3T9GA

The crystal structure of family 3 pectate lyase from caldicellulosiruptor bescii
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
196
structure length
196
Chain Sequence
b'VGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADKVFQLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase
publication title A 1.5 A resolution X-ray structure of the catalytic module of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii
molecule tags Lyase
total genus 79
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2011-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3t9gA00
1RU4A 4XOPA 4XQFA 4YZQA 3GQ7A 2NZMA 1IB4A 1HG8A 1OGOX 1O8IA 1DBGA 4XORA 2NTPA 3VMWA 3LMWA 2X3HA 4Z03A 2NTBA 3VSTA 1KCDA 4XR6A 4W8RA 2VBMA 4Z05A 2O04A 3VSVA 3B90A 4OJLA 4XLEA 3WWGA 4OZZA 2O1DA 4XN3A 1K5CA 2VJIA 3FY3A 2EWEA 2NT9A 1QJVA 1O8HA 1OFLA 4W8TA 1OOCA 2INUA 2Z8GA 4XLFA 3KRGA 4AVZA 1PLUA 1JRGA 2VBKA 4MR0A 2NT6A 3T9GA 3B8YA 4YELA 1JTAA 4OJ5A 1O8FA 4W8SA 4NK8A 4XLAA 1OGMX 4W8QA 4I84A 1AIRA 1O8LA 3SUCA 4YZXA 1O88A 4HWVA 3UW0A 1IA5A 2IQ7A 5AMVA 2QXZA 3VMVA 4OJOA 1CZFA 2NTQA 4MXNA 1VBLA 3JURA 4XLHA 4XKVA 4OJPA 1QCXA 1RWRA 1O8KA 4U4BA 2PYHA 4XKWA 4YZ0A 1EE6A 1PXZA 1PE9A 1GQ8A 4U49A 2O17A 4PMHA 2ODLA 1O8DA 1IDJA 4EW9A 2BSPA 4XLCA 4YZAA 3GQ8A 3GQ9A 4OJ6A 1KCCA 2O0VA 1NHCA 1DBOA 1O8EA 4XM3A 4OZYA 1OFMA 1O8GA 2X85A 2NSPA 5C1EA 2PECA 3GRHA 3B4NA 4URRA 1XG2A 2QY1A 4XL9A 3VSUA 2INVA 1WMRA 2UVEA 2X6YA 2NSTA 2X6XA 1O8JA 1BHEA 3EQNA 1BN8A 4XN0A 4Z06A 1O8MA 3ZPPA 4C2LA 3EQOA 1H80A 4XMYA 4XOTA 5C1CA 4XNFA 2UVFA 2X6WA 3ZSCA 4XONA 1IDKA 2O0WA 2VJJA 2VBEA 3GQAA 2QX3A 1RMGA 2PYGA 1KTWA 4NK6A 4YEJA 1X0CA
chains in the Genus database with same CATH superfamily
1RU4A 1HF2A 4XOPA 4YZQA 3GQ7A 2NZMA 4XQFA 1IB4A 4KH3A 1HG8A 1OGOX 2IOUG 1O8IA 1K4ZA 1EZGA 3LYCA 3N6ZA 1TYWA 5JLVC 1DBGA 4YC5A 4XORA 2NTPA 3RIQA 3VMWA 3LMWA 2X3HA 3NAWA 4Z03A 1CLWA 2NTBA 1QA2A 3VSTA 1KCDA 4YDTA 4XR6A 4W8RA 2VBMA 4Z05A 2O04A 2O6WA 3VSVA 1TYUA 3B90A 2VFOA 4OJLA 4XLEA 3WWGA 4OZZA 4YEIA 2O1DA 4XN3A 1K8FA 1K5CA 2VFNA 2VJIA 3FY3A 2J8IA 1OFDA 2BM7A 2EWEA 2NT9A 3NB2A 1QJVA 1O8HA 3SYJA 1OFLA 1LLZA 4W8TA 1OOCA 2INUA 2BM6A 1OFEA 2Z8GA 4XLFA 3KRGA 4AVZA 1PLUA 1QA3A 1JRGA 2VBKA 2BM4A 2G0YA 4MR0A 2NT6A 3T9GA 1LLWA 3B8YA 4OM9A 1JTAA 4YELA 4OJ5A 1O8FA 1EA0A 2F3LA 4W8SA 1DABA 4NK8A 4XLAA 1OGMX 4W8QA 4I84A 1AIRA 1O8LA 5DNSA 3SUCA 2W7ZA 4YZXA 1O88A 4HWVA 3UW0A 1IA5A 1KQ5A 2IQ7A 5AMVA 2XT4A 1LM1A 2QXZA 3VMVA 4OJOA 1CZFA 2NTQA 2XT2A 4MXNA 2QYUA 1VBLA 3JURA 4XLHA 4XKVA 4YCQA 4OJPA 1TYVA 2J8KA 2VFQA 1QCXA 3TH0A 1RWRA 1O8KA 4U4BA 4YFOA 2PYHA 4XKWA 2XTXA 4YZ0A 3N90A 1EE6A 1PXZA 3AK5A 1PE9A 1GQ8A 2B0RA 4JRAC 2O17A 4U49A 2BM5A 2V5IA 3H09A 4PMHA 2ODLA 1O8DA 3DU1X 1IDJA 3JX8A 4EW9A 2BX6A 3BH7B 3P4GA 3ML3A 2BSPA 4XLCA 3PETA 1TYXA 4YZAA 1QA1A 3GQ8A 3GQ9A 4OJ6A 1KCCA 2O0VA 1NHCA 1DBOA 1O8EA 1TSPA 4XM3A 2VFMA 4OZYA 2XTWA 1OFMA 1O8GA 2X85A 3PSZA 3SQVA 2NSPA 5C1EA 2PECA 5JMCB 3GRHA 3B4NA 3BH6B 4OPWA 4V02C 4URRA 1XG2A 1QRBA 2QY1A 4XL9A 3SZEA 3VSUA 1QQ1A 2INVA 1WMRA 2UVEA 2X6YA 2NSTA 2X6XA 2XTYA 1L1IA 1O8JA 1BHEA 2YUHA 3EQNA 1BN8A 2QZAA 4XN0A 3LJYA 4Z06A 1O8MA 3SY2A 3ZPPA 4C2LA 3EQOA 3PSSA 1H80A 4XMYA 4XOTA 5C1CA 4XNFA 2UVFA 1WXRA 2X6WA 2XC1A 3ZSCA 4XONA 1IDKA 2O0WA 2VFPA 2VBEA 2VJJA 3GQAA 2QX3A 1RMGA 2PYGA 1KTWA 4NK6A 4YEJA 1QRCA 1X0CA
chains in the Genus database with same CATH topology
1RU4A 4XOPA 4XQFA 4YZQA 3GQ7A 2NZMA 1IB4A 1HG8A 1OGOX 1O8IA 1DBGA 4XORA 2NTPA 3VMWA 3LMWA 2X3HA 4Z03A 2NTBA 3VSTA 1KCDA 4XR6A 4W8RA 2VBMA 4Z05A 2O04A 3VSVA 3B90A 4OJLA 4XLEA 3WWGA 4OZZA 2O1DA 4XN3A 1K5CA 2VJIA 3FY3A 2EWEA 2NT9A 1QJVA 1O8HA 1OFLA 4W8TA 1OOCA 2INUA 2Z8GA 4XLFA 3KRGA 4AVZA 1PLUA 1JRGA 2VBKA 4MR0A 2NT6A 3T9GA 3B8YA 4YELA 1JTAA 4OJ5A 1O8FA 4W8SA 4NK8A 4XLAA 1OGMX 4W8QA 4I84A 1AIRA 1O8LA 3SUCA 4YZXA 1O88A 4HWVA 3UW0A 1IA5A 2IQ7A 5AMVA 2QXZA 3VMVA 4OJOA 1CZFA 2NTQA 4MXNA 1VBLA 3JURA 4XLHA 4XKVA 4OJPA 1QCXA 1RWRA 1O8KA 4U4BA 2PYHA 4XKWA 4YZ0A 1EE6A 1PXZA 1PE9A 1GQ8A 4U49A 2O17A 4PMHA 2ODLA 1O8DA 1IDJA 4EW9A 2BSPA 4XLCA 4YZAA 3GQ8A 3GQ9A 4OJ6A 1KCCA 2O0VA 1NHCA 1DBOA 1O8EA 4XM3A 4OZYA 1OFMA 1O8GA 2X85A 2NSPA 5C1EA 2PECA 3GRHA 3B4NA 4URRA 1XG2A 2QY1A 4XL9A 3VSUA 2INVA 1WMRA 2UVEA 2X6YA 2NSTA 2X6XA 1O8JA 1BHEA 3EQNA 1BN8A 4XN0A 4Z06A 1O8MA 3ZPPA 4C2LA 3EQOA 1H80A 4XMYA 4XOTA 5C1CA 4XNFA 2UVFA 2X6WA 3ZSCA 4XONA 1IDKA 2O0WA 2VJJA 2VBEA 3GQAA 2QX3A 1RMGA 2PYGA 1KTWA 4NK6A 4YEJA 1X0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RU4 A;  4XOP A;  4XQF A;  4YZQ A;  3GQ7 A;  2NZM A;  1IB4 A;  1HG8 A;  1OGO X;  1O8I A;  1DBG A;  4XOR A;  2NTP A;  3VMW A;  3LMW A;  2X3H A;  4Z03 A;  2NTB A;  3VST A;  1KCD A;  4XR6 A;  4W8R A;  2VBM A;  4Z05 A;  2O04 A;  3VSV A;  3B90 A;  4OJL A;  4XLE A;  3WWG A;  4OZZ A;  2O1D A;  4XN3 A;  1K5C A;  2VJI A;  3FY3 A;  2EWE A;  2NT9 A;  1QJV A;  1O8H A;  1OFL A;  4W8T A;  1OOC A;  2INU A;  2Z8G A;  4XLF A;  3KRG A;  4AVZ A;  1PLU A;  1JRG A;  2VBK A;  4MR0 A;  2NT6 A;  3T9G A;  3B8Y A;  4YEL A;  1JTA A;  4OJ5 A;  1O8F A;  4W8S A;  4NK8 A;  4XLA A;  1OGM X;  4W8Q A;  4I84 A;  1AIR A;  1O8L A;  3SUC A;  4YZX A;  1O88 A;  4HWV A;  3UW0 A;  1IA5 A;  2IQ7 A;  5AMV A;  2QXZ A;  3VMV A;  4OJO A;  1CZF A;  2NTQ A;  4MXN A;  1VBL A;  3JUR A;  4XLH A;  4XKV A;  4OJP A;  1QCX A;  1RWR A;  1O8K A;  4U4B A;  2PYH A;  4XKW A;  4YZ0 A;  1EE6 A;  1PXZ A;  1PE9 A;  1GQ8 A;  4U49 A;  2O17 A;  4PMH A;  2ODL A;  1O8D A;  1IDJ A;  4EW9 A;  2BSP A;  4XLC A;  4YZA A;  3GQ8 A;  3GQ9 A;  4OJ6 A;  1KCC A;  2O0V A;  1NHC A;  1DBO A;  1O8E A;  4XM3 A;  4OZY A;  1OFM A;  1O8G A;  2X85 A;  2NSP A;  5C1E A;  2PEC A;  3GRH A;  3B4N A;  4URR A;  1XG2 A;  2QY1 A;  4XL9 A;  3VSU A;  2INV A;  1WMR A;  2UVE A;  2X6Y A;  2NST A;  2X6X A;  1O8J A;  1BHE A;  3EQN A;  1BN8 A;  4XN0 A;  4Z06 A;  1O8M A;  3ZPP A;  4C2L A;  3EQO A;  1H80 A;  4XMY A;  4XOT A;  5C1C A;  4XNF A;  2UVF A;  2X6W A;  3ZSC A;  4XON A;  1IDK A;  2O0W A;  2VJJ A;  2VBE A;  3GQA A;  2QX3 A;  1RMG A;  2PYG A;  1KTW A;  4NK6 A;  4YEJ A;  1X0C A; 
#chains in the Genus database with same CATH topology
 1RU4 A;  1HF2 A;  4XOP A;  4YZQ A;  3GQ7 A;  2NZM A;  4XQF A;  1IB4 A;  4KH3 A;  1HG8 A;  1OGO X;  2IOU G;  1O8I A;  1K4Z A;  1EZG A;  3LYC A;  3N6Z A;  1TYW A;  5JLV C;  1DBG A;  4YC5 A;  4XOR A;  2NTP A;  3RIQ A;  3VMW A;  3LMW A;  2X3H A;  3NAW A;  4Z03 A;  1CLW A;  2NTB A;  1QA2 A;  3VST A;  1KCD A;  4YDT A;  4XR6 A;  4W8R A;  2VBM A;  4Z05 A;  2O04 A;  2O6W A;  3VSV A;  1TYU A;  3B90 A;  2VFO A;  4OJL A;  4XLE A;  3WWG A;  4OZZ A;  4YEI A;  2O1D A;  4XN3 A;  1K8F A;  1K5C A;  2VFN A;  2VJI A;  3FY3 A;  2J8I A;  1OFD A;  2BM7 A;  2EWE A;  2NT9 A;  3NB2 A;  1QJV A;  1O8H A;  3SYJ A;  1OFL A;  1LLZ A;  4W8T A;  1OOC A;  2INU A;  2BM6 A;  1OFE A;  2Z8G A;  4XLF A;  3KRG A;  4AVZ A;  1PLU A;  1QA3 A;  1JRG A;  2VBK A;  2BM4 A;  2G0Y A;  4MR0 A;  2NT6 A;  3T9G A;  1LLW A;  3B8Y A;  4OM9 A;  1JTA A;  4YEL A;  4OJ5 A;  1O8F A;  1EA0 A;  2F3L A;  4W8S A;  1DAB A;  4NK8 A;  4XLA A;  1OGM X;  4W8Q A;  4I84 A;  1AIR A;  1O8L A;  5DNS A;  3SUC A;  2W7Z A;  4YZX A;  1O88 A;  4HWV A;  3UW0 A;  1IA5 A;  1KQ5 A;  2IQ7 A;  5AMV A;  2XT4 A;  1LM1 A;  2QXZ A;  3VMV A;  4OJO A;  1CZF A;  2NTQ A;  2XT2 A;  4MXN A;  2QYU A;  1VBL A;  3JUR A;  4XLH A;  4XKV A;  4YCQ A;  4OJP A;  1TYV A;  2J8K A;  2VFQ A;  1QCX A;  3TH0 A;  1RWR A;  1O8K A;  4U4B A;  4YFO A;  2PYH A;  4XKW A;  2XTX A;  4YZ0 A;  3N90 A;  1EE6 A;  1PXZ A;  3AK5 A;  1PE9 A;  1GQ8 A;  2B0R A;  4JRA C;  2O17 A;  4U49 A;  2BM5 A;  2V5I A;  3H09 A;  4PMH A;  2ODL A;  1O8D A;  3DU1 X;  1IDJ A;  3JX8 A;  4EW9 A;  2BX6 A;  3BH7 B;  3P4G A;  3ML3 A;  2BSP A;  4XLC A;  3PET A;  1TYX A;  4YZA A;  1QA1 A;  3GQ8 A;  3GQ9 A;  4OJ6 A;  1KCC A;  2O0V A;  1NHC A;  1DBO A;  1O8E A;  1TSP A;  4XM3 A;  2VFM A;  4OZY A;  2XTW A;  1OFM A;  1O8G A;  2X85 A;  3PSZ A;  3SQV A;  2NSP A;  5C1E A;  2PEC A;  5JMC B;  3GRH A;  3B4N A;  3BH6 B;  4OPW A;  4V02 C;  4URR A;  1XG2 A;  1QRB A;  2QY1 A;  4XL9 A;  3SZE A;  3VSU A;  1QQ1 A;  2INV A;  1WMR A;  2UVE A;  2X6Y A;  2NST A;  2X6X A;  2XTY A;  1L1I A;  1O8J A;  1BHE A;  2YUH A;  3EQN A;  1BN8 A;  2QZA A;  4XN0 A;  3LJY A;  4Z06 A;  1O8M A;  3SY2 A;  3ZPP A;  4C2L A;  3EQO A;  3PSS A;  1H80 A;  4XMY A;  4XOT A;  5C1C A;  4XNF A;  2UVF A;  1WXR A;  2X6W A;  2XC1 A;  3ZSC A;  4XON A;  1IDK A;  2O0W A;  2VFP A;  2VBE A;  2VJJ A;  3GQA A;  2QX3 A;  1RMG A;  2PYG A;  1KTW A;  4NK6 A;  4YEJ A;  1QRC A;  1X0C A; 
#chains in the Genus database with same CATH homology
 1RU4 A;  4XOP A;  4XQF A;  4YZQ A;  3GQ7 A;  2NZM A;  1IB4 A;  1HG8 A;  1OGO X;  1O8I A;  1DBG A;  4XOR A;  2NTP A;  3VMW A;  3LMW A;  2X3H A;  4Z03 A;  2NTB A;  3VST A;  1KCD A;  4XR6 A;  4W8R A;  2VBM A;  4Z05 A;  2O04 A;  3VSV A;  3B90 A;  4OJL A;  4XLE A;  3WWG A;  4OZZ A;  2O1D A;  4XN3 A;  1K5C A;  2VJI A;  3FY3 A;  2EWE A;  2NT9 A;  1QJV A;  1O8H A;  1OFL A;  4W8T A;  1OOC A;  2INU A;  2Z8G A;  4XLF A;  3KRG A;  4AVZ A;  1PLU A;  1JRG A;  2VBK A;  4MR0 A;  2NT6 A;  3T9G A;  3B8Y A;  4YEL A;  1JTA A;  4OJ5 A;  1O8F A;  4W8S A;  4NK8 A;  4XLA A;  1OGM X;  4W8Q A;  4I84 A;  1AIR A;  1O8L A;  3SUC A;  4YZX A;  1O88 A;  4HWV A;  3UW0 A;  1IA5 A;  2IQ7 A;  5AMV A;  2QXZ A;  3VMV A;  4OJO A;  1CZF A;  2NTQ A;  4MXN A;  1VBL A;  3JUR A;  4XLH A;  4XKV A;  4OJP A;  1QCX A;  1RWR A;  1O8K A;  4U4B A;  2PYH A;  4XKW A;  4YZ0 A;  1EE6 A;  1PXZ A;  1PE9 A;  1GQ8 A;  4U49 A;  2O17 A;  4PMH A;  2ODL A;  1O8D A;  1IDJ A;  4EW9 A;  2BSP A;  4XLC A;  4YZA A;  3GQ8 A;  3GQ9 A;  4OJ6 A;  1KCC A;  2O0V A;  1NHC A;  1DBO A;  1O8E A;  4XM3 A;  4OZY A;  1OFM A;  1O8G A;  2X85 A;  2NSP A;  5C1E A;  2PEC A;  3GRH A;  3B4N A;  4URR A;  1XG2 A;  2QY1 A;  4XL9 A;  3VSU A;  2INV A;  1WMR A;  2UVE A;  2X6Y A;  2NST A;  2X6X A;  1O8J A;  1BHE A;  3EQN A;  1BN8 A;  4XN0 A;  4Z06 A;  1O8M A;  3ZPP A;  4C2L A;  3EQO A;  1H80 A;  4XMY A;  4XOT A;  5C1C A;  4XNF A;  2UVF A;  2X6W A;  3ZSC A;  4XON A;  1IDK A;  2O0W A;  2VJJ A;  2VBE A;  3GQA A;  2QX3 A;  1RMG A;  2PYG A;  1KTW A;  4NK6 A;  4YEJ A;  1X0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...