2IJZA 5LYDA 2ZEEA 4F0XA 2AFOA 3SI0A 1CG2A 1F2OA 4MRIA 1KUXA 1ZG8A 1CJWA 1OBRA 3H8EA 5A27A 1L0CA 4H6ZA 2ZOGA 2B4DB 4E2AA 1NSAA 4MBUA 2VZYA 2BCOA 1B6BA 3F5BA 4KOVA 3NH8A 4P6YA 4OC4A 4ZX8A 4II9A 3NH5A 2ZXVA 1XOVA 2WUUA 4MHPA 4U5YA 3SJFA 1YLOA 4B13A 3SXNA 2ODFA 5I0CA 2BEIA 3W91A 2HB6A 4A33A 1TF8A 4Z65A 4R3KA 2AFXA 2A4NA 1V0CA 5IB9A 5EBVA 4YU9A 1IU8A 3TC8A 2PJCA 3PB8X 3OWCA 3GIUA 2ANPA 2AFUA 1NE9A 2C6GA 1Z4EA 1XF8A 4I49A 2ZEMA 1MK4A 3D67A 3B3WA 2R8VA 3TO9A 4TNUA 4CYNA 1P4NA 2PE3A 3F8KA 1LCPA 4QUSA 3DNSA 4FWUA 4P4EA 5I4MA 3S9LA 2CTCA 1QSMA 4GXHA 4NGRA 1LANA 2R1IA 4MFQA 3UY5A 1ARMA 1XMTA 4JLYA 4MHYA 4A95A 4TWEA 3TX8A 2PSWA 5A28A 2FCKA 3GUXA 3TFYA 4P4FA 3R9GA 3D8PA 1VKCA 4G1PA 2POKA 4A2ZA 4AVBA 2OH1A 2Z0ZA 1YREA 4M6HA 4R87A 1R43A 1I1DA 4C7IA 5KTCA 1CPSA 2PDOA 2FVGA 3FYNA 1Q2YA 2PJ7A 2RB7A 3KHZA 3PFOA 1DTDA 1XE4A 1HEEA 4IUSA 3KKWA 2WPXA 5H84A 3QB8A 2PRBA 3S6GA 5F48A 1GHEA 1BOBA 2I79A 4AG7A 2FIAA 3PB7X 4MI4A 4UWJA 4XPLA 1P0HA 5AG4A 2Q04A 4KOYA 3S6KA 2HUZA 2P0WA 3SXOA 4KOUA 2YNEA 2P6FA 4KOWA 5CNPA 4A31A 1IOIA 4FD6A 1M1DA 4PQAA 4R57A 2ZOFA 2HV2A 3IO1A 1BO4A 1XIXA 2JDCA 4C68A 5CPAA 1CP6A 1BPMA 1R3NA 1IOFA 2OB0A 1Z8WA 1QSRA 4JWPA 4U9ZA 3JRUA 4B5PB 4FAIA 5J8FA 2IL4A 3KQXA 4YGOA 1FNOA 4AG9A 4XPKA 5IB0A 3D7HA 2DEAA 3R96A 5LRKA 1YW4A 2NSMA 5HVFA 1CPXA 2F7VA 3H5ZA 1RXTA 3VH9A 4B10A 3I1UA 1QQ9A 2K5TA 2ZEFA 4NFRA 2OZHA 2AJ6A 2PJ4A 3KL9A 5G1ZA 1Y0YA 2YNCC 3W6XA 1VHOA 2EK8A 2IMOA 4QVTA 4QBJA 3CXPA 4MJ8A 4FD4A 1M4DA 1S3ZA 1QSOA 2F5IA 2FE7A 5CBMA 4K30A 4ZBGA 3GB0A 3KZWA 4JYWA 4JXRA 4C2YA 2PJ6A 3D66A 4XPDB 1PYTB 2JEWA 5ISVA 3B3TA 5K8OA 4PPZA 1KUVA 5HH1A 5DWMA 1XBUA 2ZEDA 1ON0A 1TKJA 3FF3A 1YK3A 3D3SA 2QYVA 5F46A 3C26A 3VATA 4A38A 4NGNA 3VWEA 3WABA 4M3SA 3KQZA 3B3SA 4CS0B 1Q2CA 2Q0YA 4UFWA 2Y0MA 4Q36A 4UCMA 4ONWA 3ZJ0A 4RN7A 4M6IA 5HMNA 4X8IA 3MGDA 1FY7A 2VEZA 3P2FA 3T8WA 3VARA 2D4PA 3GLJA 3TOAA 2PR1A 1M44A 3FEEA 4M85A 4EFDA 3I3GA 3FMCA 4JD6A 4XNHB 4KLVA 3KGQA 4OKOA 4EMEA 4B5PA 3GKRA 4XPDC 4CAFA 2WSAA 3B2YA 5HXDA 2AFZA 5E96A 2B5GA 1TIQA 2PC1A 4GS4A 4AXVA 4H6UA 2DXQA 3DR6A 4MCSA 1AUGA 3IWWA 4MMOA 4PV6A 3RNZA 3ISXA 4IHMA 5KTAA 4KLWA 3TOBA 3F0AA 1X10A 1DE4C 1Z8TA 3GYAA 1CX8A 3PB6X 4WWVA 3ISZA 4O23A 1A2ZA 5EMIA 1YGHA 2GANA 4KSAA 2GFQA 3A9LA 3DDDA 4KVXA 2B3VA 1X12A 2H5MA 2WZNA 1R57A 2FSRA 1IIDA 1WK4A 4H89A 3FIXA 4DNCA 5J8CA 1ARLA 4MHZA 4UFXA 3CZXA 1XRYA 4OP4A 1CM0A 3CXQA 3NE7A 3H8FA 4KVOE 4PK2A 5JPHA 3QNVA 4RS2A 3RBUA 1Q2DA 2OU2A 2ZW4A 4IAVA 4W9YA 4R7MA 2GIVA 1XMBA 2VBQA 4Q38A 4BINA 1MJBA 3N5FA 1EE3P 4RUHA 3CXSA 3N7ZA 2D4OA 4F9UA 5DS0A 4OC1A 4ZI6A 3ZZIA 4CGOA 2G3AA 3MRUA 2NYQA 3IWEA 2P6GA 2VQYA 1N71A 4OIDA 4UWIA 1S7NA 4MFZA 5J1QA 4OC2A 4Q7AA 4P4JA 2Z3PA 5D8NA 4UIAA 4R76A 2JBKA 1MJ9A 5C88A 2G0BA 2V8VA 3CT9A 4PK3A 4CYPA 3LD2A 4CYOA 4MFPA 4NGTA 1NMTA 4MY0A 4OMEA 4MCPA 1I12A 2X7BA 3BLNA 3PB9X 2AFMA 4P4IA 2OZGA 2Q4YA 3FB3A 1ZG7A 3PGPA 3R9EA 4F9VA 2YNDA 4M6GA 3PFEA 2ABZA 3EY5A 3VWDA 3CPXA 1S5KA 1Y0RA 5JQ4A 3IU2A 3IEHA 4A37A 2PCUA 1M4IA 2Z3NA 2Z3KA 5F09A 4HKFA 4RI1A 2J8RA 4K3NA 3IJ3A 4FD7A 2PIYA 1UFHA 4OC5A
chains in the Genus database with same CATH topology
2AE6A 3DR8A 3T90A 1VHSA 4MY3A 5AG6A 3V8IA 4C7HA 1YVKA 1K4JA 1PU9A 4ORFA 1IICA 4MHDA 4FD5A 2Z3OA 2Z3LA 2CNMA 4KOSA 4KUAA 4E0AA 2BSWA 2B5GB 1IB1E 2BUEA 1YR0A 2Q4VA 4OLLA 1S60A 2FT0A 5KTDA 2HQYA 4KOXA 4NSQA 1NSLA 4X5KA 1S7LA 4B14A 4F0YA 4IF5A 4ONUA 3TO7A 2J8NA 2VXKA 3IWGA 4Y49B 4B11A 2CNTA 4OADA 5F49A 1KZFA 1WWZA 2J8MA 4R3LA 4NF1A 3H4QA 2ATRA 3D2PA 5GCNA 1PUAA 4CYQA 4CAWA 2REEA 1J4JA 4NCZA 2PR8A 2VZZA 3WR7A 2CY2A 2VI7A 4Y49C 2B58A 2YNCA 3QAHA 2R98A 2Q44A 5AG7A 3TT2A 3R1KA 3FXTA 4UCPA 2Q7BA 4R9MA 2KCWA 3EO4A 4UFVA 2G3TA 3IU1A 4A30A 3JVNA 4AB7A 4CRZB 4MFJA 2EVNA 4AVCA 3EXNA 3TCVA 2P6EA 4PSWA 3T9YA 4XNHC 3SHPA 2CXAA 4HNXB 4BBHA 1Y9WA 5AG5A 4HNYB 4E8OA 4BMHA 2C27A 1I21A 4LUAA 1IYKA 2BL1A 2I00A 1M4GA 4L8AA 2ARHA 4QC6A 1S7FA 4ZGYB 2ZW6A 4CRYB 4QB9A 4OAEA 2FXFA 3TE4A 2RC4A 4CGNA 5BWAB 4LX9A 4CAEA 1MJAA 2FS5A 2QMLA 4HNWB 2FIWA 2Z10A 4JXQA 4F6AA 4C2ZA 4YFJA 5EC4A 3GY9A 3FRMA 4A32A 2O28A 3JUWA 4MFKA 4KZTA 1YLEA 5IV0A 2GE3A 2EUIA 3P2HA 1QSNA 5G22A 1IYLA 4UA3A 2WPWA 4JJXA 1YX0A 3G8WA 4CAVA 2DPSA 5FVJA 5H86A 2Z3MA 3IGRA 3E0KA 4KOTA 3R95A 5C82A 4C2XA 2ZW7A 5AGEA 4CGLA 4UCNA 2B4DA 3JTKA 2Z11A 1SQHA 4AVAA 4EVYA 3LODA 4KORA 4B12A 3EFAA 4MFLA 2YGWA 4J3GA 1Y7RA 1LRZA 2JDDA 4B5OA 2R7HA 1ZO0A 2B4BA 3BJ8A 1S7KA 2NMTA 4U9YA 3BJ7A 3I9SA 2ZW5A 3D2MA 3DSBA 5IX3A 3EC4A 1QSTA 3W6SA 3TTHA 2CNSA 4KVME 4CGPA 2JEVA 4PSXA 3S6HA 1YVOA 1RO5A 3G3SA 4NEXA 2PQ8A 3R9FA 2ZPAA 2JLMA 3PZJA 3FNCA 4KUBA 2FL4A 2OZUA 3B8GA 5G20A 4KSFA 4NXYA 4CAXA 5G21A 2B3UA 2QIRA 5DWNA 3S6FA 2DPTA 4CGMA 1Z4RA 3K9UA 1U6MA 1B87A 1Y9KA 4UBRA 1XEBA 1OZPA 3RYOA 2QECA 5F47A 4KS9A 1KUYA 1Z9UA 3FBUA 3TO6A 4L89A 2REFA 3PP9A 4YRHA 4F0XA 1KUXA 1CJWA 5A27A 1L0CA 4H6ZA 2B4DB 4E2AA 4MBUA 2VZYA 1B6BA 3F5BA 4KOVA 4II9A 2ZXVA 2WUUA 4U5YA 4B13A 3SXNA 5I0CA 2BEIA 3W91A 4A33A 4R3KA 2A4NA 1V0CA 5EBVA 3OWCA 1NE9A 1Z4EA 1XF8A 4I49A 1MK4A 2R8VA 3TO9A 4CYNA 1P4NA 3F8KA 4QUSA 3DNSA 1QSMA 3UY5A 2R1IA 4MFQA 1XMTA 4JLYA 4A95A 2PSWA 5A28A 2FCKA 3TFYA 3R9GA 3D8PA 1VKCA 4A2ZA 4AVBA 2OH1A 2Z0ZA 1YREA 4R87A 1I1DA 4C7IA 5KTCA 2PDOA 3FYNA 1Q2YA 1XE4A 4IUSA 5H84A 3KKWA 2WPXA 3QB8A 2PRBA 3S6GA 5F48A 1GHEA 1BOBA 2I79A 4AG7A 2FIAA 4MI4A 4UWJA 4XPLA 1P0HA 5AG4A 2Q04A 4KOYA 3S6KA 2HUZA 2P0WA 3SXOA 4KOUA 2YNEA 2P6FA 4KOWA 5CNPA 4A31A 4FD6A 1M1DA 4R57A 2HV2A 4C68A 1BO4A 1XIXA 2JDCA 2OB0A 4U9ZA 1QSRA 4JWPA 4B5PB 5J8FA 2IL4A 4YGOA 4AG9A 4XPKA 5IB0A 3R96A 3H5ZA 1RXTA 4B10A 2K5TA 2OZHA 2AJ6A 5G1ZA 3W6XA 2YNCC 4QVTA 4QBJA 3CXPA 4MJ8A 4FD4A 1M4DA 1S3ZA 1QSOA 2F5IA 2FE7A 4K30A 4ZBGA 4C2YA 4JXRA 4XPDB 5ISVA 1KUVA 5HH1A 5DWMA 1ON0A 1YK3A 3D3SA 5F46A 3C26A 3VWEA 4M3SA 4CS0B 1Q2CA 2Q0YA 4UFWA 2Y0MA 4Q36A 4UCMA 3ZJ0A 5HMNA 3MGDA 1FY7A 2VEZA 3P2FA 2D4PA 3TOAA 2PR1A 1M44A 4M85A 3I3GA 4JD6A 4XNHB 4KLVA 4B5PA 3GKRA 4XPDC 4CAFA 2WSAA 5E96A 2B5GA 1TIQA 2PC1A 4GS4A 4H6UA 2DXQA 3DR6A 4PV6A 5KTAA 4KLWA 3TOBA 3F0AA 3GYAA 1YGHA 2GANA 4KSAA 3A9LA 4KVXA 3DDDA 2B3VA 2H5MA 1R57A 2FSRA 1IIDA 1WK4A 4H89A 3FIXA 4DNCA 5J8CA 4UFXA 5JPHA 1CM0A 3CXQA 3NE7A 4KVOE 4PK2A 4RS2A 1Q2DA 2OU2A 2ZW4A 2GIVA 2VBQA 4Q38A 1MJBA 3CXSA 3N7ZA 2D4OA 3ZZIA 4CGOA 2G3AA 3IWEA 2P6GA 2VQYA 1N71A 4UWIA 1S7NA 4MFZA 2Z3PA 1MJ9A 5C88A 2G0BA 4PK3A 4CYPA 3LD2A 4CYOA 4MFPA 1NMTA 4MY0A 1I12A 2X7BA 3BLNA 2OZGA 2Q4YA 3FB3A 3PGPA 3R9EA 2YNDA 3EY5A 3VWDA 1S5KA 5JQ4A 3IU2A 1M4IA 2Z3NA 2Z3KA 4HKFA 4RI1A 2J8RA 4FD7A 1UFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AE6 A;  3DR8 A;  3T90 A;  1VHS A;  4MY3 A;  3V8I A;  1YVK A;  1K4J A;  1PU9 A;  4ORF A;  1IIC A;  4MHD A;  4FD5 A;  2CNM A;  4KOS A;  4KUA A;  4E0A A;  2BSW A;  2B5G B;  1IB1 E;  2BUE A;  1YR0 A;  2Q4V A;  4OLL A;  1S60 A;  2FT0 A;  5KTD A;  2HQY A;  4KOX A;  4NSQ A;  1NSL A;  4X5K A;  1S7L A;  4F0Y A;  4IF5 A;  4ONU A;  3TO7 A;  2J8N A;  2VXK A;  3IWG A;  4Y49 B;  2CNT A;  4OAD A;  5F49 A;  1KZF A;  1WWZ A;  2J8M A;  4R3L A;  4NF1 A;  3H4Q A;  2ATR A;  3D2P A;  5GCN A;  1PUA A;  4CAW A;  2REE A;  1J4J A;  4NCZ A;  2PR8 A;  2VZZ A;  3WR7 A;  2CY2 A;  2VI7 A;  4Y49 C;  2B58 A;  3QAH A;  2R98 A;  2Q44 A;  3TT2 A;  3R1K A;  3FXT A;  2Q7B A;  4R9M A;  2KCW A;  3EO4 A;  2G3T A;  4AB7 A;  4CRZ B;  3JVN A;  2EVN A;  4AVC A;  3EXN A;  3TCV A;  2P6E A;  4PSW A;  3T9Y A;  4XNH C;  3SHP A;  4HNX B;  1Y9W A;  4HNY B;  4E8O A;  4BMH A;  2C27 A;  1I21 A;  4LUA A;  1IYK A;  2BL1 A;  2I00 A;  1M4G A;  4L8A A;  2ARH A;  4QC6 A;  1S7F A;  2ZW6 A;  4CRY B;  4QB9 A;  4OAE A;  2FXF A;  3TE4 A;  2RC4 A;  4LX9 A;  1MJA A;  2FS5 A;  2QML A;  4HNW B;  2FIW A;  2Z10 A;  4JXQ A;  4F6A A;  4YFJ A;  5EC4 A;  3GY9 A;  3FRM A;  2O28 A;  3JUW A;  4KZT A;  1YLE A;  5IV0 A;  2GE3 A;  2EUI A;  3P2H A;  1QSN A;  1IYL A;  4UA3 A;  2WPW A;  4JJX A;  1YX0 A;  3G8W A;  4CAV A;  5FVJ A;  5H86 A;  3IGR A;  3E0K A;  4KOT A;  3R95 A;  5C82 A;  2ZW7 A;  2B4D A;  2Z11 A;  1SQH A;  4AVA A;  4EVY A;  3LOD A;  4KOR A;  3EFA A;  4J3G A;  1Y7R A;  1LRZ A;  2JDD A;  4B5O A;  2R7H A;  2B4B A;  3BJ8 A;  1S7K A;  2NMT A;  4U9Y A;  3BJ7 A;  3I9S A;  2ZW5 A;  3D2M A;  3DSB A;  5IX3 A;  3EC4 A;  1QST A;  3W6S A;  3TTH A;  2CNS A;  4KVM E;  2JEV A;  4PSX A;  3S6H A;  1YVO A;  1RO5 A;  3G3S A;  4NEX A;  2PQ8 A;  3R9F A;  2ZPA A;  2JLM A;  3PZJ A;  3FNC A;  4KUB A;  2FL4 A;  2OZU A;  3B8G A;  4NXY A;  4CAX A;  2B3U A;  2QIR A;  5DWN A;  3S6F A;  1Z4R A;  3K9U A;  1U6M A;  1B87 A;  1Y9K A;  4UBR A;  1XEB A;  1OZP A;  3RYO A;  2QEC A;  5F47 A;  1KUY A;  1Z9U A;  3FBU A;  3TO6 A;  4L89 A;  2REF A;  3PP9 A;  4YRH A;  1KUX A;  1CJW A;  1L0C A;  4H6Z A;  2B4D B;  4E2A A;  4MBU A;  2VZY A;  1B6B A;  3F5B A;  4KOV A;  4II9 A;  2ZXV A;  4U5Y A;  3SXN A;  5I0C A;  2BEI A;  3W91 A;  4R3K A;  2A4N A;  1V0C A;  5EBV A;  3OWC A;  1NE9 A;  1Z4E A;  1XF8 A;  4I49 A;  1MK4 A;  2R8V A;  3TO9 A;  1P4N A;  3F8K A;  4QUS A;  3DNS A;  1QSM A;  3UY5 A;  2R1I A;  1XMT A;  4JLY A;  2PSW A;  2FCK A;  3TFY A;  3R9G A;  3D8P A;  1VKC A;  4AVB A;  2OH1 A;  2Z0Z A;  1YRE A;  4R87 A;  1I1D A;  5KTC A;  2PDO A;  3FYN A;  1Q2Y A;  1XE4 A;  4IUS A;  5H84 A;  3KKW A;  2WPX A;  3QB8 A;  2PRB A;  3S6G A;  5F48 A;  1GHE A;  1BOB A;  2I79 A;  4AG7 A;  2FIA A;  4MI4 A;  4UWJ A;  4XPL A;  1P0H A;  2Q04 A;  4KOY A;  3S6K A;  2HUZ A;  2P0W A;  3SXO A;  4KOU A;  4KOW A;  2P6F A;  5CNP A;  4FD6 A;  1M1D A;  4R57 A;  2HV2 A;  1BO4 A;  1XIX A;  2JDC A;  2OB0 A;  4U9Z A;  1QSR A;  4JWP A;  4B5P B;  5J8F A;  2IL4 A;  4YGO A;  4AG9 A;  4XPK A;  5IB0 A;  3R96 A;  1RXT A;  2K5T A;  2OZH A;  2AJ6 A;  3W6X A;  4QVT A;  4QBJ A;  3CXP A;  4MJ8 A;  4FD4 A;  1M4D A;  1S3Z A;  1QSO A;  2F5I A;  2FE7 A;  4K30 A;  4ZBG A;  4JXR A;  4XPD B;  5ISV A;  1KUV A;  5HH1 A;  5DWM A;  1ON0 A;  1YK3 A;  3D3S A;  5F46 A;  3C26 A;  3VWE A;  4M3S A;  4CS0 B;  1Q2C A;  2Q0Y A;  2Y0M A;  3ZJ0 A;  5HMN A;  3MGD A;  1FY7 A;  2VEZ A;  3P2F A;  2D4P A;  3TOA A;  2PR1 A;  1M44 A;  4M85 A;  3I3G A;  4JD6 A;  4XNH B;  4KLV A;  4B5P A;  3GKR A;  4XPD C;  5E96 A;  2B5G A;  1TIQ A;  2PC1 A;  4GS4 A;  4H6U A;  2DXQ A;  3DR6 A;  4PV6 A;  5KTA A;  4KLW A;  3TOB A;  3F0A A;  3GYA A;  1YGH A;  2GAN A;  4KVX A;  3DDD A;  2B3V A;  2H5M A;  1R57 A;  2FSR A;  1IID A;  1WK4 A;  4H89 A;  3FIX A;  4DNC A;  5J8C A;  5JPH A;  1CM0 A;  3CXQ A;  3NE7 A;  4KVO E;  4PK2 A;  4RS2 A;  1Q2D A;  2OU2 A;  2ZW4 A;  2GIV A;  2VBQ A;  1MJB A;  3CXS A;  3N7Z A;  2D4O A;  3ZZI A;  2G3A A;  2P6G A;  2VQY A;  1N71 A;  4UWI A;  1S7N A;  1MJ9 A;  5C88 A;  2G0B A;  4PK3 A;  3LD2 A;  1NMT A;  4MY0 A;  1I12 A;  2X7B A;  3BLN A;  2OZG A;  2Q4Y A;  3FB3 A;  3PGP A;  3R9E A;  3EY5 A;  3VWD A;  1S5K A;  5JQ4 A;  1M4I A;  4HKF A;  4RI1 A;  2J8R A;  4FD7 A;  1UFH A; 
#chains in the Genus database with same CATH topology
 2AE6 A;  3DR8 A;  3T90 A;  1VHS A;  5K8P A;  4MY3 A;  4R8F A;  5AG6 A;  3V8I A;  4C7H A;  1YVK A;  1K4J A;  1PU9 A;  4ORF A;  2O4H A;  1IIC A;  4MHD A;  2PJB A;  1Y7E A;  1LFW A;  4FD5 A;  2Z3O A;  4NGQ A;  2Z3L A;  1H8L A;  2CNM A;  1UWY A;  4KOS A;  4KUA A;  4E0A A;  2BSW A;  2XEF A;  4LQ6 A;  2B5G B;  2C6P A;  2PJ9 A;  1JQG A;  4DJL A;  1IB1 E;  2GLJ A;  4A94 A;  3KR5 A;  2BUE A;  1YR0 A;  2Q4V A;  2QVP A;  2VL1 A;  4OLL A;  4UEF A;  3S9M A;  3B7I A;  1S60 A;  2FT0 A;  4H2K A;  5KTD A;  2HQY A;  4KOX A;  4NSQ A;  1NSL A;  1Q7L A;  4X5K A;  2GLF A;  1S7L A;  2PRQ A;  3NE8 A;  4B14 A;  4F0Y A;  4IF5 A;  4ONU A;  3FEC A;  3KAS A;  3NH4 A;  4ZY0 A;  3KI9 A;  1IGB A;  2HC9 A;  3TO7 A;  1ZG9 A;  3D68 A;  2J8N A;  3LAC A;  3B3C A;  2EO8 A;  2VXK A;  3IWG A;  4NGP A;  4Y49 B;  3SI1 A;  2QJ8 A;  4F8Z A;  2C6C A;  2C1C A;  4B11 A;  2CNT A;  1BAV A;  3L2N A;  1TF9 A;  4OAD A;  5F49 A;  5K8N A;  3S9N A;  1KZF A;  1YME A;  1WWZ A;  2J8M A;  1BLL E;  2Q4Z A;  4HPS A;  4MHN A;  4R3L A;  4JZ0 A;  2PJ3 A;  1YW6 A;  1QMU A;  2OOT A;  2GRE A;  2XEJ A;  3D7F A;  3PBE A;  3QAY A;  2V8H A;  4ZY2 A;  4P4D A;  4NF1 A;  5LRG A;  1TKH A;  3H4Q A;  2XEI A;  3BI1 A;  3SJX A;  4FBE A;  2ATR A;  3D2P A;  8CPA A;  5GCN A;  1PUA A;  4CYQ A;  2OR4 A;  4CAW A;  1RTQ A;  3RO0 A;  4R6T A;  2REE A;  1J4J A;  6CPA A;  2PJA A;  3BI0 A;  4NCZ A;  2PJ1 A;  4UF4 A;  5HVH A;  2PR8 A;  2I3C A;  2VZZ A;  3WR7 A;  2CY2 A;  3KHX A;  2VI7 A;  2CIJ A;  2ZEH A;  4Y49 C;  2B58 A;  2YNC A;  3QAH A;  4NGS A;  1F57 A;  2R98 A;  2PVV A;  2Q44 A;  5AG7 A;  3TT2 A;  3LWU A;  3R1K A;  2Q51 A;  3FXT A;  4UCP A;  1CBX A;  4R9M A;  2KCW A;  3EO4 A;  2Q7B A;  4UIB A;  4CPA A;  1Z2L A;  1F2P A;  3D4U A;  1FT7 A;  4UFV A;  2G3T A;  3IU1 A;  4PXB A;  3JVN A;  4A30 A;  3MN8 A;  4AB7 A;  4MFJ A;  2EK9 A;  3HLP A;  2EVN A;  4CRZ B;  2IQ6 A;  5JM6 A;  4AVC A;  5HVG A;  3EXN A;  2EWB A;  3TCV A;  2P6E A;  4PSW A;  4PXC A;  1AYE A;  3DLJ A;  3T9Y A;  4XNH C;  3SHP A;  2CXA A;  4HNX B;  3RAM A;  4BBH A;  2BO9 A;  1Y9W A;  5K8M A;  1BPN A;  4HNY B;  5AG5 A;  3IFE A;  4E8O A;  4BMH A;  1YQE A;  4NJR A;  2PIZ A;  2C27 A;  3SJG A;  1I21 A;  4ZX9 A;  3RZA A;  4LUA A;  3PBB A;  1IYK A;  2BL1 A;  2PVW A;  2I00 A;  4LQG A;  1M4G A;  4L8A A;  4B6Z A;  2ARH A;  4QC6 A;  1S7F A;  2ZEG A;  3LMS A;  4NJQ A;  4ZGY B;  2ZW6 A;  4CRY B;  4KSI A;  2PJ2 A;  4QB9 A;  3FH4 A;  4MCQ A;  4OAE A;  1VIX A;  2FXF A;  4MCR A;  3HUV A;  3TE4 A;  2DF5 A;  3FED A;  1Z5R A;  2PJ5 A;  2RC4 A;  4CGN A;  5BWA B;  3NA6 A;  3FJU A;  3WC7 A;  4LX9 A;  4CAE A;  3SJE A;  1KWM A;  1MJA A;  2FS5 A;  3PB4 X;  2QML A;  4HNW B;  2FIW A;  2Z10 A;  3D7D A;  4JXQ A;  4F6A A;  2ZEP A;  4C2Z A;  4YFJ A;  4EWT A;  3FX6 A;  1Z8X A;  4PXD A;  5EC4 A;  3GY9 A;  1Z8L A;  3IIB A;  4OIW A;  1TXR A;  3FRM A;  4A32 A;  1ELM P;  3K2K A;  2O28 A;  4P44 A;  3JUW A;  4MFK A;  4OC3 A;  4KZT A;  1YLE A;  5IV0 A;  2GE3 A;  2EUI A;  3P2H A;  1QSN A;  5G22 A;  2CTB A;  1CP7 A;  5THW A;  1IYL A;  4UA3 A;  2WPW A;  1HDQ A;  4JJX A;  1HDU A;  1VGY A;  1YX0 A;  3G8W A;  2RFH A;  4CAV A;  4P4B A;  4DYO A;  2DPS A;  5FVJ A;  4WJB A;  2Z3M A;  5H86 A;  2CF4 A;  3IGR A;  2Q7S A;  3E0K A;  3V38 A;  4PXE A;  2WYR A;  4KOT A;  3R95 A;  5C82 A;  4C2X A;  2ZW7 A;  5AGE A;  4CGL A;  2PJ0 A;  4UCN A;  2B4D A;  1LOK A;  4UEE A;  3JTK A;  2Z11 A;  4OC0 A;  1SQH A;  4ZY1 A;  4AVA A;  4EVY A;  3BXM A;  1TKF A;  3LOD A;  4KOR A;  4GM5 A;  5LRJ A;  4B12 A;  3EFA A;  4MFL A;  2YGW A;  3BHX A;  4J3G A;  5ELY A;  5LYF A;  2PJ8 A;  1Y7R A;  2V8G A;  3IC1 A;  3DGV A;  1LRZ A;  4P45 A;  2BOA A;  2JDD A;  4B5O A;  2R7H A;  3B3V A;  1ZO0 A;  2B4B A;  2V8D A;  1S7K A;  1AMP A;  3BJ8 A;  2NMT A;  4U9Y A;  3H8G A;  3BJ7 A;  2ZEO A;  3I9S A;  2ZW5 A;  3PEI A;  3D2M A;  3DSB A;  2AFS A;  4UEZ A;  1PCA A;  5IX3 A;  2JBJ A;  3EC4 A;  1QST A;  3W6S A;  3CDX A;  3TTH A;  2EBJ A;  1M4L A;  2XEG A;  2O53 A;  2CNS A;  4KVM E;  4ZYQ A;  1VHE A;  4CGP A;  2JEV A;  2J9A A;  1JWQ A;  4PSX A;  3FVL A;  3S6H A;  5D29 A;  5LYI A;  1YVO A;  1ZLI A;  4X3R A;  4X2T A;  4NGM A;  1RO5 A;  3G3S A;  3WC5 A;  4NEX A;  2PQ8 A;  3R9F A;  2ZPA A;  2JLM A;  2G9D A;  3PZJ A;  3WC6 A;  3FNC A;  4KUB A;  2V77 A;  4YWY A;  3NFZ A;  2FL4 A;  2OZU A;  3B8G A;  3K9T A;  5G20 A;  1ELL P;  5JGF A;  4A39 A;  1XFO A;  1LAM A;  4DUK A;  2ZEN A;  4IK2 A;  4KSF A;  4NXY A;  3D7G A;  4CAX A;  5G21 A;  2B3U A;  2QIR A;  4MXU A;  5DWN A;  3S6F A;  3WT4 A;  2DPT A;  1YSJ A;  1GYT A;  4CGM A;  7CPA A;  2AFW A;  3PRT A;  3B35 A;  1Z4R A;  3K9U A;  2GU2 A;  1U6M A;  1B87 A;  1XJO A;  1Y9K A;  4UBR A;  3SI2 A;  2Q43 A;  1XEB A;  1ZLH A;  2F8H A;  1LAP A;  1OZP A;  1IY7 A;  3RYO A;  2QEC A;  5F47 A;  4KS9 A;  5JH9 A;  1KUY A;  1Z9U A;  3FBU A;  2ZEL A;  3TO6 A;  4BD9 A;  4FUU A;  4P10 A;  4L89 A;  2REF A;  5LYL A;  3V7Z A;  3PP9 A;  3CPA A;  4YRH A;  3KR4 A;  2IJZ A;  5LYD A;  2ZEE A;  4F0X A;  2AFO A;  3SI0 A;  1CG2 A;  1F2O A;  4MRI A;  1KUX A;  1ZG8 A;  1CJW A;  1OBR A;  3H8E A;  5A27 A;  1L0C A;  4H6Z A;  2ZOG A;  2B4D B;  4E2A A;  1NSA A;  4MBU A;  2VZY A;  2BCO A;  1B6B A;  3F5B A;  4KOV A;  3NH8 A;  4P6Y A;  4OC4 A;  4ZX8 A;  4II9 A;  3NH5 A;  2ZXV A;  1XOV A;  2WUU A;  4MHP A;  4U5Y A;  3SJF A;  1YLO A;  4B13 A;  3SXN A;  2ODF A;  5I0C A;  2BEI A;  3W91 A;  2HB6 A;  4A33 A;  1TF8 A;  4Z65 A;  4R3K A;  2AFX A;  2A4N A;  1V0C A;  5IB9 A;  5EBV A;  4YU9 A;  1IU8 A;  3TC8 A;  2PJC A;  3PB8 X;  3OWC A;  3GIU A;  2ANP A;  2AFU A;  1NE9 A;  2C6G A;  1Z4E A;  1XF8 A;  4I49 A;  2ZEM A;  1MK4 A;  3D67 A;  3B3W A;  2R8V A;  3TO9 A;  4TNU A;  4CYN A;  1P4N A;  2PE3 A;  3F8K A;  1LCP A;  4QUS A;  3DNS A;  4FWU A;  4P4E A;  5I4M A;  3S9L A;  2CTC A;  1QSM A;  4GXH A;  4NGR A;  1LAN A;  2R1I A;  4MFQ A;  3UY5 A;  1ARM A;  1XMT A;  4JLY A;  4MHY A;  4A95 A;  4TWE A;  3TX8 A;  2PSW A;  5A28 A;  2FCK A;  3GUX A;  3TFY A;  4P4F A;  3R9G A;  3D8P A;  1VKC A;  4G1P A;  2POK A;  4A2Z A;  4AVB A;  2OH1 A;  2Z0Z A;  1YRE A;  4M6H A;  4R87 A;  1R43 A;  1I1D A;  4C7I A;  5KTC A;  1CPS A;  2PDO A;  2FVG A;  3FYN A;  1Q2Y A;  2PJ7 A;  2RB7 A;  3KHZ A;  3PFO A;  1DTD A;  1XE4 A;  1HEE A;  4IUS A;  3KKW A;  2WPX A;  5H84 A;  3QB8 A;  2PRB A;  3S6G A;  5F48 A;  1GHE A;  1BOB A;  2I79 A;  4AG7 A;  2FIA A;  3PB7 X;  4MI4 A;  4UWJ A;  4XPL A;  1P0H A;  5AG4 A;  2Q04 A;  4KOY A;  3S6K A;  2HUZ A;  2P0W A;  3SXO A;  4KOU A;  2YNE A;  2P6F A;  4KOW A;  5CNP A;  4A31 A;  1IOI A;  4FD6 A;  1M1D A;  4PQA A;  4R57 A;  2ZOF A;  2HV2 A;  3IO1 A;  1BO4 A;  1XIX A;  2JDC A;  4C68 A;  5CPA A;  1CP6 A;  1BPM A;  1R3N A;  1IOF A;  2OB0 A;  1Z8W A;  1QSR A;  4JWP A;  4U9Z A;  3JRU A;  4B5P B;  4FAI A;  5J8F A;  2IL4 A;  3KQX A;  4YGO A;  1FNO A;  4AG9 A;  4XPK A;  5IB0 A;  3D7H A;  2DEA A;  3R96 A;  5LRK A;  1YW4 A;  2NSM A;  5HVF A;  1CPX A;  2F7V A;  3H5Z A;  1RXT A;  3VH9 A;  4B10 A;  3I1U A;  1QQ9 A;  2K5T A;  2ZEF A;  4NFR A;  2OZH A;  2AJ6 A;  2PJ4 A;  3KL9 A;  5G1Z A;  1Y0Y A;  2YNC C;  3W6X A;  1VHO A;  2EK8 A;  2IMO A;  4QVT A;  4QBJ A;  3CXP A;  4MJ8 A;  4FD4 A;  1M4D A;  1S3Z A;  1QSO A;  2F5I A;  2FE7 A;  5CBM A;  4K30 A;  4ZBG A;  3GB0 A;  3KZW A;  4JYW A;  4JXR A;  4C2Y A;  2PJ6 A;  3D66 A;  4XPD B;  1PYT B;  2JEW A;  5ISV A;  3B3T A;  5K8O A;  4PPZ A;  1KUV A;  5HH1 A;  5DWM A;  1XBU A;  2ZED A;  1ON0 A;  1TKJ A;  3FF3 A;  1YK3 A;  3D3S A;  2QYV A;  5F46 A;  3C26 A;  3VAT A;  4A38 A;  4NGN A;  3VWE A;  3WAB A;  4M3S A;  3KQZ A;  3B3S A;  4CS0 B;  1Q2C A;  2Q0Y A;  4UFW A;  2Y0M A;  4Q36 A;  4UCM A;  4ONW A;  3ZJ0 A;  4RN7 A;  4M6I A;  5HMN A;  4X8I A;  3MGD A;  1FY7 A;  2VEZ A;  3P2F A;  3T8W A;  3VAR A;  2D4P A;  3GLJ A;  3TOA A;  2PR1 A;  1M44 A;  3FEE A;  4M85 A;  4EFD A;  3I3G A;  3FMC A;  4JD6 A;  4XNH B;  4KLV A;  3KGQ A;  4OKO A;  4EME A;  4B5P A;  3GKR A;  4XPD C;  4CAF A;  2WSA A;  3B2Y A;  5HXD A;  2AFZ A;  5E96 A;  2B5G A;  1TIQ A;  2PC1 A;  4GS4 A;  4AXV A;  4H6U A;  2DXQ A;  3DR6 A;  4MCS A;  1AUG A;  3IWW A;  4MMO A;  4PV6 A;  3RNZ A;  3ISX A;  4IHM A;  5KTA A;  4KLW A;  3TOB A;  3F0A A;  1X10 A;  1DE4 C;  1Z8T A;  3GYA A;  1CX8 A;  3PB6 X;  4WWV A;  3ISZ A;  4O23 A;  1A2Z A;  5EMI A;  1YGH A;  2GAN A;  4KSA A;  2GFQ A;  3A9L A;  3DDD A;  4KVX A;  2B3V A;  1X12 A;  2H5M A;  2WZN A;  1R57 A;  2FSR A;  1IID A;  1WK4 A;  4H89 A;  3FIX A;  4DNC A;  5J8C A;  1ARL A;  4MHZ A;  4UFX A;  3CZX A;  1XRY A;  4OP4 A;  1CM0 A;  3CXQ A;  3NE7 A;  3H8F A;  4KVO E;  4PK2 A;  5JPH A;  3QNV A;  4RS2 A;  3RBU A;  1Q2D A;  2OU2 A;  2ZW4 A;  4IAV A;  4W9Y A;  4R7M A;  2GIV A;  1XMB A;  2VBQ A;  4Q38 A;  4BIN A;  1MJB A;  3N5F A;  1EE3 P;  4RUH A;  3CXS A;  3N7Z A;  2D4O A;  4F9U A;  5DS0 A;  4OC1 A;  4ZI6 A;  3ZZI A;  4CGO A;  2G3A A;  3MRU A;  2NYQ A;  3IWE A;  2P6G A;  2VQY A;  1N71 A;  4OID A;  4UWI A;  1S7N A;  4MFZ A;  5J1Q A;  4OC2 A;  4Q7A A;  4P4J A;  2Z3P A;  5D8N A;  4UIA A;  4R76 A;  2JBK A;  1MJ9 A;  5C88 A;  2G0B A;  2V8V A;  3CT9 A;  4PK3 A;  4CYP A;  3LD2 A;  4CYO A;  4MFP A;  4NGT A;  1NMT A;  4MY0 A;  4OME A;  4MCP A;  1I12 A;  2X7B A;  3BLN A;  3PB9 X;  2AFM A;  4P4I A;  2OZG A;  2Q4Y A;  3FB3 A;  1ZG7 A;  3PGP A;  3R9E A;  4F9V A;  2YND A;  4M6G A;  3PFE A;  2ABZ A;  3EY5 A;  3VWD A;  3CPX A;  1S5K A;  1Y0R A;  5JQ4 A;  3IU2 A;  3IEH A;  4A37 A;  2PCU A;  1M4I A;  2Z3N A;  2Z3K A;  5F09 A;  4HKF A;  4RI1 A;  2J8R A;  4K3N A;  3IJ3 A;  4FD7 A;  2PIY A;  1UFH A;  4OC5 A; 
#chains in the Genus database with same CATH homology
 2AE6 A;  3DR8 A;  3T90 A;  1VHS A;  4MY3 A;  5AG6 A;  3V8I A;  4C7H A;  1YVK A;  1K4J A;  1PU9 A;  4ORF A;  1IIC A;  4MHD A;  4FD5 A;  2Z3O A;  2Z3L A;  2CNM A;  4KOS A;  4KUA A;  4E0A A;  2BSW A;  2B5G B;  1IB1 E;  2BUE A;  1YR0 A;  2Q4V A;  4OLL A;  1S60 A;  2FT0 A;  5KTD A;  2HQY A;  4KOX A;  4NSQ A;  1NSL A;  4X5K A;  1S7L A;  4B14 A;  4F0Y A;  4IF5 A;  4ONU A;  3TO7 A;  2J8N A;  2VXK A;  3IWG A;  4Y49 B;  4B11 A;  2CNT A;  4OAD A;  5F49 A;  1KZF A;  1WWZ A;  2J8M A;  4R3L A;  4NF1 A;  3H4Q A;  2ATR A;  3D2P A;  5GCN A;  1PUA A;  4CYQ A;  4CAW A;  2REE A;  1J4J A;  4NCZ A;  2PR8 A;  2VZZ A;  3WR7 A;  2CY2 A;  2VI7 A;  4Y49 C;  2B58 A;  2YNC A;  3QAH A;  2R98 A;  2Q44 A;  5AG7 A;  3TT2 A;  3R1K A;  3FXT A;  4UCP A;  2Q7B A;  4R9M A;  2KCW A;  3EO4 A;  4UFV A;  2G3T A;  3IU1 A;  4A30 A;  3JVN A;  4AB7 A;  4CRZ B;  4MFJ A;  2EVN A;  4AVC A;  3EXN A;  3TCV A;  2P6E A;  4PSW A;  3T9Y A;  4XNH C;  3SHP A;  2CXA A;  4HNX B;  4BBH A;  1Y9W A;  5AG5 A;  4HNY B;  4E8O A;  4BMH A;  2C27 A;  1I21 A;  4LUA A;  1IYK A;  2BL1 A;  2I00 A;  1M4G A;  4L8A A;  2ARH A;  4QC6 A;  1S7F A;  4ZGY B;  2ZW6 A;  4CRY B;  4QB9 A;  4OAE A;  2FXF A;  3TE4 A;  2RC4 A;  4CGN A;  5BWA B;  4LX9 A;  4CAE A;  1MJA A;  2FS5 A;  2QML A;  4HNW B;  2FIW A;  2Z10 A;  4JXQ A;  4F6A A;  4C2Z A;  4YFJ A;  5EC4 A;  3GY9 A;  3FRM A;  4A32 A;  2O28 A;  3JUW A;  4MFK A;  4KZT A;  1YLE A;  5IV0 A;  2GE3 A;  2EUI A;  3P2H A;  1QSN A;  5G22 A;  1IYL A;  4UA3 A;  2WPW A;  4JJX A;  1YX0 A;  3G8W A;  4CAV A;  2DPS A;  5FVJ A;  5H86 A;  2Z3M A;  3IGR A;  3E0K A;  4KOT A;  3R95 A;  5C82 A;  4C2X A;  2ZW7 A;  5AGE A;  4CGL A;  4UCN A;  2B4D A;  3JTK A;  2Z11 A;  1SQH A;  4AVA A;  4EVY A;  3LOD A;  4KOR A;  4B12 A;  3EFA A;  4MFL A;  2YGW A;  4J3G A;  1Y7R A;  1LRZ A;  2JDD A;  4B5O A;  2R7H A;  1ZO0 A;  2B4B A;  3BJ8 A;  1S7K A;  2NMT A;  4U9Y A;  3BJ7 A;  3I9S A;  2ZW5 A;  3D2M A;  3DSB A;  5IX3 A;  3EC4 A;  1QST A;  3W6S A;  3TTH A;  2CNS A;  4KVM E;  4CGP A;  2JEV A;  4PSX A;  3S6H A;  1YVO A;  1RO5 A;  3G3S A;  4NEX A;  2PQ8 A;  3R9F A;  2ZPA A;  2JLM A;  3PZJ A;  3FNC A;  4KUB A;  2FL4 A;  2OZU A;  3B8G A;  5G20 A;  4KSF A;  4NXY A;  4CAX A;  5G21 A;  2B3U A;  2QIR A;  5DWN A;  3S6F A;  2DPT A;  4CGM A;  1Z4R A;  3K9U A;  1U6M A;  1B87 A;  1Y9K A;  4UBR A;  1XEB A;  1OZP A;  3RYO A;  2QEC A;  5F47 A;  4KS9 A;  1KUY A;  1Z9U A;  3FBU A;  3TO6 A;  4L89 A;  2REF A;  3PP9 A;  4YRH A;  4F0X A;  1KUX A;  1CJW A;  5A27 A;  1L0C A;  4H6Z A;  2B4D B;  4E2A A;  4MBU A;  2VZY A;  1B6B A;  3F5B A;  4KOV A;  4II9 A;  2ZXV A;  2WUU A;  4U5Y A;  4B13 A;  3SXN A;  5I0C A;  2BEI A;  3W91 A;  4A33 A;  4R3K A;  2A4N A;  1V0C A;  5EBV A;  3OWC A;  1NE9 A;  1Z4E A;  1XF8 A;  4I49 A;  1MK4 A;  2R8V A;  3TO9 A;  4CYN A;  1P4N A;  3F8K A;  4QUS A;  3DNS A;  1QSM A;  3UY5 A;  2R1I A;  4MFQ A;  1XMT A;  4JLY A;  4A95 A;  2PSW A;  5A28 A;  2FCK A;  3TFY A;  3R9G A;  3D8P A;  1VKC A;  4A2Z A;  4AVB A;  2OH1 A;  2Z0Z A;  1YRE A;  4R87 A;  1I1D A;  4C7I A;  5KTC A;  2PDO A;  3FYN A;  1Q2Y A;  1XE4 A;  4IUS A;  5H84 A;  3KKW A;  2WPX A;  3QB8 A;  2PRB A;  3S6G A;  5F48 A;  1GHE A;  1BOB A;  2I79 A;  4AG7 A;  2FIA A;  4MI4 A;  4UWJ A;  4XPL A;  1P0H A;  5AG4 A;  2Q04 A;  4KOY A;  3S6K A;  2HUZ A;  2P0W A;  3SXO A;  4KOU A;  2YNE A;  2P6F A;  4KOW A;  5CNP A;  4A31 A;  4FD6 A;  1M1D A;  4R57 A;  2HV2 A;  4C68 A;  1BO4 A;  1XIX A;  2JDC A;  2OB0 A;  4U9Z A;  1QSR A;  4JWP A;  4B5P B;  5J8F A;  2IL4 A;  4YGO A;  4AG9 A;  4XPK A;  5IB0 A;  3R96 A;  3H5Z A;  1RXT A;  4B10 A;  2K5T A;  2OZH A;  2AJ6 A;  5G1Z A;  3W6X A;  2YNC C;  4QVT A;  4QBJ A;  3CXP A;  4MJ8 A;  4FD4 A;  1M4D A;  1S3Z A;  1QSO A;  2F5I A;  2FE7 A;  4K30 A;  4ZBG A;  4C2Y A;  4JXR A;  4XPD B;  5ISV A;  1KUV A;  5HH1 A;  5DWM A;  1ON0 A;  1YK3 A;  3D3S A;  5F46 A;  3C26 A;  3VWE A;  4M3S A;  4CS0 B;  1Q2C A;  2Q0Y A;  4UFW A;  2Y0M A;  4Q36 A;  4UCM A;  3ZJ0 A;  5HMN A;  3MGD A;  1FY7 A;  2VEZ A;  3P2F A;  2D4P A;  3TOA A;  2PR1 A;  1M44 A;  4M85 A;  3I3G A;  4JD6 A;  4XNH B;  4KLV A;  4B5P A;  3GKR A;  4XPD C;  4CAF A;  2WSA A;  5E96 A;  2B5G A;  1TIQ A;  2PC1 A;  4GS4 A;  4H6U A;  2DXQ A;  3DR6 A;  4PV6 A;  5KTA A;  4KLW A;  3TOB A;  3F0A A;  3GYA A;  1YGH A;  2GAN A;  4KSA A;  3A9L A;  4KVX A;  3DDD A;  2B3V A;  2H5M A;  1R57 A;  2FSR A;  1IID A;  1WK4 A;  4H89 A;  3FIX A;  4DNC A;  5J8C A;  4UFX A;  5JPH A;  1CM0 A;  3CXQ A;  3NE7 A;  4KVO E;  4PK2 A;  4RS2 A;  1Q2D A;  2OU2 A;  2ZW4 A;  2GIV A;  2VBQ A;  4Q38 A;  1MJB A;  3CXS A;  3N7Z A;  2D4O A;  3ZZI A;  4CGO A;  2G3A A;  3IWE A;  2P6G A;  2VQY A;  1N71 A;  4UWI A;  1S7N A;  4MFZ A;  2Z3P A;  1MJ9 A;  5C88 A;  2G0B A;  4PK3 A;  4CYP A;  3LD2 A;  4CYO A;  4MFP A;  1NMT A;  4MY0 A;  1I12 A;  2X7B A;  3BLN A;  2OZG A;  2Q4Y A;  3FB3 A;  3PGP A;  3R9E A;  2YND A;  3EY5 A;  3VWD A;  1S5K A;  5JQ4 A;  3IU2 A;  1M4I A;  2Z3N A;  2Z3K A;  4HKF A;  4RI1 A;  2J8R A;  4FD7 A;  1UFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...