3T9LA

Structure of n-terminal dusp-ubl domains of human usp15
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
222
structure length
222
Chain Sequence
AADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 15
publication title Structure of the USP15 N-Terminal Domains: A beta-Hairpin Mediates Close Association between the DUSP and UBL Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 69
structure length 222
sequence length 222
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06337 DUSP DUSP domain
A PF14836 Ubiquitin_3 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3t9lA02
3.30.2230.10 Alpha Beta 2-Layer Sandwich DUSP-like DUSP-like 3t9lA01
4MEMA 4MGIE 4NAWA 3WAPA 1LXDA 2AL3A 4W9LA 3V61A 3HM3A 1YIWA 2MLBA 3DBLI 3JW0X 2IZVB 1H8CA 2KDFB 3RT3B 1WXMA 2PE6B 1WM3A 2O2VB 1WI0A 3ZKJC 4OVVA 2KLGA 3AXCA 2BGFA 4K81A 1D3ZA 1UBQA 2Y5BB 1OEYA 4KV2A 3TJPA 3R3MA 3PREA 2RR9A 4RMAA 4DBGA 2N1WA 2L0TA 2O6VB 3JVZX 3T8MA 2NCNA 4B6WA 2C9WB 1YQBA 2GBJA 1KLVA 2JZZA 2ZNVB 3PGEA 3ML9A 1M94A 2KQ7A 2GMIC 4MM3A 3VXWA 4F1SA 5JHAA 1UZXB 2CHWA 2WX0A 5C1ZA 2O6VA 1TBEA 4KSLC 5AZGA 1U4AA 4G11A 3RD2A 3RYTA 3H9DA 3VH4B 2DX5B 2KQSA 5L95C 2KN5A 3ZVVA 1KOTA 1V86A 2J7QB 2KJHB 5TR5A 4CHKA 1P9DU 4JIOU 2KDEB 5LXIB 2A4ZA 2JUOA 4XZ4A 4B95A 2D11A 3KUZA 1L7YA 3GOEA 4I6LB 1XQQA 1WM2A 5JH5C 2GOWA 2LGDA 3DBSA 4MGYE 1WZ0A 4NQKE 4EKUA 4NPNA 1J8CA 4MELA 5DPWA 2ZCBA 1I35A 3CSTA 1WMHB 4TKNA 2RGFA 4GIVA 2M0XA 3JSVB 3W1SA 2HE7A 3I3TB 3UQBA 1OGWA 3DPDA 3QJZA 2MQJA 2DYMA 2NBWB 2XK5B 1UH6A 4KIKB 1WMHA 4BKSA 1KM7A 3ZNID 4A20A 1WX8A 4ZRKA 2KMCA 2C7NB 5AZHA 2EMSA 3M95A 2IO0B 1Q0WB 4KIKA 4GU2A 3WIMA 3A1QA 4II2B 2JRIB 4PYUA 2L76A 3IBEA 4JL9A 2HD5B 5AZFA 4MDKE 2IO3B 1YJ1A 5IAAC 4DWFA 4HLEA 4KSKC 5G2NA 3R7QA 3DDCB 1S1QB 1UBIA 1J0GA 1CMXB 4ANWA 3OAWA 3UIOB 3R66C 3Q3FA 3T9LA 3L16A 4RM8A 2N4FA 4LJOB 4DHJD 4W9JA 3A4RA 3PRZA 1YX6B 3ZDMC 4ZYNA 2C7HA 2JT4B 3H1UA 4DDID 4BFRA 1Z2MA 1WXAA 3CF6E 4KZCA 1E8ZA 4G50A 3ZNZB 2CU1A 1ZGUB 4FJVB 1WX7A 1NI2A 2EMTA 3RZWC 1TZ1A 2KHWB 2IO2B 1TTNA 2KJRA 2G4DB 4AJYB 4HDQA 3TL5A 3HHMA 2XEWA 4MSQB 3ZNGC 3PT2B 4ZRJA 1K8RB 4ASWC 1SE9A 3HIZA 3NOBA 4X57B 4GOCA 3ENEA 2LASA 3W1YA 5D6JB 3AI5A 2JY6A 2GBNA 3WALA 3SD5A 3VUYA 3M3JA 1SGHA 4G3XB 1C3TA 3DVNU 3LJ3A 4CO7A 1FXTB 3D32A 2L0FA 2V3SA 4GSWA 3QAQA 4LCDE 3CMMB 2WX1A 2JF5A 5J17A 1AARA 2LJ5A 3PV1A 4FA6A 2DZKA 1WXVA 4AWJA 2FCNA 3QCAA 5DPTA 4IUMB 5C23A 4A3PA 3PPAA 3S2AA 1OQYA 3WAMA 3APDA 4K7SA 5JHBA 2C60A 3PLUA 3DBRI 1W6VA 3NS8A 2LWPA 2WDTB 1WE7A 3HM6X 4EZLA 2XBBC 1P98A 1X1MA 4K1RB 5CTRC 2YVCA 2LD9A 2KD0A 3SU8X 5DPRA 2MWSB 2HJ8A 3APFA 2BPSA 4GMVA 4HXDA 3PHXB 2MSED 2FNJB 2N9XA 3LDZE 3VUWA 5CX3A 5FR6A 1GUAB 1GJZA 1IPGA 2LRWA 5CHWA 2YLMA 4IW0A 3UF8A 1GG3A 2LI5A 2FCMA 3X23A 4AP4C 4XC2A 4FN2A 5L83A 2KVRA 2L05A 2ZVNA 3K9OB 4II3B 4KDIC 3BY4B 1VD2A 2KTFA 3VTWA 4EUTA 2MW5A 5D7GA 3TIXA 2R2OA 1WE6A 3M62B 2WYQA 3JYUA 5KHOA 2IY1B 2K8HA 3KUCB 3R7RA 2K8BA 1E5WA 3EECA 3DQVA 4WAAA 1UELA 2DZMA 3EC8A 2L3ZA 2KLCA 3ZW3A 1WRDB 1KJTA 2UYZB 2WWZA 2B3AA 4HK2A 3M63B 3H7PA 3DVNV 4IC7B 2M1MA 3ZTCA 5GMVA 2ZJDA 3OJ3A 3A1QB 4BVUC 4WQOB 4DDGD 1QZEA 4DHJB 1WJUA 2MX2A 3UQAA 2RSUA 2JWZA 4CYEA 1V9JA 1L2NA 2KFKB 1WF9A 3N3KB 1WR1A 4TQ0A 4W9HA 3ZRCA 2KWVB 2MRPA 5IA7A 2KWCA 1YX5B 3ZNHB 1Z5SB 2M8SA 2LRUA 3DVGX 1E8WA 2LXAA 3DCGA 2I1JA 2KXJA 4URKA 2PJHA 2KFKA 3N32A 5D94A 5KHQA 1OEYJ 2AWTA 2G4SA 3QQ8B 1J19A 4DHZE 1P0RA 2KFJA 2BF8B 2MA9B 4KZ0A 4HPLB 2K6QA 1VCBA 3L17A 3K9PB 5G55A 3PTFC 4FBJB 2ZVOA 1IP9A 4HCNB 2V4LA 1F9JA 3KUDB 1WJNA 5CHFA 2KWUB 3PHWB 3OJ4B 1WGHA 2PE9A 4HJKA 1V2YA 2DZIA 1WJ6A 4LDTD 1T0YA 3H6NA 3V60A 4BOZB 4ANXA 4G0NB 3MJWA 4LJPB 5BO4B 1WGGA 4EFOA 4W9EA 1RLFA 4YL8A 1I42A 1V5TA 4ICVA 2M4NA 2L00B 4AOFA 3QARA 4I6PA 2N1VA 1IYFA 3GZNI 2D3GA 2JXXA 4W9FA 3U7DA 2ZCCA 2KK8A 2BWFA 3TMPB 1LM8B 4ANUA 2ZPYA 3NHEB 4M8NA 2OOBB 5J18A 4IG7B 3VFKA 2CHZA 3VUXA 1WZ3A 3ZUNA 2DHZA 4P7IA 2W9NA 1G6JA 2K6DB 3L08A 1P1AA 4DK5A 4E3CA 2JPHA 4BKTA 1V6EA 2K39A 3KVFB 3V6EB 2MBBB 2JVCA 1WIAA 2JRHA 4HCPB 3ECIA 3VTVA 4W9KA 1WH3A 1MG8A 2K8CA 4ZDVA 2GBKA 3ZO5B 5E6NA 3ZTDA 2IO1B 2ZZPB 4WJQA 3N30A 4K7UA 2BKRB 4NJ7A 2DENB 2IY0B 1JRUA 3APCA 2LZ6A 2MBEA 1R4NI 4NJ6A 3PSEB 3H7SA 1V49A 2CR5A 4M0WB 2JZ3B 3PRMB 2KC1A 2KDBA 2Z59B 4WJOA 2BYEA 4PS8A 5AEKB 2HTHA 1H4RA 2D2QA 2FAZA 2G3QB 4WWNA 4MSMB 3ZIMA 2MBQA 3A9JA 1EUVB 3RULA 2VRRB 4A3OA 1V5OA 3Q3JA 4HPMB 5E6PA 3QA8A 3A9KB 2BKFA 2DZJA 3U8ZA 2LVQA 3DVGY 5LLIA 2KZRA 2R2QA 3AULA 3KW5B 1WYWB 2ZEQA 1WX9A 1E7UA 2K25A 1HE8A 2NBUA 3A33B 1WJ4A 3WA0A 4ICUA 4GGQA 3A9KA 4ZRIA 4MGZE 3X0WA 4AUQC 3QK0A 1P3QU 1RAXA 1EF5A 2AEHA 1UD7A 3L0WB 1UGMA 4W9IA 3WANA 2L8JA 2GBRA 1TGZB 1WR6E 1Y8RC 2IYDB 4FJYA 4JQWC 4BBNC 3O65B 3AU4A 1EO6A 2O2VA 3C0RB 1Q5WB 4E74A 3PRPB 3L13A 2DAFA 2NVUI 3H7PB 1EF1A 3ALBA 3QHTA 3QWZB 4EEWA 3ZDTA 1XD3B 1ZKHA 1Q1OA 1E8XA 2LVPA 1WXSA 3VAWA 4BKGA 4EOYA 2KANA 2ASQA 2KMAA 3VVWB 2KO3A 2FCQA 1A5RA 4IWQA 4NQLB 2RD0A 3EHVA 2REXA 4KDLB 4IM2A 3U30A 5J2RA 2FUHB 2GBMA 2KX0A 2FIFA 3L10B 3VHTC 2NR2A 4GB9A 4J6IA 3TBLD 4BBNF 4F8CB 2BYVE 2N9EB 3MTNB 2MCNB 3UIPB 1V80A 2KNBA 4LDTB 3VQIA 3UGBB 4DXAB 2NBVB 2BWES 4AJWA 5D2MB 2O6VD 1XT9B 3A4SC 4WJPA 4GN1A 5EDSA 4W9DA 3UINB 4IM3A 3B1LX 3ONSA 4IM0A 1GC7A 2NS5A 1OTRB 2RPQA 4JGHB 2CS4A 4PS7A 4MJSB 1WFYA 5DPSA 3V62A 2KJ6A 2DYBA 2Z0EB 2V1YA 5HKHA 1E8YA 4IWPA 4FHJA 4ANVA 2K1FA 2AYOB 3DBHI 3JSVA 3VDZA 3ZRFA 2KX3A 4KVGB 4MJSA 4FHKA 3V6CB 2CHXA 2ZPNA 4PYZA 2KTRB 2XK5A 2AL6A 4GDKB 4HDOA 2C5LC 2IBIB 3IHPC 3KYCD 3VTUA 3L54A 3VH3B 3MHSD 4JLCA 2A5UA 3CSFA 2M17A 2L7RA 3KH0A 3SDLC 4HVBA 1NBFC 2MP2B 2KTRA 2LUEA 2J0KA 2NPTB 2OJRA 3AU5A 4GDKA 3TCAA 2KKCA 2J0JA 2D10A 2LVOA 3OLMD 4TQ1A 4BKSD 4EZKA 1BT0A 2N7DA 4DHZB 2N9PC 5JZEB 4M8MA 4K7WA 4FADA 1ISNA 1LFDA 1RFAA 2MP2A 1WY8A 1ZW7A 2NPTA 1SIFA 3QIJA 2KC2A 2DYOA 3RUIB 3LMNA 4MGKE 3RZFA 3WAOA 3HK0A 2J0MA 2FCSA 4XX5A 4W9GA 2C7MB 4TV3A 4F7ZA 1R4MI 1E7VA 2ZNVC 1WGDA 3IVFA 4GDLB 2FIDA 3PZDA 2PEAA 1LQBA 1GC6A 4FLHA 1PQSA 3PS6A 4W9CA 5LXHA 2BYFA 4B9KA 2N7EA 3IG3A 1C1YB 2LXCA 1V81A 2KOXA 3B08A 4OVUA 4GDLA 2Z0DB 2G45B 4NY0A 3NY5A 4RM9A 3BINA 3KYDD 2MBOA 3NZUA 2MBHA 1NDDA 4HWIB 3P2BA 4MH0E 4N9F4 4WWOA 2D07B 3DOWA 1E90A 5DCNA 2EKEC 3ZLZA 2DAJA 2PPHA 3IFWB 3W1SC 3A9JB 4E71A 3EFUA 1S3SG 4TUUA 4EZJA 4FJZA 4PS3A 3NZSA 3QX1A 3RCZA 4NNJB 1WGYA 2QHOA 4FULA 1RRBA 2I1KA 2KDIA 1WGRA 5E6OA 4NAWB 1YD8U 3SHQA 4GXBA 3ML8A 3PVLA 2LGXA 4WWPA 2UWQA 3B0AA 2CKHB 1GNUA 3QC8B 4I6NB 4WJNA 5CHVC 4BOSC 4IWOA 3PLVA 2LGYA
chains in the Genus database with same CATH superfamily
3NVZA 1FD6A 4MEMA 4NAWA 4P1BC 4DQOC 1L0YB 2Q5WD 3V61A 3NVWA 2IGGA 3DBLI 4TSSA 2IZVB 1L4DB 4OVZA 4YT0B 3AE2B 3RT3B 3ZXVA 2KLGA 3I9V1 1D3ZA 3DBLB 1B9RA 2L0TA 3T8MA 3JVZX 3IT4B 4RF1A 2KAJA 1YQBA 4YTMB 3AMZA 3ML9A 2JYEA 2CHWA 1TBEA 4KSLC 2ACZB 1KOTA 2J7QB 2MHJA 1P9DU 2KDEB 2A4ZA 4I6LB 3HVZA 1BUIC 5JH5C 3DBSA 2LGDA 4D2KA 2RGFA 5FR3A 1OGWA 2NBWB 1UH6A 4ZRQA 1WMHA 4IDIA 1T0RC 1CQVA 2HDEA 4A20A 1WX8A 2PW9A 4II2B 4PYUA 2HD5B 2IO3B 2I2YA 5H8YE 2INCC 3AM9A 3OAWA 4JX1C 3UIOB 3Q3FA 4RM8A 2M56B 4LJOB 4DHJD 4WQMA 2LHDA 5GXGB 4REZA 1UF0A 4DDID 1GAQB 1HXYD 4HRSA 3CF6E 1ZGUB 4FJVB 1JALA 1NI2A 2EMTA 2JZPA 3KWLA 3DWMA 2IO2B 1TTNA 1TY0A 1ZDVA 3TL5A 3ZNGC 3PT2B 1PGXA 4ASWC 3NOBA 2Y3AA 2IJ0A 2VZKB 3ENEA 2LASA 3AEAB 2GBNA 2W3SA 3SD5A 3M3JA 1JWAD 1LO5D 3LJ3A 3NRZA 3D32A 2YEPB 2BS2B 2V3SA 2MJEA 3AE8B 2RDGA 4LCDE 3CMMB 2BBCA 2AQ1B 1JWUD 3QCAA 4M01A 1E0ZA 1ET6A 3GS2A 3APDA 5JHBA 3DBRI 4TMAB 1WE7A 3HM6X 5LNK1 1ZXHA 1X1MA 4K1RB 3Q8EA 2YVCA 3P4PB 5DPRA 2HJ8A 2BPSA 1SEBD 5G5GA 2N9XA 3LDZE 1GUAB 1QF6A 2YLMA 3UF8A 2LFIA 3CIRB 3RMKC 2D3CA 1PGAA 2LI5A 2G1EA 4AP4C 4XC2A 2KVRA 2L05A 3N1XC 1OQRA 1VD2A 1RWSA 3VTWA 1K53A 4RGMA 1VLBA 5D7GA 2KMMA 4RGTA 5KHOA 2IY1B 2K8HA 3KUCB 3R7RA 4WAAA 3ZW3A 4HK2A 2UYZB 3M63B 3H7PA 3DVNV 3ZTCA 1KFYB 2ZJDA 3BYTB 2QJLA 1WJUA 2MX2A 3J9CA 1YN5A 3N3KB 2M8SA 1E8WA 2BB6A 2I1JA 5HI1A 2PJHA 3AEFB 2WDVB 4RGNA 1OEYJ 5TSSA 1GPXA 2KFJA 2MH7A 3RNEC 5G55A 2ZVOA 1IP9A 2AQ2B 4HCNB 4HEA1 1DOIA 2KWUB 3AB5A 4HJKA 3V60A 1T0YA 3H6NA 4LJPB 4EFOA 2KYWA 1ENFA 3FAHA 2L00B 1HZ5A 3QARA 4I6PA 1PDXA 2QSDA 2OEDA 4W9FA 1MPEA 4M8NA 1NYQA 1I4XA 1C79A 1N60A 2W9NA 1G6JA 1YMHE 4E3CA 3V6EB 3KVFB 2MBBB 2PIAA 4HCPB 1WIAA 2JRHA 4JWUC 3RNGC 3MJ5A 1L6UA 3ZXRA 4K7UA 4NJ7A 2IY0B 1R4NI 3PSEB 4M0WB 1VZ8A 1ET9A 2D2QA 2G3QB 4MSMB 2MBQA 3A9JA 3MC0B 4HPMB 4B0EA 3QA8A 2QC8A 3DVGY 1I7HA 2R2QA 2ZW0A 2HTME 3AULA 2BTEA 2PTLA 1WX9A 1GB1A 2NBUA 1HE8A 2D3AA 4GGQA 3A9KA 4ZRIA 2GB1A 2J53A 1EF5A 3WANA 1UGMA 1DGJA 1FIQA 2NTSA 1YJJA 1JCKB 1XXGA 2KT7A 2LVPA 1Q1OA 1E8XA 4BKGA 1CK1A 1WXSA 5BMIA 2KANA 2FCQA 4NQLB 1AN8A 1KF6B 2ONQA 1AWDA 3L10B 1TT5B 4J6IA 4F8CB 2N9EB 3Q14C 3FILA 2L83A 1V80A 2KNBA 1SE4A 1DOYA 2NBVB 3B2GA 2V4IB 5EDSA 2CS4A 4ZYSA 5DPSA 2KJ6A 2DYBA 2KN4A 2V1YA 3IAS1 1E8YA 2K1FA 2AYOB 3VDZA 2KX3A 4MJSA 4FHKA 2K9XA 4RGOS 2AL6A 4HDOA 1D6EC 5BMHA 3EUB2 2CJNA 3MHSD 3CSFA 4RF0A 2L7RA 3SDLC 3TCAA 2J0JA 2LVOA 4TQ1A 1BT0A 1FXIA 2WXMA 5BYQA 2KQ4X 3QIJA 1L4ZB 2WXKA 2PVOD 1FFUA 2C7MB 4KGRA 1FNWA 3P42A 3R2IA 4RFBA 2B76B 3IVFA 4GDLB 3PZDA 1FRRA 1YQ3B 2N7EA 2MJDA 1C1YB 3B08A 2Z0DB 2WXRA 2MBHA 5DCNA 1E90A 1F77A 2EKEC 3GE3C 1VZ7A 4EZJA 3RCZA 3NZSA 1WGYA 2KDIA 3AEBB 1WGRA 2WXHA 1J7AA 3SHQA 2CJOA 4WJNA 1IUEA 1T5XD 3DHGC 1P7FA 1LXDA 2AL3A 4W9LA 2M19A 3HM3A 2JU6X 1TS4A 2MLBA 1WXMA 2PE6B 1KLGD 3DHHC 1WI0A 3ZKJC 2VZKD 4OVVA 3AXCA 1UBQA 1OEYA 4YTPB 3TJPA 4WWMA 2NTTA 4RMAA 1PYWD 1ZOYB 2O6VB 2NCNA 4B6WA 1VDVA 3T3NA 2C9WB 3P63A 1XCTL 2JZZA 1DYQA 1D5ZC 2KQ7A 4MM3A 5JHAA 3ZYYX 1UZXB 2WX0A 5IKCM 2JWUA 1U4AA 4LNKA 2KQSA 5L95C 2KN5A 4RH6A 1V1OA 1V86A 5TR5A 3RNAC 3BZDB 4JIOU 5LXIB 3BK1A 1I4GA 4XZ4A 3KUZA 1L7YA 1FNVA 3AEGB 1XQQA 4RCOA 4NQKE 5DPWA 4R3DA 1I35A 1WSPA 2M0XA 3JSVB 3W1SA 2HE7A 3I3TB 2DYMA 4BKSA 4JE3B 1UWXA 3ZNID 2C7NB 4KIKA 1I4HA 1HZ6A 2JRIB 5AZFA 3B9JA 2D5GA 5IAAC 1NVID 4DWFA 3N1ZC 3T9LA 3L16A 3BVMA 1E10A 3PRZA 1WRIA 4MT5A 2JT4B 1SJHD 1R7SA 4KZCA 2CU1A 3RZWC 5EE9A 1R4MB 1P7EA 2KJRA 4AJYB 2WXIA 3BYYB 4HDQA 4A90A 2XEWA 4MSQB 1HEZE 4ZRJA 1K8RB 1XEEA 1SE9A 3HIZA 1N62A 4ARIA 4MACA 5D6JB 4XDDA 4G3XB 1C3TA 2AQ3B 3QAQA 3IXSA 5J17A 2JF5A 2X38A 3PV1A 4HKQA 4BAXA 2WXLA 3PPAA 3WAMA 3PLUA 1IBXB 2WDTB 4EZLA 2KVZA 2WXGA 3SU8X 2KD0A 2MWSB 3APFA 3FC4A 4HXDA 4KGSA 4L1BA 5CX3A 3TSSA 1IPGA 4NAMA 3E9SA 3VR9B 2FCMA 1GOZA 4ZRPA 4II3B 4EUTA 2MW5A 2R2OA 3M62B 4PK1A 2K8BA 1UELA 1L0VB 4B0MA 2KLCA 3BVZA 4K3BA 5FKAC 2WWZA 4IC7B 2N9LA 1XLQA 2M1MA 1C4PA 3OJ3A 3A1QB 1F2RI 4WQOB 4DDGD 1RFKA 4CYEA 2KFKB 1WR1A 1MJDA 2KWCA 1YX5B 2X8XX 2LRUA 2WXNA 4URKA 3QQ8B 2L32A 2K5PA 3AE4B 4KZ0A 3K9PB 3EGRA 1ZPSA 1F9JA 5CHFA 3GE8C 3MHZA 3MFGA 4O1NA 1WJ6A 4ANXA 2YEPF 4G0NB 3MJWA 5BO4B 4YL8A 1ZP0B 1I42A 1TKGA 4AOFA 4A8XC 2RMMA 3GZNI 2JXXA 2ZCCA 2KK8A 2BWFA 2OJWA 1LM8B 4C4VB 4ANUA 5J18A 4IG7B 3ZUNA 2DHZA 4P7IA 1VZ6A 4DK5A 2QIEB 2JPHA 3Q6BA 3U7ZA 1VR9A 2W3RA 3ETRA 2K3UA 2TSSA 4M02A 5D3DA 1WH3A 1MG8A 1C76A 4ZOHC 5E6NA 1D4BA 3N1YC 1AYFA 2BKRB 4NJ6A 1JRUA 1V49A 2JZ3B 3PRMB 4WJOA 4KGTA 1K51A 2RDBC 3Q69A 3ZIMA 1EUVB 4A3OA 1AW7A 2IGDA 3DBRB 2BKFA 1SIJA 2BS4B 3U8ZA 2SAKA 1JMLA 1EWCA 2KZRA 4XWWA 3KW5B 2ZEQA 1TS2A 1E7UA 2WQYB 3A33B 3DWGC 3WA0A 1FO4A 3AE1B 1NYRA 3X0WA 3EFCA 3QK0A 1UD7A 4C00A 1F0ZA 1TGZB 3IT6B 1Y8RC 4JQWC 3WCQA 4BBNC 3O65B 1IGCA 4P6VF 1EM7A 3PRPB 4QAYA 2DAFA 2NVUI 1F52A 2WDRB 3VAWA 2KMAA 3VVWB 2RD0A 3EHVA 4ZHOA 3NG0A 4BBNF 1L5PA 4RNAA 3MTNB 5EE0A 2MCNB 4LDTB 3VQIA 3UGBB 4DXAB 5HHDG 2O6VD 4GN1A 3IAM1 4IM3A 3B1LX 4IM0A 2NS5A 2RPQA 1RM6C 5HKHA 4IWPA 1MVKA 3JSVA 1YNTE 4PYZA 3AE3B 2KTRB 2C5LC 1STEA 2IGHA 1A70A 3VH3B 4XYCA 2M17A 1NBFC 2LUEA 4P1CC 4GDKA 2KKCA 3VRAB 2N7DA 2INNE 1YJIA 1JWMD 1RFAA 2MP2A 1WY8A 4WAFA 2NPTA 1N61A 3Q3OC 1SIFA 3RUIB 2QMTA 3WAOA 1I4RA 4W9GA 4TV3A 4F7ZA 1ZDXA 1JW9D 3NVYA 2ZNVC 2PEAA 4W9CA 4FLHA 4EE2A 2BYFA 1ACCA 2JQRB 3I63C 2LXCA 2EKIA 4OVUA 4XGAB 4NY0A 4RM9A 3KYDD 1PGBA 1YN3A 3P2BA 3P4RB 4E71A 2DAJA 2PPHA 2Z8LA 2KACA 1S3SG 4LK0M 4FULA 1L0XB 1RRBA 5C2TB 1FCLA 2QCZA 4NAWB 1R4NB 1TZOA 5AUKA 3U4EG 2LGXA 2UWQA 1VJKA 2SEBD 4IWOA 4MGIE 3WAPA 1XCQL 1YIWA 3ZQ4A 1H8CA 2KDFB 3MP9A 4K81A 2NMQA 2WXQA 3R3MA 1UNSA 5IP4D 2N1WA 1GB4A 2GBJA 5IO9A 2ZNVB 1M94A 2JX5A 2K0PA 3RYTA 3VH4B 1TYGB 4CHKA 2LGSA 2D11A 3GOEA 1WM2A 4YXDB 4MGYE 1WZ0A 2PKOA 4NPNA 3OWEB 4MELA 3CSTA 1WMHB 4TKNA 4GIVA 3Q3NC 3UQBA 3DPDA 3QJZA 4WURA 3W5UB 1E7PB 1E9MA 3PZ8A 4YSXB 2WXFA 4ZRKA 1SJED 2EMSA 3M95A 4YSZB 2IO0B 3WIMA 3A1QA 1C78A 1T3QA 4N59A 2L76A 3IBEA 4JL9A 4MDKE 4HLEA 4KSKC 1S1QB 1UBIA 1CMXB 2WGSA 3RPFC 4LTUA 3R66C 2WXJA 2JYTA 2N4FA 2N0SB 2QILA 1N63A 1SXTA 4ZYNA 3H1UA 1WXAA 1E8ZA 4G50A 1TZ1A 1KH0A 1L6VA 2G4DB 3L4PA 1TKYA 1WWTA 4A55A 3HHMA 2INPE 1FRDA 4GOCA 3W1YA 1N5WA 2JY6A 3TUOA 3WALA 4YWGG 4CQNA 1LGRA 1TY2A 3LXFA 4WH4A 1SE3A 4OZCA 1FXTB 2L0FA 4GSWA 2N9KA 2LJ5A 1WXVA 2VH2A 4OZAA 3NZ3A 2FCNA 4ITKA 4IUMB 5C23A 2WLBA 4A3PA 2DWQA 3S2AA 4K7SA 2PMVA 3CWIA 4LLGM 1EU4A 4YSYB 3ZGZA 1TIFA 2LWPA 5CTRC 1NI3A 2LD9A 1XF5L 3V3XA 4GMVA 2MSED 1KLUD 2FNJB 2D3BA 4N6EB 5FR6A 1GJZA 3T3OA 4YTNB 4HJGE 2EELA 3X23A 4FN2A 3K9OB 3R2TA 3MC8A 3BY4B 5IN7A 4KKIA 3JYUA 3HRDD 3EECA 3C8YA 2DZMA 3TEXA 3EC8A 1PUTA 3PO0A 2L1AA 2L3ZA 3SR6A 1SBBB 1WRDB 1KJTA 1EWYC 2BVCA 1XO3A 3AE6B 3P4QB 4BVUC 1QZEA 1V8CA 2JWZA 4W9HA 3ZRCA 1QILA 5IA7A 1QLBB 4LNIA 3I5JC 3ZNHB 1Z5SB 4HPPA 2KWDA 3DCGA 2KXJA 3GB1A 5KHQA 3B2FA 2AWTA 4XDCA 4DHZE 2MA9B 1BXTA 4L23A 3LYYA 2K6QA 1VCBA 1SE2A 3L17A 1UGJA 3PTFC 4FBJB 2V4LA 3KUDB 4C7ZA 2ICIA 3ABVB 3PHWB 1V2YA 2DZIA 4LDTD 4BOZB 5JXVA 5IOIA 4W9EA 1V5TA 3SFEB 1T0QC 2M4NA 4ICVA 4JPSA 2WNMA 3Q8AA 2N1VA 5FK9C 5C3JB 1JQ4A 1IYFA 3NVVA 2D3GA 3URYA 1CZPA 3TMPB 2ZPYA 3NHEB 2OOBB 3VFKA 2CHZA 3VUXA 1WZ3A 4US8A 5EE1A 1P1AA 4BZAA 1V6EA 4KX6B 2LUMA 2JVCA 1N6ZA 3ECIA 3SFDB 3VTVA 4W9KA 2K8CA 4ZDVA 2INDC 2V9HA 3ZTDA 3OG5A 3AE5B 2ZZPB 4WJQA 3N30A 1KRHA 2DENB 2LZ6A 4N58A 3H7SA 3AEEB 2CR5A 5T8IA 3VRBB 2Z59B 2FBWB 2E3TA 1F2RC 5AEKB 2HTHA 2FAZA 4WWNA 3RULA 4M0WA 2VRRB 1V5OA 3A9KB 2DZJA 2Y5CA 1WYWB 2LHEA 2K25A 1WJ4A 1QOAA 4ICUA 2H88B 1JRPA 1P3QU 1RAXA 2AEHA 2IPKD 4US9A 2L8JA 1WR6E 1QKZA 4C56C 1ESFA 3C0RB 1ROEA 2G9HD 3L13A 1YQ4B 1EF1A 2W55A 3ALBA 3QHTA 2WU2B 4EEWA 1XD3B 1ZKHA 3U2SC 2ASQA 3FILB 4IWQA 5MPOA 2HJ1A 1C4CA 4KDLB 1UUPA 1MHXA 2FUHB 2GBMA 2FIFA 3TEZA 2NR2A 4GB9A 4LNFA 1ZUD2 3TBLD 2E6XA 1HTQA 3MC9A 1EU3A 5D2MB 2M0AA 4NZLB 3UINB 3ONSA 4C80A 1GC7A 1OTRB 4PS7A 4MJSB 3V62A 3AEDB 2Z0EB 4FHJA 4ANVA 1WYGA 3ZRFA 3V6CB 3IHPC 1M4VA 3L54A 4JLCA 1XLPA 4HVBA 3AECB 2JXTA 2D10A 2J42A 1SF0A 2OHFA 3NJTA 1V1PB 5JZEB 1CJEA 5HG2A 3P4SB 1LFDA 1ZW7A 4USAA 2WHIA 1I4QA 4A6QA 3LMNA 4MGKE 2J0MA 3GZNB 4GLSC 5BYSA 3SEBA 2FE8A 1WGDA 2FIDA 1LQBA 4LNOA 1PQSA 3PS6A 3VR8B 5LXHA 3AE9B 1WGKA 2PLPA 4B9KA 1QOBA 3IG3A 1DOXA 1V81A 2KOXA 3PZ7A 1MG4A 4GDLA 2G45B 1Q10A 2H89B 2R61A 4MH0E 4WWOA 3BIID 4N9F4 1NDDA 4HWIB 3ZLZA 3DOWA 3IFWB 3W1SC 3AE7B 2V0GA 3RNCC 1YD8U 1YN4A 1FM0D 3ML8A 1NEKB 3PVLA 4WWPA 3B0AA 5CHVC 4BOSC 3RNFC 4KVGB 3PLVA 2LGYA 1OQQA 1I4PA 2V3PA 4JWSC 3JW0X 2WU5B 1WM3A 2O2VB 2WP9B 2BGFA 1TS5A 1E6EB 1JWBD 2Y5BB 4KV2A 1MI0A 4HKZE 4MM3B 3PREA 2RR9A 2MEKA 2J52A 4DBGA 3ZJVA 3RN9C 1KLVA 3PGEA 4F1SA 2GMIC 3VXWA 1SB3C 5C1ZA 2O6VA 5AZGA 4OW0A 4G11A 3RD2A 3KLSX 3H9DA 3Q8FA 2ON8A 2DX5B 2WDQB 1FNUA 2ZW1A 3ZVVA 2KJHB 3W5VB 3TEYA 3KWVA 2JUOA 4B95A 1NENB 5D3IB 2GOWA 4EKUA 1J8CA 2ZCBA 3Q3MC 1OFFA 1ZE3D 2MQJA 2XK5B 4KIKB 2WXPA 1KM7A 3NUHB 4OZBA 2KMCA 3N9YC 5AZHA 1Q0WB 4GU2A 3N20C 5I4DA 3W2DA 1YJ1A 1MFWA 5G2NA 3R7QA 3DDCB 1J0GA 4ANWA 4DXFA 4W9JA 3A4RA 1YX6B 3ZDMC 4Q2JA 2C7HA 2VH1A 4BFRA 4K3CA 3UI3A 1Z2MA 1J7CA 3AH7A 2JSVX 3ZNZB 1WX7A 1VRAB 2KHWB 1JWSD 4UDUC 3W9CB 1QQRA 4XWTA 4ARCA 1F1HA 4WIPA 4X57B 3AI5A 1UWMA 4A9AA 3VUYA 3EA6A 1SGHA 3DVNU 1PFDA 2BYTA 4CO7A 2DBYA 2WX1A 1AARA 3H8HA 4FA6A 2DZKA 4AWJA 2GLSA 5DPTA 1OQYA 2C60A 1W6VA 3NS8A 2XBBC 1P98A 2RDHA 3KQ4A 1IBXA 3PHXB 4P16A 3VUWA 4PT5A 2LRWA 4IKGA 5CHWA 1KTKA 4IW0A 1GG3A 4FXCA 5L83A 2L52A 2ZVNA 3RNBC 4KDIC 5BMGA 3ZJUA 2KTFA 2GRIA 1HTOA 3TIXA 1WE6A 2AX5A 2WYQA 3RI7C 1E5WA 3DQVA 1FEHA 4ACFA 1N5XA 1XLNA 2B3AA 1RYJA 1TKEA 2WXOA 5HFYA 2DNFA 5GMVA 1K50A 4DHJB 1C4AA 3UQAA 2RSUA 2XN9C 1V9JA 1L2NA 1WF9A 2CU3A 4TQ0A 2J4XA 2KWVB 2MRPA 1D5MC 3BWUD 3TEWA 3NS1A 3DVGX 2LXAA 2KFKA 3N32A 5D94A 2G4SA 1J19A 3LB8C 1P0RA 2BF8B 4HPLB 2W54A 1WJNA 3OJ4B 1WGHA 2PE9A 3DHIC 1WGGA 2WS3B 1RLFA 3BVGA 1K52A 1B1ZA 1HA5A 4OHJA 2LMCA 4DXGA 4S0RA 3U7DA 1V1PA 2W82A 3I57A 4AQ7A 1WXQA 5H92C 2K6DB 3L08A 4C4VA 4AS1A 4BKTA 2K39A 4ZHPA 1D5XC 3Q8BA 5BYRA 3V05A 2GBKA 3O13A 3ZO5B 5G5HA 2GI9A 2IO1B 2IDYA 1XLOA 3AN1A 3APCA 2LGIA 2MBEA 3P1MA 2KC1A 2KDBA 2BYEA 4PS8A 4KKJA 3BK2A 1H4RA 1T6BX 4IOIE 1FCCC 2RPVA 1FXAA 3Q3JA 5E6PA 4J3OD 5E6JA 1BMLC 2LVQA 5LLIA 4NJCA 2LJIA 3U52E 2DLBA 3AV8A 1FMAD 2MJ3A 2FUG1 4MGZE 4AUQC 3L0WB 3ZJTA 1J7BA 4W9IA 1T0SC 2GBRA 4FJYA 2IYDB 3AU4A 1EO6A 2O2VA 3C19A 1Q5WB 4E74A 1QOGA 3H7PB 2BB5A 3RFZB 2LEKA 3Q8CA 3QWZB 3ZDTA 1HQRD 3R8BA 4EOYA 2KO3A 1A5RA 1IGDA 2REXA 1QT9A 4IM2A 3U30A 1V97A 5J2RA 2KX0A 2UU7A 3VHTC 2BYVE 3UIPB 2Y5PA 1MHHE 3HVDA 2BWES 4AJWA 3FKYA 1XT9B 3A4SC 4WJPA 4W9DA 1TJEA 4JGHB 1WFYA 1JROA 2BW2A 1Y56A 2XNAC 2KDMA 3DBHI 2BT6A 3HUIA 1QOFA 4LNNA 2CHXA 2ZPNA 4HROA 2QEJC 2XK5A 4GDKB 1FPYA 2IBIB 4S17A 3DBHB 3KYCD 3VTUA 2A5UA 2K22A 3KH0A 2MP2B 2KTRA 2NPTB 2J0KA 2OJRA 3AU5A 4MH8A 5AUIA 3OLMD 4BKSD 4EZKA 4DHZB 2N9PC 4M8MA 4K7WA 4FADA 1ISNA 4XE0A 3GP7A 2PVGC 2KC2A 2DYOA 3RZFA 1TS3A 3HK0A 2QDFA 2FCSA 4XX5A 3Q2AC 3E56A 1C9FA 2BQQA 1R4MI 1C77A 2N7JA 5EE3A 4H2AA 1E7VA 1SSNA 4L2YA 1GC6A 1YOVB 2I38A 4C7YA 3NY5A 3BINA 2MBOA 3NZUA 2D07B 3A9JB 3EFUA 4TUUA 4FJZA 4PS3A 3QX1A 4NNJB 2QHOA 2I1KA 2BS3B 5E6OA 1FFVA 1ZXIA 4GXBA 2CKHB 1GNUA 3QC8B 4I6NB 2V3NA 4M00A
chains in the Genus database with same CATH topology
4MEMA 4MGIE 4NAWA 3WAPA 1LXDA 2AL3A 4W9LA 3V61A 3HM3A 1YIWA 2MLBA 3DBLI 3JW0X 2IZVB 1H8CA 2KDFB 3RT3B 1WXMA 2PE6B 1WM3A 2O2VB 1WI0A 3ZKJC 4OVVA 2KLGA 3AXCA 2BGFA 4K81A 1D3ZA 1UBQA 2Y5BB 1OEYA 4KV2A 3TJPA 3R3MA 3PREA 2RR9A 4RMAA 4DBGA 2N1WA 2L0TA 2O6VB 3JVZX 3T8MA 2NCNA 4B6WA 2C9WB 1YQBA 2GBJA 1KLVA 2JZZA 2ZNVB 3PGEA 3ML9A 1M94A 2KQ7A 2GMIC 4MM3A 3VXWA 4F1SA 5JHAA 1UZXB 2CHWA 2WX0A 5C1ZA 2O6VA 1TBEA 4KSLC 5AZGA 1U4AA 4G11A 3RD2A 3RYTA 3H9DA 3VH4B 2DX5B 2KQSA 5L95C 2KN5A 3ZVVA 1KOTA 1V86A 2J7QB 2KJHB 5TR5A 4CHKA 1P9DU 4JIOU 2KDEB 5LXIB 2A4ZA 2JUOA 4XZ4A 4B95A 2D11A 3KUZA 1L7YA 3GOEA 4I6LB 1XQQA 1WM2A 5JH5C 2GOWA 2LGDA 3DBSA 4MGYE 1WZ0A 4NQKE 4EKUA 4NPNA 1J8CA 4MELA 5DPWA 2ZCBA 1I35A 3CSTA 1WMHB 4TKNA 2RGFA 4GIVA 2M0XA 3JSVB 3W1SA 2HE7A 3I3TB 3UQBA 1OGWA 3DPDA 3QJZA 2MQJA 2DYMA 2NBWB 2XK5B 1UH6A 4KIKB 1WMHA 4BKSA 1KM7A 3ZNID 4A20A 1WX8A 4ZRKA 2KMCA 2C7NB 5AZHA 2EMSA 3M95A 2IO0B 1Q0WB 4KIKA 4GU2A 3WIMA 3A1QA 4II2B 2JRIB 4PYUA 2L76A 3IBEA 4JL9A 2HD5B 5AZFA 4MDKE 2IO3B 1YJ1A 5IAAC 4DWFA 4HLEA 4KSKC 5G2NA 3R7QA 3DDCB 1S1QB 1UBIA 1J0GA 1CMXB 4ANWA 3OAWA 3UIOB 3R66C 3Q3FA 3T9LA 3L16A 4RM8A 2N4FA 4LJOB 4DHJD 4W9JA 3A4RA 3PRZA 1YX6B 3ZDMC 4ZYNA 2C7HA 2JT4B 3H1UA 4DDID 4BFRA 1Z2MA 1WXAA 3CF6E 4KZCA 1E8ZA 4G50A 3ZNZB 2CU1A 1ZGUB 4FJVB 1WX7A 1NI2A 2EMTA 3RZWC 1TZ1A 2KHWB 2IO2B 1TTNA 2KJRA 2G4DB 4AJYB 4HDQA 3TL5A 3HHMA 2XEWA 4MSQB 3ZNGC 3PT2B 4ZRJA 1K8RB 4ASWC 1SE9A 3HIZA 3NOBA 4X57B 4GOCA 3ENEA 2LASA 3W1YA 5D6JB 3AI5A 2JY6A 2GBNA 3WALA 3SD5A 3VUYA 3M3JA 1SGHA 4G3XB 1C3TA 3DVNU 3LJ3A 4CO7A 1FXTB 3D32A 2L0FA 2V3SA 4GSWA 3QAQA 4LCDE 3CMMB 2WX1A 2JF5A 5J17A 1AARA 2LJ5A 3PV1A 4FA6A 2DZKA 1WXVA 4AWJA 2FCNA 3QCAA 5DPTA 4IUMB 5C23A 4A3PA 3PPAA 3S2AA 1OQYA 3WAMA 3APDA 4K7SA 5JHBA 2C60A 3PLUA 3DBRI 1W6VA 3NS8A 2LWPA 2WDTB 1WE7A 3HM6X 4EZLA 2XBBC 1P98A 1X1MA 4K1RB 5CTRC 2YVCA 2LD9A 2KD0A 3SU8X 5DPRA 2MWSB 2HJ8A 3APFA 2BPSA 4GMVA 4HXDA 3PHXB 2MSED 2FNJB 2N9XA 3LDZE 3VUWA 5CX3A 5FR6A 1GUAB 1GJZA 1IPGA 2LRWA 5CHWA 2YLMA 4IW0A 3UF8A 1GG3A 2LI5A 2FCMA 3X23A 4AP4C 4XC2A 4FN2A 5L83A 2KVRA 2L05A 2ZVNA 3K9OB 4II3B 4KDIC 3BY4B 1VD2A 2KTFA 3VTWA 4EUTA 2MW5A 5D7GA 3TIXA 2R2OA 1WE6A 3M62B 2WYQA 3JYUA 5KHOA 2IY1B 2K8HA 3KUCB 3R7RA 2K8BA 1E5WA 3EECA 3DQVA 4WAAA 1UELA 2DZMA 3EC8A 2L3ZA 2KLCA 3ZW3A 1WRDB 1KJTA 2UYZB 2WWZA 2B3AA 4HK2A 3M63B 3H7PA 3DVNV 4IC7B 2M1MA 3ZTCA 5GMVA 2ZJDA 3OJ3A 3A1QB 4BVUC 4WQOB 4DDGD 1QZEA 4DHJB 1WJUA 2MX2A 3UQAA 2RSUA 2JWZA 4CYEA 1V9JA 1L2NA 2KFKB 1WF9A 3N3KB 1WR1A 4TQ0A 4W9HA 3ZRCA 2KWVB 2MRPA 5IA7A 2KWCA 1YX5B 3ZNHB 1Z5SB 2M8SA 2LRUA 3DVGX 1E8WA 2LXAA 3DCGA 2I1JA 2KXJA 4URKA 2PJHA 2KFKA 3N32A 5D94A 5KHQA 1OEYJ 2AWTA 2G4SA 3QQ8B 1J19A 4DHZE 1P0RA 2KFJA 2BF8B 2MA9B 4KZ0A 4HPLB 2K6QA 1VCBA 3L17A 3K9PB 5G55A 3PTFC 4FBJB 2ZVOA 1IP9A 4HCNB 2V4LA 1F9JA 3KUDB 1WJNA 5CHFA 2KWUB 3PHWB 3OJ4B 1WGHA 2PE9A 4HJKA 1V2YA 2DZIA 1WJ6A 4LDTD 1T0YA 3H6NA 3V60A 4BOZB 4ANXA 4G0NB 3MJWA 4LJPB 5BO4B 1WGGA 4EFOA 4W9EA 1RLFA 4YL8A 1I42A 1V5TA 4ICVA 2M4NA 2L00B 4AOFA 3QARA 4I6PA 2N1VA 1IYFA 3GZNI 2D3GA 2JXXA 4W9FA 3U7DA 2ZCCA 2KK8A 2BWFA 3TMPB 1LM8B 4ANUA 2ZPYA 3NHEB 4M8NA 2OOBB 5J18A 4IG7B 3VFKA 2CHZA 3VUXA 1WZ3A 3ZUNA 2DHZA 4P7IA 2W9NA 1G6JA 2K6DB 3L08A 1P1AA 4DK5A 4E3CA 2JPHA 4BKTA 1V6EA 2K39A 3KVFB 3V6EB 2MBBB 2JVCA 1WIAA 2JRHA 4HCPB 3ECIA 3VTVA 4W9KA 1WH3A 1MG8A 2K8CA 4ZDVA 2GBKA 3ZO5B 5E6NA 3ZTDA 2IO1B 2ZZPB 4WJQA 3N30A 4K7UA 2BKRB 4NJ7A 2DENB 2IY0B 1JRUA 3APCA 2LZ6A 2MBEA 1R4NI 4NJ6A 3PSEB 3H7SA 1V49A 2CR5A 4M0WB 2JZ3B 3PRMB 2KC1A 2KDBA 2Z59B 4WJOA 2BYEA 4PS8A 5AEKB 2HTHA 1H4RA 2D2QA 2FAZA 2G3QB 4WWNA 4MSMB 3ZIMA 2MBQA 3A9JA 1EUVB 3RULA 2VRRB 4A3OA 1V5OA 3Q3JA 4HPMB 5E6PA 3QA8A 3A9KB 2BKFA 2DZJA 3U8ZA 2LVQA 3DVGY 5LLIA 2KZRA 2R2QA 3AULA 3KW5B 1WYWB 2ZEQA 1WX9A 1E7UA 2K25A 1HE8A 2NBUA 3A33B 1WJ4A 3WA0A 4ICUA 4GGQA 3A9KA 4ZRIA 4MGZE 3X0WA 4AUQC 3QK0A 1P3QU 1RAXA 1EF5A 2AEHA 1UD7A 3L0WB 1UGMA 4W9IA 3WANA 2L8JA 2GBRA 1TGZB 1WR6E 1Y8RC 2IYDB 4FJYA 4JQWC 4BBNC 3O65B 3AU4A 1EO6A 2O2VA 3C0RB 1Q5WB 4E74A 3PRPB 3L13A 2DAFA 2NVUI 3H7PB 1EF1A 3ALBA 3QHTA 3QWZB 4EEWA 3ZDTA 1XD3B 1ZKHA 1Q1OA 1E8XA 2LVPA 1WXSA 3VAWA 4BKGA 4EOYA 2KANA 2ASQA 2KMAA 3VVWB 2KO3A 2FCQA 1A5RA 4IWQA 4NQLB 2RD0A 3EHVA 2REXA 4KDLB 4IM2A 3U30A 5J2RA 2FUHB 2GBMA 2KX0A 2FIFA 3L10B 3VHTC 2NR2A 4GB9A 4J6IA 3TBLD 4BBNF 4F8CB 2BYVE 2N9EB 3MTNB 2MCNB 3UIPB 1V80A 2KNBA 4LDTB 3VQIA 3UGBB 4DXAB 2NBVB 2BWES 4AJWA 5D2MB 2O6VD 1XT9B 3A4SC 4WJPA 4GN1A 5EDSA 4W9DA 3UINB 4IM3A 3B1LX 3ONSA 4IM0A 1GC7A 2NS5A 1OTRB 2RPQA 4JGHB 2CS4A 4PS7A 4MJSB 1WFYA 5DPSA 3V62A 2KJ6A 2DYBA 2Z0EB 2V1YA 5HKHA 1E8YA 4IWPA 4FHJA 4ANVA 2K1FA 2AYOB 3DBHI 3JSVA 3VDZA 3ZRFA 2KX3A 4KVGB 4MJSA 4FHKA 3V6CB 2CHXA 2ZPNA 4PYZA 2KTRB 2XK5A 2AL6A 4GDKB 4HDOA 2C5LC 2IBIB 3IHPC 3KYCD 3VTUA 3L54A 3VH3B 3MHSD 4JLCA 2A5UA 3CSFA 2M17A 2L7RA 3KH0A 3SDLC 4HVBA 1NBFC 2MP2B 2KTRA 2LUEA 2J0KA 2NPTB 2OJRA 3AU5A 4GDKA 3TCAA 2KKCA 2J0JA 2D10A 2LVOA 3OLMD 4TQ1A 4BKSD 4EZKA 1BT0A 2N7DA 4DHZB 2N9PC 5JZEB 4M8MA 4K7WA 4FADA 1ISNA 1LFDA 1RFAA 2MP2A 1WY8A 1ZW7A 2NPTA 1SIFA 3QIJA 2KC2A 2DYOA 3RUIB 3LMNA 4MGKE 3RZFA 3WAOA 3HK0A 2J0MA 2FCSA 4XX5A 4W9GA 2C7MB 4TV3A 4F7ZA 1R4MI 1E7VA 2ZNVC 1WGDA 3IVFA 4GDLB 2FIDA 3PZDA 2PEAA 1LQBA 1GC6A 4FLHA 1PQSA 3PS6A 4W9CA 5LXHA 2BYFA 4B9KA 2N7EA 3IG3A 1C1YB 2LXCA 1V81A 2KOXA 3B08A 4OVUA 4GDLA 2Z0DB 2G45B 4NY0A 3NY5A 4RM9A 3BINA 3KYDD 2MBOA 3NZUA 2MBHA 1NDDA 4HWIB 3P2BA 4MH0E 4N9F4 4WWOA 2D07B 3DOWA 1E90A 5DCNA 2EKEC 3ZLZA 2DAJA 2PPHA 3IFWB 3W1SC 3A9JB 4E71A 3EFUA 1S3SG 4TUUA 4EZJA 4FJZA 4PS3A 3NZSA 3QX1A 3RCZA 4NNJB 1WGYA 2QHOA 4FULA 1RRBA 2I1KA 2KDIA 1WGRA 5E6OA 4NAWB 1YD8U 3SHQA 4GXBA 3ML8A 3PVLA 2LGXA 4WWPA 2UWQA 3B0AA 2CKHB 1GNUA 3QC8B 4I6NB 4WJNA 5CHVC 4BOSC 4IWOA 3PLVA 2LGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MEM A;  4MGI E;  4NAW A;  3WAP A;  1LXD A;  2AL3 A;  4W9L A;  3V61 A;  3HM3 A;  1YIW A;  2MLB A;  3DBL I;  3JW0 X;  2IZV B;  1H8C A;  2KDF B;  3RT3 B;  1WXM A;  2PE6 B;  1WM3 A;  2O2V B;  1WI0 A;  3ZKJ C;  4OVV A;  2KLG A;  3AXC A;  2BGF A;  4K81 A;  1D3Z A;  1UBQ A;  2Y5B B;  1OEY A;  4KV2 A;  3TJP A;  3R3M A;  3PRE A;  2RR9 A;  4RMA A;  4DBG A;  2N1W A;  2L0T A;  2O6V B;  3JVZ X;  3T8M A;  2NCN A;  4B6W A;  2C9W B;  1YQB A;  2GBJ A;  1KLV A;  2JZZ A;  2ZNV B;  3PGE A;  3ML9 A;  1M94 A;  2KQ7 A;  2GMI C;  4MM3 A;  3VXW A;  4F1S A;  5JHA A;  1UZX B;  2CHW A;  2WX0 A;  5C1Z A;  2O6V A;  1TBE A;  4KSL C;  5AZG A;  1U4A A;  4G11 A;  3RD2 A;  3RYT A;  3H9D A;  3VH4 B;  2DX5 B;  2KQS A;  5L95 C;  2KN5 A;  3ZVV A;  1KOT A;  1V86 A;  2J7Q B;  2KJH B;  5TR5 A;  4CHK A;  1P9D U;  4JIO U;  2KDE B;  5LXI B;  2A4Z A;  2JUO A;  4XZ4 A;  4B95 A;  2D11 A;  3KUZ A;  1L7Y A;  3GOE A;  4I6L B;  1XQQ A;  1WM2 A;  5JH5 C;  2GOW A;  2LGD A;  3DBS A;  4MGY E;  1WZ0 A;  4NQK E;  4EKU A;  4NPN A;  1J8C A;  4MEL A;  5DPW A;  2ZCB A;  1I35 A;  3CST A;  1WMH B;  4TKN A;  2RGF A;  4GIV A;  2M0X A;  3JSV B;  3W1S A;  2HE7 A;  3I3T B;  3UQB A;  1OGW A;  3DPD A;  3QJZ A;  2MQJ A;  2DYM A;  2NBW B;  2XK5 B;  1UH6 A;  4KIK B;  1WMH A;  4BKS A;  1KM7 A;  3ZNI D;  4A20 A;  1WX8 A;  4ZRK A;  2KMC A;  2C7N B;  5AZH A;  2EMS A;  3M95 A;  2IO0 B;  1Q0W B;  4KIK A;  4GU2 A;  3WIM A;  3A1Q A;  4II2 B;  2JRI B;  4PYU A;  2L76 A;  3IBE A;  4JL9 A;  2HD5 B;  5AZF A;  4MDK E;  2IO3 B;  1YJ1 A;  5IAA C;  4DWF A;  4HLE A;  4KSK C;  5G2N A;  3R7Q A;  3DDC B;  1S1Q B;  1UBI A;  1J0G A;  1CMX B;  4ANW A;  3OAW A;  3UIO B;  3R66 C;  3Q3F A;  3T9L A;  3L16 A;  4RM8 A;  2N4F A;  4LJO B;  4DHJ D;  4W9J A;  3A4R A;  3PRZ A;  1YX6 B;  3ZDM C;  4ZYN A;  2C7H A;  2JT4 B;  3H1U A;  4DDI D;  4BFR A;  1Z2M A;  1WXA A;  3CF6 E;  4KZC A;  1E8Z A;  4G50 A;  3ZNZ B;  2CU1 A;  1ZGU B;  4FJV B;  1WX7 A;  1NI2 A;  2EMT A;  3RZW C;  1TZ1 A;  2KHW B;  2IO2 B;  1TTN A;  2KJR A;  2G4D B;  4AJY B;  4HDQ A;  3TL5 A;  3HHM A;  2XEW A;  4MSQ B;  3ZNG C;  3PT2 B;  4ZRJ A;  1K8R B;  4ASW C;  1SE9 A;  3HIZ A;  3NOB A;  4X57 B;  4GOC A;  3ENE A;  2LAS A;  3W1Y A;  5D6J B;  3AI5 A;  2JY6 A;  2GBN A;  3WAL A;  3SD5 A;  3VUY A;  3M3J A;  1SGH A;  4G3X B;  1C3T A;  3DVN U;  3LJ3 A;  4CO7 A;  1FXT B;  3D32 A;  2L0F A;  2V3S A;  4GSW A;  3QAQ A;  4LCD E;  3CMM B;  2WX1 A;  2JF5 A;  5J17 A;  1AAR A;  2LJ5 A;  3PV1 A;  4FA6 A;  2DZK A;  1WXV A;  4AWJ A;  2FCN A;  3QCA A;  5DPT A;  4IUM B;  5C23 A;  4A3P A;  3PPA A;  3S2A A;  1OQY A;  3WAM A;  3APD A;  4K7S A;  5JHB A;  2C60 A;  3PLU A;  3DBR I;  1W6V A;  3NS8 A;  2LWP A;  2WDT B;  1WE7 A;  3HM6 X;  4EZL A;  2XBB C;  1P98 A;  1X1M A;  4K1R B;  5CTR C;  2YVC A;  2LD9 A;  2KD0 A;  3SU8 X;  5DPR A;  2MWS B;  2HJ8 A;  3APF A;  2BPS A;  4GMV A;  4HXD A;  3PHX B;  2MSE D;  2FNJ B;  2N9X A;  3LDZ E;  3VUW A;  5CX3 A;  5FR6 A;  1GUA B;  1GJZ A;  1IPG A;  2LRW A;  5CHW A;  2YLM A;  4IW0 A;  3UF8 A;  1GG3 A;  2LI5 A;  2FCM A;  3X23 A;  4AP4 C;  4XC2 A;  4FN2 A;  5L83 A;  2KVR A;  2L05 A;  2ZVN A;  3K9O B;  4II3 B;  4KDI C;  3BY4 B;  1VD2 A;  2KTF A;  3VTW A;  4EUT A;  2MW5 A;  5D7G A;  3TIX A;  2R2O A;  1WE6 A;  3M62 B;  2WYQ A;  3JYU A;  5KHO A;  2IY1 B;  2K8H A;  3KUC B;  3R7R A;  2K8B A;  1E5W A;  3EEC A;  3DQV A;  4WAA A;  1UEL A;  2DZM A;  3EC8 A;  2L3Z A;  2KLC A;  3ZW3 A;  1WRD B;  1KJT A;  2UYZ B;  2WWZ A;  2B3A A;  4HK2 A;  3M63 B;  3H7P A;  3DVN V;  4IC7 B;  2M1M A;  3ZTC A;  5GMV A;  2ZJD A;  3OJ3 A;  3A1Q B;  4BVU C;  4WQO B;  4DDG D;  1QZE A;  4DHJ B;  1WJU A;  2MX2 A;  3UQA A;  2RSU A;  2JWZ A;  4CYE A;  1V9J A;  1L2N A;  2KFK B;  1WF9 A;  3N3K B;  1WR1 A;  4TQ0 A;  4W9H A;  3ZRC A;  2KWV B;  2MRP A;  5IA7 A;  2KWC A;  1YX5 B;  3ZNH B;  1Z5S B;  2M8S A;  2LRU A;  3DVG X;  1E8W A;  2LXA A;  3DCG A;  2I1J A;  2KXJ A;  4URK A;  2PJH A;  2KFK A;  3N32 A;  5D94 A;  5KHQ A;  1OEY J;  2AWT A;  2G4S A;  3QQ8 B;  1J19 A;  4DHZ E;  1P0R A;  2KFJ A;  2BF8 B;  2MA9 B;  4KZ0 A;  4HPL B;  2K6Q A;  1VCB A;  3L17 A;  3K9P B;  5G55 A;  3PTF C;  4FBJ B;  2ZVO A;  1IP9 A;  4HCN B;  2V4L A;  1F9J A;  3KUD B;  1WJN A;  5CHF A;  2KWU B;  3PHW B;  3OJ4 B;  1WGH A;  2PE9 A;  4HJK A;  1V2Y A;  2DZI A;  1WJ6 A;  4LDT D;  1T0Y A;  3H6N A;  3V60 A;  4BOZ B;  4ANX A;  4G0N B;  3MJW A;  4LJP B;  5BO4 B;  1WGG A;  4EFO A;  4W9E A;  1RLF A;  4YL8 A;  1I42 A;  1V5T A;  4ICV A;  2M4N A;  2L00 B;  4AOF A;  3QAR A;  4I6P A;  2N1V A;  1IYF A;  3GZN I;  2D3G A;  2JXX A;  4W9F A;  3U7D A;  2ZCC A;  2KK8 A;  2BWF A;  3TMP B;  1LM8 B;  4ANU A;  2ZPY A;  3NHE B;  4M8N A;  2OOB B;  5J18 A;  4IG7 B;  3VFK A;  2CHZ A;  3VUX A;  1WZ3 A;  3ZUN A;  2DHZ A;  4P7I A;  2W9N A;  1G6J A;  2K6D B;  3L08 A;  1P1A A;  4DK5 A;  4E3C A;  2JPH A;  4BKT A;  1V6E A;  2K39 A;  3KVF B;  3V6E B;  2MBB B;  2JVC A;  1WIA A;  2JRH A;  4HCP B;  3ECI A;  3VTV A;  4W9K A;  1WH3 A;  1MG8 A;  2K8C A;  4ZDV A;  2GBK A;  3ZO5 B;  5E6N A;  3ZTD A;  2IO1 B;  2ZZP B;  4WJQ A;  3N30 A;  4K7U A;  2BKR B;  4NJ7 A;  2DEN B;  2IY0 B;  1JRU A;  3APC A;  2LZ6 A;  2MBE A;  1R4N I;  4NJ6 A;  3PSE B;  3H7S A;  1V49 A;  2CR5 A;  4M0W B;  2JZ3 B;  3PRM B;  2KC1 A;  2KDB A;  2Z59 B;  4WJO A;  2BYE A;  4PS8 A;  5AEK B;  2HTH A;  1H4R A;  2D2Q A;  2FAZ A;  2G3Q B;  4WWN A;  4MSM B;  3ZIM A;  2MBQ A;  3A9J A;  1EUV B;  3RUL A;  2VRR B;  4A3O A;  1V5O A;  3Q3J A;  4HPM B;  5E6P A;  3QA8 A;  3A9K B;  2BKF A;  2DZJ A;  3U8Z A;  2LVQ A;  3DVG Y;  5LLI A;  2KZR A;  2R2Q A;  3AUL A;  3KW5 B;  1WYW B;  2ZEQ A;  1WX9 A;  1E7U A;  2K25 A;  1HE8 A;  2NBU A;  3A33 B;  1WJ4 A;  3WA0 A;  4ICU A;  4GGQ A;  3A9K A;  4ZRI A;  4MGZ E;  3X0W A;  4AUQ C;  3QK0 A;  1P3Q U;  1RAX A;  1EF5 A;  2AEH A;  1UD7 A;  3L0W B;  1UGM A;  4W9I A;  3WAN A;  2L8J A;  2GBR A;  1TGZ B;  1WR6 E;  1Y8R C;  2IYD B;  4FJY A;  4JQW C;  4BBN C;  3O65 B;  3AU4 A;  1EO6 A;  2O2V A;  3C0R B;  1Q5W B;  4E74 A;  3PRP B;  3L13 A;  2DAF A;  2NVU I;  3H7P B;  1EF1 A;  3ALB A;  3QHT A;  3QWZ B;  4EEW A;  3ZDT A;  1XD3 B;  1ZKH A;  1Q1O A;  1E8X A;  2LVP A;  1WXS A;  3VAW A;  4BKG A;  4EOY A;  2KAN A;  2ASQ A;  2KMA A;  3VVW B;  2KO3 A;  2FCQ A;  1A5R A;  4IWQ A;  4NQL B;  2RD0 A;  3EHV A;  2REX A;  4KDL B;  4IM2 A;  3U30 A;  5J2R A;  2FUH B;  2GBM A;  2KX0 A;  2FIF A;  3L10 B;  3VHT C;  2NR2 A;  4GB9 A;  4J6I A;  3TBL D;  4BBN F;  4F8C B;  2BYV E;  2N9E B;  3MTN B;  2MCN B;  3UIP B;  1V80 A;  2KNB A;  4LDT B;  3VQI A;  3UGB B;  4DXA B;  2NBV B;  2BWE S;  4AJW A;  5D2M B;  2O6V D;  1XT9 B;  3A4S C;  4WJP A;  4GN1 A;  5EDS A;  4W9D A;  3UIN B;  4IM3 A;  3B1L X;  3ONS A;  4IM0 A;  1GC7 A;  2NS5 A;  1OTR B;  2RPQ A;  4JGH B;  2CS4 A;  4PS7 A;  4MJS B;  1WFY A;  5DPS A;  3V62 A;  2KJ6 A;  2DYB A;  2Z0E B;  2V1Y A;  5HKH A;  1E8Y A;  4IWP A;  4FHJ A;  4ANV A;  2K1F A;  2AYO B;  3DBH I;  3JSV A;  3VDZ A;  3ZRF A;  2KX3 A;  4KVG B;  4MJS A;  4FHK A;  3V6C B;  2CHX A;  2ZPN A;  4PYZ A;  2KTR B;  2XK5 A;  2AL6 A;  4GDK B;  4HDO A;  2C5L C;  2IBI B;  3IHP C;  3KYC D;  3VTU A;  3L54 A;  3VH3 B;  3MHS D;  4JLC A;  2A5U A;  3CSF A;  2M17 A;  2L7R A;  3KH0 A;  3SDL C;  4HVB A;  1NBF C;  2MP2 B;  2KTR A;  2LUE A;  2J0K A;  2NPT B;  2OJR A;  3AU5 A;  4GDK A;  3TCA A;  2KKC A;  2J0J A;  2D10 A;  2LVO A;  3OLM D;  4TQ1 A;  4BKS D;  4EZK A;  1BT0 A;  2N7D A;  4DHZ B;  2N9P C;  5JZE B;  4M8M A;  4K7W A;  4FAD A;  1ISN A;  1LFD A;  1RFA A;  2MP2 A;  1WY8 A;  1ZW7 A;  2NPT A;  1SIF A;  3QIJ A;  2KC2 A;  2DYO A;  3RUI B;  3LMN A;  4MGK E;  3RZF A;  3WAO A;  3HK0 A;  2J0M A;  2FCS A;  4XX5 A;  4W9G A;  2C7M B;  4TV3 A;  4F7Z A;  1R4M I;  1E7V A;  2ZNV C;  1WGD A;  3IVF A;  4GDL B;  2FID A;  3PZD A;  2PEA A;  1LQB A;  1GC6 A;  4FLH A;  1PQS A;  3PS6 A;  4W9C A;  5LXH A;  2BYF A;  4B9K A;  2N7E A;  3IG3 A;  1C1Y B;  2LXC A;  1V81 A;  2KOX A;  3B08 A;  4OVU A;  4GDL A;  2Z0D B;  2G45 B;  4NY0 A;  3NY5 A;  4RM9 A;  3BIN A;  3KYD D;  2MBO A;  3NZU A;  2MBH A;  1NDD A;  4HWI B;  3P2B A;  4MH0 E;  4N9F 4;  4WWO A;  2D07 B;  3DOW A;  1E90 A;  5DCN A;  2EKE C;  3ZLZ A;  2DAJ A;  2PPH A;  3IFW B;  3W1S C;  3A9J B;  4E71 A;  3EFU A;  1S3S G;  4TUU A;  4EZJ A;  4FJZ A;  4PS3 A;  3NZS A;  3QX1 A;  3RCZ A;  4NNJ B;  1WGY A;  2QHO A;  4FUL A;  1RRB A;  2I1K A;  2KDI A;  1WGR A;  5E6O A;  4NAW B;  1YD8 U;  3SHQ A;  4GXB A;  3ML8 A;  3PVL A;  2LGX A;  4WWP A;  2UWQ A;  3B0A A;  2CKH B;  1GNU A;  3QC8 B;  4I6N B;  4WJN A;  5CHV C;  4BOS C;  4IWO A;  3PLV A;  2LGY A; 
#chains in the Genus database with same CATH topology
 3NVZ A;  1FD6 A;  4MEM A;  4NAW A;  4P1B C;  4DQO C;  1L0Y B;  2Q5W D;  3V61 A;  3NVW A;  2IGG A;  3DBL I;  4TSS A;  2IZV B;  1L4D B;  4OVZ A;  4YT0 B;  3AE2 B;  3RT3 B;  3ZXV A;  2KLG A;  3I9V 1;  1D3Z A;  3DBL B;  1B9R A;  2L0T A;  3T8M A;  3JVZ X;  3IT4 B;  4RF1 A;  2KAJ A;  1YQB A;  4YTM B;  3AMZ A;  3ML9 A;  2JYE A;  2CHW A;  1TBE A;  4KSL C;  2ACZ B;  1KOT A;  2J7Q B;  2MHJ A;  1P9D U;  2KDE B;  2A4Z A;  4I6L B;  3HVZ A;  1BUI C;  5JH5 C;  3DBS A;  2LGD A;  4D2K A;  2RGF A;  5FR3 A;  1OGW A;  2NBW B;  1UH6 A;  4ZRQ A;  1WMH A;  4IDI A;  1T0R C;  1CQV A;  2HDE A;  4A20 A;  1WX8 A;  2PW9 A;  4II2 B;  4PYU A;  2HD5 B;  2IO3 B;  2I2Y A;  5H8Y E;  2INC C;  3AM9 A;  3OAW A;  4JX1 C;  3UIO B;  3Q3F A;  4RM8 A;  2M56 B;  4LJO B;  4DHJ D;  4WQM A;  2LHD A;  5GXG B;  4REZ A;  1UF0 A;  4DDI D;  1GAQ B;  1HXY D;  4HRS A;  3CF6 E;  1ZGU B;  4FJV B;  1JAL A;  1NI2 A;  2EMT A;  2JZP A;  3KWL A;  3DWM A;  2IO2 B;  1TTN A;  1TY0 A;  1ZDV A;  3TL5 A;  3ZNG C;  3PT2 B;  1PGX A;  4ASW C;  3NOB A;  2Y3A A;  2IJ0 A;  2VZK B;  3ENE A;  2LAS A;  3AEA B;  2GBN A;  2W3S A;  3SD5 A;  3M3J A;  1JWA D;  1LO5 D;  3LJ3 A;  3NRZ A;  3D32 A;  2YEP B;  2BS2 B;  2V3S A;  2MJE A;  3AE8 B;  2RDG A;  4LCD E;  3CMM B;  2BBC A;  2AQ1 B;  1JWU D;  3QCA A;  4M01 A;  1E0Z A;  1ET6 A;  3GS2 A;  3APD A;  5JHB A;  3DBR I;  4TMA B;  1WE7 A;  3HM6 X;  5LNK 1;  1ZXH A;  1X1M A;  4K1R B;  3Q8E A;  2YVC A;  3P4P B;  5DPR A;  2HJ8 A;  2BPS A;  1SEB D;  5G5G A;  2N9X A;  3LDZ E;  1GUA B;  1QF6 A;  2YLM A;  3UF8 A;  2LFI A;  3CIR B;  3RMK C;  2D3C A;  1PGA A;  2LI5 A;  2G1E A;  4AP4 C;  4XC2 A;  2KVR A;  2L05 A;  3N1X C;  1OQR A;  1VD2 A;  1RWS A;  3VTW A;  1K53 A;  4RGM A;  1VLB A;  5D7G A;  2KMM A;  4RGT A;  5KHO A;  2IY1 B;  2K8H A;  3KUC B;  3R7R A;  4WAA A;  3ZW3 A;  4HK2 A;  2UYZ B;  3M63 B;  3H7P A;  3DVN V;  3ZTC A;  1KFY B;  2ZJD A;  3BYT B;  2QJL A;  1WJU A;  2MX2 A;  3J9C A;  1YN5 A;  3N3K B;  2M8S A;  1E8W A;  2BB6 A;  2I1J A;  5HI1 A;  2PJH A;  3AEF B;  2WDV B;  4RGN A;  1OEY J;  5TSS A;  1GPX A;  2KFJ A;  2MH7 A;  3RNE C;  5G55 A;  2ZVO A;  1IP9 A;  2AQ2 B;  4HCN B;  4HEA 1;  1DOI A;  2KWU B;  3AB5 A;  4HJK A;  3V60 A;  1T0Y A;  3H6N A;  4LJP B;  4EFO A;  2KYW A;  1ENF A;  3FAH A;  2L00 B;  1HZ5 A;  3QAR A;  4I6P A;  1PDX A;  2QSD A;  2OED A;  4W9F A;  1MPE A;  4M8N A;  1NYQ A;  1I4X A;  1C79 A;  1N60 A;  2W9N A;  1G6J A;  1YMH E;  4E3C A;  3V6E B;  3KVF B;  2MBB B;  2PIA A;  4HCP B;  1WIA A;  2JRH A;  4JWU C;  3RNG C;  3MJ5 A;  1L6U A;  3ZXR A;  4K7U A;  4NJ7 A;  2IY0 B;  1R4N I;  3PSE B;  4M0W B;  1VZ8 A;  1ET9 A;  2D2Q A;  2G3Q B;  4MSM B;  2MBQ A;  3A9J A;  3MC0 B;  4HPM B;  4B0E A;  3QA8 A;  2QC8 A;  3DVG Y;  1I7H A;  2R2Q A;  2ZW0 A;  2HTM E;  3AUL A;  2BTE A;  2PTL A;  1WX9 A;  1GB1 A;  2NBU A;  1HE8 A;  2D3A A;  4GGQ A;  3A9K A;  4ZRI A;  2GB1 A;  2J53 A;  1EF5 A;  3WAN A;  1UGM A;  1DGJ A;  1FIQ A;  2NTS A;  1YJJ A;  1JCK B;  1XXG A;  2KT7 A;  2LVP A;  1Q1O A;  1E8X A;  4BKG A;  1CK1 A;  1WXS A;  5BMI A;  2KAN A;  2FCQ A;  4NQL B;  1AN8 A;  1KF6 B;  2ONQ A;  1AWD A;  3L10 B;  1TT5 B;  4J6I A;  4F8C B;  2N9E B;  3Q14 C;  3FIL A;  2L83 A;  1V80 A;  2KNB A;  1SE4 A;  1DOY A;  2NBV B;  3B2G A;  2V4I B;  5EDS A;  2CS4 A;  4ZYS A;  5DPS A;  2KJ6 A;  2DYB A;  2KN4 A;  2V1Y A;  3IAS 1;  1E8Y A;  2K1F A;  2AYO B;  3VDZ A;  2KX3 A;  4MJS A;  4FHK A;  2K9X A;  4RGO S;  2AL6 A;  4HDO A;  1D6E C;  5BMH A;  3EUB 2;  2CJN A;  3MHS D;  3CSF A;  4RF0 A;  2L7R A;  3SDL C;  3TCA A;  2J0J A;  2LVO A;  4TQ1 A;  1BT0 A;  1FXI A;  2WXM A;  5BYQ A;  2KQ4 X;  3QIJ A;  1L4Z B;  2WXK A;  2PVO D;  1FFU A;  2C7M B;  4KGR A;  1FNW A;  3P42 A;  3R2I A;  4RFB A;  2B76 B;  3IVF A;  4GDL B;  3PZD A;  1FRR A;  1YQ3 B;  2N7E A;  2MJD A;  1C1Y B;  3B08 A;  2Z0D B;  2WXR A;  2MBH A;  5DCN A;  1E90 A;  1F77 A;  2EKE C;  3GE3 C;  1VZ7 A;  4EZJ A;  3RCZ A;  3NZS A;  1WGY A;  2KDI A;  3AEB B;  1WGR A;  2WXH A;  1J7A A;  3SHQ A;  2CJO A;  4WJN A;  1IUE A;  1T5X D;  3DHG C;  1P7F A;  1LXD A;  2AL3 A;  4W9L A;  2M19 A;  3HM3 A;  2JU6 X;  1TS4 A;  2MLB A;  1WXM A;  2PE6 B;  1KLG D;  3DHH C;  1WI0 A;  3ZKJ C;  2VZK D;  4OVV A;  3AXC A;  1UBQ A;  1OEY A;  4YTP B;  3TJP A;  4WWM A;  2NTT A;  4RMA A;  1PYW D;  1ZOY B;  2O6V B;  2NCN A;  4B6W A;  1VDV A;  3T3N A;  2C9W B;  3P63 A;  1XCT L;  2JZZ A;  1DYQ A;  1D5Z C;  2KQ7 A;  4MM3 A;  5JHA A;  3ZYY X;  1UZX B;  2WX0 A;  5IKC M;  2JWU A;  1U4A A;  4LNK A;  2KQS A;  5L95 C;  2KN5 A;  4RH6 A;  1V1O A;  1V86 A;  5TR5 A;  3RNA C;  3BZD B;  4JIO U;  5LXI B;  3BK1 A;  1I4G A;  4XZ4 A;  3KUZ A;  1L7Y A;  1FNV A;  3AEG B;  1XQQ A;  4RCO A;  4NQK E;  5DPW A;  4R3D A;  1I35 A;  1WSP A;  2M0X A;  3JSV B;  3W1S A;  2HE7 A;  3I3T B;  2DYM A;  4BKS A;  4JE3 B;  1UWX A;  3ZNI D;  2C7N B;  4KIK A;  1I4H A;  1HZ6 A;  2JRI B;  5AZF A;  3B9J A;  2D5G A;  5IAA C;  1NVI D;  4DWF A;  3N1Z C;  3T9L A;  3L16 A;  3BVM A;  1E10 A;  3PRZ A;  1WRI A;  4MT5 A;  2JT4 B;  1SJH D;  1R7S A;  4KZC A;  2CU1 A;  3RZW C;  5EE9 A;  1R4M B;  1P7E A;  2KJR A;  4AJY B;  2WXI A;  3BYY B;  4HDQ A;  4A90 A;  2XEW A;  4MSQ B;  1HEZ E;  4ZRJ A;  1K8R B;  1XEE A;  1SE9 A;  3HIZ A;  1N62 A;  4ARI A;  4MAC A;  5D6J B;  4XDD A;  4G3X B;  1C3T A;  2AQ3 B;  3QAQ A;  3IXS A;  5J17 A;  2JF5 A;  2X38 A;  3PV1 A;  4HKQ A;  4BAX A;  2WXL A;  3PPA A;  3WAM A;  3PLU A;  1IBX B;  2WDT B;  4EZL A;  2KVZ A;  2WXG A;  3SU8 X;  2KD0 A;  2MWS B;  3APF A;  3FC4 A;  4HXD A;  4KGS A;  4L1B A;  5CX3 A;  3TSS A;  1IPG A;  4NAM A;  3E9S A;  3VR9 B;  2FCM A;  1GOZ A;  4ZRP A;  4II3 B;  4EUT A;  2MW5 A;  2R2O A;  3M62 B;  4PK1 A;  2K8B A;  1UEL A;  1L0V B;  4B0M A;  2KLC A;  3BVZ A;  4K3B A;  5FKA C;  2WWZ A;  4IC7 B;  2N9L A;  1XLQ A;  2M1M A;  1C4P A;  3OJ3 A;  3A1Q B;  1F2R I;  4WQO B;  4DDG D;  1RFK A;  4CYE A;  2KFK B;  1WR1 A;  1MJD A;  2KWC A;  1YX5 B;  2X8X X;  2LRU A;  2WXN A;  4URK A;  3QQ8 B;  2L32 A;  2K5P A;  3AE4 B;  4KZ0 A;  3K9P B;  3EGR A;  1ZPS A;  1F9J A;  5CHF A;  3GE8 C;  3MHZ A;  3MFG A;  4O1N A;  1WJ6 A;  4ANX A;  2YEP F;  4G0N B;  3MJW A;  5BO4 B;  4YL8 A;  1ZP0 B;  1I42 A;  1TKG A;  4AOF A;  4A8X C;  2RMM A;  3GZN I;  2JXX A;  2ZCC A;  2KK8 A;  2BWF A;  2OJW A;  1LM8 B;  4C4V B;  4ANU A;  5J18 A;  4IG7 B;  3ZUN A;  2DHZ A;  4P7I A;  1VZ6 A;  4DK5 A;  2QIE B;  2JPH A;  3Q6B A;  3U7Z A;  1VR9 A;  2W3R A;  3ETR A;  2K3U A;  2TSS A;  4M02 A;  5D3D A;  1WH3 A;  1MG8 A;  1C76 A;  4ZOH C;  5E6N A;  1D4B A;  3N1Y C;  1AYF A;  2BKR B;  4NJ6 A;  1JRU A;  1V49 A;  2JZ3 B;  3PRM B;  4WJO A;  4KGT A;  1K51 A;  2RDB C;  3Q69 A;  3ZIM A;  1EUV B;  4A3O A;  1AW7 A;  2IGD A;  3DBR B;  2BKF A;  1SIJ A;  2BS4 B;  3U8Z A;  2SAK A;  1JML A;  1EWC A;  2KZR A;  4XWW A;  3KW5 B;  2ZEQ A;  1TS2 A;  1E7U A;  2WQY B;  3A33 B;  3DWG C;  3WA0 A;  1FO4 A;  3AE1 B;  1NYR A;  3X0W A;  3EFC A;  3QK0 A;  1UD7 A;  4C00 A;  1F0Z A;  1TGZ B;  3IT6 B;  1Y8R C;  4JQW C;  3WCQ A;  4BBN C;  3O65 B;  1IGC A;  4P6V F;  1EM7 A;  3PRP B;  4QAY A;  2DAF A;  2NVU I;  1F52 A;  2WDR B;  3VAW A;  2KMA A;  3VVW B;  2RD0 A;  3EHV A;  4ZHO A;  3NG0 A;  4BBN F;  1L5P A;  4RNA A;  3MTN B;  5EE0 A;  2MCN B;  4LDT B;  3VQI A;  3UGB B;  4DXA B;  5HHD G;  2O6V D;  4GN1 A;  3IAM 1;  4IM3 A;  3B1L X;  4IM0 A;  2NS5 A;  2RPQ A;  1RM6 C;  5HKH A;  4IWP A;  1MVK A;  3JSV A;  1YNT E;  4PYZ A;  3AE3 B;  2KTR B;  2C5L C;  1STE A;  2IGH A;  1A70 A;  3VH3 B;  4XYC A;  2M17 A;  1NBF C;  2LUE A;  4P1C C;  4GDK A;  2KKC A;  3VRA B;  2N7D A;  2INN E;  1YJI A;  1JWM D;  1RFA A;  2MP2 A;  1WY8 A;  4WAF A;  2NPT A;  1N61 A;  3Q3O C;  1SIF A;  3RUI B;  2QMT A;  3WAO A;  1I4R A;  4W9G A;  4TV3 A;  4F7Z A;  1ZDX A;  1JW9 D;  3NVY A;  2ZNV C;  2PEA A;  4W9C A;  4FLH A;  4EE2 A;  2BYF A;  1ACC A;  2JQR B;  3I63 C;  2LXC A;  2EKI A;  4OVU A;  4XGA B;  4NY0 A;  4RM9 A;  3KYD D;  1PGB A;  1YN3 A;  3P2B A;  3P4R B;  4E71 A;  2DAJ A;  2PPH A;  2Z8L A;  2KAC A;  1S3S G;  4LK0 M;  4FUL A;  1L0X B;  1RRB A;  5C2T B;  1FCL A;  2QCZ A;  4NAW B;  1R4N B;  1TZO A;  5AUK A;  3U4E G;  2LGX A;  2UWQ A;  1VJK A;  2SEB D;  4IWO A;  4MGI E;  3WAP A;  1XCQ L;  1YIW A;  3ZQ4 A;  1H8C A;  2KDF B;  3MP9 A;  4K81 A;  2NMQ A;  2WXQ A;  3R3M A;  1UNS A;  5IP4 D;  2N1W A;  1GB4 A;  2GBJ A;  5IO9 A;  2ZNV B;  1M94 A;  2JX5 A;  2K0P A;  3RYT A;  3VH4 B;  1TYG B;  4CHK A;  2LGS A;  2D11 A;  3GOE A;  1WM2 A;  4YXD B;  4MGY E;  1WZ0 A;  2PKO A;  4NPN A;  3OWE B;  4MEL A;  3CST A;  1WMH B;  4TKN A;  4GIV A;  3Q3N C;  3UQB A;  3DPD A;  3QJZ A;  4WUR A;  3W5U B;  1E7P B;  1E9M A;  3PZ8 A;  4YSX B;  2WXF A;  4ZRK A;  1SJE D;  2EMS A;  3M95 A;  4YSZ B;  2IO0 B;  3WIM A;  3A1Q A;  1C78 A;  1T3Q A;  4N59 A;  2L76 A;  3IBE A;  4JL9 A;  4MDK E;  4HLE A;  4KSK C;  1S1Q B;  1UBI A;  1CMX B;  2WGS A;  3RPF C;  4LTU A;  3R66 C;  2WXJ A;  2JYT A;  2N4F A;  2N0S B;  2QIL A;  1N63 A;  1SXT A;  4ZYN A;  3H1U A;  1WXA A;  1E8Z A;  4G50 A;  1TZ1 A;  1KH0 A;  1L6V A;  2G4D B;  3L4P A;  1TKY A;  1WWT A;  4A55 A;  3HHM A;  2INP E;  1FRD A;  4GOC A;  3W1Y A;  1N5W A;  2JY6 A;  3TUO A;  3WAL A;  4YWG G;  4CQN A;  1LGR A;  1TY2 A;  3LXF A;  4WH4 A;  1SE3 A;  4OZC A;  1FXT B;  2L0F A;  4GSW A;  2N9K A;  2LJ5 A;  1WXV A;  2VH2 A;  4OZA A;  3NZ3 A;  2FCN A;  4ITK A;  4IUM B;  5C23 A;  2WLB A;  4A3P A;  2DWQ A;  3S2A A;  4K7S A;  2PMV A;  3CWI A;  4LLG M;  1EU4 A;  4YSY B;  3ZGZ A;  1TIF A;  2LWP A;  5CTR C;  1NI3 A;  2LD9 A;  1XF5 L;  3V3X A;  4GMV A;  2MSE D;  1KLU D;  2FNJ B;  2D3B A;  4N6E B;  5FR6 A;  1GJZ A;  3T3O A;  4YTN B;  4HJG E;  2EEL A;  3X23 A;  4FN2 A;  3K9O B;  3R2T A;  3MC8 A;  3BY4 B;  5IN7 A;  4KKI A;  3JYU A;  3HRD D;  3EEC A;  3C8Y A;  2DZM A;  3TEX A;  3EC8 A;  1PUT A;  3PO0 A;  2L1A A;  2L3Z A;  3SR6 A;  1SBB B;  1WRD B;  1KJT A;  1EWY C;  2BVC A;  1XO3 A;  3AE6 B;  3P4Q B;  4BVU C;  1QZE A;  1V8C A;  2JWZ A;  4W9H A;  3ZRC A;  1QIL A;  5IA7 A;  1QLB B;  4LNI A;  3I5J C;  3ZNH B;  1Z5S B;  4HPP A;  2KWD A;  3DCG A;  2KXJ A;  3GB1 A;  5KHQ A;  3B2F A;  2AWT A;  4XDC A;  4DHZ E;  2MA9 B;  1BXT A;  4L23 A;  3LYY A;  2K6Q A;  1VCB A;  1SE2 A;  3L17 A;  1UGJ A;  3PTF C;  4FBJ B;  2V4L A;  3KUD B;  4C7Z A;  2ICI A;  3ABV B;  3PHW B;  1V2Y A;  2DZI A;  4LDT D;  4BOZ B;  5JXV A;  5IOI A;  4W9E A;  1V5T A;  3SFE B;  1T0Q C;  2M4N A;  4ICV A;  4JPS A;  2WNM A;  3Q8A A;  2N1V A;  5FK9 C;  5C3J B;  1JQ4 A;  1IYF A;  3NVV A;  2D3G A;  3URY A;  1CZP A;  3TMP B;  2ZPY A;  3NHE B;  2OOB B;  3VFK A;  2CHZ A;  3VUX A;  1WZ3 A;  4US8 A;  5EE1 A;  1P1A A;  4BZA A;  1V6E A;  4KX6 B;  2LUM A;  2JVC A;  1N6Z A;  3ECI A;  3SFD B;  3VTV A;  4W9K A;  2K8C A;  4ZDV A;  2IND C;  2V9H A;  3ZTD A;  3OG5 A;  3AE5 B;  2ZZP B;  4WJQ A;  3N30 A;  1KRH A;  2DEN B;  2LZ6 A;  4N58 A;  3H7S A;  3AEE B;  2CR5 A;  5T8I A;  3VRB B;  2Z59 B;  2FBW B;  2E3T A;  1F2R C;  5AEK B;  2HTH A;  2FAZ A;  4WWN A;  3RUL A;  4M0W A;  2VRR B;  1V5O A;  3A9K B;  2DZJ A;  2Y5C A;  1WYW B;  2LHE A;  2K25 A;  1WJ4 A;  1QOA A;  4ICU A;  2H88 B;  1JRP A;  1P3Q U;  1RAX A;  2AEH A;  2IPK D;  4US9 A;  2L8J A;  1WR6 E;  1QKZ A;  4C56 C;  1ESF A;  3C0R B;  1ROE A;  2G9H D;  3L13 A;  1YQ4 B;  1EF1 A;  2W55 A;  3ALB A;  3QHT A;  2WU2 B;  4EEW A;  1XD3 B;  1ZKH A;  3U2S C;  2ASQ A;  3FIL B;  4IWQ A;  5MPO A;  2HJ1 A;  1C4C A;  4KDL B;  1UUP A;  1MHX A;  2FUH B;  2GBM A;  2FIF A;  3TEZ A;  2NR2 A;  4GB9 A;  4LNF A;  1ZUD 2;  3TBL D;  2E6X A;  1HTQ A;  3MC9 A;  1EU3 A;  5D2M B;  2M0A A;  4NZL B;  3UIN B;  3ONS A;  4C80 A;  1GC7 A;  1OTR B;  4PS7 A;  4MJS B;  3V62 A;  3AED B;  2Z0E B;  4FHJ A;  4ANV A;  1WYG A;  3ZRF A;  3V6C B;  3IHP C;  1M4V A;  3L54 A;  4JLC A;  1XLP A;  4HVB A;  3AEC B;  2JXT A;  2D10 A;  2J42 A;  1SF0 A;  2OHF A;  3NJT A;  1V1P B;  5JZE B;  1CJE A;  5HG2 A;  3P4S B;  1LFD A;  1ZW7 A;  4USA A;  2WHI A;  1I4Q A;  4A6Q A;  3LMN A;  4MGK E;  2J0M A;  3GZN B;  4GLS C;  5BYS A;  3SEB A;  2FE8 A;  1WGD A;  2FID A;  1LQB A;  4LNO A;  1PQS A;  3PS6 A;  3VR8 B;  5LXH A;  3AE9 B;  1WGK A;  2PLP A;  4B9K A;  1QOB A;  3IG3 A;  1DOX A;  1V81 A;  2KOX A;  3PZ7 A;  1MG4 A;  4GDL A;  2G45 B;  1Q10 A;  2H89 B;  2R61 A;  4MH0 E;  4WWO A;  3BII D;  4N9F 4;  1NDD A;  4HWI B;  3ZLZ A;  3DOW A;  3IFW B;  3W1S C;  3AE7 B;  2V0G A;  3RNC C;  1YD8 U;  1YN4 A;  1FM0 D;  3ML8 A;  1NEK B;  3PVL A;  4WWP A;  3B0A A;  5CHV C;  4BOS C;  3RNF C;  4KVG B;  3PLV A;  2LGY A;  1OQQ A;  1I4P A;  2V3P A;  4JWS C;  3JW0 X;  2WU5 B;  1WM3 A;  2O2V B;  2WP9 B;  2BGF A;  1TS5 A;  1E6E B;  1JWB D;  2Y5B B;  4KV2 A;  1MI0 A;  4HKZ E;  4MM3 B;  3PRE A;  2RR9 A;  2MEK A;  2J52 A;  4DBG A;  3ZJV A;  3RN9 C;  1KLV A;  3PGE A;  4F1S A;  2GMI C;  3VXW A;  1SB3 C;  5C1Z A;  2O6V A;  5AZG A;  4OW0 A;  4G11 A;  3RD2 A;  3KLS X;  3H9D A;  3Q8F A;  2ON8 A;  2DX5 B;  2WDQ B;  1FNU A;  2ZW1 A;  3ZVV A;  2KJH B;  3W5V B;  3TEY A;  3KWV A;  2JUO A;  4B95 A;  1NEN B;  5D3I B;  2GOW A;  4EKU A;  1J8C A;  2ZCB A;  3Q3M C;  1OFF A;  1ZE3 D;  2MQJ A;  2XK5 B;  4KIK B;  2WXP A;  1KM7 A;  3NUH B;  4OZB A;  2KMC A;  3N9Y C;  5AZH A;  1Q0W B;  4GU2 A;  3N20 C;  5I4D A;  3W2D A;  1YJ1 A;  1MFW A;  5G2N A;  3R7Q A;  3DDC B;  1J0G A;  4ANW A;  4DXF A;  4W9J A;  3A4R A;  1YX6 B;  3ZDM C;  4Q2J A;  2C7H A;  2VH1 A;  4BFR A;  4K3C A;  3UI3 A;  1Z2M A;  1J7C A;  3AH7 A;  2JSV X;  3ZNZ B;  1WX7 A;  1VRA B;  2KHW B;  1JWS D;  4UDU C;  3W9C B;  1QQR A;  4XWT A;  4ARC A;  1F1H A;  4WIP A;  4X57 B;  3AI5 A;  1UWM A;  4A9A A;  3VUY A;  3EA6 A;  1SGH A;  3DVN U;  1PFD A;  2BYT A;  4CO7 A;  2DBY A;  2WX1 A;  1AAR A;  3H8H A;  4FA6 A;  2DZK A;  4AWJ A;  2GLS A;  5DPT A;  1OQY A;  2C60 A;  1W6V A;  3NS8 A;  2XBB C;  1P98 A;  2RDH A;  3KQ4 A;  1IBX A;  3PHX B;  4P16 A;  3VUW A;  4PT5 A;  2LRW A;  4IKG A;  5CHW A;  1KTK A;  4IW0 A;  1GG3 A;  4FXC A;  5L83 A;  2L52 A;  2ZVN A;  3RNB C;  4KDI C;  5BMG A;  3ZJU A;  2KTF A;  2GRI A;  1HTO A;  3TIX A;  1WE6 A;  2AX5 A;  2WYQ A;  3RI7 C;  1E5W A;  3DQV A;  1FEH A;  4ACF A;  1N5X A;  1XLN A;  2B3A A;  1RYJ A;  1TKE A;  2WXO A;  5HFY A;  2DNF A;  5GMV A;  1K50 A;  4DHJ B;  1C4A A;  3UQA A;  2RSU A;  2XN9 C;  1V9J A;  1L2N A;  1WF9 A;  2CU3 A;  4TQ0 A;  2J4X A;  2KWV B;  2MRP A;  1D5M C;  3BWU D;  3TEW A;  3NS1 A;  3DVG X;  2LXA A;  2KFK A;  3N32 A;  5D94 A;  2G4S A;  1J19 A;  3LB8 C;  1P0R A;  2BF8 B;  4HPL B;  2W54 A;  1WJN A;  3OJ4 B;  1WGH A;  2PE9 A;  3DHI C;  1WGG A;  2WS3 B;  1RLF A;  3BVG A;  1K52 A;  1B1Z A;  1HA5 A;  4OHJ A;  2LMC A;  4DXG A;  4S0R A;  3U7D A;  1V1P A;  2W82 A;  3I57 A;  4AQ7 A;  1WXQ A;  5H92 C;  2K6D B;  3L08 A;  4C4V A;  4AS1 A;  4BKT A;  2K39 A;  4ZHP A;  1D5X C;  3Q8B A;  5BYR A;  3V05 A;  2GBK A;  3O13 A;  3ZO5 B;  5G5H A;  2GI9 A;  2IO1 B;  2IDY A;  1XLO A;  3AN1 A;  3APC A;  2LGI A;  2MBE A;  3P1M A;  2KC1 A;  2KDB A;  2BYE A;  4PS8 A;  4KKJ A;  3BK2 A;  1H4R A;  1T6B X;  4IOI E;  1FCC C;  2RPV A;  1FXA A;  3Q3J A;  5E6P A;  4J3O D;  5E6J A;  1BML C;  2LVQ A;  5LLI A;  4NJC A;  2LJI A;  3U52 E;  2DLB A;  3AV8 A;  1FMA D;  2MJ3 A;  2FUG 1;  4MGZ E;  4AUQ C;  3L0W B;  3ZJT A;  1J7B A;  4W9I A;  1T0S C;  2GBR A;  4FJY A;  2IYD B;  3AU4 A;  1EO6 A;  2O2V A;  3C19 A;  1Q5W B;  4E74 A;  1QOG A;  3H7P B;  2BB5 A;  3RFZ B;  2LEK A;  3Q8C A;  3QWZ B;  3ZDT A;  1HQR D;  3R8B A;  4EOY A;  2KO3 A;  1A5R A;  1IGD A;  2REX A;  1QT9 A;  4IM2 A;  3U30 A;  1V97 A;  5J2R A;  2KX0 A;  2UU7 A;  3VHT C;  2BYV E;  3UIP B;  2Y5P A;  1MHH E;  3HVD A;  2BWE S;  4AJW A;  3FKY A;  1XT9 B;  3A4S C;  4WJP A;  4W9D A;  1TJE A;  4JGH B;  1WFY A;  1JRO A;  2BW2 A;  1Y56 A;  2XNA C;  2KDM A;  3DBH I;  2BT6 A;  3HUI A;  1QOF A;  4LNN A;  2CHX A;  2ZPN A;  4HRO A;  2QEJ C;  2XK5 A;  4GDK B;  1FPY A;  2IBI B;  4S17 A;  3DBH B;  3KYC D;  3VTU A;  2A5U A;  2K22 A;  3KH0 A;  2MP2 B;  2KTR A;  2NPT B;  2J0K A;  2OJR A;  3AU5 A;  4MH8 A;  5AUI A;  3OLM D;  4BKS D;  4EZK A;  4DHZ B;  2N9P C;  4M8M A;  4K7W A;  4FAD A;  1ISN A;  4XE0 A;  3GP7 A;  2PVG C;  2KC2 A;  2DYO A;  3RZF A;  1TS3 A;  3HK0 A;  2QDF A;  2FCS A;  4XX5 A;  3Q2A C;  3E56 A;  1C9F A;  2BQQ A;  1R4M I;  1C77 A;  2N7J A;  5EE3 A;  4H2A A;  1E7V A;  1SSN A;  4L2Y A;  1GC6 A;  1YOV B;  2I38 A;  4C7Y A;  3NY5 A;  3BIN A;  2MBO A;  3NZU A;  2D07 B;  3A9J B;  3EFU A;  4TUU A;  4FJZ A;  4PS3 A;  3QX1 A;  4NNJ B;  2QHO A;  2I1K A;  2BS3 B;  5E6O A;  1FFV A;  1ZXI A;  4GXB A;  2CKH B;  1GNU A;  3QC8 B;  4I6N B;  2V3N A;  4M00 A; 
#chains in the Genus database with same CATH homology
 4MEM A;  4MGI E;  4NAW A;  3WAP A;  1LXD A;  2AL3 A;  4W9L A;  3V61 A;  3HM3 A;  1YIW A;  2MLB A;  3DBL I;  3JW0 X;  2IZV B;  1H8C A;  2KDF B;  3RT3 B;  1WXM A;  2PE6 B;  1WM3 A;  2O2V B;  1WI0 A;  3ZKJ C;  4OVV A;  2KLG A;  3AXC A;  2BGF A;  4K81 A;  1D3Z A;  1UBQ A;  2Y5B B;  1OEY A;  4KV2 A;  3TJP A;  3R3M A;  3PRE A;  2RR9 A;  4RMA A;  4DBG A;  2N1W A;  2L0T A;  2O6V B;  3JVZ X;  3T8M A;  2NCN A;  4B6W A;  2C9W B;  1YQB A;  2GBJ A;  1KLV A;  2JZZ A;  2ZNV B;  3PGE A;  3ML9 A;  1M94 A;  2KQ7 A;  2GMI C;  4MM3 A;  3VXW A;  4F1S A;  5JHA A;  1UZX B;  2CHW A;  2WX0 A;  5C1Z A;  2O6V A;  1TBE A;  4KSL C;  5AZG A;  1U4A A;  4G11 A;  3RD2 A;  3RYT A;  3H9D A;  3VH4 B;  2DX5 B;  2KQS A;  5L95 C;  2KN5 A;  3ZVV A;  1KOT A;  1V86 A;  2J7Q B;  2KJH B;  5TR5 A;  4CHK A;  1P9D U;  4JIO U;  2KDE B;  5LXI B;  2A4Z A;  2JUO A;  4XZ4 A;  4B95 A;  2D11 A;  3KUZ A;  1L7Y A;  3GOE A;  4I6L B;  1XQQ A;  1WM2 A;  5JH5 C;  2GOW A;  2LGD A;  3DBS A;  4MGY E;  1WZ0 A;  4NQK E;  4EKU A;  4NPN A;  1J8C A;  4MEL A;  5DPW A;  2ZCB A;  1I35 A;  3CST A;  1WMH B;  4TKN A;  2RGF A;  4GIV A;  2M0X A;  3JSV B;  3W1S A;  2HE7 A;  3I3T B;  3UQB A;  1OGW A;  3DPD A;  3QJZ A;  2MQJ A;  2DYM A;  2NBW B;  2XK5 B;  1UH6 A;  4KIK B;  1WMH A;  4BKS A;  1KM7 A;  3ZNI D;  4A20 A;  1WX8 A;  4ZRK A;  2KMC A;  2C7N B;  5AZH A;  2EMS A;  3M95 A;  2IO0 B;  1Q0W B;  4KIK A;  4GU2 A;  3WIM A;  3A1Q A;  4II2 B;  2JRI B;  4PYU A;  2L76 A;  3IBE A;  4JL9 A;  2HD5 B;  5AZF A;  4MDK E;  2IO3 B;  1YJ1 A;  5IAA C;  4DWF A;  4HLE A;  4KSK C;  5G2N A;  3R7Q A;  3DDC B;  1S1Q B;  1UBI A;  1J0G A;  1CMX B;  4ANW A;  3OAW A;  3UIO B;  3R66 C;  3Q3F A;  3T9L A;  3L16 A;  4RM8 A;  2N4F A;  4LJO B;  4DHJ D;  4W9J A;  3A4R A;  3PRZ A;  1YX6 B;  3ZDM C;  4ZYN A;  2C7H A;  2JT4 B;  3H1U A;  4DDI D;  4BFR A;  1Z2M A;  1WXA A;  3CF6 E;  4KZC A;  1E8Z A;  4G50 A;  3ZNZ B;  2CU1 A;  1ZGU B;  4FJV B;  1WX7 A;  1NI2 A;  2EMT A;  3RZW C;  1TZ1 A;  2KHW B;  2IO2 B;  1TTN A;  2KJR A;  2G4D B;  4AJY B;  4HDQ A;  3TL5 A;  3HHM A;  2XEW A;  4MSQ B;  3ZNG C;  3PT2 B;  4ZRJ A;  1K8R B;  4ASW C;  1SE9 A;  3HIZ A;  3NOB A;  4X57 B;  4GOC A;  3ENE A;  2LAS A;  3W1Y A;  5D6J B;  3AI5 A;  2JY6 A;  2GBN A;  3WAL A;  3SD5 A;  3VUY A;  3M3J A;  1SGH A;  4G3X B;  1C3T A;  3DVN U;  3LJ3 A;  4CO7 A;  1FXT B;  3D32 A;  2L0F A;  2V3S A;  4GSW A;  3QAQ A;  4LCD E;  3CMM B;  2WX1 A;  2JF5 A;  5J17 A;  1AAR A;  2LJ5 A;  3PV1 A;  4FA6 A;  2DZK A;  1WXV A;  4AWJ A;  2FCN A;  3QCA A;  5DPT A;  4IUM B;  5C23 A;  4A3P A;  3PPA A;  3S2A A;  1OQY A;  3WAM A;  3APD A;  4K7S A;  5JHB A;  2C60 A;  3PLU A;  3DBR I;  1W6V A;  3NS8 A;  2LWP A;  2WDT B;  1WE7 A;  3HM6 X;  4EZL A;  2XBB C;  1P98 A;  1X1M A;  4K1R B;  5CTR C;  2YVC A;  2LD9 A;  2KD0 A;  3SU8 X;  5DPR A;  2MWS B;  2HJ8 A;  3APF A;  2BPS A;  4GMV A;  4HXD A;  3PHX B;  2MSE D;  2FNJ B;  2N9X A;  3LDZ E;  3VUW A;  5CX3 A;  5FR6 A;  1GUA B;  1GJZ A;  1IPG A;  2LRW A;  5CHW A;  2YLM A;  4IW0 A;  3UF8 A;  1GG3 A;  2LI5 A;  2FCM A;  3X23 A;  4AP4 C;  4XC2 A;  4FN2 A;  5L83 A;  2KVR A;  2L05 A;  2ZVN A;  3K9O B;  4II3 B;  4KDI C;  3BY4 B;  1VD2 A;  2KTF A;  3VTW A;  4EUT A;  2MW5 A;  5D7G A;  3TIX A;  2R2O A;  1WE6 A;  3M62 B;  2WYQ A;  3JYU A;  5KHO A;  2IY1 B;  2K8H A;  3KUC B;  3R7R A;  2K8B A;  1E5W A;  3EEC A;  3DQV A;  4WAA A;  1UEL A;  2DZM A;  3EC8 A;  2L3Z A;  2KLC A;  3ZW3 A;  1WRD B;  1KJT A;  2UYZ B;  2WWZ A;  2B3A A;  4HK2 A;  3M63 B;  3H7P A;  3DVN V;  4IC7 B;  2M1M A;  3ZTC A;  5GMV A;  2ZJD A;  3OJ3 A;  3A1Q B;  4BVU C;  4WQO B;  4DDG D;  1QZE A;  4DHJ B;  1WJU A;  2MX2 A;  3UQA A;  2RSU A;  2JWZ A;  4CYE A;  1V9J A;  1L2N A;  2KFK B;  1WF9 A;  3N3K B;  1WR1 A;  4TQ0 A;  4W9H A;  3ZRC A;  2KWV B;  2MRP A;  5IA7 A;  2KWC A;  1YX5 B;  3ZNH B;  1Z5S B;  2M8S A;  2LRU A;  3DVG X;  1E8W A;  2LXA A;  3DCG A;  2I1J A;  2KXJ A;  4URK A;  2PJH A;  2KFK A;  3N32 A;  5D94 A;  5KHQ A;  1OEY J;  2AWT A;  2G4S A;  3QQ8 B;  1J19 A;  4DHZ E;  1P0R A;  2KFJ A;  2BF8 B;  2MA9 B;  4KZ0 A;  4HPL B;  2K6Q A;  1VCB A;  3L17 A;  3K9P B;  5G55 A;  3PTF C;  4FBJ B;  2ZVO A;  1IP9 A;  4HCN B;  2V4L A;  1F9J A;  3KUD B;  1WJN A;  5CHF A;  2KWU B;  3PHW B;  3OJ4 B;  1WGH A;  2PE9 A;  4HJK A;  1V2Y A;  2DZI A;  1WJ6 A;  4LDT D;  1T0Y A;  3H6N A;  3V60 A;  4BOZ B;  4ANX A;  4G0N B;  3MJW A;  4LJP B;  5BO4 B;  1WGG A;  4EFO A;  4W9E A;  1RLF A;  4YL8 A;  1I42 A;  1V5T A;  4ICV A;  2M4N A;  2L00 B;  4AOF A;  3QAR A;  4I6P A;  2N1V A;  1IYF A;  3GZN I;  2D3G A;  2JXX A;  4W9F A;  3U7D A;  2ZCC A;  2KK8 A;  2BWF A;  3TMP B;  1LM8 B;  4ANU A;  2ZPY A;  3NHE B;  4M8N A;  2OOB B;  5J18 A;  4IG7 B;  3VFK A;  2CHZ A;  3VUX A;  1WZ3 A;  3ZUN A;  2DHZ A;  4P7I A;  2W9N A;  1G6J A;  2K6D B;  3L08 A;  1P1A A;  4DK5 A;  4E3C A;  2JPH A;  4BKT A;  1V6E A;  2K39 A;  3KVF B;  3V6E B;  2MBB B;  2JVC A;  1WIA A;  2JRH A;  4HCP B;  3ECI A;  3VTV A;  4W9K A;  1WH3 A;  1MG8 A;  2K8C A;  4ZDV A;  2GBK A;  3ZO5 B;  5E6N A;  3ZTD A;  2IO1 B;  2ZZP B;  4WJQ A;  3N30 A;  4K7U A;  2BKR B;  4NJ7 A;  2DEN B;  2IY0 B;  1JRU A;  3APC A;  2LZ6 A;  2MBE A;  1R4N I;  4NJ6 A;  3PSE B;  3H7S A;  1V49 A;  2CR5 A;  4M0W B;  2JZ3 B;  3PRM B;  2KC1 A;  2KDB A;  2Z59 B;  4WJO A;  2BYE A;  4PS8 A;  5AEK B;  2HTH A;  1H4R A;  2D2Q A;  2FAZ A;  2G3Q B;  4WWN A;  4MSM B;  3ZIM A;  2MBQ A;  3A9J A;  1EUV B;  3RUL A;  2VRR B;  4A3O A;  1V5O A;  3Q3J A;  4HPM B;  5E6P A;  3QA8 A;  3A9K B;  2BKF A;  2DZJ A;  3U8Z A;  2LVQ A;  3DVG Y;  5LLI A;  2KZR A;  2R2Q A;  3AUL A;  3KW5 B;  1WYW B;  2ZEQ A;  1WX9 A;  1E7U A;  2K25 A;  1HE8 A;  2NBU A;  3A33 B;  1WJ4 A;  3WA0 A;  4ICU A;  4GGQ A;  3A9K A;  4ZRI A;  4MGZ E;  3X0W A;  4AUQ C;  3QK0 A;  1P3Q U;  1RAX A;  1EF5 A;  2AEH A;  1UD7 A;  3L0W B;  1UGM A;  4W9I A;  3WAN A;  2L8J A;  2GBR A;  1TGZ B;  1WR6 E;  1Y8R C;  2IYD B;  4FJY A;  4JQW C;  4BBN C;  3O65 B;  3AU4 A;  1EO6 A;  2O2V A;  3C0R B;  1Q5W B;  4E74 A;  3PRP B;  3L13 A;  2DAF A;  2NVU I;  3H7P B;  1EF1 A;  3ALB A;  3QHT A;  3QWZ B;  4EEW A;  3ZDT A;  1XD3 B;  1ZKH A;  1Q1O A;  1E8X A;  2LVP A;  1WXS A;  3VAW A;  4BKG A;  4EOY A;  2KAN A;  2ASQ A;  2KMA A;  3VVW B;  2KO3 A;  2FCQ A;  1A5R A;  4IWQ A;  4NQL B;  2RD0 A;  3EHV A;  2REX A;  4KDL B;  4IM2 A;  3U30 A;  5J2R A;  2FUH B;  2GBM A;  2KX0 A;  2FIF A;  3L10 B;  3VHT C;  2NR2 A;  4GB9 A;  4J6I A;  3TBL D;  4BBN F;  4F8C B;  2BYV E;  2N9E B;  3MTN B;  2MCN B;  3UIP B;  1V80 A;  2KNB A;  4LDT B;  3VQI A;  3UGB B;  4DXA B;  2NBV B;  2BWE S;  4AJW A;  5D2M B;  2O6V D;  1XT9 B;  3A4S C;  4WJP A;  4GN1 A;  5EDS A;  4W9D A;  3UIN B;  4IM3 A;  3B1L X;  3ONS A;  4IM0 A;  1GC7 A;  2NS5 A;  1OTR B;  2RPQ A;  4JGH B;  2CS4 A;  4PS7 A;  4MJS B;  1WFY A;  5DPS A;  3V62 A;  2KJ6 A;  2DYB A;  2Z0E B;  2V1Y A;  5HKH A;  1E8Y A;  4IWP A;  4FHJ A;  4ANV A;  2K1F A;  2AYO B;  3DBH I;  3JSV A;  3VDZ A;  3ZRF A;  2KX3 A;  4KVG B;  4MJS A;  4FHK A;  3V6C B;  2CHX A;  2ZPN A;  4PYZ A;  2KTR B;  2XK5 A;  2AL6 A;  4GDK B;  4HDO A;  2C5L C;  2IBI B;  3IHP C;  3KYC D;  3VTU A;  3L54 A;  3VH3 B;  3MHS D;  4JLC A;  2A5U A;  3CSF A;  2M17 A;  2L7R A;  3KH0 A;  3SDL C;  4HVB A;  1NBF C;  2MP2 B;  2KTR A;  2LUE A;  2J0K A;  2NPT B;  2OJR A;  3AU5 A;  4GDK A;  3TCA A;  2KKC A;  2J0J A;  2D10 A;  2LVO A;  3OLM D;  4TQ1 A;  4BKS D;  4EZK A;  1BT0 A;  2N7D A;  4DHZ B;  2N9P C;  5JZE B;  4M8M A;  4K7W A;  4FAD A;  1ISN A;  1LFD A;  1RFA A;  2MP2 A;  1WY8 A;  1ZW7 A;  2NPT A;  1SIF A;  3QIJ A;  2KC2 A;  2DYO A;  3RUI B;  3LMN A;  4MGK E;  3RZF A;  3WAO A;  3HK0 A;  2J0M A;  2FCS A;  4XX5 A;  4W9G A;  2C7M B;  4TV3 A;  4F7Z A;  1R4M I;  1E7V A;  2ZNV C;  1WGD A;  3IVF A;  4GDL B;  2FID A;  3PZD A;  2PEA A;  1LQB A;  1GC6 A;  4FLH A;  1PQS A;  3PS6 A;  4W9C A;  5LXH A;  2BYF A;  4B9K A;  2N7E A;  3IG3 A;  1C1Y B;  2LXC A;  1V81 A;  2KOX A;  3B08 A;  4OVU A;  4GDL A;  2Z0D B;  2G45 B;  4NY0 A;  3NY5 A;  4RM9 A;  3BIN A;  3KYD D;  2MBO A;  3NZU A;  2MBH A;  1NDD A;  4HWI B;  3P2B A;  4MH0 E;  4N9F 4;  4WWO A;  2D07 B;  3DOW A;  1E90 A;  5DCN A;  2EKE C;  3ZLZ A;  2DAJ A;  2PPH A;  3IFW B;  3W1S C;  3A9J B;  4E71 A;  3EFU A;  1S3S G;  4TUU A;  4EZJ A;  4FJZ A;  4PS3 A;  3NZS A;  3QX1 A;  3RCZ A;  4NNJ B;  1WGY A;  2QHO A;  4FUL A;  1RRB A;  2I1K A;  2KDI A;  1WGR A;  5E6O A;  4NAW B;  1YD8 U;  3SHQ A;  4GXB A;  3ML8 A;  3PVL A;  2LGX A;  4WWP A;  2UWQ A;  3B0A A;  2CKH B;  1GNU A;  3QC8 B;  4I6N B;  4WJN A;  5CHV C;  4BOS C;  4IWO A;  3PLV A;  2LGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...