3T9GA

The crystal structure of family 3 pectate lyase from caldicellulosiruptor bescii
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
196
structure length
196
Chain Sequence
VGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADKVFQLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A 1.5 A resolution X-ray structure of the catalytic module of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii
molecule tags Lyase
molecule keywords Pectate lyase
total genus 79
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2011-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3t9gA00
2X85A 2O04A 2BSPA 4XLFA 2UVFA 2X6YA 2VJIA 3B8YA 3EQNA 4W8TA 4OZZA 1O8EA 1PXZA 1RWRA 2QX3A 4U49A 1NHCA 1HG8A 2EWEA 1X0CA 4XR6A 4XL9A 4XLAA 3GRHA 2QXZA 4XLEA 1OOCA 1O8HA 1IDKA 1WMRA 1RU4A 2O0VA 3B4NA 4YZ0A 3EQOA 5C1EA 1O8GA 1IDJA 1KCDA 2INVA 4NK8A 2PECA 2O1DA 1RMGA 2UVEA 4YZXA 4AVZA 2NSPA 3GQ9A 4YZQA 2QY1A 4Z05A 1PE9A 2PYGA 5C1CA 1DBGA 4MR0A 3GQAA 2NT6A 4PMHA 4I84A 2NTQA 4U4BA 2PYHA 2VBKA 3T9GA 1O8FA 1VBLA 4OJ6A 4YZAA 2X6XA 3WWGA 2NTPA 2VJJA 3GQ8A 4Z06A 3VSUA 4XMYA 2O0WA 1O8DA 2NTBA 4XM3A 4XQFA 4C2LA 3VSVA 1DBOA 1H80A 4XOPA 1OFLA 1AIRA 1XG2A 4OJPA 1PLUA 1OFMA 4W8SA 3ZPPA 4NK6A 4XOTA 4OJLA 3ZSCA 1BHEA 3JURA 4XNFA 1KTWA 1O8KA 2VBEA 1IB4A 1QCXA 2ODLA 1IA5A 4OJ5A 4W8RA 1OGOX 4XONA 4XKWA 4YELA 1O8MA 4EW9A 1QJVA 1BN8A 2O17A 4OZYA 3GQ7A 2NT9A 1O8IA 2X6WA 2NZMA 1JRGA 4XKVA 4XLCA 2INUA 4OJOA 1O88A 4MXNA 2X3HA 3FY3A 4W8QA 4XN0A 1KCCA 4URRA 2Z8GA 2IQ7A 3UW0A 4XLHA 4YEJA 3VMWA 3SUCA 2NSTA 4HWVA 3LMWA 1OGMX 3KRGA 1JTAA 4XORA 3B90A 4Z03A 1O8LA 4XN3A 1K5CA 1EE6A 1GQ8A 2VBMA 5AMVA 3VMVA 3VSTA 1CZFA 1O8JA
chains in the Genus database with same CATH superfamily
1K8FA 3N90A 2X85A 2O04A 2BSPA 4XLFA 1LLZA 2UVFA 2X6YA 1WXRA 2VJIA 3B8YA 3EQNA 2QZAA 4W8TA 2W7ZA 1O8EA 4OZZA 1PXZA 1RWRA 2QX3A 4U49A 1NHCA 2XT4A 1CLWA 4YFOA 1HG8A 2EWEA 2J8KA 1TSPA 4OM9A 3N6ZA 1X0CA 3NB2A 4XR6A 4XL9A 1QRBA 2B0RA 4XLAA 3GRHA 1TYUA 3TH0A 2QXZA 3SQVA 4XLEA 1OFDA 1OOCA 4JRAC 1O8HA 1IDKA 1WMRA 1RU4A 2O0VA 2VFNA 2XC1A 3B4NA 4YZ0A 3EQOA 5C1EA 1O8GA 1IDJA 2BM5A 1KCDA 2INVA 4NK8A 3PSZA 2PECA 2O1DA 4V02C 1RMGA 2UVEA 4YZXA 4AVZA 1QA2A 4YDTA 2NSPA 2VFMA 3GQ9A 4YZQA 2QY1A 4Z05A 1EZGA 1PE9A 2PYGA 1DBGA 5C1CA 4MR0A 2QYUA 5JLVC 2VFPA 3GQAA 2NT6A 1L1IA 3SZEA 4PMHA 4I84A 2NTQA 4U4BA 2PYHA 4YCQA 2VBKA 3T9GA 1O8FA 1VBLA 4OJ6A 4YZAA 2X6XA 3WWGA 1KQ5A 2NTPA 2VJJA 2YUHA 3GQ8A 4Z06A 3VSUA 4YEIA 3P4GA 4XMYA 2O0WA 2BM4A 2XTWA 4OPWA 1O8DA 2NTBA 4XM3A 4XQFA 4C2LA 3BH7B 3VSVA 1DBOA 1H80A 4KH3A 4XOPA 1K4ZA 1OFLA 2VFQA 2XT2A 1AIRA 1XG2A 3H09A 4OJPA 1PLUA 1HF2A 1OFMA 4W8SA 4NK6A 4XOTA 3ZPPA 1OFEA 4YC5A 4OJLA 3ZSCA 1BHEA 3DU1X 3JURA 4XNFA 1KTWA 1QA3A 1LLWA 1O8KA 2VBEA 1TYVA 1IB4A 1QCXA 2J8IA 2BM7A 2G0YA 2ODLA 1IA5A 3LYCA 4OJ5A 1OGOX 4W8RA 4XKWA 4XONA 5JMCB 3AK5A 4YELA 1O8MA 2XTYA 5DNSA 3SYJA 4EW9A 3NAWA 1QJVA 3SY2A 3JX8A 1EA0A 1BN8A 2O17A 4OZYA 3VSTA 1QA1A 3ML3A 2VFOA 3GQ7A 2BM6A 1QRCA 2NT9A 2XTXA 1O8IA 2X6WA 2NZMA 1JRGA 4XKVA 4XLCA 2INUA 4OJOA 1O88A 4MXNA 3PSSA 1DABA 2X3HA 3FY3A 4W8QA 4XN0A 1KCCA 4URRA 2Z8GA 1TYXA 3BH6B 2IQ7A 3UW0A 1QQ1A 4XLHA 4YEJA 3VMWA 3PETA 1LM1A 2NSTA 2O6WA 3SUCA 4HWVA 3LMWA 2V5IA 1OGMX 2F3LA 3KRGA 3RIQA 1JTAA 4XORA 3B90A 4Z03A 1O8LA 4XN3A 1K5CA 1EE6A 1GQ8A 2IOUG 2BX6A 2VBMA 3LJYA 5AMVA 3VMVA 1TYWA 1CZFA 1O8JA
chains in the Genus database with same CATH topology
2X85A 2O04A 2BSPA 4XLFA 2UVFA 2X6YA 2VJIA 3B8YA 3EQNA 4W8TA 4OZZA 1O8EA 1PXZA 1RWRA 2QX3A 4U49A 1NHCA 1HG8A 2EWEA 1X0CA 4XR6A 4XL9A 4XLAA 3GRHA 2QXZA 4XLEA 1OOCA 1O8HA 1IDKA 1WMRA 1RU4A 2O0VA 3B4NA 4YZ0A 3EQOA 5C1EA 1O8GA 1IDJA 1KCDA 2INVA 4NK8A 2PECA 2O1DA 1RMGA 2UVEA 4YZXA 4AVZA 2NSPA 3GQ9A 4YZQA 2QY1A 4Z05A 1PE9A 2PYGA 5C1CA 1DBGA 4MR0A 3GQAA 2NT6A 4PMHA 4I84A 2NTQA 4U4BA 2PYHA 2VBKA 3T9GA 1O8FA 1VBLA 4OJ6A 4YZAA 2X6XA 3WWGA 2NTPA 2VJJA 3GQ8A 4Z06A 3VSUA 4XMYA 2O0WA 1O8DA 2NTBA 4XM3A 4XQFA 4C2LA 3VSVA 1DBOA 1H80A 4XOPA 1OFLA 1AIRA 1XG2A 4OJPA 1PLUA 1OFMA 4W8SA 3ZPPA 4NK6A 4XOTA 4OJLA 3ZSCA 1BHEA 3JURA 4XNFA 1KTWA 1O8KA 2VBEA 1IB4A 1QCXA 2ODLA 1IA5A 4OJ5A 4W8RA 1OGOX 4XONA 4XKWA 4YELA 1O8MA 4EW9A 1QJVA 1BN8A 2O17A 4OZYA 3GQ7A 2NT9A 1O8IA 2X6WA 2NZMA 1JRGA 4XKVA 4XLCA 2INUA 4OJOA 1O88A 4MXNA 2X3HA 3FY3A 4W8QA 4XN0A 1KCCA 4URRA 2Z8GA 2IQ7A 3UW0A 4XLHA 4YEJA 3VMWA 3SUCA 2NSTA 4HWVA 3LMWA 1OGMX 3KRGA 1JTAA 4XORA 3B90A 4Z03A 1O8LA 4XN3A 1K5CA 1EE6A 1GQ8A 2VBMA 5AMVA 3VMVA 3VSTA 1CZFA 1O8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X85 A;  2O04 A;  2BSP A;  4XLF A;  2UVF A;  2X6Y A;  2VJI A;  3B8Y A;  3EQN A;  4W8T A;  4OZZ A;  1O8E A;  1PXZ A;  1RWR A;  2QX3 A;  4U49 A;  1NHC A;  1HG8 A;  2EWE A;  1X0C A;  4XR6 A;  4XL9 A;  4XLA A;  3GRH A;  2QXZ A;  4XLE A;  1OOC A;  1O8H A;  1IDK A;  1WMR A;  1RU4 A;  2O0V A;  3B4N A;  4YZ0 A;  3EQO A;  5C1E A;  1O8G A;  1IDJ A;  1KCD A;  2INV A;  4NK8 A;  2PEC A;  2O1D A;  1RMG A;  2UVE A;  4YZX A;  4AVZ A;  2NSP A;  3GQ9 A;  4YZQ A;  2QY1 A;  4Z05 A;  1PE9 A;  2PYG A;  5C1C A;  1DBG A;  4MR0 A;  3GQA A;  2NT6 A;  4PMH A;  4I84 A;  2NTQ A;  4U4B A;  2PYH A;  2VBK A;  3T9G A;  1O8F A;  1VBL A;  4OJ6 A;  4YZA A;  2X6X A;  3WWG A;  2NTP A;  2VJJ A;  3GQ8 A;  4Z06 A;  3VSU A;  4XMY A;  2O0W A;  1O8D A;  2NTB A;  4XM3 A;  4XQF A;  4C2L A;  3VSV A;  1DBO A;  1H80 A;  4XOP A;  1OFL A;  1AIR A;  1XG2 A;  4OJP A;  1PLU A;  1OFM A;  4W8S A;  3ZPP A;  4NK6 A;  4XOT A;  4OJL A;  3ZSC A;  1BHE A;  3JUR A;  4XNF A;  1KTW A;  1O8K A;  2VBE A;  1IB4 A;  1QCX A;  2ODL A;  1IA5 A;  4OJ5 A;  4W8R A;  1OGO X;  4XON A;  4XKW A;  4YEL A;  1O8M A;  4EW9 A;  1QJV A;  1BN8 A;  2O17 A;  4OZY A;  3GQ7 A;  2NT9 A;  1O8I A;  2X6W A;  2NZM A;  1JRG A;  4XKV A;  4XLC A;  2INU A;  4OJO A;  1O88 A;  4MXN A;  2X3H A;  3FY3 A;  4W8Q A;  4XN0 A;  1KCC A;  4URR A;  2Z8G A;  2IQ7 A;  3UW0 A;  4XLH A;  4YEJ A;  3VMW A;  3SUC A;  2NST A;  4HWV A;  3LMW A;  1OGM X;  3KRG A;  1JTA A;  4XOR A;  3B90 A;  4Z03 A;  1O8L A;  4XN3 A;  1K5C A;  1EE6 A;  1GQ8 A;  2VBM A;  5AMV A;  3VMV A;  3VST A;  1CZF A;  1O8J A; 
#chains in the Genus database with same CATH topology
 1K8F A;  3N90 A;  2X85 A;  2O04 A;  2BSP A;  4XLF A;  1LLZ A;  2UVF A;  2X6Y A;  1WXR A;  2VJI A;  3B8Y A;  3EQN A;  2QZA A;  4W8T A;  2W7Z A;  1O8E A;  4OZZ A;  1PXZ A;  1RWR A;  2QX3 A;  4U49 A;  1NHC A;  2XT4 A;  1CLW A;  4YFO A;  1HG8 A;  2EWE A;  2J8K A;  1TSP A;  4OM9 A;  3N6Z A;  1X0C A;  3NB2 A;  4XR6 A;  4XL9 A;  1QRB A;  2B0R A;  4XLA A;  3GRH A;  1TYU A;  3TH0 A;  2QXZ A;  3SQV A;  4XLE A;  1OFD A;  1OOC A;  4JRA C;  1O8H A;  1IDK A;  1WMR A;  1RU4 A;  2O0V A;  2VFN A;  2XC1 A;  3B4N A;  4YZ0 A;  3EQO A;  5C1E A;  1O8G A;  1IDJ A;  2BM5 A;  1KCD A;  2INV A;  4NK8 A;  3PSZ A;  2PEC A;  2O1D A;  4V02 C;  1RMG A;  2UVE A;  4YZX A;  4AVZ A;  1QA2 A;  4YDT A;  2NSP A;  2VFM A;  3GQ9 A;  4YZQ A;  2QY1 A;  4Z05 A;  1EZG A;  1PE9 A;  2PYG A;  1DBG A;  5C1C A;  4MR0 A;  2QYU A;  5JLV C;  2VFP A;  3GQA A;  2NT6 A;  1L1I A;  3SZE A;  4PMH A;  4I84 A;  2NTQ A;  4U4B A;  2PYH A;  4YCQ A;  2VBK A;  3T9G A;  1O8F A;  1VBL A;  4OJ6 A;  4YZA A;  2X6X A;  3WWG A;  1KQ5 A;  2NTP A;  2VJJ A;  2YUH A;  3GQ8 A;  4Z06 A;  3VSU A;  4YEI A;  3P4G A;  4XMY A;  2O0W A;  2BM4 A;  2XTW A;  4OPW A;  1O8D A;  2NTB A;  4XM3 A;  4XQF A;  4C2L A;  3BH7 B;  3VSV A;  1DBO A;  1H80 A;  4KH3 A;  4XOP A;  1K4Z A;  1OFL A;  2VFQ A;  2XT2 A;  1AIR A;  1XG2 A;  3H09 A;  4OJP A;  1PLU A;  1HF2 A;  1OFM A;  4W8S A;  4NK6 A;  4XOT A;  3ZPP A;  1OFE A;  4YC5 A;  4OJL A;  3ZSC A;  1BHE A;  3DU1 X;  3JUR A;  4XNF A;  1KTW A;  1QA3 A;  1LLW A;  1O8K A;  2VBE A;  1TYV A;  1IB4 A;  1QCX A;  2J8I A;  2BM7 A;  2G0Y A;  2ODL A;  1IA5 A;  3LYC A;  4OJ5 A;  1OGO X;  4W8R A;  4XKW A;  4XON A;  5JMC B;  3AK5 A;  4YEL A;  1O8M A;  2XTY A;  5DNS A;  3SYJ A;  4EW9 A;  3NAW A;  1QJV A;  3SY2 A;  3JX8 A;  1EA0 A;  1BN8 A;  2O17 A;  4OZY A;  3VST A;  1QA1 A;  3ML3 A;  2VFO A;  3GQ7 A;  2BM6 A;  1QRC A;  2NT9 A;  2XTX A;  1O8I A;  2X6W A;  2NZM A;  1JRG A;  4XKV A;  4XLC A;  2INU A;  4OJO A;  1O88 A;  4MXN A;  3PSS A;  1DAB A;  2X3H A;  3FY3 A;  4W8Q A;  4XN0 A;  1KCC A;  4URR A;  2Z8G A;  1TYX A;  3BH6 B;  2IQ7 A;  3UW0 A;  1QQ1 A;  4XLH A;  4YEJ A;  3VMW A;  3PET A;  1LM1 A;  2NST A;  2O6W A;  3SUC A;  4HWV A;  3LMW A;  2V5I A;  1OGM X;  2F3L A;  3KRG A;  3RIQ A;  1JTA A;  4XOR A;  3B90 A;  4Z03 A;  1O8L A;  4XN3 A;  1K5C A;  1EE6 A;  1GQ8 A;  2IOU G;  2BX6 A;  2VBM A;  3LJY A;  5AMV A;  3VMV A;  1TYW A;  1CZF A;  1O8J A; 
#chains in the Genus database with same CATH homology
 2X85 A;  2O04 A;  2BSP A;  4XLF A;  2UVF A;  2X6Y A;  2VJI A;  3B8Y A;  3EQN A;  4W8T A;  4OZZ A;  1O8E A;  1PXZ A;  1RWR A;  2QX3 A;  4U49 A;  1NHC A;  1HG8 A;  2EWE A;  1X0C A;  4XR6 A;  4XL9 A;  4XLA A;  3GRH A;  2QXZ A;  4XLE A;  1OOC A;  1O8H A;  1IDK A;  1WMR A;  1RU4 A;  2O0V A;  3B4N A;  4YZ0 A;  3EQO A;  5C1E A;  1O8G A;  1IDJ A;  1KCD A;  2INV A;  4NK8 A;  2PEC A;  2O1D A;  1RMG A;  2UVE A;  4YZX A;  4AVZ A;  2NSP A;  3GQ9 A;  4YZQ A;  2QY1 A;  4Z05 A;  1PE9 A;  2PYG A;  5C1C A;  1DBG A;  4MR0 A;  3GQA A;  2NT6 A;  4PMH A;  4I84 A;  2NTQ A;  4U4B A;  2PYH A;  2VBK A;  3T9G A;  1O8F A;  1VBL A;  4OJ6 A;  4YZA A;  2X6X A;  3WWG A;  2NTP A;  2VJJ A;  3GQ8 A;  4Z06 A;  3VSU A;  4XMY A;  2O0W A;  1O8D A;  2NTB A;  4XM3 A;  4XQF A;  4C2L A;  3VSV A;  1DBO A;  1H80 A;  4XOP A;  1OFL A;  1AIR A;  1XG2 A;  4OJP A;  1PLU A;  1OFM A;  4W8S A;  3ZPP A;  4NK6 A;  4XOT A;  4OJL A;  3ZSC A;  1BHE A;  3JUR A;  4XNF A;  1KTW A;  1O8K A;  2VBE A;  1IB4 A;  1QCX A;  2ODL A;  1IA5 A;  4OJ5 A;  4W8R A;  1OGO X;  4XON A;  4XKW A;  4YEL A;  1O8M A;  4EW9 A;  1QJV A;  1BN8 A;  2O17 A;  4OZY A;  3GQ7 A;  2NT9 A;  1O8I A;  2X6W A;  2NZM A;  1JRG A;  4XKV A;  4XLC A;  2INU A;  4OJO A;  1O88 A;  4MXN A;  2X3H A;  3FY3 A;  4W8Q A;  4XN0 A;  1KCC A;  4URR A;  2Z8G A;  2IQ7 A;  3UW0 A;  4XLH A;  4YEJ A;  3VMW A;  3SUC A;  2NST A;  4HWV A;  3LMW A;  1OGM X;  3KRG A;  1JTA A;  4XOR A;  3B90 A;  4Z03 A;  1O8L A;  4XN3 A;  1K5C A;  1EE6 A;  1GQ8 A;  2VBM A;  5AMV A;  3VMV A;  3VST A;  1CZF A;  1O8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...