3T9GA

The crystal structure of family 3 pectate lyase from caldicellulosiruptor bescii
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
196
structure length
196
Chain Sequence
VGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADKVFQLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A 1.5 A resolution X-ray structure of the catalytic module of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
source organism Caldicellulosiruptor bescii
molecule tags Lyase
molecule keywords Pectate lyase
total genus 79
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2011-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3t9gA00
2UVEA 3VSVA 4I84A 5AMVA 1VBLA 1H80A 2NTPA 3JURA 4NK6A 4Z05A 4W8TA 2QX3A 1KCCA 1WMRA 4U49A 1JRGA 4XKVA 2NSTA 4U4BA 4YZXA 1X0CA 4XN0A 2NT6A 1IDJA 4W8QA 1OFLA 2X3HA 4XR6A 4XNFA 1OGMX 1O8LA 1HG8A 4XLHA 1OFMA 1KTWA 4XONA 1PXZA 1EE6A 2O17A 1O8MA 3ZSCA 2PECA 1BN8A 3VSTA 1PE9A 4Z03A 3VMWA 3T9GA 1NHCA 4XORA 2PYGA 2O04A 2INVA 3B8YA 1O8DA 2O0WA 1O8IA 1RWRA 1QJVA 2UVFA 1O8HA 2ODLA 4W8SA 2BSPA 3B4NA 4XLCA 1IB4A 2VJJA 2VBKA 3EQOA 4XOTA 1IDKA 4NK8A 1KCDA 4OJOA 4AVZA 5C1EA 1OGOX 2X6XA 4YEJA 1O8GA 4XLFA 2X85A 1K5CA 1DBGA 4XOPA 4OZYA 3B90A 2NTQA 2VBEA 1O8JA 2O0VA 4MXNA 3LMWA 4OJPA 3SUCA 1DBOA 4XQFA 1GQ8A 4OJ6A 3ZPPA 4XN3A 2IQ7A 4XM3A 1O88A 3VMVA 1XG2A 4PMHA 3WWGA 2NZMA 2VJIA 4HWVA 4YZAA 3EQNA 1JTAA 1QCXA 2VBMA 4YZ0A 3GQ9A 3VSUA 1RMGA 4C2LA 2Z8GA 4OZZA 3FY3A 2NT9A 1O8KA 3KRGA 4W8RA 2NTBA 4XMYA 2X6YA 4OJ5A 4YELA 1PLUA 1RU4A 2PYHA 3GRHA 3GQ8A 2X6WA 2O1DA 4OJLA 4XLEA 1O8EA 1BHEA 2QY1A 4URRA 1IA5A 1OOCA 1AIRA 3GQAA 2INUA 5C1CA 4YZQA 4XL9A 4Z06A 1O8FA 1CZFA 4MR0A 4XLAA 4EW9A 2EWEA 3GQ7A 2NSPA 2QXZA 3UW0A 4XKWA
chains in the Genus database with same CATH superfamily
2UVEA 3VSVA 1QRCA 4I84A 2IOUG 5AMVA 1QA2A 1VBLA 1H80A 1DABA 2NTPA 3JURA 4NK6A 4Z05A 4W8TA 2QX3A 3LJYA 1KCCA 2BM5A 1WMRA 4U49A 1JRGA 4JRAC 2NSTA 3PSZA 4U4BA 4XKVA 4YZXA 3P4GA 1X0CA 4XN0A 2NT6A 2W7ZA 1IDJA 4W8QA 2J8KA 1OFLA 2X3HA 4XR6A 4XNFA 1OGMX 1O8LA 1HG8A 2VFNA 4XLHA 2QZAA 1QA1A 1OFMA 1KTWA 3JX8A 4XONA 1PXZA 1EE6A 1WXRA 2O17A 1LLWA 1O8MA 5JMCB 3ZSCA 2PECA 1BN8A 3PETA 1QRBA 3VSTA 1PE9A 4Z03A 3VMWA 3T9GA 1NHCA 4XORA 2PYGA 2O04A 2XTWA 2VFOA 2INVA 2BM7A 2J8IA 3B8YA 4YDTA 1O8DA 2O0WA 2O6WA 3AK5A 1O8IA 3TH0A 1RWRA 4OPWA 1QJVA 2UVFA 4KH3A 2VFPA 1KQ5A 1O8HA 2ODLA 4W8SA 3RIQA 2BSPA 2XTXA 3B4NA 4XLCA 1IB4A 2VJJA 2VBKA 3EQOA 4V02C 1IDKA 4NK8A 2QYUA 4XOTA 1KCDA 4OJOA 4AVZA 5C1EA 3SZEA 1OGOX 4OM9A 2X6XA 4YEJA 2VFMA 1O8GA 1K8FA 4XLFA 2X85A 1K5CA 1DBGA 4XOPA 4OZYA 3B90A 1EA0A 5DNSA 1QQ1A 2B0RA 2NTQA 2YUHA 2VBEA 1O8JA 2O0VA 4MXNA 2XT4A 3LMWA 4OJPA 3SQVA 2BX6A 1DBOA 3SUCA 3H09A 4XQFA 1GQ8A 1EZGA 1K4ZA 5JLVC 4OJ6A 3ZPPA 4XN3A 4YEIA 2IQ7A 4XM3A 1O88A 3VMVA 1XG2A 4PMHA 2XTYA 2F3LA 3SY2A 3WWGA 2NZMA 2VJIA 3PSSA 4HWVA 4YZAA 3EQNA 1TSPA 1JTAA 1LLZA 1QCXA 2VBMA 4YFOA 4YZ0A 3GQ9A 3VSUA 1RMGA 4C2LA 2Z8GA 3BH6B 3LYCA 4OZZA 3DU1X 1OFEA 2NT9A 1O8KA 3FY3A 3KRGA 4W8RA 1CLWA 2NTBA 4XMYA 2X6YA 2G0YA 4OJ5A 1PLUA 4YELA 1RU4A 2PYHA 3GRHA 3GQ8A 2XC1A 3ML3A 2X6WA 2O1DA 1TYXA 2VFQA 2V5IA 3NB2A 3N90A 4OJLA 4XLEA 1O8EA 1TYWA 1BHEA 2BM6A 2QY1A 4URRA 1IA5A 3N6ZA 3NAWA 1OOCA 1AIRA 1HF2A 3GQAA 3SYJA 2INUA 1L1IA 5C1CA 4YC5A 4YZQA 2BM4A 3BH7B 4XL9A 1TYUA 4YCQA 4Z06A 1O8FA 1OFDA 1CZFA 4MR0A 4XLAA 4EW9A 2EWEA 1LM1A 3GQ7A 2NSPA 2QXZA 1TYVA 3UW0A 2XT2A 1QA3A 4XKWA
chains in the Genus database with same CATH topology
2UVEA 3VSVA 4I84A 5AMVA 1VBLA 1H80A 2NTPA 3JURA 4NK6A 4Z05A 4W8TA 2QX3A 1KCCA 1WMRA 4U49A 1JRGA 4XKVA 2NSTA 4U4BA 4YZXA 1X0CA 4XN0A 2NT6A 1IDJA 4W8QA 1OFLA 2X3HA 4XR6A 4XNFA 1OGMX 1O8LA 1HG8A 4XLHA 1OFMA 1KTWA 4XONA 1PXZA 1EE6A 2O17A 1O8MA 3ZSCA 2PECA 1BN8A 3VSTA 1PE9A 4Z03A 3VMWA 3T9GA 1NHCA 4XORA 2PYGA 2O04A 2INVA 3B8YA 1O8DA 2O0WA 1O8IA 1RWRA 1QJVA 2UVFA 1O8HA 2ODLA 4W8SA 2BSPA 3B4NA 4XLCA 1IB4A 2VJJA 2VBKA 3EQOA 4XOTA 1IDKA 4NK8A 1KCDA 4OJOA 4AVZA 5C1EA 1OGOX 2X6XA 4YEJA 1O8GA 4XLFA 2X85A 1K5CA 1DBGA 4XOPA 4OZYA 3B90A 2NTQA 2VBEA 1O8JA 2O0VA 4MXNA 3LMWA 4OJPA 3SUCA 1DBOA 4XQFA 1GQ8A 4OJ6A 3ZPPA 4XN3A 2IQ7A 4XM3A 1O88A 3VMVA 1XG2A 4PMHA 3WWGA 2NZMA 2VJIA 4HWVA 4YZAA 3EQNA 1JTAA 1QCXA 2VBMA 4YZ0A 3GQ9A 3VSUA 1RMGA 4C2LA 2Z8GA 4OZZA 3FY3A 2NT9A 1O8KA 3KRGA 4W8RA 2NTBA 4XMYA 2X6YA 4OJ5A 4YELA 1PLUA 1RU4A 2PYHA 3GRHA 3GQ8A 2X6WA 2O1DA 4OJLA 4XLEA 1O8EA 1BHEA 2QY1A 4URRA 1IA5A 1OOCA 1AIRA 3GQAA 2INUA 5C1CA 4YZQA 4XL9A 4Z06A 1O8FA 1CZFA 4MR0A 4XLAA 4EW9A 2EWEA 3GQ7A 2NSPA 2QXZA 3UW0A 4XKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UVE A;  3VSV A;  4I84 A;  5AMV A;  1VBL A;  1H80 A;  2NTP A;  3JUR A;  4NK6 A;  4Z05 A;  4W8T A;  2QX3 A;  1KCC A;  1WMR A;  4U49 A;  1JRG A;  4XKV A;  2NST A;  4U4B A;  4YZX A;  1X0C A;  4XN0 A;  2NT6 A;  1IDJ A;  4W8Q A;  1OFL A;  2X3H A;  4XR6 A;  4XNF A;  1OGM X;  1O8L A;  1HG8 A;  4XLH A;  1OFM A;  1KTW A;  4XON A;  1PXZ A;  1EE6 A;  2O17 A;  1O8M A;  3ZSC A;  2PEC A;  1BN8 A;  3VST A;  1PE9 A;  4Z03 A;  3VMW A;  3T9G A;  1NHC A;  4XOR A;  2PYG A;  2O04 A;  2INV A;  3B8Y A;  1O8D A;  2O0W A;  1O8I A;  1RWR A;  1QJV A;  2UVF A;  1O8H A;  2ODL A;  4W8S A;  2BSP A;  3B4N A;  4XLC A;  1IB4 A;  2VJJ A;  2VBK A;  3EQO A;  4XOT A;  1IDK A;  4NK8 A;  1KCD A;  4OJO A;  4AVZ A;  5C1E A;  1OGO X;  2X6X A;  4YEJ A;  1O8G A;  4XLF A;  2X85 A;  1K5C A;  1DBG A;  4XOP A;  4OZY A;  3B90 A;  2NTQ A;  2VBE A;  1O8J A;  2O0V A;  4MXN A;  3LMW A;  4OJP A;  3SUC A;  1DBO A;  4XQF A;  1GQ8 A;  4OJ6 A;  3ZPP A;  4XN3 A;  2IQ7 A;  4XM3 A;  1O88 A;  3VMV A;  1XG2 A;  4PMH A;  3WWG A;  2NZM A;  2VJI A;  4HWV A;  4YZA A;  3EQN A;  1JTA A;  1QCX A;  2VBM A;  4YZ0 A;  3GQ9 A;  3VSU A;  1RMG A;  4C2L A;  2Z8G A;  4OZZ A;  3FY3 A;  2NT9 A;  1O8K A;  3KRG A;  4W8R A;  2NTB A;  4XMY A;  2X6Y A;  4OJ5 A;  4YEL A;  1PLU A;  1RU4 A;  2PYH A;  3GRH A;  3GQ8 A;  2X6W A;  2O1D A;  4OJL A;  4XLE A;  1O8E A;  1BHE A;  2QY1 A;  4URR A;  1IA5 A;  1OOC A;  1AIR A;  3GQA A;  2INU A;  5C1C A;  4YZQ A;  4XL9 A;  4Z06 A;  1O8F A;  1CZF A;  4MR0 A;  4XLA A;  4EW9 A;  2EWE A;  3GQ7 A;  2NSP A;  2QXZ A;  3UW0 A;  4XKW A; 
#chains in the Genus database with same CATH topology
 2UVE A;  3VSV A;  1QRC A;  4I84 A;  2IOU G;  5AMV A;  1QA2 A;  1VBL A;  1H80 A;  1DAB A;  2NTP A;  3JUR A;  4NK6 A;  4Z05 A;  4W8T A;  2QX3 A;  3LJY A;  1KCC A;  2BM5 A;  1WMR A;  4U49 A;  1JRG A;  4JRA C;  2NST A;  3PSZ A;  4U4B A;  4XKV A;  4YZX A;  3P4G A;  1X0C A;  4XN0 A;  2NT6 A;  2W7Z A;  1IDJ A;  4W8Q A;  2J8K A;  1OFL A;  2X3H A;  4XR6 A;  4XNF A;  1OGM X;  1O8L A;  1HG8 A;  2VFN A;  4XLH A;  2QZA A;  1QA1 A;  1OFM A;  1KTW A;  3JX8 A;  4XON A;  1PXZ A;  1EE6 A;  1WXR A;  2O17 A;  1LLW A;  1O8M A;  5JMC B;  3ZSC A;  2PEC A;  1BN8 A;  3PET A;  1QRB A;  3VST A;  1PE9 A;  4Z03 A;  3VMW A;  3T9G A;  1NHC A;  4XOR A;  2PYG A;  2O04 A;  2XTW A;  2VFO A;  2INV A;  2BM7 A;  2J8I A;  3B8Y A;  4YDT A;  1O8D A;  2O0W A;  2O6W A;  3AK5 A;  1O8I A;  3TH0 A;  1RWR A;  4OPW A;  1QJV A;  2UVF A;  4KH3 A;  2VFP A;  1KQ5 A;  1O8H A;  2ODL A;  4W8S A;  3RIQ A;  2BSP A;  2XTX A;  3B4N A;  4XLC A;  1IB4 A;  2VJJ A;  2VBK A;  3EQO A;  4V02 C;  1IDK A;  4NK8 A;  2QYU A;  4XOT A;  1KCD A;  4OJO A;  4AVZ A;  5C1E A;  3SZE A;  1OGO X;  4OM9 A;  2X6X A;  4YEJ A;  2VFM A;  1O8G A;  1K8F A;  4XLF A;  2X85 A;  1K5C A;  1DBG A;  4XOP A;  4OZY A;  3B90 A;  1EA0 A;  5DNS A;  1QQ1 A;  2B0R A;  2NTQ A;  2YUH A;  2VBE A;  1O8J A;  2O0V A;  4MXN A;  2XT4 A;  3LMW A;  4OJP A;  3SQV A;  2BX6 A;  1DBO A;  3SUC A;  3H09 A;  4XQF A;  1GQ8 A;  1EZG A;  1K4Z A;  5JLV C;  4OJ6 A;  3ZPP A;  4XN3 A;  4YEI A;  2IQ7 A;  4XM3 A;  1O88 A;  3VMV A;  1XG2 A;  4PMH A;  2XTY A;  2F3L A;  3SY2 A;  3WWG A;  2NZM A;  2VJI A;  3PSS A;  4HWV A;  4YZA A;  3EQN A;  1TSP A;  1JTA A;  1LLZ A;  1QCX A;  2VBM A;  4YFO A;  4YZ0 A;  3GQ9 A;  3VSU A;  1RMG A;  4C2L A;  2Z8G A;  3BH6 B;  3LYC A;  4OZZ A;  3DU1 X;  1OFE A;  2NT9 A;  1O8K A;  3FY3 A;  3KRG A;  4W8R A;  1CLW A;  2NTB A;  4XMY A;  2X6Y A;  2G0Y A;  4OJ5 A;  1PLU A;  4YEL A;  1RU4 A;  2PYH A;  3GRH A;  3GQ8 A;  2XC1 A;  3ML3 A;  2X6W A;  2O1D A;  1TYX A;  2VFQ A;  2V5I A;  3NB2 A;  3N90 A;  4OJL A;  4XLE A;  1O8E A;  1TYW A;  1BHE A;  2BM6 A;  2QY1 A;  4URR A;  1IA5 A;  3N6Z A;  3NAW A;  1OOC A;  1AIR A;  1HF2 A;  3GQA A;  3SYJ A;  2INU A;  1L1I A;  5C1C A;  4YC5 A;  4YZQ A;  2BM4 A;  3BH7 B;  4XL9 A;  1TYU A;  4YCQ A;  4Z06 A;  1O8F A;  1OFD A;  1CZF A;  4MR0 A;  4XLA A;  4EW9 A;  2EWE A;  1LM1 A;  3GQ7 A;  2NSP A;  2QXZ A;  1TYV A;  3UW0 A;  2XT2 A;  1QA3 A;  4XKW A; 
#chains in the Genus database with same CATH homology
 2UVE A;  3VSV A;  4I84 A;  5AMV A;  1VBL A;  1H80 A;  2NTP A;  3JUR A;  4NK6 A;  4Z05 A;  4W8T A;  2QX3 A;  1KCC A;  1WMR A;  4U49 A;  1JRG A;  4XKV A;  2NST A;  4U4B A;  4YZX A;  1X0C A;  4XN0 A;  2NT6 A;  1IDJ A;  4W8Q A;  1OFL A;  2X3H A;  4XR6 A;  4XNF A;  1OGM X;  1O8L A;  1HG8 A;  4XLH A;  1OFM A;  1KTW A;  4XON A;  1PXZ A;  1EE6 A;  2O17 A;  1O8M A;  3ZSC A;  2PEC A;  1BN8 A;  3VST A;  1PE9 A;  4Z03 A;  3VMW A;  3T9G A;  1NHC A;  4XOR A;  2PYG A;  2O04 A;  2INV A;  3B8Y A;  1O8D A;  2O0W A;  1O8I A;  1RWR A;  1QJV A;  2UVF A;  1O8H A;  2ODL A;  4W8S A;  2BSP A;  3B4N A;  4XLC A;  1IB4 A;  2VJJ A;  2VBK A;  3EQO A;  4XOT A;  1IDK A;  4NK8 A;  1KCD A;  4OJO A;  4AVZ A;  5C1E A;  1OGO X;  2X6X A;  4YEJ A;  1O8G A;  4XLF A;  2X85 A;  1K5C A;  1DBG A;  4XOP A;  4OZY A;  3B90 A;  2NTQ A;  2VBE A;  1O8J A;  2O0V A;  4MXN A;  3LMW A;  4OJP A;  3SUC A;  1DBO A;  4XQF A;  1GQ8 A;  4OJ6 A;  3ZPP A;  4XN3 A;  2IQ7 A;  4XM3 A;  1O88 A;  3VMV A;  1XG2 A;  4PMH A;  3WWG A;  2NZM A;  2VJI A;  4HWV A;  4YZA A;  3EQN A;  1JTA A;  1QCX A;  2VBM A;  4YZ0 A;  3GQ9 A;  3VSU A;  1RMG A;  4C2L A;  2Z8G A;  4OZZ A;  3FY3 A;  2NT9 A;  1O8K A;  3KRG A;  4W8R A;  2NTB A;  4XMY A;  2X6Y A;  4OJ5 A;  4YEL A;  1PLU A;  1RU4 A;  2PYH A;  3GRH A;  3GQ8 A;  2X6W A;  2O1D A;  4OJL A;  4XLE A;  1O8E A;  1BHE A;  2QY1 A;  4URR A;  1IA5 A;  1OOC A;  1AIR A;  3GQA A;  2INU A;  5C1C A;  4YZQ A;  4XL9 A;  4Z06 A;  1O8F A;  1CZF A;  4MR0 A;  4XLA A;  4EW9 A;  2EWE A;  3GQ7 A;  2NSP A;  2QXZ A;  3UW0 A;  4XKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...