3T9GA

The crystal structure of family 3 pectate lyase from caldicellulosiruptor bescii
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
196
structure length
196
Chain Sequence
b'VGTNTGGVLVITDTIIVKSGQTYDGKGIKIIAQGMGDGSQSENQKPIFKLEKGANLKNVIIGAPGCDGIHCYGDNVVENVVWEDVGEDALTVKSEGVVEVIGGSAKEAADKVFQLNAPCTFKVKNFTATNIGKLVRQNGNTTFKVVIYLEDVTLNNVKSCVAKSDSPVSELWYHNLNVNNCKTLFEFPSQSQIHQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pectate lyase
molecule tags Lyase
source organism Caldicellulosiruptor bescii
publication title A 1.5 A resolution X-ray structure of the catalytic module of Caldicellulosiruptor bescii family 3 pectate lyase.
pubmed doi rcsb
total genus 79
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature ec 4.2.2.2: Pectate lyase.
pdb deposition date 2011-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3t9gA00
4YELA 2O0WA 3VSUA 1O88A 1O8LA 2Z8GA 4XLAA 1O8GA 4YZ0A 3T9GA 4XLFA 4W8SA 3UW0A 4XKWA 4W8QA 1WMRA 3GQ9A 4OJOA 4PMHA 1KTWA 4MR0A 3VMWA 2O17A 1HG8A 1QCXA 4Z03A 3JURA 1IDKA 3VSVA 1PE9A 4XM3A 1O8IA 1O8EA 1RU4A 1O8MA 2X6XA 4URRA 4NK8A 2EWEA 2QY1A 2O0VA 4NK6A 1K5CA 4XN3A 3SUCA 2NTPA 1JTAA 2PYGA 1DBGA 2VBEA 1OGOX 1NHCA 2NT6A 1O8DA 4YZAA 4U49A 2VBKA 4Z06A 4U4BA 3ZSCA 4OZZA 1OFMA 4OJLA 1KCCA 1O8KA 2NTBA 1IDJA 4OZYA 2UVEA 4OJPA 4XOPA 1KCDA 2QX3A 3EQNA 4Z05A 2UVFA 2X6WA 3ZPPA 4W8TA 1OOCA 3LMWA 4AVZA 1H80A 3B8YA 2VBMA 2INVA 4YEJA 3GQAA 4XLEA 5C1EA 1X0CA 2IQ7A 3EQOA 1PLUA 2O04A 2PECA 2X3HA 3GQ7A 4XN0A 3WWGA 4MXNA 1OFLA 2PYHA 4W8RA 2VJJA 1O8FA 2NZMA 1IA5A 4I84A 4XQFA 4XKVA 2ODLA 1O8JA 1DBOA 1O8HA 1OGMX 2NSPA 4EW9A 2NTQA 1GQ8A 1RWRA 1PXZA 4YZXA 4XLCA 4XLHA 3GRHA 4YZQA 1RMGA 4XNFA 2NSTA 5C1CA 5AMVA 4OJ6A 4HWVA 1EE6A 3GQ8A 1CZFA 2QXZA 3VSTA 3B4NA 4XR6A 3VMVA 4XOTA 1VBLA 1XG2A 1IB4A 3KRGA 4C2LA 2INUA 3FY3A 1QJVA 4XONA 2X6YA 1JRGA 4XMYA 2BSPA 2O1DA 1BN8A 1AIRA 4XORA 2NT9A 2X85A 1BHEA 3B90A 4OJ5A 4XL9A 2VJIA
chains in the Genus database with same CATH superfamily
4YELA 2O0WA 3SY2A 3VSUA 1O88A 2W7ZA 1O8LA 2Z8GA 1QA2A 4XLAA 2BX6A 1O8GA 2VFPA 4YZ0A 3T9GA 3PSSA 2IOUG 4XLFA 1QRCA 2XT4A 3LYCA 2XC1A 4W8SA 3UW0A 4XKWA 4W8QA 1WMRA 3GQ9A 4OJOA 4PMHA 1KTWA 4MR0A 3VMWA 4YDTA 3ML3A 2O17A 1CLWA 1HG8A 3BH6B 1QCXA 1HF2A 2BM5A 4V02C 3JURA 1IDKA 4Z03A 1PE9A 3VSVA 4XM3A 1O8IA 1O8EA 1RU4A 1O8MA 2X6XA 2YUHA 4URRA 1QQ1A 2QYUA 4NK8A 2EWEA 2QY1A 2O0VA 4NK6A 1K5CA 4XN3A 1EZGA 1OFDA 3SUCA 1EA0A 2NTPA 1JTAA 2PYGA 1DBGA 2VBEA 1OGOX 3SQVA 4YCQA 1NHCA 2NT6A 1O8DA 4YZAA 4U49A 2VBKA 2XTYA 2XTXA 4U4BA 4Z06A 3ZSCA 3JX8A 3NB2A 4OZZA 1OFMA 3N6ZA 4OJLA 1DABA 2XTWA 1KCCA 1O8KA 2NTBA 2J8KA 1IDJA 4OZYA 2UVEA 4OM9A 1QA3A 4OJPA 1L1IA 4XOPA 1KCDA 2QX3A 3EQNA 4Z05A 3RIQA 1OFEA 2UVFA 2X6WA 3P4GA 4JRAC 3ZPPA 4W8TA 1OOCA 3LMWA 4AVZA 1H80A 3B8YA 1LLZA 2INVA 2VBMA 2VFMA 4YEJA 3GQAA 4XLEA 5C1EA 2BM4A 1X0CA 5JMCB 2IQ7A 3EQOA 1PLUA 2O04A 2PECA 2X3HA 1TYXA 2V5IA 3GQ7A 4XN0A 3WWGA 4MXNA 2VFOA 4YEIA 1OFLA 3SZEA 2PYHA 4W8RA 2VJJA 4YC5A 1O8FA 2NZMA 2XT2A 1K8FA 1IA5A 3LJYA 4I84A 4XQFA 4XKVA 2ODLA 3TH0A 1O8JA 2QZAA 2G0YA 2NSPA 1DBOA 1O8HA 1OGMX 4EW9A 3AK5A 2NTQA 1GQ8A 1RWRA 1PXZA 1QRBA 4YZXA 4XLCA 4XLHA 3GRHA 3H09A 4YZQA 1RMGA 3N90A 2NSTA 3NAWA 4XNFA 5C1CA 5AMVA 4OJ6A 2J8IA 4HWVA 1EE6A 1TSPA 2O6WA 3BH7B 5DNSA 3GQ8A 1LLWA 3SYJA 4OPWA 1TYUA 1WXRA 5JLVC 1CZFA 2QXZA 3VSTA 1TYWA 3B4NA 4XR6A 3VMVA 1K4ZA 4XOTA 1TYVA 2VFQA 1VBLA 4YFOA 1XG2A 2B0RA 1IB4A 3KRGA 4C2LA 3PSZA 2BM6A 2INUA 1QJVA 3FY3A 4XONA 2BM7A 1QA1A 3PETA 2VFNA 2X6YA 1JRGA 4XMYA 2BSPA 2O1DA 1BN8A 3DU1X 1AIRA 4XORA 2NT9A 2X85A 1BHEA 3B90A 4OJ5A 2F3LA 1LM1A 4XL9A 1KQ5A 2VJIA 4KH3A
chains in the Genus database with same CATH topology
4YELA 2O0WA 3VSUA 1O88A 1O8LA 2Z8GA 4XLAA 1O8GA 4YZ0A 3T9GA 4XLFA 4W8SA 3UW0A 4XKWA 4W8QA 1WMRA 3GQ9A 4OJOA 4PMHA 1KTWA 4MR0A 3VMWA 2O17A 1HG8A 1QCXA 4Z03A 3JURA 1IDKA 3VSVA 1PE9A 4XM3A 1O8IA 1O8EA 1RU4A 1O8MA 2X6XA 4URRA 4NK8A 2EWEA 2QY1A 2O0VA 4NK6A 1K5CA 4XN3A 3SUCA 2NTPA 1JTAA 2PYGA 1DBGA 2VBEA 1OGOX 1NHCA 2NT6A 1O8DA 4YZAA 4U49A 2VBKA 4Z06A 4U4BA 3ZSCA 4OZZA 1OFMA 4OJLA 1KCCA 1O8KA 2NTBA 1IDJA 4OZYA 2UVEA 4OJPA 4XOPA 1KCDA 2QX3A 3EQNA 4Z05A 2UVFA 2X6WA 3ZPPA 4W8TA 1OOCA 3LMWA 4AVZA 1H80A 3B8YA 2VBMA 2INVA 4YEJA 3GQAA 4XLEA 5C1EA 1X0CA 2IQ7A 3EQOA 1PLUA 2O04A 2PECA 2X3HA 3GQ7A 4XN0A 3WWGA 4MXNA 1OFLA 2PYHA 4W8RA 2VJJA 1O8FA 2NZMA 1IA5A 4I84A 4XQFA 4XKVA 2ODLA 1O8JA 1DBOA 1O8HA 1OGMX 2NSPA 4EW9A 2NTQA 1GQ8A 1RWRA 1PXZA 4YZXA 4XLCA 4XLHA 3GRHA 4YZQA 1RMGA 4XNFA 2NSTA 5C1CA 5AMVA 4OJ6A 4HWVA 1EE6A 3GQ8A 1CZFA 2QXZA 3VSTA 3B4NA 4XR6A 3VMVA 4XOTA 1VBLA 1XG2A 1IB4A 3KRGA 4C2LA 2INUA 3FY3A 1QJVA 4XONA 2X6YA 1JRGA 4XMYA 2BSPA 2O1DA 1BN8A 1AIRA 4XORA 2NT9A 2X85A 1BHEA 3B90A 4OJ5A 4XL9A 2VJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YEL A;  2O0W A;  3VSU A;  1O88 A;  1O8L A;  2Z8G A;  4XLA A;  1O8G A;  4YZ0 A;  3T9G A;  4XLF A;  4W8S A;  3UW0 A;  4XKW A;  4W8Q A;  1WMR A;  3GQ9 A;  4OJO A;  4PMH A;  1KTW A;  4MR0 A;  3VMW A;  2O17 A;  1HG8 A;  1QCX A;  4Z03 A;  3JUR A;  1IDK A;  3VSV A;  1PE9 A;  4XM3 A;  1O8I A;  1O8E A;  1RU4 A;  1O8M A;  2X6X A;  4URR A;  4NK8 A;  2EWE A;  2QY1 A;  2O0V A;  4NK6 A;  1K5C A;  4XN3 A;  3SUC A;  2NTP A;  1JTA A;  2PYG A;  1DBG A;  2VBE A;  1OGO X;  1NHC A;  2NT6 A;  1O8D A;  4YZA A;  4U49 A;  2VBK A;  4Z06 A;  4U4B A;  3ZSC A;  4OZZ A;  1OFM A;  4OJL A;  1KCC A;  1O8K A;  2NTB A;  1IDJ A;  4OZY A;  2UVE A;  4OJP A;  4XOP A;  1KCD A;  2QX3 A;  3EQN A;  4Z05 A;  2UVF A;  2X6W A;  3ZPP A;  4W8T A;  1OOC A;  3LMW A;  4AVZ A;  1H80 A;  3B8Y A;  2VBM A;  2INV A;  4YEJ A;  3GQA A;  4XLE A;  5C1E A;  1X0C A;  2IQ7 A;  3EQO A;  1PLU A;  2O04 A;  2PEC A;  2X3H A;  3GQ7 A;  4XN0 A;  3WWG A;  4MXN A;  1OFL A;  2PYH A;  4W8R A;  2VJJ A;  1O8F A;  2NZM A;  1IA5 A;  4I84 A;  4XQF A;  4XKV A;  2ODL A;  1O8J A;  1DBO A;  1O8H A;  1OGM X;  2NSP A;  4EW9 A;  2NTQ A;  1GQ8 A;  1RWR A;  1PXZ A;  4YZX A;  4XLC A;  4XLH A;  3GRH A;  4YZQ A;  1RMG A;  4XNF A;  2NST A;  5C1C A;  5AMV A;  4OJ6 A;  4HWV A;  1EE6 A;  3GQ8 A;  1CZF A;  2QXZ A;  3VST A;  3B4N A;  4XR6 A;  3VMV A;  4XOT A;  1VBL A;  1XG2 A;  1IB4 A;  3KRG A;  4C2L A;  2INU A;  3FY3 A;  1QJV A;  4XON A;  2X6Y A;  1JRG A;  4XMY A;  2BSP A;  2O1D A;  1BN8 A;  1AIR A;  4XOR A;  2NT9 A;  2X85 A;  1BHE A;  3B90 A;  4OJ5 A;  4XL9 A;  2VJI A; 
#chains in the Genus database with same CATH topology
 4YEL A;  2O0W A;  3SY2 A;  3VSU A;  1O88 A;  2W7Z A;  1O8L A;  2Z8G A;  1QA2 A;  4XLA A;  2BX6 A;  1O8G A;  2VFP A;  4YZ0 A;  3T9G A;  3PSS A;  2IOU G;  4XLF A;  1QRC A;  2XT4 A;  3LYC A;  2XC1 A;  4W8S A;  3UW0 A;  4XKW A;  4W8Q A;  1WMR A;  3GQ9 A;  4OJO A;  4PMH A;  1KTW A;  4MR0 A;  3VMW A;  4YDT A;  3ML3 A;  2O17 A;  1CLW A;  1HG8 A;  3BH6 B;  1QCX A;  1HF2 A;  2BM5 A;  4V02 C;  3JUR A;  1IDK A;  4Z03 A;  1PE9 A;  3VSV A;  4XM3 A;  1O8I A;  1O8E A;  1RU4 A;  1O8M A;  2X6X A;  2YUH A;  4URR A;  1QQ1 A;  2QYU A;  4NK8 A;  2EWE A;  2QY1 A;  2O0V A;  4NK6 A;  1K5C A;  4XN3 A;  1EZG A;  1OFD A;  3SUC A;  1EA0 A;  2NTP A;  1JTA A;  2PYG A;  1DBG A;  2VBE A;  1OGO X;  3SQV A;  4YCQ A;  1NHC A;  2NT6 A;  1O8D A;  4YZA A;  4U49 A;  2VBK A;  2XTY A;  2XTX A;  4U4B A;  4Z06 A;  3ZSC A;  3JX8 A;  3NB2 A;  4OZZ A;  1OFM A;  3N6Z A;  4OJL A;  1DAB A;  2XTW A;  1KCC A;  1O8K A;  2NTB A;  2J8K A;  1IDJ A;  4OZY A;  2UVE A;  4OM9 A;  1QA3 A;  4OJP A;  1L1I A;  4XOP A;  1KCD A;  2QX3 A;  3EQN A;  4Z05 A;  3RIQ A;  1OFE A;  2UVF A;  2X6W A;  3P4G A;  4JRA C;  3ZPP A;  4W8T A;  1OOC A;  3LMW A;  4AVZ A;  1H80 A;  3B8Y A;  1LLZ A;  2INV A;  2VBM A;  2VFM A;  4YEJ A;  3GQA A;  4XLE A;  5C1E A;  2BM4 A;  1X0C A;  5JMC B;  2IQ7 A;  3EQO A;  1PLU A;  2O04 A;  2PEC A;  2X3H A;  1TYX A;  2V5I A;  3GQ7 A;  4XN0 A;  3WWG A;  4MXN A;  2VFO A;  4YEI A;  1OFL A;  3SZE A;  2PYH A;  4W8R A;  2VJJ A;  4YC5 A;  1O8F A;  2NZM A;  2XT2 A;  1K8F A;  1IA5 A;  3LJY A;  4I84 A;  4XQF A;  4XKV A;  2ODL A;  3TH0 A;  1O8J A;  2QZA A;  2G0Y A;  2NSP A;  1DBO A;  1O8H A;  1OGM X;  4EW9 A;  3AK5 A;  2NTQ A;  1GQ8 A;  1RWR A;  1PXZ A;  1QRB A;  4YZX A;  4XLC A;  4XLH A;  3GRH A;  3H09 A;  4YZQ A;  1RMG A;  3N90 A;  2NST A;  3NAW A;  4XNF A;  5C1C A;  5AMV A;  4OJ6 A;  2J8I A;  4HWV A;  1EE6 A;  1TSP A;  2O6W A;  3BH7 B;  5DNS A;  3GQ8 A;  1LLW A;  3SYJ A;  4OPW A;  1TYU A;  1WXR A;  5JLV C;  1CZF A;  2QXZ A;  3VST A;  1TYW A;  3B4N A;  4XR6 A;  3VMV A;  1K4Z A;  4XOT A;  1TYV A;  2VFQ A;  1VBL A;  4YFO A;  1XG2 A;  2B0R A;  1IB4 A;  3KRG A;  4C2L A;  3PSZ A;  2BM6 A;  2INU A;  1QJV A;  3FY3 A;  4XON A;  2BM7 A;  1QA1 A;  3PET A;  2VFN A;  2X6Y A;  1JRG A;  4XMY A;  2BSP A;  2O1D A;  1BN8 A;  3DU1 X;  1AIR A;  4XOR A;  2NT9 A;  2X85 A;  1BHE A;  3B90 A;  4OJ5 A;  2F3L A;  1LM1 A;  4XL9 A;  1KQ5 A;  2VJI A;  4KH3 A; 
#chains in the Genus database with same CATH homology
 4YEL A;  2O0W A;  3VSU A;  1O88 A;  1O8L A;  2Z8G A;  4XLA A;  1O8G A;  4YZ0 A;  3T9G A;  4XLF A;  4W8S A;  3UW0 A;  4XKW A;  4W8Q A;  1WMR A;  3GQ9 A;  4OJO A;  4PMH A;  1KTW A;  4MR0 A;  3VMW A;  2O17 A;  1HG8 A;  1QCX A;  4Z03 A;  3JUR A;  1IDK A;  3VSV A;  1PE9 A;  4XM3 A;  1O8I A;  1O8E A;  1RU4 A;  1O8M A;  2X6X A;  4URR A;  4NK8 A;  2EWE A;  2QY1 A;  2O0V A;  4NK6 A;  1K5C A;  4XN3 A;  3SUC A;  2NTP A;  1JTA A;  2PYG A;  1DBG A;  2VBE A;  1OGO X;  1NHC A;  2NT6 A;  1O8D A;  4YZA A;  4U49 A;  2VBK A;  4Z06 A;  4U4B A;  3ZSC A;  4OZZ A;  1OFM A;  4OJL A;  1KCC A;  1O8K A;  2NTB A;  1IDJ A;  4OZY A;  2UVE A;  4OJP A;  4XOP A;  1KCD A;  2QX3 A;  3EQN A;  4Z05 A;  2UVF A;  2X6W A;  3ZPP A;  4W8T A;  1OOC A;  3LMW A;  4AVZ A;  1H80 A;  3B8Y A;  2VBM A;  2INV A;  4YEJ A;  3GQA A;  4XLE A;  5C1E A;  1X0C A;  2IQ7 A;  3EQO A;  1PLU A;  2O04 A;  2PEC A;  2X3H A;  3GQ7 A;  4XN0 A;  3WWG A;  4MXN A;  1OFL A;  2PYH A;  4W8R A;  2VJJ A;  1O8F A;  2NZM A;  1IA5 A;  4I84 A;  4XQF A;  4XKV A;  2ODL A;  1O8J A;  1DBO A;  1O8H A;  1OGM X;  2NSP A;  4EW9 A;  2NTQ A;  1GQ8 A;  1RWR A;  1PXZ A;  4YZX A;  4XLC A;  4XLH A;  3GRH A;  4YZQ A;  1RMG A;  4XNF A;  2NST A;  5C1C A;  5AMV A;  4OJ6 A;  4HWV A;  1EE6 A;  3GQ8 A;  1CZF A;  2QXZ A;  3VST A;  3B4N A;  4XR6 A;  3VMV A;  4XOT A;  1VBL A;  1XG2 A;  1IB4 A;  3KRG A;  4C2L A;  2INU A;  3FY3 A;  1QJV A;  4XON A;  2X6Y A;  1JRG A;  4XMY A;  2BSP A;  2O1D A;  1BN8 A;  1AIR A;  4XOR A;  2NT9 A;  2X85 A;  1BHE A;  3B90 A;  4OJ5 A;  4XL9 A;  2VJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...