3T9GA

The crystal structure of family 3 pectate lyase from caldicellulosiruptor bescii
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
196
structure length
196
Chain Sequence
VGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADKVFQLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase
publication title A 1.5 A resolution X-ray structure of the catalytic module of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii
molecule tags Lyase
total genus 79
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2011-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3t9gA00
4XLAA 2QY1A 1X0CA 4OJ6A 3GQ9A 1EE6A 2IQ7A 2NTBA 3FY3A 4OJPA 4PMHA 1PLUA 3GQ7A 3VSUA 1RU4A 1KCCA 1AIRA 1KCDA 3T9GA 4U4BA 2NSPA 3GQAA 4HWVA 2VBEA 2X6YA 4OJOA 4NK6A 4XLHA 2ODLA 1JRGA 1IA5A 3GRHA 3LMWA 1NHCA 3WWGA 2INVA 4YZAA 2NTPA 1K5CA 1O8JA 2INUA 2NT6A 1O8IA 2PYHA 3JURA 4W8RA 4YELA 1OFLA 4Z03A 3SUCA 4URRA 2VBMA 2QXZA 1O8HA 4XN0A 2O1DA 1OOCA 3EQOA 4XMYA 4XLCA 2VJJA 2NZMA 1KTWA 1O8EA 4W8SA 2QX3A 2NT9A 3B4NA 4MXNA 4YEJA 4YZ0A 4NK8A 3B8YA 1HG8A 2PECA 4OZYA 1GQ8A 2NSTA 1IDKA 1QCXA 2VBKA 4XM3A 4U49A 1PE9A 1O8GA 1WMRA 4OJ5A 3VMWA 1IB4A 3EQNA 4XKVA 3UW0A 4XL9A 5C1CA 2X6XA 3B90A 4Z05A 2UVEA 1O8FA 1OGMX 4XQFA 2O0VA 1O8KA 2EWEA 4XLEA 1DBGA 4XNFA 2NTQA 4EW9A 3ZPPA 1RMGA 1OGOX 4XR6A 2X85A 2UVFA 4OZZA 2X3HA 1RWRA 4MR0A 4W8QA 3VSVA 4C2LA 4Z06A 1QJVA 3ZSCA 1XG2A 3VSTA 4YZXA 4AVZA 4OJLA 2O0WA 4XKWA 3GQ8A 3VMVA 2O17A 1H80A 4XONA 1BHEA 2Z8GA 1JTAA 1VBLA 5C1EA 1PXZA 4XOPA 2BSPA 1O8MA 4XOTA 4W8TA 1IDJA 4XLFA 4XN3A 2PYGA 1BN8A 1O8DA 1O88A 3KRGA 4XORA 1CZFA 1O8LA 2VJIA 4I84A 2O04A 1DBOA 5AMVA 2X6WA 1OFMA 4YZQA
chains in the Genus database with same CATH superfamily
4XLAA 2QY1A 1X0CA 4OJ6A 3GQ9A 4YC5A 1WXRA 2B0RA 1EE6A 2IQ7A 2NTBA 3FY3A 2XC1A 4YCQA 2J8KA 4OJPA 4YDTA 4PMHA 1PLUA 3GQ7A 3VSUA 1EZGA 1RU4A 2W7ZA 1AIRA 2BM7A 3PETA 1KCCA 1KCDA 3T9GA 4U4BA 2NSPA 3GQAA 3SQVA 4HWVA 2VBEA 2X6YA 4OJOA 4NK6A 4XLHA 2ODLA 1JRGA 1IA5A 3GRHA 3LMWA 1NHCA 3TH0A 1HF2A 2V5IA 3WWGA 2BX6A 2BM4A 2INVA 3N90A 2NTPA 4YZAA 1K8FA 1K5CA 3PSSA 4YEIA 1O8JA 2INUA 2VFQA 2YUHA 1LM1A 2NT6A 5JLVC 1O8IA 2PYHA 1K4ZA 3JURA 4W8RA 1TYVA 1L1IA 4YELA 1OFLA 4Z03A 3SUCA 4URRA 2VBMA 2QXZA 1O8HA 3N6ZA 2XT4A 2VFMA 3LYCA 4XN0A 3NB2A 3SZEA 2VFNA 3RIQA 2O1DA 2VFOA 1OOCA 3EQOA 4XMYA 4XLCA 2XTXA 2QYUA 2VJJA 2NZMA 1QRBA 1KTWA 1O8EA 2BM6A 4W8SA 2QX3A 2NT9A 3B4NA 4MXNA 4YEJA 4YZ0A 1QRCA 4NK8A 3B8YA 1QA2A 1HG8A 2PECA 4OM9A 1CLWA 3SYJA 4OZYA 1GQ8A 3BH7B 1TYXA 2NSTA 1IDKA 2BM5A 1QCXA 2VBKA 1QQ1A 4XM3A 4U49A 1OFEA 1PE9A 1O8GA 1WMRA 4OJ5A 3VMWA 1IB4A 3EQNA 4XKVA 3UW0A 4XL9A 5C1CA 2X6XA 3B90A 1EA0A 4Z05A 2XTYA 2UVEA 1O8FA 3DU1X 1OGMX 4XQFA 2O0VA 1O8KA 2EWEA 4XLEA 1DBGA 4XNFA 2NTQA 3H09A 1OFMA 3P4GA 4EW9A 3ZPPA 2QZAA 1RMGA 1OGOX 4XR6A 2X85A 2UVFA 3JX8A 4OZZA 1DABA 1TYUA 2X3HA 3AK5A 1KQ5A 1RWRA 2IOUG 4MR0A 1QA3A 4W8QA 3VSVA 4C2LA 4Z06A 2XTWA 4JRAC 1QJVA 3NAWA 5DNSA 3ZSCA 1TYWA 1XG2A 3VSTA 4YZXA 4AVZA 4OJLA 2O0WA 3PSZA 4XKWA 1TSPA 3GQ8A 4OPWA 3VMVA 2O17A 4YFOA 1H80A 4XONA 1QA1A 1BHEA 2Z8GA 5JMCB 4V02C 1JTAA 2XT2A 1VBLA 5C1EA 1PXZA 4XOPA 2BSPA 1O8MA 1LLWA 2VFPA 4XOTA 4W8TA 1IDJA 4XLFA 4YZQA 3SY2A 4XN3A 2PYGA 1BN8A 1O8DA 1O88A 3KRGA 4XORA 4KH3A 1CZFA 1O8LA 2O6WA 1LLZA 2VJIA 4I84A 2O04A 1DBOA 3LJYA 1OFDA 3BH6B 2J8IA 5AMVA 2X6WA 2G0YA 2F3LA 3ML3A
chains in the Genus database with same CATH topology
4XLAA 2QY1A 1X0CA 4OJ6A 3GQ9A 1EE6A 2IQ7A 2NTBA 3FY3A 4OJPA 4PMHA 1PLUA 3GQ7A 3VSUA 1RU4A 1KCCA 1AIRA 1KCDA 3T9GA 4U4BA 2NSPA 3GQAA 4HWVA 2VBEA 2X6YA 4OJOA 4NK6A 4XLHA 2ODLA 1JRGA 1IA5A 3GRHA 3LMWA 1NHCA 3WWGA 2INVA 4YZAA 2NTPA 1K5CA 1O8JA 2INUA 2NT6A 1O8IA 2PYHA 3JURA 4W8RA 4YELA 1OFLA 4Z03A 3SUCA 4URRA 2VBMA 2QXZA 1O8HA 4XN0A 2O1DA 1OOCA 3EQOA 4XMYA 4XLCA 2VJJA 2NZMA 1KTWA 1O8EA 4W8SA 2QX3A 2NT9A 3B4NA 4MXNA 4YEJA 4YZ0A 4NK8A 3B8YA 1HG8A 2PECA 4OZYA 1GQ8A 2NSTA 1IDKA 1QCXA 2VBKA 4XM3A 4U49A 1PE9A 1O8GA 1WMRA 4OJ5A 3VMWA 1IB4A 3EQNA 4XKVA 3UW0A 4XL9A 5C1CA 2X6XA 3B90A 4Z05A 2UVEA 1O8FA 1OGMX 4XQFA 2O0VA 1O8KA 2EWEA 4XLEA 1DBGA 4XNFA 2NTQA 4EW9A 3ZPPA 1RMGA 1OGOX 4XR6A 2X85A 2UVFA 4OZZA 2X3HA 1RWRA 4MR0A 4W8QA 3VSVA 4C2LA 4Z06A 1QJVA 3ZSCA 1XG2A 3VSTA 4YZXA 4AVZA 4OJLA 2O0WA 4XKWA 3GQ8A 3VMVA 2O17A 1H80A 4XONA 1BHEA 2Z8GA 1JTAA 1VBLA 5C1EA 1PXZA 4XOPA 2BSPA 1O8MA 4XOTA 4W8TA 1IDJA 4XLFA 4XN3A 2PYGA 1BN8A 1O8DA 1O88A 3KRGA 4XORA 1CZFA 1O8LA 2VJIA 4I84A 2O04A 1DBOA 5AMVA 2X6WA 1OFMA 4YZQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLA A;  2QY1 A;  1X0C A;  4OJ6 A;  3GQ9 A;  1EE6 A;  2IQ7 A;  2NTB A;  3FY3 A;  4OJP A;  4PMH A;  1PLU A;  3GQ7 A;  3VSU A;  1RU4 A;  1KCC A;  1AIR A;  1KCD A;  3T9G A;  4U4B A;  2NSP A;  3GQA A;  4HWV A;  2VBE A;  2X6Y A;  4OJO A;  4NK6 A;  4XLH A;  2ODL A;  1JRG A;  1IA5 A;  3GRH A;  3LMW A;  1NHC A;  3WWG A;  2INV A;  4YZA A;  2NTP A;  1K5C A;  1O8J A;  2INU A;  2NT6 A;  1O8I A;  2PYH A;  3JUR A;  4W8R A;  4YEL A;  1OFL A;  4Z03 A;  3SUC A;  4URR A;  2VBM A;  2QXZ A;  1O8H A;  4XN0 A;  2O1D A;  1OOC A;  3EQO A;  4XMY A;  4XLC A;  2VJJ A;  2NZM A;  1KTW A;  1O8E A;  4W8S A;  2QX3 A;  2NT9 A;  3B4N A;  4MXN A;  4YEJ A;  4YZ0 A;  4NK8 A;  3B8Y A;  1HG8 A;  2PEC A;  4OZY A;  1GQ8 A;  2NST A;  1IDK A;  1QCX A;  2VBK A;  4XM3 A;  4U49 A;  1PE9 A;  1O8G A;  1WMR A;  4OJ5 A;  3VMW A;  1IB4 A;  3EQN A;  4XKV A;  3UW0 A;  4XL9 A;  5C1C A;  2X6X A;  3B90 A;  4Z05 A;  2UVE A;  1O8F A;  1OGM X;  4XQF A;  2O0V A;  1O8K A;  2EWE A;  4XLE A;  1DBG A;  4XNF A;  2NTQ A;  4EW9 A;  3ZPP A;  1RMG A;  1OGO X;  4XR6 A;  2X85 A;  2UVF A;  4OZZ A;  2X3H A;  1RWR A;  4MR0 A;  4W8Q A;  3VSV A;  4C2L A;  4Z06 A;  1QJV A;  3ZSC A;  1XG2 A;  3VST A;  4YZX A;  4AVZ A;  4OJL A;  2O0W A;  4XKW A;  3GQ8 A;  3VMV A;  2O17 A;  1H80 A;  4XON A;  1BHE A;  2Z8G A;  1JTA A;  1VBL A;  5C1E A;  1PXZ A;  4XOP A;  2BSP A;  1O8M A;  4XOT A;  4W8T A;  1IDJ A;  4XLF A;  4XN3 A;  2PYG A;  1BN8 A;  1O8D A;  1O88 A;  3KRG A;  4XOR A;  1CZF A;  1O8L A;  2VJI A;  4I84 A;  2O04 A;  1DBO A;  5AMV A;  2X6W A;  1OFM A;  4YZQ A; 
#chains in the Genus database with same CATH topology
 4XLA A;  2QY1 A;  1X0C A;  4OJ6 A;  3GQ9 A;  4YC5 A;  1WXR A;  2B0R A;  1EE6 A;  2IQ7 A;  2NTB A;  3FY3 A;  2XC1 A;  4YCQ A;  2J8K A;  4OJP A;  4YDT A;  4PMH A;  1PLU A;  3GQ7 A;  3VSU A;  1EZG A;  1RU4 A;  2W7Z A;  1AIR A;  2BM7 A;  3PET A;  1KCC A;  1KCD A;  3T9G A;  4U4B A;  2NSP A;  3GQA A;  3SQV A;  4HWV A;  2VBE A;  2X6Y A;  4OJO A;  4NK6 A;  4XLH A;  2ODL A;  1JRG A;  1IA5 A;  3GRH A;  3LMW A;  1NHC A;  3TH0 A;  1HF2 A;  2V5I A;  3WWG A;  2BX6 A;  2BM4 A;  2INV A;  3N90 A;  2NTP A;  4YZA A;  1K8F A;  1K5C A;  3PSS A;  4YEI A;  1O8J A;  2INU A;  2VFQ A;  2YUH A;  1LM1 A;  2NT6 A;  5JLV C;  1O8I A;  2PYH A;  1K4Z A;  3JUR A;  4W8R A;  1TYV A;  1L1I A;  4YEL A;  1OFL A;  4Z03 A;  3SUC A;  4URR A;  2VBM A;  2QXZ A;  1O8H A;  3N6Z A;  2XT4 A;  2VFM A;  3LYC A;  4XN0 A;  3NB2 A;  3SZE A;  2VFN A;  3RIQ A;  2O1D A;  2VFO A;  1OOC A;  3EQO A;  4XMY A;  4XLC A;  2XTX A;  2QYU A;  2VJJ A;  2NZM A;  1QRB A;  1KTW A;  1O8E A;  2BM6 A;  4W8S A;  2QX3 A;  2NT9 A;  3B4N A;  4MXN A;  4YEJ A;  4YZ0 A;  1QRC A;  4NK8 A;  3B8Y A;  1QA2 A;  1HG8 A;  2PEC A;  4OM9 A;  1CLW A;  3SYJ A;  4OZY A;  1GQ8 A;  3BH7 B;  1TYX A;  2NST A;  1IDK A;  2BM5 A;  1QCX A;  2VBK A;  1QQ1 A;  4XM3 A;  4U49 A;  1OFE A;  1PE9 A;  1O8G A;  1WMR A;  4OJ5 A;  3VMW A;  1IB4 A;  3EQN A;  4XKV A;  3UW0 A;  4XL9 A;  5C1C A;  2X6X A;  3B90 A;  1EA0 A;  4Z05 A;  2XTY A;  2UVE A;  1O8F A;  3DU1 X;  1OGM X;  4XQF A;  2O0V A;  1O8K A;  2EWE A;  4XLE A;  1DBG A;  4XNF A;  2NTQ A;  3H09 A;  1OFM A;  3P4G A;  4EW9 A;  3ZPP A;  2QZA A;  1RMG A;  1OGO X;  4XR6 A;  2X85 A;  2UVF A;  3JX8 A;  4OZZ A;  1DAB A;  1TYU A;  2X3H A;  3AK5 A;  1KQ5 A;  1RWR A;  2IOU G;  4MR0 A;  1QA3 A;  4W8Q A;  3VSV A;  4C2L A;  4Z06 A;  2XTW A;  4JRA C;  1QJV A;  3NAW A;  5DNS A;  3ZSC A;  1TYW A;  1XG2 A;  3VST A;  4YZX A;  4AVZ A;  4OJL A;  2O0W A;  3PSZ A;  4XKW A;  1TSP A;  3GQ8 A;  4OPW A;  3VMV A;  2O17 A;  4YFO A;  1H80 A;  4XON A;  1QA1 A;  1BHE A;  2Z8G A;  5JMC B;  4V02 C;  1JTA A;  2XT2 A;  1VBL A;  5C1E A;  1PXZ A;  4XOP A;  2BSP A;  1O8M A;  1LLW A;  2VFP A;  4XOT A;  4W8T A;  1IDJ A;  4XLF A;  4YZQ A;  3SY2 A;  4XN3 A;  2PYG A;  1BN8 A;  1O8D A;  1O88 A;  3KRG A;  4XOR A;  4KH3 A;  1CZF A;  1O8L A;  2O6W A;  1LLZ A;  2VJI A;  4I84 A;  2O04 A;  1DBO A;  3LJY A;  1OFD A;  3BH6 B;  2J8I A;  5AMV A;  2X6W A;  2G0Y A;  2F3L A;  3ML3 A; 
#chains in the Genus database with same CATH homology
 4XLA A;  2QY1 A;  1X0C A;  4OJ6 A;  3GQ9 A;  1EE6 A;  2IQ7 A;  2NTB A;  3FY3 A;  4OJP A;  4PMH A;  1PLU A;  3GQ7 A;  3VSU A;  1RU4 A;  1KCC A;  1AIR A;  1KCD A;  3T9G A;  4U4B A;  2NSP A;  3GQA A;  4HWV A;  2VBE A;  2X6Y A;  4OJO A;  4NK6 A;  4XLH A;  2ODL A;  1JRG A;  1IA5 A;  3GRH A;  3LMW A;  1NHC A;  3WWG A;  2INV A;  4YZA A;  2NTP A;  1K5C A;  1O8J A;  2INU A;  2NT6 A;  1O8I A;  2PYH A;  3JUR A;  4W8R A;  4YEL A;  1OFL A;  4Z03 A;  3SUC A;  4URR A;  2VBM A;  2QXZ A;  1O8H A;  4XN0 A;  2O1D A;  1OOC A;  3EQO A;  4XMY A;  4XLC A;  2VJJ A;  2NZM A;  1KTW A;  1O8E A;  4W8S A;  2QX3 A;  2NT9 A;  3B4N A;  4MXN A;  4YEJ A;  4YZ0 A;  4NK8 A;  3B8Y A;  1HG8 A;  2PEC A;  4OZY A;  1GQ8 A;  2NST A;  1IDK A;  1QCX A;  2VBK A;  4XM3 A;  4U49 A;  1PE9 A;  1O8G A;  1WMR A;  4OJ5 A;  3VMW A;  1IB4 A;  3EQN A;  4XKV A;  3UW0 A;  4XL9 A;  5C1C A;  2X6X A;  3B90 A;  4Z05 A;  2UVE A;  1O8F A;  1OGM X;  4XQF A;  2O0V A;  1O8K A;  2EWE A;  4XLE A;  1DBG A;  4XNF A;  2NTQ A;  4EW9 A;  3ZPP A;  1RMG A;  1OGO X;  4XR6 A;  2X85 A;  2UVF A;  4OZZ A;  2X3H A;  1RWR A;  4MR0 A;  4W8Q A;  3VSV A;  4C2L A;  4Z06 A;  1QJV A;  3ZSC A;  1XG2 A;  3VST A;  4YZX A;  4AVZ A;  4OJL A;  2O0W A;  4XKW A;  3GQ8 A;  3VMV A;  2O17 A;  1H80 A;  4XON A;  1BHE A;  2Z8G A;  1JTA A;  1VBL A;  5C1E A;  1PXZ A;  4XOP A;  2BSP A;  1O8M A;  4XOT A;  4W8T A;  1IDJ A;  4XLF A;  4XN3 A;  2PYG A;  1BN8 A;  1O8D A;  1O88 A;  3KRG A;  4XOR A;  1CZF A;  1O8L A;  2VJI A;  4I84 A;  2O04 A;  1DBO A;  5AMV A;  2X6W A;  1OFM A;  4YZQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...