3T9LA

Structure of n-terminal dusp-ubl domains of human usp15
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
222
structure length
222
Chain Sequence
b'AADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRLEHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 15
molecule tags Hydrolase
source organism Homo sapiens
publication title Structure of the USP15 N-Terminal Domains: A beta-Hairpin Mediates Close Association between the DUSP and UBL Domains
pubmed doi rcsb
total genus 69
structure length 222
sequence length 222
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06337 DUSP DUSP domain
A PF14836 Ubiquitin_3 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3t9lA02
3.30.2230.10 Alpha Beta 2-Layer Sandwich DUSP-like DUSP-like 3t9lA01
3QIJA 2KOXA 5E6OA 3N30A 3KUCB 5J2RA 4BKGA 3ZIMA 1WFYA 4NNJB 2NBWB 3EFUA 2FUHB 1WRDB 1WR6E 1ZW7A 3JW0X 1PQSA 3KVFB 3PGEA 5CX3A 1XT9B 4WWOA 1WXVA 1KJTA 2JY6A 3A9JB 2CKHB 3HIZA 1YQBA 1Q1OA 2LGYA 1R4MI 1WIAA 3EHVA 2BYEA 4KSKC 5FR6A 4AJYB 4JIOU 4EKUA 2O6VD 4MSMB 4ANUA 2WYQA 2KFKB 2OJRA 3ENEA 1RRBA 3MHSD 2B3AA 2RGFA 4HCPB 5L95C 2UWQA 3VDZA 4K1RB 3TL5A 2JWZA 4IG7B 2JF5A 4JQWC 2BGFA 2MBQA 3VUWA 4MDKE 3NOBA 4PS3A 4F1SA 2ZCCA 4FA6A 2FAZA 2AWTA 4GMVA 1ZGUB 5G55A 2HE7A 2AYOB 1Z2MA 3PHWB 2IO1B 1JRUA 5KHOA 3T8MA 3VTUA 2BPSA 3AI5A 4A20A 2LXAA 2BYVE 2XK5A 2W9NA 1TGZB 2LD9A 3KUZA 4WWNA 3UIPB 1WX7A 2JUOA 4AUQC 3L54A 5D2MB 2RR9A 2XEWA 1TTNA 2WWZA 2L8JA 2N1VA 2RSUA 3N32A 2O2VB 1E8YA 3GZNI 3PRPB 4KZCA 3ZNHB 3WANA 4ANXA 1P0RA 4FULA 3QAQA 4HPLB 3NZSA 4GB9A 4TUUA 3VQIA 4PS7A 3CSFA 3DVNU 2XK5B 3QCAA 2KO3A 5E6PA 4TQ0A 4MJSA 3H7PB 3M63B 4W9JA 4WAAA 3V6EB 2KDEB 1M94A 3ZLZA 3NHEB 4DBGA 3B08A 2I1KA 3ALBA 4II3B 3AXCA 5LXHA 4MGIE 4ICVA 3R7QA 4NJ7A 1YX5B 2BF8B 1E5WA 1T0YA 2MBBB 4PYZA 4W9KA 3ZNZB 4NAWA 5D7GA 2ZCBA 4BFRA 1OEYJ 2K25A 2DZJA 4I6LB 4ZYNA 4LJOB 1EF1A 1XQQA 3PZDA 1WJ6A 3D32A 3KYDD 3UGBB 4EOYA 4OVUA 2L3ZA 5AZGA 3ZNID 3ZRCA 3PRMB 4FHKA 1WZ3A 1NBFC 2PE6B 2BKRB 3QWZB 3QARA 4MGKE 4LDTB 5DPRA 3UIOB 2M4NA 4TV3A 1OEYA 2A5UA 4ZRIA 2ZVNA 1Q5WB 3JSVB 4W9HA 3V6CB 4KSLC 1D3ZA 4ANWA 2CS4A 3ML8A 1WE6A 2NPTA 2K6QA 1YIWA 2DZMA 2NVUI 3S2AA 1IP9A 4J6IA 2KHWB 1WY8A 2NCNA 3CF6E 2DZIA 3NS8A 4KIKA 3KW5B 2I1JA 3LJ3A 1WMHB 2L0TA 4BBNF 2EMSA 2JT4B 1C3TA 1K8RB 4YL8A 4G3XB 1WR1A 3JYUA 2K8CA 2FCSA 3TIXA 5D94A 4GGQA 4TKNA 4W9GA 3P2BA 3T9LA 3DBLI 4HXDA 1E8ZA 1V6EA 1Q0WB 4DDID 4F8CB 1WZ0A 4MH0E 4II2B 2YVCA 4ZRKA 2C5LC 4FN2A 3OJ4B 5LLIA 1E90A 1J8CA 1WGDA 2VRRB 3DBSA 4EFOA 2ZNVC 1W6VA 2CHWA 2IY1B 3DVGX 4BVUC 4DDGD 3HM3A 3R7RA 2D10A 2V4LA 4XZ4A 3UINB 2O6VA 3L16A 4W9EA 4MGYE 3RULA 3ZKJC 1AARA 2O2VA 1TZ1A 3BY4B 5GMVA 1P1AA 2MLBA 1LXDA 4LCDE 1GNUA 1WYWB 4K7SA 4KDIC 2DAJA 2Z59B 5DPSA 2N1WA 3R66C 3WAMA 2K8HA 2MP2A 4EZKA 5C1ZA 1GG3A 4KIKB 3DVGY 2GBNA 1WXMA 1WF9A 3Q3JA 2GBRA 3MJWA 3SDLC 4MELA 4A3PA 4HCNB 3VUYA 3W1YA 4MJSB 3U30A 3M62B 4IM3A 5IAAC 4DWFA 1I42A 1YX6B 1UZXB 3ZRFA 1UD7A 2V3SA 3DQVA 1EUVB 2PE9A 3ZTCA 2L76A 4EUTA 3ZDMC 2KLCA 3WALA 1KOTA 1WGHA 2HTHA 1E7VA 1VD2A 4XX5A 3V61A 1WJUA 2ZNVB 1WX8A 3EECA 3TBLD 2LJ5A 4EZLA 5E6NA 3ZO5B 2KFKA 4GN1A 1TBEA 2R2OA 2K39A 2JRHA 1V5TA 3CSTA 2L00B 3EC8A 2MCNB 2MQJA 2N9PC 4W9CA 4MM3A 4WJPA 2DZKA 2L0FA 2LGDA 2RPQA 5JH5C 1V49A 5JHBA 3L10B 2FNJB 2KDFB 3IFWB 4DK5A 5L83A 3KH0A 3PS6A 1S1QB 2KJRA 3KUDB 3WIMA 4HWIB 1EO6A 4A3OA 1RFAA 4CO7A 5J18A 2KX0A 2PJHA 2NBUA 2JRIB 1WM3A 4URKA 4OVVA 4XC2A 4AOFA 2J0KA 3IVFA 3QX1A 2ZPNA 2DX5B 2KQ7A 2KKCA 2D2QA 1UELA 2M17A 3K9OB 3KYCD 2HD5B 4MEMA 3X23A 2KZRA 1SE9A 4ZRJA 3A4RA 5AEKB 1WJNA 2ZEQA 3NY5A 2NR2A 5JHAA 5C23A 3CMMB 5IA7A 1SGHA 4AJWA 3PPAA 4FHJA 3DOWA 4G11A 2N9EB 2KWCA 3LMNA 4GDLB 2KK8A 1R4NI 2FCMA 4X57B 1NDDA 2K1FA 3OAWA 2MSED 4FJYA 4K7UA 2FCNA 2HJ8A 1WH3A 4K7WA 2LUEA 4M0WB 4HDQA 3DBHI 1V5OA 4NAWB 2WX0A 4W9FA 3DPDA 5LXIB 1CMXB 3AU5A 2MBOA 3QC8B 4DHZE 2KFJA 4I6PA 4FJVB 2KLGA 2KX3A 4RM8A 1I35A 3BINA 3RCZA 2KWVB 3H1UA 3PLUA 2MW5A 3SD5A 2C7NB 2QHOA 3O65B 1NI2A 2FCQA 2N7DA 4HPMB 1GUAB 4BOSC 5AZFA 4BKSD 2KNBA 2LGXA 4ASWC 4HVBA 2LI5A 4ANVA 1Z5SB 3IBEA 4G0NB 3APCA 3VH4B 4ZDVA 1P9DU 1H4RA 4WWPA 2AL3A 3W1SA 2YLMA 4LDTD 4BKTA 3VAWA 3APDA 3AULA 1EF5A 1V80A 1HE8A 1WGYA 2DYMA 2M1MA 4LJPB 2FIDA 3ZNGC 1V2YA 2G3QB 2JXXA 2MRPA 2L7RA 2C7HA 2KDBA 1YJ1A 4N9F4 3L17A 4IWPA 4M8NA 2J7QB 4IM2A 2FIFA 4AP4C 2MWSB 3B0AA 2LRWA 3TJPA 2REXA 3W1SC 2L05A 4DXAB 1U4AA 2EKEC 2ZZPB 2C60A 3V62A 4FADA 1WXSA 4JGHB 5DCNA 1V81A 3RZWC 2PPHA 3RZFA 2G4SA 4IWOA 1BT0A 4RM9A 2MA9B 1VCBA 3ONSA 3VFKA 1A5RA 1UH6A 3QJZA 3WA0A 1ISNA 2G4DB 3IG3A 1LM8B 4WJNA 4DHJD 4M8MA 4GIVA 4DHZB 3PTFC 4PS8A 3A9KA 1E8XA 4JLCA 4W9IA 4W9LA 1UGMA 2Z0DB 3QHTA 2LASA 1LFDA 2DENB 2LVQA 3N3KB 3U8ZA 2NBVB 3VVWB 2KTRB 3V60A 2MP2B 2LVPA 3JSVA 1WJ4A 2C7MB 3L0WB 2Z0EB 2LZ6A 3DVNV 1Y8RC 5G2NA 5JZEB 4IUMB 2LWPA 3H7SA 2GBMA 2KN5A 2AEHA 2KXJA 3ML9A 3OLMD 4GSWA 3VHTC 3UQBA 3WAOA 3K9PB 3R3MA 3PRZA 1WE7A 3OJ3A 5CHVC 1WGRA 1WXAA 3MTNB 2ZJDA 3NZUA 2JPHA 2LRUA 1WI0A 5CHWA 4AWJA 2M8SA 1X1MA 4B95A 4NPNA 4BKSA 3HHMA 1RAXA 3GOEA 2JZ3B 2IBIB 4E74A 2M0XA 2KJHB 3L13A 4GOCA 2KMCA 1G6JA 2WDTB 5DPWA 4NQKE 3X0WA 4IWQA 3WAPA 3PSEB 3H7PA 2KVRA 3ZW3A 2KC2A 3UF8A 2BWES 1FXTB 3RT3B 2CU1A 3PLVA 1GC7A 1WM2A 1UBIA 2DAFA 2A4ZA 2J0MA 2CR5A 1GJZA 1UBQA 2PEAA 4HDOA 5AZHA 3A1QB 4GDKA 2MX2A 3L08A 4MSQB 4B6WA 4FJZA 4HK2A 3JVZX 3TMPB 4GDLA 2IO0B 1WX9A 2LXCA 4ICUA 1OGWA 1IPGA 3SHQA 4F7ZA 1L2NA 4MGZE 1E8WA 3M95A 4KZ0A 3DCGA 1L7YA 2K8BA 3DBRI 3HM6X 5J17A 1WMHA 2XBBC 1V9JA 4FBJB 3TCAA 4BBNC 2JZZA 2GBKA 4GXBA 2WX1A 4KV2A 4CYEA 4EEWA 3Q3FA 4B9KA 1P3QU 1F9JA 5CTRC 4I6NB 2AL6A 2N4FA 3M3JA 2N9XA 4FLHA 3U7DA 1J0GA 1RLFA 3PREA 2CHXA 3ZDTA 3LDZE 5CHFA 2IYDB 2LVOA 2KTRA 2CHZA 4TQ1A 1MG8A 3B1LX 4IW0A 3IHPC 3QA8A 4JL9A 2D07B 3PVLA 4WJOA 4E71A 2DHZA 4CHKA 1YD8U 2NS5A 3SU8X 3A33B 1QZEA 2GOWA 2RD0A 1E7UA 1H8CA 2KMAA 3A4SC 4NJ6A 5BO4B 2JVCA 1S3SG 2UYZB 2O6VB 4PYUA 1J19A 3ZUNA 2IY0B 2KTFA 4WQOB 2OOBB 4NQLB 2EMTA 4E3CA 2KC1A 2Y5BB 3ECIA 5D6JB 3H6NA 4RMAA 3AU4A 2MBHA 3H9DA 2KQSA 4GU2A 1OQYA 2NPTB 4DHJB 4P7IA 4K81A 3I3TB 4WJQA 2C9WB 2R2QA 2ZPYA 2KWUB 2IO3B 2D11A 1LQBA 4NY0A 3RD2A 2KJ6A 2ASQA 1KLVA 3PHXB 2V1YA 4G50A 4BOZB 3QK0A 4IC7B 2KD0A 3UQAA 4IM0A 3RUIB 5HKHA 1GC6A 4KVGB 2D3GA 3DDCB 1ZKHA 1XD3B 5KHQA 5DPTA 1IYFA 2BYFA 3RYTA 1KM7A 4KDLB 2DYOA 3PV1A 2ZVOA 4EZJA 2KANA 3HK0A 3PT2B 1V86A 2GBJA 2IO2B 1WGGA 3C0RB 1P98A 3VH3B 3A1QA 4GDKB 3VTWA 3VTVA 2K6DB 3A9JA 3A9KB 1OTRB 4HJKA 3VXWA 2BKFA 2J0JA 2MBEA 2IZVB 3ZTDA 4HLEA 2G45B 4W9DA 3ZVVA 3VUXA 3QQ8B 3APFA 2BWFA 2KDIA 1C1YB 2N7EA 5TR5A 2GMIC 2DYBA 5EDSA 1SIFA
chains in the Genus database with same CATH superfamily
1Q10A 2WXJA 5J2RA 4BKGA 3W5VB 2J42A 4WWMA 3EFUA 3JW0X 2HTME 5BMGA 2AQ2B 2O6VD 4RFBA 3P63A 2OJRA 4LNFA 3TL5A 1MPEA 2L83A 2JF5A 3KWLA 4TMAB 4LLGM 3VUWA 3NOBA 4PS3A 1QILA 1D5MC 1FXAA 1ZGUB 5G55A 3ZQ4A 2HE7A 5KHOA 3T8MA 3VTUA 2LXAA 2XK5A 1L6UA 3IT6B 1FFVA 4KKIA 2L8JA 1KLGD 2RSUA 2O2VB 1E8YA 4KZCA 2KACA 1P0RA 4OVZA 5JXVA 4A55A 1T0SC 2XK5B 4MJSA 1UF0A 2J4XA 3M63B 1XLNA 2QDFA 3DHHC 4DBGA 3R7QA 3NRZA 2QILA 2MBBB 3ZNZB 3EFCA 2K25A 2DZJA 4I6LB 1VDVA 1EF1A 3AEEB 3D32A 5IN7A 1C4PA 3ZNID 1PYWD 1PDXA 1WZ3A 1IGCA 1NBFC 2PE6B 3QWZB 4US8A 4MGKE 2M4NA 1OEYA 2A5UA 3Q3OC 2ZVNA 3JSVB 4W9HA 4KSLC 1C76A 2KQ4X 2NVUI 2K6QA 2WP9B 3S2AA 1GOZA 1WY8A 5I4DA 2KWDA 2BT6A 2AQ3B 3VR9B 1K8RB 4G3XB 3JYUA 5IP4D 5D94A 4GGQA 4TKNA 4W9GA 3P2BA 3N20C 2VZKD 1V6EA 1Q0WB 4P6VF 1WZ0A 4FN2A 2W55A 4EFOA 1W6VA 2WXIA 2IY1B 2D10A 4XZ4A 3UINB 4OZCA 3L16A 4KX6B 4WURA 2O2VA 2DBYA 1WSPA 3BY4B 4Q2JA 3HUIA 2ONQA 2MLBA 2L32A 4LCDE 4KDIC 3NVZA 3WAMA 3R66C 4ARCA 4UDUC 1GG3A 2DNFA 1R4MB 4WH4A 4DWFA 1I42A 1YX6B 1HA5A 4C7ZA 1STEA 1EUVB 2FUG1 4HRSA 2L76A 3FKYA 4EUTA 4KGSA 4LTUA 3DBRB 1KOTA 4ZRQA 2PLPA 3V61A 3MFGA 5E6NA 2K39A 3CSTA 3EC8A 3ZXRA 2MCNB 2MQJA 1VZ8A 2E6XA 2RPQA 1Y56A 5JHBA 3L10B 5L83A 1VZ6A 2KJRA 4P1BC 1EO6A 1SXTA 1FEHA 5J18A 2KX0A 2NBUA 2JRIB 3J9CA 4URKA 4XC2A 2N9KA 1JWBD 2DX5B 2KQ7A 2KDMA 3KYCD 3K9OB 1J7AA 1WJNA 3C8YA 3NY5A 2NR2A 3CMMB 5IA7A 3PPAA 4YT0B 4FHJA 3LMNA 2IJ0A 1R4NI 3BVZA 1P7EA 2BQQA 1NDDA 4OZBA 3PZ7A 4K7UA 2HJ8A 3SFDB 4HDQA 3DBHI 3DPDA 1CMXB 3AU5A 2KFJA 4I6PA 2KLGA 2N0SB 3RCZA 4IDIA 3O65B 2N7DA 2FCQA 2D5GA 5AZFA 4BKSD 2KNBA 2XNAC 4MACA 2WDQB 3W1SA 2YLMA 4LDTD 3VAWA 4LJPB 2FIDA 3ZNGC 1V2YA 2G3QB 2JXXA 4HKZE 1YQ3B 2KDBA 3E56A 4N9F4 2J53A 3E9SA 2FIFA 3TJPA 4YTPB 3W1SC 4DXAB 2ZZPB 2C60A 3V62A 4C80A 3N9YC 3VR8B 2G4SA 3WA0A 3NVVA 3KLSX 4DHJD 4M8MA 4DHZB 2PMVA 3A9KA 3VRAB 3LB8C 1E8XA 2LASA 1FRDA 1TKEA 5G2NA 1N62A 4IUMB 2LWPA 3ML9A 2AEHA 3VHTC 3WAOA 1WXAA 2ZJDA 2JPHA 5FR3A 2LRUA 2M8SA 4B95A 2JZ3B 4K3BA 1L5PA 1JWAD 4TSSA 3V05A 4LK0M 5DPWA 4L1BA 1T6BX 3PSEB 2BWES 1FXTB 4DXGA 4EE2A 1RYJA 3PLVA 1UBIA 5C2TB 1JWUD 2PEAA 5AZHA 4FJZA 1YN3A 4GDLA 3TMPB 2LXCA 4ICUA 4F7ZA 4MGZE 3HM6X 5J17A 1V9JA 2IPKD 2JZZA 4AS1A 2WX1A 5CTRC 1XLOA 2AL6A 2N9XA 1RLFA 1WGKA 1B1ZA 1HZ5A 3MHZA 1F0ZA 1MG8A 3IHPC 3PVLA 4WJOA 2DHZA 1EU3A 1YD8U 3A33B 2RD0A 3ZXVA 1C78A 1FNUA 2PKOA 1FO4A 4PYUA 1J19A 2EMTA 4RMAA 1TZOA 3H9DA 2KQSA 3NJTA 4K81A 1IBXB 2C9WB 2KWUB 1XEEA 1KLVA 2V1YA 2INCC 3RUIB 3FILA 4KVGB 1T0QC 2D3GA 3DDCB 5KHQA 3DWMA 3EUB2 3HK0A 2IO2B 4DQOC 1RM6C 1GB4A 3EA6A 4GDKB 3VTVA 4YTNB 3VXWA 2MBEA 3ZTDA 3GP7A 3QQ8B 2N7EA 2MEKA 4OZAA 2KOXA 3NS1A 5E6OA 1VRAB 1M4VA 3ZIMA 3AB5A 4XE0A 1JW9D 1WRDB 3KVFB 3I9V1 1XT9B 1ZDVA 4WWOA 1YQBA 1Q1OA 2JQRB 1R4MI 1WIAA 2BYEA 2BVCA 2WYQA 2KFKB 1FCLA 3MHSD 3KQ4A 3P4QB 3PZ8A 3VDZA 2KN4A 3U2SC 1OFFA 3TUOA 1N6ZA 2JWZA 1QOGA 3AECB 4JQWC 1GAQB 2ICIA 4CQNA 2Y5PA 1GB1A 4F1SA 1MFWA 2AWTA 4GMVA 2WXOA 1Z2MA 2IO1B 2WXFA 1QLBB 3RN9C 1XO3A 5HFYA 4AUQC 2JUOA 3L54A 5D2MB 4ZRPA 4NAMA 5D3IB 1NVID 3AV8A 3RI7C 2N1VA 3N32A 3H8HA 4HPLB 4GB9A 3DVNU 3L4PA 2KO3A 5E6PA 2KAJA 3H7PB 4WAAA 2YEPB 3V6EB 2L52A 3AEFB 2DWQA 2I1KA 4YXDB 3AXCA 4ICVA 1RFKA 2BF8B 4PYZA 4W9KA 4BFRA 2ZCBA 4ZYNA 4LJOB 3UGBB 4OVUA 3T3NA 2L3ZA 5AZGA 2WLBA 3UIOB 3QARA 4ZRIA 2GLSA 3V6CB 4ANWA 3DHGC 3MJ5A 1YIWA 1IP9A 4J6IA 1KFYB 2DZIA 3NS8A 1JCKB 4RGMA 1C4AA 2EMSA 2JT4B 1C3TA 2Z8LA 2K8CA 3TIXA 4REZA 3P4SB 3R2TA 1R7SA 3P4PB 1YNTE 4HXDA 1E8ZA 4HPPA 1I4RA 4DDID 1SBBB 4C4VA 4ZRKA 2C5LC 2J52A 5IKCM 1E90A 2ZNVC 3ZJUA 1MI0A 1MVKA 3HM3A 3R7RA 2V4LA 2O6VA 4W9EA 4MGYE 3RULA 3BK2A 5GMVA 2EELA 3Q8EA 3VRBB 1KTKA 5DPSA 2MP2A 2NTSA 4EZKA 2W3RA 4LNOA 2JWUA 3DVGY 2GBNA 1FPYA 3SDLC 3IXSA 3MJWA 3GZNB 4A3PA 3RNGC 3VUYA 3U30A 3M62B 4IM3A 5E6JA 3DQVA 2WQYB 4LNIA 4L23A 1SJED 1K53A 3ZTCA 3ZDMC 3WALA 1WGHA 1WX8A 2LJ5A 1K51A 2X38A 3ZO5B 2KFKA 5C3JB 1TBEA 2BW2A 1TS2A 2G1EA 2JX5A 2N9PC 3DHIC 4WJPA 1I4XA 1V49A 1UNSA 2KDFB 4DK5A 1EU4A 1HEZE 4WAFA 3WIMA 4HWIB 3AE1B 4A3OA 4A9AA 5AUKA 2J0KA 3IVFA 2QMTA 2M17A 2QSDA 5JHAA 3CWIA 1SGHA 4AJWA 2BBCA 2RMMA 3DOWA 3FC4A 2IGGA 4FJYA 1WH3A 4YSXB 2LUEA 4M0WB 4ZHOA 1K50A 3BYYB 4W9FA 2QCZA 5LXIB 1QOAA 3QC8B 2V9HA 4FJVB 2KX3A 3PLUA 3UI3A 1XLPA 2C7NB 2MJ3A 4RGTA 4HPMB 1GUAB 2LGXA 4ASWC 1Z5SB 2AL3A 2N7JA 2K22A 4BKTA 3AULA 2IGDA 1EF5A 1WGYA 1HE8A 2M1MA 2DYMA 2MRPA 4HJGE 3NUHB 4JWUC 2L7RA 3AE8B 2C7HA 4US9A 3L17A 4LNNA 4KKJA 1VLBA 4AP4C 3B0AA 2EKEC 5DCNA 1XXGA 3RFZB 2WXPA 3VFKA 3TEXA 1UH6A 2LUMA 2BTEA 2WXRA 2GI9A 2IGHA 5BYSA 1LM8B 1YN4A 2LGSA 1E10A 1MJDA 2VZKB 4PS8A 4HROA 4W9IA 4W9LA 2INPE 1NI3A 1LFDA 2LVQA 1K52A 2BB5A 1WWTA 2KTRB 4ARIA 2Z0EB 3V3XA 1ENFA 2H88B 4B0MA 3R2IA 3UQBA 1NEKB 1WE7A 3OJ3A 1JWMD 3NZUA 5CHWA 1WI0A 4OHJA 3RMKC 1RAXA 4E74A 2HDEA 1IBXA 2KJHB 3AH7A 1UWXA 4ZOHC 4NQKE 3RPFC 2ZW1A 4IWQA 3WAPA 2KVRA 3UF8A 3RT3B 2CU1A 1ZDXA 1OQQA 1UBQA 4GDKA 2MX2A 3C19A 4KGRA 3JVZX 1N60A 1IPGA 1OGWA 3SHQA 4KZ0A 3N1XC 1FD6A 3DBRI 1NYRA 5AUIA 4R3DA 4XWTA 4QAYA 2BS4B 3I5JC 1SIJA 4I6NB 3M3JA 4P16A 1J0GA 2JSVX 2CHXA 3FILB 3ZDTA 2DLBA 1SE3A 2IYDB 2LVOA 4RF0A 2KTRA 2Q5WD 3Q3MC 4IW0A 2D07B 3AEDB 4CHKA 2NS5A 2INNE 2GOWA 1J7CA 1JMLA 4C00A 2D3BA 2IY0B 4NQLB 2RPVA 3AU4A 1OQYA 4WIPA 1FRRA 2SAKA 1NENB 4HKQA 2WU2B 2IO3B 3PHXB 1DYQA 2CJOA 2AX5A 4IC7B 1GC6A 2UU7A 1ZKHA 1XD3B 1IYFA 1C9FA 2BB6A 1BMLC 3TEWA 1WGGA 3C0RB 1P98A 3VH3B 3VTWA 2K6DB 2ACZB 3A9JA 3A9KB 4HJKA 4MM3B 3ZVVA 3VUXA 1ZOYB 3APFA 5TR5A 2KDIA 5EDSA 1SIFA 2WXQA 3QIJA 4C56C 1TYGB 1UUPA 2XN9C 3ZGZA 3LYYA 3U7ZA 2WDVB 2FUHB 1WR6E 3PGEA 5CX3A 1PQSA 3ABVB 2JY6A 3I63C 3RNFC 2LGYA 4AJYB 4D2KA 4MSMB 1V1OA 4N58A 3ENEA 1RRBA 4HCPB 2WXLA 4K1RB 1E6EB 1TKYA 4XYCA 1IGDA 1SE4A 2M19A 1N5XA 3AE5B 4IG7B 1CJEA 3OG5A 2BGFA 2M0AA 5LNK1 3IAM1 1TY0A 2ZCCA 2FAZA 1AYFA 2AYOB 3PHWB 1JRUA 1E9MA 1T5XD 2BPSA 1TT5B 2W9NA 1TGZB 2LD9A 3KUZA 1L0XB 3UIPB 4AOFA 1DOYA 2RR9A 2WWZA 3Q8FA 4IOIE 5EE3A 3PRPB 3ZNHB 2QIEB 4ANXA 3QAQA 4GLSC 3T3OA 1A70A 3VQIA 3CSFA 2W82A 4W9JA 2MJEA 2KDEB 1M94A 2JZPA 3NHEB 3ALBA 5LXHA 4MGIE 2OEDA 1YX5B 1L0VB 3DWGC 5D7GA 2WHIA 1OEYJ 4K3CA 1RWSA 2I38A 3PZDA 1WJ6A 3BWUD 3AM9A 2W3SA 4EOYA 3P4RB 3ZRCA 3PRMB 1PUTA 1CZPA 5IO9A 4TV3A 3NVWA 1WRIA 1KF6B 2LHDA 1D3ZA 2NPTA 2BYTA 1HXYD 2LJIA 2KHWB 3CF6E 1F2RI 1N5WA 1WMHB 2L0TA 4BBNF 5D3DA 2G9HD 4IKGA 1WR1A 5HHDG 2R61A 4F8CB 5EE0A 4MH0E 4II2B 3OJ4B 3SEBA 1AWDA 2PTLA 4PK1A 2VRRB 3DBSA 1J8CA 2CHWA 1I7HA 4NZLB 2WXMA 1XCQL 2E3TA 3IAS1 2B76B 2V4IB 2VH2A 3GE3C 1L4ZB 1AARA 3ZKJC 4YTMB 3Q8AA 1GNUA 5BMHA 2N1WA 1FM0D 2K8HA 5C1ZA 1WXMA 1WF9A 3Q3JA 3W1YA 4ZHPA 1I4HA 2JYTA 2V3SA 1QF6A 2PE9A 3PO0A 4JWSC 4S0RA 2KMMA 1E7VA 1VD2A 4N6EB 1WJUA 2ZNVB 2QEJC 1NYQA 2HJ1A 4EZLA 5BMIA 3N1YC 4GN1A 2R2OA 2JRHA 1V5TA 4W9CA 3AEAB 1MG4A 4MM3A 3OWEB 2DZKA 3ETRA 2L0FA 5JH5C 2FNJB 2LMCA 1WYGA 3IFWB 3EGRA 3KH0A 1S1QB 4OVVA 1L0YB 2ZPNA 3ZYYX 2D2QA 1UELA 4MEMA 2HD5B 2KZRA 1SE9A 4ZRJA 3AE3B 3TEZA 5AEKB 1JALA 1KH0A 2D3CA 1PGXA 2K0PA 2N9EB 3AE9B 1PGBA 2KYWA 2KK8A 4X57B 2K1FA 2OJWA 3OAWA 1SE2A 1P7FA 2LFIA 4A90A 2FCNA 1SSNA 3MC9A 3MC0B 4NAWB 2MBOA 5FK9C 4DHZE 1I35A 1DOXA 3SD5A 2QHOA 1HQRD 4BOSC 4HVBA 3HVDA 1D4BA 4A6QA 4G0NB 3APCA 1P9DU 1I4PA 4ITKA 3APDA 4RGOS 3BVGA 1J7BA 4ACFA 1V80A 3HRDD 1V8CA 2LEKA 2WXHA 5BYQA 1YJJA 4OW0A 3AEGB 2WXGA 1D5XC 2CU3A 2MWSB 5HG2A 2LRWA 4RGNA 2REXA 1U4AA 1ESFA 4FADA 1EM7A 1WXSA 2JU6X 1V81A 5HI1A 3RZFA 1F1HA 1BT0A 1A5RA 1VCBA 1QT9A 3QJZA 2FE8A 3BK1A 3IG3A 4FXCA 3PTFC 4YWGG 1FNWA 1V1PA 3AEBB 2DENB 3IT4B 3VVWB 3V60A 3JSVA 1WJ4A 2VH1A 3DVNV 5EE9A 2GBMA 2KXJA 4GSWA 3K9PB 3R3MA 3PRZA 3AMZA 5TSSA 1BUIC 3MTNB 1V97A 3BVMA 4NPNA 1LO5D 4BKSA 3HHMA 1C79A 2IBIB 1CQVA 4GOCA 2KMCA 1G6JA 2FBWB 2WGSA 4HEA1 3TEYA 2V0GA 2WXKA 3W5UB 4XDDA 5IOIA 4YSZB 3BIID 2DAFA 1N61A 1MHXA 2J0MA 1KRHA 1GJZA 4HDOA 3A1QB 3MC8A 4MSQB 1JROA 4HK2A 2IO0B 3B9JA 3Q3NC 1L2NA 3M95A 3KWVA 3DCGA 5H8YE 2K8BA 1WMHA 4FBJB 4BBNC 2X8XX 2GBKA 4YSYB 4GXBA 5BYRA 4J3OD 3Q3FA 5T8IA 4B9KA 1EWCA 3NG0A 4FLHA 1HTOA 2YEPF 3PREA 4XWWA 3LDZE 4C4VB 2H89B 2CHZA 4TQ1A 2KVZA 1XF5L 2PIAA 1DGJA 3QA8A 4JL9A 4E71A 3I57A 1SJHD 2NMQA 3SU8X 1QZEA 1TJEA 1T3QA 1HTQA 1D6EC 2JVCA 1S3SG 4ZYSA 2WXNA 2UYZB 2KTFA 4E3CA 2KC1A 2TSSA 2Y5BB 2MHJA 1E7PB 4DHJB 4P7IA 1UWMA 2R2QA 2D11A 4NY0A 2KJ6A 1TS5A 2ASQA 5MPOA 4G50A 4BOZB 4M0WA 4IM0A 5HKHA 1YJIA 1ZP0B 5DPTA 1ZUD2 2BYFA 4KDLB 3PV1A 2ZVOA 4H2AA 4EZJA 3FAHA 3PT2B 5FKAC 5H92C 2IDYA 1XCTL 2BKFA 2J0JA 2G45B 4W9DA 1YN5A 3Q69A 1TS4A 1FNVA 2GMIC 1YOVB 2PW9A 3N30A 3KUCB 1IUEA 4O1NA 1WFYA 4NNJB 2LGIA 2NBWB 1ZW7A 3Q6BA 1WXVA 1KJTA 4C7YA 3A9JB 2CKHB 3HIZA 1QQRA 4RH6A 3BZDB 3EHVA 3Q8BA 4KSKC 5FR6A 4JIOU 4EKUA 1TY2A 4ANUA 2Y5CA 1VZ7A 2Y3AA 2B3AA 2RGFA 4DXFA 5L95C 2UWQA 2KT7A 1FXIA 2MBQA 4MDKE 4FA6A 1TIFA 1QOFA 4A20A 1B9RA 3AI5A 2BYVE 3NZ3A 4RCOA 3MP9A 5G5GA 4WWNA 2K9XA 1WX7A 2PVOD 2XEWA 1TTNA 3DBLB 3GZNI 3WANA 1FCCC 1I4GA 3TSSA 4FULA 3NZSA 2D3AA 4TUUA 1QOBA 4PS7A 3QCAA 3O13A 4TQ0A 1AN8A 2M56B 3ZLZA 3B08A 2ON8A 4II3B 4NJ7A 1E5WA 1T0YA 1ZXIA 2RDBC 4NAWA 4M02A 1XQQA 4XDCA 3KYDD 2PVGC 4FHKA 2BKRB 5DPRA 4LDTB 3B2FA 3RNAC 1Q5WB 2CS4A 3ML8A 1D5ZC 1WE6A 1FMAD 2DZMA 1AW7A 2NCNA 4KIKA 1EWYC 3AN1A 3KW5B 2I1JA 3NVYA 3P42A 3ZJVA 4MT5A 3LJ3A 3AE7B 1MHHE 4YL8A 1JWSD 2FCSA 1ACCA 4N59A 3T9LA 3DBLI 2GRIA 2YVCA 5LLIA 1WGDA 5G5HA 4XGAB 3N1ZC 3DVGX 4BVUC 4DDGD 1PFDA 4RF1A 2RDHA 3W2DA 1E0ZA 1TZ1A 4RNAA 1P1AA 1LXDA 1WYWB 4K7SA 2DAJA 2Z59B 4KIKB 1ET9A 2GBRA 1UGJA 4MELA 4HCNB 4MJSB 5IAAC 3Q2AC 1UZXB 3ZRFA 1UD7A 1ROEA 2KLCA 2HTHA 5GXGB 3Q14C 4XX5A 4BZAA 3EECA 3TBLD 2JXTA 2BS2B 1TKGA 4PT5A 2L00B 3W9CB 4KGTA 2LGDA 2EKIA 4M00A 3PS6A 3KUDB 1F2RC 1RFAA 4CO7A 2PJHA 4JE3B 1WM3A 3QX1A 2KKCA 2SEBD 3X23A 3A4RA 2ZEQA 5C23A 4G11A 2KWCA 3LXFA 4GDLB 2FCMA 1SB3C 1ZXHA 2MSED 4BAXA 3U4EG 4K7WA 1I4QA 4LNKA 1V5OA 2WX0A 5EE1A 1N63A 1SEBD 1FFUA 2K3UA 4RM8A 3BINA 2KWVB 3H1UA 2MW5A 1ZPSA 3RNCC 3P1MA 1F52A 2I2YA 1ZE3D 2V3PA 1NI2A 3B2GA 1WXQA 2CJNA 3DBHB 2N9LA 2LI5A 4ANVA 3IBEA 2BS3B 3VH4B 4ZDVA 4L2YA 1H4RA 4WWPA 1F77A 3RNBC 1YJ1A 2WU5B 4IWPA 4M8NA 2J7QB 4IM2A 2V3NA 1R4NB 2L05A 4JGHB 3RZWC 2GB1A 2PPHA 2ZW0A 4IWOA 4RM9A 2MA9B 3AE4B 3ONSA 1ISNA 2G4DB 4WJNA 4GIVA 2MJDA 1YQ4B 4JLCA 1C77A 1UGMA 2Z0DB 3QHTA 3N3KB 3U8ZA 4JPSA 2NBVB 4S17A 2MP2B 2LVPA 4USAA 2C7MB 3L0WB 2K5PA 2LZ6A 2QJLA 1Y8RC 5JZEB 1QKZA 3H7SA 2KN5A 2WNMA 3OLMD 3R8BA 3ZJTA 4NJCA 5CHVC 1WGRA 1KLUD 2WDRB 4AWJA 1X1MA 3GOEA 4P1CC 2M0XA 1JQ4A 3L13A 1PGAA 2WDTB 2L1AA 2WS3B 3X0WA 3SFEB 3H7PA 3ZW3A 1ET6A 2KC2A 1BXTA 1GC7A 1WM2A 2AQ1B 2NTTA 2RDGA 1XLQA 1T0RC 2A4ZA 1VR9A 1L4DB 2CR5A 1HZ6A 1YMHE 3WCQA 4A8XC 3L08A 3CIRB 4B6WA 2OHFA 1WX9A 1CK1A 2LHEA 1VJKA 2MH7A 1E8WA 1LGRA 1L7YA 3U52E 2XBBC 3GE8C 3TCAA 2INDC 3HVZA 2QC8A 3GB1A 3AE6B 4AQ7A 4KV2A 4CYEA 4EEWA 1P3QU 1F9JA 2N4FA 1SF0A 3U7DA 5CHFA 3AE2B 3B1LX 3URYA 1TS3A 1E7UA 4WQMA 1OQRA 1H8CA 2KMAA 3A4SC 4NJ6A 5BO4B 1L6VA 2JYEA 1JRPA 2O6VB 3ZUNA 4WQOB 2OOBB 1GPXA 5D6JB 3ECIA 3H6NA 3SR6A 2MBHA 4GU2A 2NPTB 3BYTB 3RNEC 3I3TB 4WJQA 2ZPYA 3RD2A 1LQBA 3Q8CA 1C4CA 3QK0A 2KD0A 3UQAA 4M01A 4JX1C 1DOIA 3RYTA 1KM7A 4MH8A 2DYOA 4B0EA 2W54A 2KANA 1V86A 2GBJA 3GS2A 3A1QA 1V1PB 1OTRB 2IZVB 4HLEA 2BWFA 1C1YB 1FIQA 2DYBA
chains in the Genus database with same CATH topology
3QIJA 2KOXA 5E6OA 3N30A 3KUCB 5J2RA 4BKGA 3ZIMA 1WFYA 4NNJB 2NBWB 3EFUA 2FUHB 1WRDB 1WR6E 1ZW7A 3JW0X 1PQSA 3KVFB 3PGEA 5CX3A 1XT9B 4WWOA 1WXVA 1KJTA 2JY6A 3A9JB 2CKHB 3HIZA 1YQBA 1Q1OA 2LGYA 1R4MI 1WIAA 3EHVA 2BYEA 4KSKC 5FR6A 4AJYB 4JIOU 4EKUA 2O6VD 4MSMB 4ANUA 2WYQA 2KFKB 2OJRA 3ENEA 1RRBA 3MHSD 2B3AA 2RGFA 4HCPB 5L95C 2UWQA 3VDZA 4K1RB 3TL5A 2JWZA 4IG7B 2JF5A 4JQWC 2BGFA 2MBQA 3VUWA 4MDKE 3NOBA 4PS3A 4F1SA 2ZCCA 4FA6A 2FAZA 2AWTA 4GMVA 1ZGUB 5G55A 2HE7A 2AYOB 1Z2MA 3PHWB 2IO1B 1JRUA 5KHOA 3T8MA 3VTUA 2BPSA 3AI5A 4A20A 2LXAA 2BYVE 2XK5A 2W9NA 1TGZB 2LD9A 3KUZA 4WWNA 3UIPB 1WX7A 2JUOA 4AUQC 3L54A 5D2MB 2RR9A 2XEWA 1TTNA 2WWZA 2L8JA 2N1VA 2RSUA 3N32A 2O2VB 1E8YA 3GZNI 3PRPB 4KZCA 3ZNHB 3WANA 4ANXA 1P0RA 4FULA 3QAQA 4HPLB 3NZSA 4GB9A 4TUUA 3VQIA 4PS7A 3CSFA 3DVNU 2XK5B 3QCAA 2KO3A 5E6PA 4TQ0A 4MJSA 3H7PB 3M63B 4W9JA 4WAAA 3V6EB 2KDEB 1M94A 3ZLZA 3NHEB 4DBGA 3B08A 2I1KA 3ALBA 4II3B 3AXCA 5LXHA 4MGIE 4ICVA 3R7QA 4NJ7A 1YX5B 2BF8B 1E5WA 1T0YA 2MBBB 4PYZA 4W9KA 3ZNZB 4NAWA 5D7GA 2ZCBA 4BFRA 1OEYJ 2K25A 2DZJA 4I6LB 4ZYNA 4LJOB 1EF1A 1XQQA 3PZDA 1WJ6A 3D32A 3KYDD 3UGBB 4EOYA 4OVUA 2L3ZA 5AZGA 3ZNID 3ZRCA 3PRMB 4FHKA 1WZ3A 1NBFC 2PE6B 2BKRB 3QWZB 3QARA 4MGKE 4LDTB 5DPRA 3UIOB 2M4NA 4TV3A 1OEYA 2A5UA 4ZRIA 2ZVNA 1Q5WB 3JSVB 4W9HA 3V6CB 4KSLC 1D3ZA 4ANWA 2CS4A 3ML8A 1WE6A 2NPTA 2K6QA 1YIWA 2DZMA 2NVUI 3S2AA 1IP9A 4J6IA 2KHWB 1WY8A 2NCNA 3CF6E 2DZIA 3NS8A 4KIKA 3KW5B 2I1JA 3LJ3A 1WMHB 2L0TA 4BBNF 2EMSA 2JT4B 1C3TA 1K8RB 4YL8A 4G3XB 1WR1A 3JYUA 2K8CA 2FCSA 3TIXA 5D94A 4GGQA 4TKNA 4W9GA 3P2BA 3T9LA 3DBLI 4HXDA 1E8ZA 1V6EA 1Q0WB 4DDID 4F8CB 1WZ0A 4MH0E 4II2B 2YVCA 4ZRKA 2C5LC 4FN2A 3OJ4B 5LLIA 1E90A 1J8CA 1WGDA 2VRRB 3DBSA 4EFOA 2ZNVC 1W6VA 2CHWA 2IY1B 3DVGX 4BVUC 4DDGD 3HM3A 3R7RA 2D10A 2V4LA 4XZ4A 3UINB 2O6VA 3L16A 4W9EA 4MGYE 3RULA 3ZKJC 1AARA 2O2VA 1TZ1A 3BY4B 5GMVA 1P1AA 2MLBA 1LXDA 4LCDE 1GNUA 1WYWB 4K7SA 4KDIC 2DAJA 2Z59B 5DPSA 2N1WA 3R66C 3WAMA 2K8HA 2MP2A 4EZKA 5C1ZA 1GG3A 4KIKB 3DVGY 2GBNA 1WXMA 1WF9A 3Q3JA 2GBRA 3MJWA 3SDLC 4MELA 4A3PA 4HCNB 3VUYA 3W1YA 4MJSB 3U30A 3M62B 4IM3A 5IAAC 4DWFA 1I42A 1YX6B 1UZXB 3ZRFA 1UD7A 2V3SA 3DQVA 1EUVB 2PE9A 3ZTCA 2L76A 4EUTA 3ZDMC 2KLCA 3WALA 1KOTA 1WGHA 2HTHA 1E7VA 1VD2A 4XX5A 3V61A 1WJUA 2ZNVB 1WX8A 3EECA 3TBLD 2LJ5A 4EZLA 5E6NA 3ZO5B 2KFKA 4GN1A 1TBEA 2R2OA 2K39A 2JRHA 1V5TA 3CSTA 2L00B 3EC8A 2MCNB 2MQJA 2N9PC 4W9CA 4MM3A 4WJPA 2DZKA 2L0FA 2LGDA 2RPQA 5JH5C 1V49A 5JHBA 3L10B 2FNJB 2KDFB 3IFWB 4DK5A 5L83A 3KH0A 3PS6A 1S1QB 2KJRA 3KUDB 3WIMA 4HWIB 1EO6A 4A3OA 1RFAA 4CO7A 5J18A 2KX0A 2PJHA 2NBUA 2JRIB 1WM3A 4URKA 4OVVA 4XC2A 4AOFA 2J0KA 3IVFA 3QX1A 2ZPNA 2DX5B 2KQ7A 2KKCA 2D2QA 1UELA 2M17A 3K9OB 3KYCD 2HD5B 4MEMA 3X23A 2KZRA 1SE9A 4ZRJA 3A4RA 5AEKB 1WJNA 2ZEQA 3NY5A 2NR2A 5JHAA 5C23A 3CMMB 5IA7A 1SGHA 4AJWA 3PPAA 4FHJA 3DOWA 4G11A 2N9EB 2KWCA 3LMNA 4GDLB 2KK8A 1R4NI 2FCMA 4X57B 1NDDA 2K1FA 3OAWA 2MSED 4FJYA 4K7UA 2FCNA 2HJ8A 1WH3A 4K7WA 2LUEA 4M0WB 4HDQA 3DBHI 1V5OA 4NAWB 2WX0A 4W9FA 3DPDA 5LXIB 1CMXB 3AU5A 2MBOA 3QC8B 4DHZE 2KFJA 4I6PA 4FJVB 2KLGA 2KX3A 4RM8A 1I35A 3BINA 3RCZA 2KWVB 3H1UA 3PLUA 2MW5A 3SD5A 2C7NB 2QHOA 3O65B 1NI2A 2FCQA 2N7DA 4HPMB 1GUAB 4BOSC 5AZFA 4BKSD 2KNBA 2LGXA 4ASWC 4HVBA 2LI5A 4ANVA 1Z5SB 3IBEA 4G0NB 3APCA 3VH4B 4ZDVA 1P9DU 1H4RA 4WWPA 2AL3A 3W1SA 2YLMA 4LDTD 4BKTA 3VAWA 3APDA 3AULA 1EF5A 1V80A 1HE8A 1WGYA 2DYMA 2M1MA 4LJPB 2FIDA 3ZNGC 1V2YA 2G3QB 2JXXA 2MRPA 2L7RA 2C7HA 2KDBA 1YJ1A 4N9F4 3L17A 4IWPA 4M8NA 2J7QB 4IM2A 2FIFA 4AP4C 2MWSB 3B0AA 2LRWA 3TJPA 2REXA 3W1SC 2L05A 4DXAB 1U4AA 2EKEC 2ZZPB 2C60A 3V62A 4FADA 1WXSA 4JGHB 5DCNA 1V81A 3RZWC 2PPHA 3RZFA 2G4SA 4IWOA 1BT0A 4RM9A 2MA9B 1VCBA 3ONSA 3VFKA 1A5RA 1UH6A 3QJZA 3WA0A 1ISNA 2G4DB 3IG3A 1LM8B 4WJNA 4DHJD 4M8MA 4GIVA 4DHZB 3PTFC 4PS8A 3A9KA 1E8XA 4JLCA 4W9IA 4W9LA 1UGMA 2Z0DB 3QHTA 2LASA 1LFDA 2DENB 2LVQA 3N3KB 3U8ZA 2NBVB 3VVWB 2KTRB 3V60A 2MP2B 2LVPA 3JSVA 1WJ4A 2C7MB 3L0WB 2Z0EB 2LZ6A 3DVNV 1Y8RC 5G2NA 5JZEB 4IUMB 2LWPA 3H7SA 2GBMA 2KN5A 2AEHA 2KXJA 3ML9A 3OLMD 4GSWA 3VHTC 3UQBA 3WAOA 3K9PB 3R3MA 3PRZA 1WE7A 3OJ3A 5CHVC 1WGRA 1WXAA 3MTNB 2ZJDA 3NZUA 2JPHA 2LRUA 1WI0A 5CHWA 4AWJA 2M8SA 1X1MA 4B95A 4NPNA 4BKSA 3HHMA 1RAXA 3GOEA 2JZ3B 2IBIB 4E74A 2M0XA 2KJHB 3L13A 4GOCA 2KMCA 1G6JA 2WDTB 5DPWA 4NQKE 3X0WA 4IWQA 3WAPA 3PSEB 3H7PA 2KVRA 3ZW3A 2KC2A 3UF8A 2BWES 1FXTB 3RT3B 2CU1A 3PLVA 1GC7A 1WM2A 1UBIA 2DAFA 2A4ZA 2J0MA 2CR5A 1GJZA 1UBQA 2PEAA 4HDOA 5AZHA 3A1QB 4GDKA 2MX2A 3L08A 4MSQB 4B6WA 4FJZA 4HK2A 3JVZX 3TMPB 4GDLA 2IO0B 1WX9A 2LXCA 4ICUA 1OGWA 1IPGA 3SHQA 4F7ZA 1L2NA 4MGZE 1E8WA 3M95A 4KZ0A 3DCGA 1L7YA 2K8BA 3DBRI 3HM6X 5J17A 1WMHA 2XBBC 1V9JA 4FBJB 3TCAA 4BBNC 2JZZA 2GBKA 4GXBA 2WX1A 4KV2A 4CYEA 4EEWA 3Q3FA 4B9KA 1P3QU 1F9JA 5CTRC 4I6NB 2AL6A 2N4FA 3M3JA 2N9XA 4FLHA 3U7DA 1J0GA 1RLFA 3PREA 2CHXA 3ZDTA 3LDZE 5CHFA 2IYDB 2LVOA 2KTRA 2CHZA 4TQ1A 1MG8A 3B1LX 4IW0A 3IHPC 3QA8A 4JL9A 2D07B 3PVLA 4WJOA 4E71A 2DHZA 4CHKA 1YD8U 2NS5A 3SU8X 3A33B 1QZEA 2GOWA 2RD0A 1E7UA 1H8CA 2KMAA 3A4SC 4NJ6A 5BO4B 2JVCA 1S3SG 2UYZB 2O6VB 4PYUA 1J19A 3ZUNA 2IY0B 2KTFA 4WQOB 2OOBB 4NQLB 2EMTA 4E3CA 2KC1A 2Y5BB 3ECIA 5D6JB 3H6NA 4RMAA 3AU4A 2MBHA 3H9DA 2KQSA 4GU2A 1OQYA 2NPTB 4DHJB 4P7IA 4K81A 3I3TB 4WJQA 2C9WB 2R2QA 2ZPYA 2KWUB 2IO3B 2D11A 1LQBA 4NY0A 3RD2A 2KJ6A 2ASQA 1KLVA 3PHXB 2V1YA 4G50A 4BOZB 3QK0A 4IC7B 2KD0A 3UQAA 4IM0A 3RUIB 5HKHA 1GC6A 4KVGB 2D3GA 3DDCB 1ZKHA 1XD3B 5KHQA 5DPTA 1IYFA 2BYFA 3RYTA 1KM7A 4KDLB 2DYOA 3PV1A 2ZVOA 4EZJA 2KANA 3HK0A 3PT2B 1V86A 2GBJA 2IO2B 1WGGA 3C0RB 1P98A 3VH3B 3A1QA 4GDKB 3VTWA 3VTVA 2K6DB 3A9JA 3A9KB 1OTRB 4HJKA 3VXWA 2BKFA 2J0JA 2MBEA 2IZVB 3ZTDA 4HLEA 2G45B 4W9DA 3ZVVA 3VUXA 3QQ8B 3APFA 2BWFA 2KDIA 1C1YB 2N7EA 5TR5A 2GMIC 2DYBA 5EDSA 1SIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QIJ A;  2KOX A;  5E6O A;  3N30 A;  3KUC B;  5J2R A;  4BKG A;  3ZIM A;  1WFY A;  4NNJ B;  2NBW B;  3EFU A;  2FUH B;  1WRD B;  1WR6 E;  1ZW7 A;  3JW0 X;  1PQS A;  3KVF B;  3PGE A;  5CX3 A;  1XT9 B;  4WWO A;  1WXV A;  1KJT A;  2JY6 A;  3A9J B;  2CKH B;  3HIZ A;  1YQB A;  1Q1O A;  2LGY A;  1R4M I;  1WIA A;  3EHV A;  2BYE A;  4KSK C;  5FR6 A;  4AJY B;  4JIO U;  4EKU A;  2O6V D;  4MSM B;  4ANU A;  2WYQ A;  2KFK B;  2OJR A;  3ENE A;  1RRB A;  3MHS D;  2B3A A;  2RGF A;  4HCP B;  5L95 C;  2UWQ A;  3VDZ A;  4K1R B;  3TL5 A;  2JWZ A;  4IG7 B;  2JF5 A;  4JQW C;  2BGF A;  2MBQ A;  3VUW A;  4MDK E;  3NOB A;  4PS3 A;  4F1S A;  2ZCC A;  4FA6 A;  2FAZ A;  2AWT A;  4GMV A;  1ZGU B;  5G55 A;  2HE7 A;  2AYO B;  1Z2M A;  3PHW B;  2IO1 B;  1JRU A;  5KHO A;  3T8M A;  3VTU A;  2BPS A;  3AI5 A;  4A20 A;  2LXA A;  2BYV E;  2XK5 A;  2W9N A;  1TGZ B;  2LD9 A;  3KUZ A;  4WWN A;  3UIP B;  1WX7 A;  2JUO A;  4AUQ C;  3L54 A;  5D2M B;  2RR9 A;  2XEW A;  1TTN A;  2WWZ A;  2L8J A;  2N1V A;  2RSU A;  3N32 A;  2O2V B;  1E8Y A;  3GZN I;  3PRP B;  4KZC A;  3ZNH B;  3WAN A;  4ANX A;  1P0R A;  4FUL A;  3QAQ A;  4HPL B;  3NZS A;  4GB9 A;  4TUU A;  3VQI A;  4PS7 A;  3CSF A;  3DVN U;  2XK5 B;  3QCA A;  2KO3 A;  5E6P A;  4TQ0 A;  4MJS A;  3H7P B;  3M63 B;  4W9J A;  4WAA A;  3V6E B;  2KDE B;  1M94 A;  3ZLZ A;  3NHE B;  4DBG A;  3B08 A;  2I1K A;  3ALB A;  4II3 B;  3AXC A;  5LXH A;  4MGI E;  4ICV A;  3R7Q A;  4NJ7 A;  1YX5 B;  2BF8 B;  1E5W A;  1T0Y A;  2MBB B;  4PYZ A;  4W9K A;  3ZNZ B;  4NAW A;  5D7G A;  2ZCB A;  4BFR A;  1OEY J;  2K25 A;  2DZJ A;  4I6L B;  4ZYN A;  4LJO B;  1EF1 A;  1XQQ A;  3PZD A;  1WJ6 A;  3D32 A;  3KYD D;  3UGB B;  4EOY A;  4OVU A;  2L3Z A;  5AZG A;  3ZNI D;  3ZRC A;  3PRM B;  4FHK A;  1WZ3 A;  1NBF C;  2PE6 B;  2BKR B;  3QWZ B;  3QAR A;  4MGK E;  4LDT B;  5DPR A;  3UIO B;  2M4N A;  4TV3 A;  1OEY A;  2A5U A;  4ZRI A;  2ZVN A;  1Q5W B;  3JSV B;  4W9H A;  3V6C B;  4KSL C;  1D3Z A;  4ANW A;  2CS4 A;  3ML8 A;  1WE6 A;  2NPT A;  2K6Q A;  1YIW A;  2DZM A;  2NVU I;  3S2A A;  1IP9 A;  4J6I A;  2KHW B;  1WY8 A;  2NCN A;  3CF6 E;  2DZI A;  3NS8 A;  4KIK A;  3KW5 B;  2I1J A;  3LJ3 A;  1WMH B;  2L0T A;  4BBN F;  2EMS A;  2JT4 B;  1C3T A;  1K8R B;  4YL8 A;  4G3X B;  1WR1 A;  3JYU A;  2K8C A;  2FCS A;  3TIX A;  5D94 A;  4GGQ A;  4TKN A;  4W9G A;  3P2B A;  3T9L A;  3DBL I;  4HXD A;  1E8Z A;  1V6E A;  1Q0W B;  4DDI D;  4F8C B;  1WZ0 A;  4MH0 E;  4II2 B;  2YVC A;  4ZRK A;  2C5L C;  4FN2 A;  3OJ4 B;  5LLI A;  1E90 A;  1J8C A;  1WGD A;  2VRR B;  3DBS A;  4EFO A;  2ZNV C;  1W6V A;  2CHW A;  2IY1 B;  3DVG X;  4BVU C;  4DDG D;  3HM3 A;  3R7R A;  2D10 A;  2V4L A;  4XZ4 A;  3UIN B;  2O6V A;  3L16 A;  4W9E A;  4MGY E;  3RUL A;  3ZKJ C;  1AAR A;  2O2V A;  1TZ1 A;  3BY4 B;  5GMV A;  1P1A A;  2MLB A;  1LXD A;  4LCD E;  1GNU A;  1WYW B;  4K7S A;  4KDI C;  2DAJ A;  2Z59 B;  5DPS A;  2N1W A;  3R66 C;  3WAM A;  2K8H A;  2MP2 A;  4EZK A;  5C1Z A;  1GG3 A;  4KIK B;  3DVG Y;  2GBN A;  1WXM A;  1WF9 A;  3Q3J A;  2GBR A;  3MJW A;  3SDL C;  4MEL A;  4A3P A;  4HCN B;  3VUY A;  3W1Y A;  4MJS B;  3U30 A;  3M62 B;  4IM3 A;  5IAA C;  4DWF A;  1I42 A;  1YX6 B;  1UZX B;  3ZRF A;  1UD7 A;  2V3S A;  3DQV A;  1EUV B;  2PE9 A;  3ZTC A;  2L76 A;  4EUT A;  3ZDM C;  2KLC A;  3WAL A;  1KOT A;  1WGH A;  2HTH A;  1E7V A;  1VD2 A;  4XX5 A;  3V61 A;  1WJU A;  2ZNV B;  1WX8 A;  3EEC A;  3TBL D;  2LJ5 A;  4EZL A;  5E6N A;  3ZO5 B;  2KFK A;  4GN1 A;  1TBE A;  2R2O A;  2K39 A;  2JRH A;  1V5T A;  3CST A;  2L00 B;  3EC8 A;  2MCN B;  2MQJ A;  2N9P C;  4W9C A;  4MM3 A;  4WJP A;  2DZK A;  2L0F A;  2LGD A;  2RPQ A;  5JH5 C;  1V49 A;  5JHB A;  3L10 B;  2FNJ B;  2KDF B;  3IFW B;  4DK5 A;  5L83 A;  3KH0 A;  3PS6 A;  1S1Q B;  2KJR A;  3KUD B;  3WIM A;  4HWI B;  1EO6 A;  4A3O A;  1RFA A;  4CO7 A;  5J18 A;  2KX0 A;  2PJH A;  2NBU A;  2JRI B;  1WM3 A;  4URK A;  4OVV A;  4XC2 A;  4AOF A;  2J0K A;  3IVF A;  3QX1 A;  2ZPN A;  2DX5 B;  2KQ7 A;  2KKC A;  2D2Q A;  1UEL A;  2M17 A;  3K9O B;  3KYC D;  2HD5 B;  4MEM A;  3X23 A;  2KZR A;  1SE9 A;  4ZRJ A;  3A4R A;  5AEK B;  1WJN A;  2ZEQ A;  3NY5 A;  2NR2 A;  5JHA A;  5C23 A;  3CMM B;  5IA7 A;  1SGH A;  4AJW A;  3PPA A;  4FHJ A;  3DOW A;  4G11 A;  2N9E B;  2KWC A;  3LMN A;  4GDL B;  2KK8 A;  1R4N I;  2FCM A;  4X57 B;  1NDD A;  2K1F A;  3OAW A;  2MSE D;  4FJY A;  4K7U A;  2FCN A;  2HJ8 A;  1WH3 A;  4K7W A;  2LUE A;  4M0W B;  4HDQ A;  3DBH I;  1V5O A;  4NAW B;  2WX0 A;  4W9F A;  3DPD A;  5LXI B;  1CMX B;  3AU5 A;  2MBO A;  3QC8 B;  4DHZ E;  2KFJ A;  4I6P A;  4FJV B;  2KLG A;  2KX3 A;  4RM8 A;  1I35 A;  3BIN A;  3RCZ A;  2KWV B;  3H1U A;  3PLU A;  2MW5 A;  3SD5 A;  2C7N B;  2QHO A;  3O65 B;  1NI2 A;  2FCQ A;  2N7D A;  4HPM B;  1GUA B;  4BOS C;  5AZF A;  4BKS D;  2KNB A;  2LGX A;  4ASW C;  4HVB A;  2LI5 A;  4ANV A;  1Z5S B;  3IBE A;  4G0N B;  3APC A;  3VH4 B;  4ZDV A;  1P9D U;  1H4R A;  4WWP A;  2AL3 A;  3W1S A;  2YLM A;  4LDT D;  4BKT A;  3VAW A;  3APD A;  3AUL A;  1EF5 A;  1V80 A;  1HE8 A;  1WGY A;  2DYM A;  2M1M A;  4LJP B;  2FID A;  3ZNG C;  1V2Y A;  2G3Q B;  2JXX A;  2MRP A;  2L7R A;  2C7H A;  2KDB A;  1YJ1 A;  4N9F 4;  3L17 A;  4IWP A;  4M8N A;  2J7Q B;  4IM2 A;  2FIF A;  4AP4 C;  2MWS B;  3B0A A;  2LRW A;  3TJP A;  2REX A;  3W1S C;  2L05 A;  4DXA B;  1U4A A;  2EKE C;  2ZZP B;  2C60 A;  3V62 A;  4FAD A;  1WXS A;  4JGH B;  5DCN A;  1V81 A;  3RZW C;  2PPH A;  3RZF A;  2G4S A;  4IWO A;  1BT0 A;  4RM9 A;  2MA9 B;  1VCB A;  3ONS A;  3VFK A;  1A5R A;  1UH6 A;  3QJZ A;  3WA0 A;  1ISN A;  2G4D B;  3IG3 A;  1LM8 B;  4WJN A;  4DHJ D;  4M8M A;  4GIV A;  4DHZ B;  3PTF C;  4PS8 A;  3A9K A;  1E8X A;  4JLC A;  4W9I A;  4W9L A;  1UGM A;  2Z0D B;  3QHT A;  2LAS A;  1LFD A;  2DEN B;  2LVQ A;  3N3K B;  3U8Z A;  2NBV B;  3VVW B;  2KTR B;  3V60 A;  2MP2 B;  2LVP A;  3JSV A;  1WJ4 A;  2C7M B;  3L0W B;  2Z0E B;  2LZ6 A;  3DVN V;  1Y8R C;  5G2N A;  5JZE B;  4IUM B;  2LWP A;  3H7S A;  2GBM A;  2KN5 A;  2AEH A;  2KXJ A;  3ML9 A;  3OLM D;  4GSW A;  3VHT C;  3UQB A;  3WAO A;  3K9P B;  3R3M A;  3PRZ A;  1WE7 A;  3OJ3 A;  5CHV C;  1WGR A;  1WXA A;  3MTN B;  2ZJD A;  3NZU A;  2JPH A;  2LRU A;  1WI0 A;  5CHW A;  4AWJ A;  2M8S A;  1X1M A;  4B95 A;  4NPN A;  4BKS A;  3HHM A;  1RAX A;  3GOE A;  2JZ3 B;  2IBI B;  4E74 A;  2M0X A;  2KJH B;  3L13 A;  4GOC A;  2KMC A;  1G6J A;  2WDT B;  5DPW A;  4NQK E;  3X0W A;  4IWQ A;  3WAP A;  3PSE B;  3H7P A;  2KVR A;  3ZW3 A;  2KC2 A;  3UF8 A;  2BWE S;  1FXT B;  3RT3 B;  2CU1 A;  3PLV A;  1GC7 A;  1WM2 A;  1UBI A;  2DAF A;  2A4Z A;  2J0M A;  2CR5 A;  1GJZ A;  1UBQ A;  2PEA A;  4HDO A;  5AZH A;  3A1Q B;  4GDK A;  2MX2 A;  3L08 A;  4MSQ B;  4B6W A;  4FJZ A;  4HK2 A;  3JVZ X;  3TMP B;  4GDL A;  2IO0 B;  1WX9 A;  2LXC A;  4ICU A;  1OGW A;  1IPG A;  3SHQ A;  4F7Z A;  1L2N A;  4MGZ E;  1E8W A;  3M95 A;  4KZ0 A;  3DCG A;  1L7Y A;  2K8B A;  3DBR I;  3HM6 X;  5J17 A;  1WMH A;  2XBB C;  1V9J A;  4FBJ B;  3TCA A;  4BBN C;  2JZZ A;  2GBK A;  4GXB A;  2WX1 A;  4KV2 A;  4CYE A;  4EEW A;  3Q3F A;  4B9K A;  1P3Q U;  1F9J A;  5CTR C;  4I6N B;  2AL6 A;  2N4F A;  3M3J A;  2N9X A;  4FLH A;  3U7D A;  1J0G A;  1RLF A;  3PRE A;  2CHX A;  3ZDT A;  3LDZ E;  5CHF A;  2IYD B;  2LVO A;  2KTR A;  2CHZ A;  4TQ1 A;  1MG8 A;  3B1L X;  4IW0 A;  3IHP C;  3QA8 A;  4JL9 A;  2D07 B;  3PVL A;  4WJO A;  4E71 A;  2DHZ A;  4CHK A;  1YD8 U;  2NS5 A;  3SU8 X;  3A33 B;  1QZE A;  2GOW A;  2RD0 A;  1E7U A;  1H8C A;  2KMA A;  3A4S C;  4NJ6 A;  5BO4 B;  2JVC A;  1S3S G;  2UYZ B;  2O6V B;  4PYU A;  1J19 A;  3ZUN A;  2IY0 B;  2KTF A;  4WQO B;  2OOB B;  4NQL B;  2EMT A;  4E3C A;  2KC1 A;  2Y5B B;  3ECI A;  5D6J B;  3H6N A;  4RMA A;  3AU4 A;  2MBH A;  3H9D A;  2KQS A;  4GU2 A;  1OQY A;  2NPT B;  4DHJ B;  4P7I A;  4K81 A;  3I3T B;  4WJQ A;  2C9W B;  2R2Q A;  2ZPY A;  2KWU B;  2IO3 B;  2D11 A;  1LQB A;  4NY0 A;  3RD2 A;  2KJ6 A;  2ASQ A;  1KLV A;  3PHX B;  2V1Y A;  4G50 A;  4BOZ B;  3QK0 A;  4IC7 B;  2KD0 A;  3UQA A;  4IM0 A;  3RUI B;  5HKH A;  1GC6 A;  4KVG B;  2D3G A;  3DDC B;  1ZKH A;  1XD3 B;  5KHQ A;  5DPT A;  1IYF A;  2BYF A;  3RYT A;  1KM7 A;  4KDL B;  2DYO A;  3PV1 A;  2ZVO A;  4EZJ A;  2KAN A;  3HK0 A;  3PT2 B;  1V86 A;  2GBJ A;  2IO2 B;  1WGG A;  3C0R B;  1P98 A;  3VH3 B;  3A1Q A;  4GDK B;  3VTW A;  3VTV A;  2K6D B;  3A9J A;  3A9K B;  1OTR B;  4HJK A;  3VXW A;  2BKF A;  2J0J A;  2MBE A;  2IZV B;  3ZTD A;  4HLE A;  2G45 B;  4W9D A;  3ZVV A;  3VUX A;  3QQ8 B;  3APF A;  2BWF A;  2KDI A;  1C1Y B;  2N7E A;  5TR5 A;  2GMI C;  2DYB A;  5EDS A;  1SIF A; 
#chains in the Genus database with same CATH topology
 1Q10 A;  2WXJ A;  5J2R A;  4BKG A;  3W5V B;  2J42 A;  4WWM A;  3EFU A;  3JW0 X;  2HTM E;  5BMG A;  2AQ2 B;  2O6V D;  4RFB A;  3P63 A;  2OJR A;  4LNF A;  3TL5 A;  1MPE A;  2L83 A;  2JF5 A;  3KWL A;  4TMA B;  4LLG M;  3VUW A;  3NOB A;  4PS3 A;  1QIL A;  1D5M C;  1FXA A;  1ZGU B;  5G55 A;  3ZQ4 A;  2HE7 A;  5KHO A;  3T8M A;  3VTU A;  2LXA A;  2XK5 A;  1L6U A;  3IT6 B;  1FFV A;  4KKI A;  2L8J A;  1KLG D;  2RSU A;  2O2V B;  1E8Y A;  4KZC A;  2KAC A;  1P0R A;  4OVZ A;  5JXV A;  4A55 A;  1T0S C;  2XK5 B;  4MJS A;  1UF0 A;  2J4X A;  3M63 B;  1XLN A;  2QDF A;  3DHH C;  4DBG A;  3R7Q A;  3NRZ A;  2QIL A;  2MBB B;  3ZNZ B;  3EFC A;  2K25 A;  2DZJ A;  4I6L B;  1VDV A;  1EF1 A;  3AEE B;  3D32 A;  5IN7 A;  1C4P A;  3ZNI D;  1PYW D;  1PDX A;  1WZ3 A;  1IGC A;  1NBF C;  2PE6 B;  3QWZ B;  4US8 A;  4MGK E;  2M4N A;  1OEY A;  2A5U A;  3Q3O C;  2ZVN A;  3JSV B;  4W9H A;  4KSL C;  1C76 A;  2KQ4 X;  2NVU I;  2K6Q A;  2WP9 B;  3S2A A;  1GOZ A;  1WY8 A;  5I4D A;  2KWD A;  2BT6 A;  2AQ3 B;  3VR9 B;  1K8R B;  4G3X B;  3JYU A;  5IP4 D;  5D94 A;  4GGQ A;  4TKN A;  4W9G A;  3P2B A;  3N20 C;  2VZK D;  1V6E A;  1Q0W B;  4P6V F;  1WZ0 A;  4FN2 A;  2W55 A;  4EFO A;  1W6V A;  2WXI A;  2IY1 B;  2D10 A;  4XZ4 A;  3UIN B;  4OZC A;  3L16 A;  4KX6 B;  4WUR A;  2O2V A;  2DBY A;  1WSP A;  3BY4 B;  4Q2J A;  3HUI A;  2ONQ A;  2MLB A;  2L32 A;  4LCD E;  4KDI C;  3NVZ A;  3WAM A;  3R66 C;  4ARC A;  4UDU C;  1GG3 A;  2DNF A;  1R4M B;  4WH4 A;  4DWF A;  1I42 A;  1YX6 B;  1HA5 A;  4C7Z A;  1STE A;  1EUV B;  2FUG 1;  4HRS A;  2L76 A;  3FKY A;  4EUT A;  4KGS A;  4LTU A;  3DBR B;  1KOT A;  4ZRQ A;  2PLP A;  3V61 A;  3MFG A;  5E6N A;  2K39 A;  3CST A;  3EC8 A;  3ZXR A;  2MCN B;  2MQJ A;  1VZ8 A;  2E6X A;  2RPQ A;  1Y56 A;  5JHB A;  3L10 B;  5L83 A;  1VZ6 A;  2KJR A;  4P1B C;  1EO6 A;  1SXT A;  1FEH A;  5J18 A;  2KX0 A;  2NBU A;  2JRI B;  3J9C A;  4URK A;  4XC2 A;  2N9K A;  1JWB D;  2DX5 B;  2KQ7 A;  2KDM A;  3KYC D;  3K9O B;  1J7A A;  1WJN A;  3C8Y A;  3NY5 A;  2NR2 A;  3CMM B;  5IA7 A;  3PPA A;  4YT0 B;  4FHJ A;  3LMN A;  2IJ0 A;  1R4N I;  3BVZ A;  1P7E A;  2BQQ A;  1NDD A;  4OZB A;  3PZ7 A;  4K7U A;  2HJ8 A;  3SFD B;  4HDQ A;  3DBH I;  3DPD A;  1CMX B;  3AU5 A;  2KFJ A;  4I6P A;  2KLG A;  2N0S B;  3RCZ A;  4IDI A;  3O65 B;  2N7D A;  2FCQ A;  2D5G A;  5AZF A;  4BKS D;  2KNB A;  2XNA C;  4MAC A;  2WDQ B;  3W1S A;  2YLM A;  4LDT D;  3VAW A;  4LJP B;  2FID A;  3ZNG C;  1V2Y A;  2G3Q B;  2JXX A;  4HKZ E;  1YQ3 B;  2KDB A;  3E56 A;  4N9F 4;  2J53 A;  3E9S A;  2FIF A;  3TJP A;  4YTP B;  3W1S C;  4DXA B;  2ZZP B;  2C60 A;  3V62 A;  4C80 A;  3N9Y C;  3VR8 B;  2G4S A;  3WA0 A;  3NVV A;  3KLS X;  4DHJ D;  4M8M A;  4DHZ B;  2PMV A;  3A9K A;  3VRA B;  3LB8 C;  1E8X A;  2LAS A;  1FRD A;  1TKE A;  5G2N A;  1N62 A;  4IUM B;  2LWP A;  3ML9 A;  2AEH A;  3VHT C;  3WAO A;  1WXA A;  2ZJD A;  2JPH A;  5FR3 A;  2LRU A;  2M8S A;  4B95 A;  2JZ3 B;  4K3B A;  1L5P A;  1JWA D;  4TSS A;  3V05 A;  4LK0 M;  5DPW A;  4L1B A;  1T6B X;  3PSE B;  2BWE S;  1FXT B;  4DXG A;  4EE2 A;  1RYJ A;  3PLV A;  1UBI A;  5C2T B;  1JWU D;  2PEA A;  5AZH A;  4FJZ A;  1YN3 A;  4GDL A;  3TMP B;  2LXC A;  4ICU A;  4F7Z A;  4MGZ E;  3HM6 X;  5J17 A;  1V9J A;  2IPK D;  2JZZ A;  4AS1 A;  2WX1 A;  5CTR C;  1XLO A;  2AL6 A;  2N9X A;  1RLF A;  1WGK A;  1B1Z A;  1HZ5 A;  3MHZ A;  1F0Z A;  1MG8 A;  3IHP C;  3PVL A;  4WJO A;  2DHZ A;  1EU3 A;  1YD8 U;  3A33 B;  2RD0 A;  3ZXV A;  1C78 A;  1FNU A;  2PKO A;  1FO4 A;  4PYU A;  1J19 A;  2EMT A;  4RMA A;  1TZO A;  3H9D A;  2KQS A;  3NJT A;  4K81 A;  1IBX B;  2C9W B;  2KWU B;  1XEE A;  1KLV A;  2V1Y A;  2INC C;  3RUI B;  3FIL A;  4KVG B;  1T0Q C;  2D3G A;  3DDC B;  5KHQ A;  3DWM A;  3EUB 2;  3HK0 A;  2IO2 B;  4DQO C;  1RM6 C;  1GB4 A;  3EA6 A;  4GDK B;  3VTV A;  4YTN B;  3VXW A;  2MBE A;  3ZTD A;  3GP7 A;  3QQ8 B;  2N7E A;  2MEK A;  4OZA A;  2KOX A;  3NS1 A;  5E6O A;  1VRA B;  1M4V A;  3ZIM A;  3AB5 A;  4XE0 A;  1JW9 D;  1WRD B;  3KVF B;  3I9V 1;  1XT9 B;  1ZDV A;  4WWO A;  1YQB A;  1Q1O A;  2JQR B;  1R4M I;  1WIA A;  2BYE A;  2BVC A;  2WYQ A;  2KFK B;  1FCL A;  3MHS D;  3KQ4 A;  3P4Q B;  3PZ8 A;  3VDZ A;  2KN4 A;  3U2S C;  1OFF A;  3TUO A;  1N6Z A;  2JWZ A;  1QOG A;  3AEC B;  4JQW C;  1GAQ B;  2ICI A;  4CQN A;  2Y5P A;  1GB1 A;  4F1S A;  1MFW A;  2AWT A;  4GMV A;  2WXO A;  1Z2M A;  2IO1 B;  2WXF A;  1QLB B;  3RN9 C;  1XO3 A;  5HFY A;  4AUQ C;  2JUO A;  3L54 A;  5D2M B;  4ZRP A;  4NAM A;  5D3I B;  1NVI D;  3AV8 A;  3RI7 C;  2N1V A;  3N32 A;  3H8H A;  4HPL B;  4GB9 A;  3DVN U;  3L4P A;  2KO3 A;  5E6P A;  2KAJ A;  3H7P B;  4WAA A;  2YEP B;  3V6E B;  2L52 A;  3AEF B;  2DWQ A;  2I1K A;  4YXD B;  3AXC A;  4ICV A;  1RFK A;  2BF8 B;  4PYZ A;  4W9K A;  4BFR A;  2ZCB A;  4ZYN A;  4LJO B;  3UGB B;  4OVU A;  3T3N A;  2L3Z A;  5AZG A;  2WLB A;  3UIO B;  3QAR A;  4ZRI A;  2GLS A;  3V6C B;  4ANW A;  3DHG C;  3MJ5 A;  1YIW A;  1IP9 A;  4J6I A;  1KFY B;  2DZI A;  3NS8 A;  1JCK B;  4RGM A;  1C4A A;  2EMS A;  2JT4 B;  1C3T A;  2Z8L A;  2K8C A;  3TIX A;  4REZ A;  3P4S B;  3R2T A;  1R7S A;  3P4P B;  1YNT E;  4HXD A;  1E8Z A;  4HPP A;  1I4R A;  4DDI D;  1SBB B;  4C4V A;  4ZRK A;  2C5L C;  2J52 A;  5IKC M;  1E90 A;  2ZNV C;  3ZJU A;  1MI0 A;  1MVK A;  3HM3 A;  3R7R A;  2V4L A;  2O6V A;  4W9E A;  4MGY E;  3RUL A;  3BK2 A;  5GMV A;  2EEL A;  3Q8E A;  3VRB B;  1KTK A;  5DPS A;  2MP2 A;  2NTS A;  4EZK A;  2W3R A;  4LNO A;  2JWU A;  3DVG Y;  2GBN A;  1FPY A;  3SDL C;  3IXS A;  3MJW A;  3GZN B;  4A3P A;  3RNG C;  3VUY A;  3U30 A;  3M62 B;  4IM3 A;  5E6J A;  3DQV A;  2WQY B;  4LNI A;  4L23 A;  1SJE D;  1K53 A;  3ZTC A;  3ZDM C;  3WAL A;  1WGH A;  1WX8 A;  2LJ5 A;  1K51 A;  2X38 A;  3ZO5 B;  2KFK A;  5C3J B;  1TBE A;  2BW2 A;  1TS2 A;  2G1E A;  2JX5 A;  2N9P C;  3DHI C;  4WJP A;  1I4X A;  1V49 A;  1UNS A;  2KDF B;  4DK5 A;  1EU4 A;  1HEZ E;  4WAF A;  3WIM A;  4HWI B;  3AE1 B;  4A3O A;  4A9A A;  5AUK A;  2J0K A;  3IVF A;  2QMT A;  2M17 A;  2QSD A;  5JHA A;  3CWI A;  1SGH A;  4AJW A;  2BBC A;  2RMM A;  3DOW A;  3FC4 A;  2IGG A;  4FJY A;  1WH3 A;  4YSX B;  2LUE A;  4M0W B;  4ZHO A;  1K50 A;  3BYY B;  4W9F A;  2QCZ A;  5LXI B;  1QOA A;  3QC8 B;  2V9H A;  4FJV B;  2KX3 A;  3PLU A;  3UI3 A;  1XLP A;  2C7N B;  2MJ3 A;  4RGT A;  4HPM B;  1GUA B;  2LGX A;  4ASW C;  1Z5S B;  2AL3 A;  2N7J A;  2K22 A;  4BKT A;  3AUL A;  2IGD A;  1EF5 A;  1WGY A;  1HE8 A;  2M1M A;  2DYM A;  2MRP A;  4HJG E;  3NUH B;  4JWU C;  2L7R A;  3AE8 B;  2C7H A;  4US9 A;  3L17 A;  4LNN A;  4KKJ A;  1VLB A;  4AP4 C;  3B0A A;  2EKE C;  5DCN A;  1XXG A;  3RFZ B;  2WXP A;  3VFK A;  3TEX A;  1UH6 A;  2LUM A;  2BTE A;  2WXR A;  2GI9 A;  2IGH A;  5BYS A;  1LM8 B;  1YN4 A;  2LGS A;  1E10 A;  1MJD A;  2VZK B;  4PS8 A;  4HRO A;  4W9I A;  4W9L A;  2INP E;  1NI3 A;  1LFD A;  2LVQ A;  1K52 A;  2BB5 A;  1WWT A;  2KTR B;  4ARI A;  2Z0E B;  3V3X A;  1ENF A;  2H88 B;  4B0M A;  3R2I A;  3UQB A;  1NEK B;  1WE7 A;  3OJ3 A;  1JWM D;  3NZU A;  5CHW A;  1WI0 A;  4OHJ A;  3RMK C;  1RAX A;  4E74 A;  2HDE A;  1IBX A;  2KJH B;  3AH7 A;  1UWX A;  4ZOH C;  4NQK E;  3RPF C;  2ZW1 A;  4IWQ A;  3WAP A;  2KVR A;  3UF8 A;  3RT3 B;  2CU1 A;  1ZDX A;  1OQQ A;  1UBQ A;  4GDK A;  2MX2 A;  3C19 A;  4KGR A;  3JVZ X;  1N60 A;  1IPG A;  1OGW A;  3SHQ A;  4KZ0 A;  3N1X C;  1FD6 A;  3DBR I;  1NYR A;  5AUI A;  4R3D A;  4XWT A;  4QAY A;  2BS4 B;  3I5J C;  1SIJ A;  4I6N B;  3M3J A;  4P16 A;  1J0G A;  2JSV X;  2CHX A;  3FIL B;  3ZDT A;  2DLB A;  1SE3 A;  2IYD B;  2LVO A;  4RF0 A;  2KTR A;  2Q5W D;  3Q3M C;  4IW0 A;  2D07 B;  3AED B;  4CHK A;  2NS5 A;  2INN E;  2GOW A;  1J7C A;  1JML A;  4C00 A;  2D3B A;  2IY0 B;  4NQL B;  2RPV A;  3AU4 A;  1OQY A;  4WIP A;  1FRR A;  2SAK A;  1NEN B;  4HKQ A;  2WU2 B;  2IO3 B;  3PHX B;  1DYQ A;  2CJO A;  2AX5 A;  4IC7 B;  1GC6 A;  2UU7 A;  1ZKH A;  1XD3 B;  1IYF A;  1C9F A;  2BB6 A;  1BML C;  3TEW A;  1WGG A;  3C0R B;  1P98 A;  3VH3 B;  3VTW A;  2K6D B;  2ACZ B;  3A9J A;  3A9K B;  4HJK A;  4MM3 B;  3ZVV A;  3VUX A;  1ZOY B;  3APF A;  5TR5 A;  2KDI A;  5EDS A;  1SIF A;  2WXQ A;  3QIJ A;  4C56 C;  1TYG B;  1UUP A;  2XN9 C;  3ZGZ A;  3LYY A;  3U7Z A;  2WDV B;  2FUH B;  1WR6 E;  3PGE A;  5CX3 A;  1PQS A;  3ABV B;  2JY6 A;  3I63 C;  3RNF C;  2LGY A;  4AJY B;  4D2K A;  4MSM B;  1V1O A;  4N58 A;  3ENE A;  1RRB A;  4HCP B;  2WXL A;  4K1R B;  1E6E B;  1TKY A;  4XYC A;  1IGD A;  1SE4 A;  2M19 A;  1N5X A;  3AE5 B;  4IG7 B;  1CJE A;  3OG5 A;  2BGF A;  2M0A A;  5LNK 1;  3IAM 1;  1TY0 A;  2ZCC A;  2FAZ A;  1AYF A;  2AYO B;  3PHW B;  1JRU A;  1E9M A;  1T5X D;  2BPS A;  1TT5 B;  2W9N A;  1TGZ B;  2LD9 A;  3KUZ A;  1L0X B;  3UIP B;  4AOF A;  1DOY A;  2RR9 A;  2WWZ A;  3Q8F A;  4IOI E;  5EE3 A;  3PRP B;  3ZNH B;  2QIE B;  4ANX A;  3QAQ A;  4GLS C;  3T3O A;  1A70 A;  3VQI A;  3CSF A;  2W82 A;  4W9J A;  2MJE A;  2KDE B;  1M94 A;  2JZP A;  3NHE B;  3ALB A;  5LXH A;  4MGI E;  2OED A;  1YX5 B;  1L0V B;  3DWG C;  5D7G A;  2WHI A;  1OEY J;  4K3C A;  1RWS A;  2I38 A;  3PZD A;  1WJ6 A;  3BWU D;  3AM9 A;  2W3S A;  4EOY A;  3P4R B;  3ZRC A;  3PRM B;  1PUT A;  1CZP A;  5IO9 A;  4TV3 A;  3NVW A;  1WRI A;  1KF6 B;  2LHD A;  1D3Z A;  2NPT A;  2BYT A;  1HXY D;  2LJI A;  2KHW B;  3CF6 E;  1F2R I;  1N5W A;  1WMH B;  2L0T A;  4BBN F;  5D3D A;  2G9H D;  4IKG A;  1WR1 A;  5HHD G;  2R61 A;  4F8C B;  5EE0 A;  4MH0 E;  4II2 B;  3OJ4 B;  3SEB A;  1AWD A;  2PTL A;  4PK1 A;  2VRR B;  3DBS A;  1J8C A;  2CHW A;  1I7H A;  4NZL B;  2WXM A;  1XCQ L;  2E3T A;  3IAS 1;  2B76 B;  2V4I B;  2VH2 A;  3GE3 C;  1L4Z B;  1AAR A;  3ZKJ C;  4YTM B;  3Q8A A;  1GNU A;  5BMH A;  2N1W A;  1FM0 D;  2K8H A;  5C1Z A;  1WXM A;  1WF9 A;  3Q3J A;  3W1Y A;  4ZHP A;  1I4H A;  2JYT A;  2V3S A;  1QF6 A;  2PE9 A;  3PO0 A;  4JWS C;  4S0R A;  2KMM A;  1E7V A;  1VD2 A;  4N6E B;  1WJU A;  2ZNV B;  2QEJ C;  1NYQ A;  2HJ1 A;  4EZL A;  5BMI A;  3N1Y C;  4GN1 A;  2R2O A;  2JRH A;  1V5T A;  4W9C A;  3AEA B;  1MG4 A;  4MM3 A;  3OWE B;  2DZK A;  3ETR A;  2L0F A;  5JH5 C;  2FNJ B;  2LMC A;  1WYG A;  3IFW B;  3EGR A;  3KH0 A;  1S1Q B;  4OVV A;  1L0Y B;  2ZPN A;  3ZYY X;  2D2Q A;  1UEL A;  4MEM A;  2HD5 B;  2KZR A;  1SE9 A;  4ZRJ A;  3AE3 B;  3TEZ A;  5AEK B;  1JAL A;  1KH0 A;  2D3C A;  1PGX A;  2K0P A;  2N9E B;  3AE9 B;  1PGB A;  2KYW A;  2KK8 A;  4X57 B;  2K1F A;  2OJW A;  3OAW A;  1SE2 A;  1P7F A;  2LFI A;  4A90 A;  2FCN A;  1SSN A;  3MC9 A;  3MC0 B;  4NAW B;  2MBO A;  5FK9 C;  4DHZ E;  1I35 A;  1DOX A;  3SD5 A;  2QHO A;  1HQR D;  4BOS C;  4HVB A;  3HVD A;  1D4B A;  4A6Q A;  4G0N B;  3APC A;  1P9D U;  1I4P A;  4ITK A;  3APD A;  4RGO S;  3BVG A;  1J7B A;  4ACF A;  1V80 A;  3HRD D;  1V8C A;  2LEK A;  2WXH A;  5BYQ A;  1YJJ A;  4OW0 A;  3AEG B;  2WXG A;  1D5X C;  2CU3 A;  2MWS B;  5HG2 A;  2LRW A;  4RGN A;  2REX A;  1U4A A;  1ESF A;  4FAD A;  1EM7 A;  1WXS A;  2JU6 X;  1V81 A;  5HI1 A;  3RZF A;  1F1H A;  1BT0 A;  1A5R A;  1VCB A;  1QT9 A;  3QJZ A;  2FE8 A;  3BK1 A;  3IG3 A;  4FXC A;  3PTF C;  4YWG G;  1FNW A;  1V1P A;  3AEB B;  2DEN B;  3IT4 B;  3VVW B;  3V60 A;  3JSV A;  1WJ4 A;  2VH1 A;  3DVN V;  5EE9 A;  2GBM A;  2KXJ A;  4GSW A;  3K9P B;  3R3M A;  3PRZ A;  3AMZ A;  5TSS A;  1BUI C;  3MTN B;  1V97 A;  3BVM A;  4NPN A;  1LO5 D;  4BKS A;  3HHM A;  1C79 A;  2IBI B;  1CQV A;  4GOC A;  2KMC A;  1G6J A;  2FBW B;  2WGS A;  4HEA 1;  3TEY A;  2V0G A;  2WXK A;  3W5U B;  4XDD A;  5IOI A;  4YSZ B;  3BII D;  2DAF A;  1N61 A;  1MHX A;  2J0M A;  1KRH A;  1GJZ A;  4HDO A;  3A1Q B;  3MC8 A;  4MSQ B;  1JRO A;  4HK2 A;  2IO0 B;  3B9J A;  3Q3N C;  1L2N A;  3M95 A;  3KWV A;  3DCG A;  5H8Y E;  2K8B A;  1WMH A;  4FBJ B;  4BBN C;  2X8X X;  2GBK A;  4YSY B;  4GXB A;  5BYR A;  4J3O D;  3Q3F A;  5T8I A;  4B9K A;  1EWC A;  3NG0 A;  4FLH A;  1HTO A;  2YEP F;  3PRE A;  4XWW A;  3LDZ E;  4C4V B;  2H89 B;  2CHZ A;  4TQ1 A;  2KVZ A;  1XF5 L;  2PIA A;  1DGJ A;  3QA8 A;  4JL9 A;  4E71 A;  3I57 A;  1SJH D;  2NMQ A;  3SU8 X;  1QZE A;  1TJE A;  1T3Q A;  1HTQ A;  1D6E C;  2JVC A;  1S3S G;  4ZYS A;  2WXN A;  2UYZ B;  2KTF A;  4E3C A;  2KC1 A;  2TSS A;  2Y5B B;  2MHJ A;  1E7P B;  4DHJ B;  4P7I A;  1UWM A;  2R2Q A;  2D11 A;  4NY0 A;  2KJ6 A;  1TS5 A;  2ASQ A;  5MPO A;  4G50 A;  4BOZ B;  4M0W A;  4IM0 A;  5HKH A;  1YJI A;  1ZP0 B;  5DPT A;  1ZUD 2;  2BYF A;  4KDL B;  3PV1 A;  2ZVO A;  4H2A A;  4EZJ A;  3FAH A;  3PT2 B;  5FKA C;  5H92 C;  2IDY A;  1XCT L;  2BKF A;  2J0J A;  2G45 B;  4W9D A;  1YN5 A;  3Q69 A;  1TS4 A;  1FNV A;  2GMI C;  1YOV B;  2PW9 A;  3N30 A;  3KUC B;  1IUE A;  4O1N A;  1WFY A;  4NNJ B;  2LGI A;  2NBW B;  1ZW7 A;  3Q6B A;  1WXV A;  1KJT A;  4C7Y A;  3A9J B;  2CKH B;  3HIZ A;  1QQR A;  4RH6 A;  3BZD B;  3EHV A;  3Q8B A;  4KSK C;  5FR6 A;  4JIO U;  4EKU A;  1TY2 A;  4ANU A;  2Y5C A;  1VZ7 A;  2Y3A A;  2B3A A;  2RGF A;  4DXF A;  5L95 C;  2UWQ A;  2KT7 A;  1FXI A;  2MBQ A;  4MDK E;  4FA6 A;  1TIF A;  1QOF A;  4A20 A;  1B9R A;  3AI5 A;  2BYV E;  3NZ3 A;  4RCO A;  3MP9 A;  5G5G A;  4WWN A;  2K9X A;  1WX7 A;  2PVO D;  2XEW A;  1TTN A;  3DBL B;  3GZN I;  3WAN A;  1FCC C;  1I4G A;  3TSS A;  4FUL A;  3NZS A;  2D3A A;  4TUU A;  1QOB A;  4PS7 A;  3QCA A;  3O13 A;  4TQ0 A;  1AN8 A;  2M56 B;  3ZLZ A;  3B08 A;  2ON8 A;  4II3 B;  4NJ7 A;  1E5W A;  1T0Y A;  1ZXI A;  2RDB C;  4NAW A;  4M02 A;  1XQQ A;  4XDC A;  3KYD D;  2PVG C;  4FHK A;  2BKR B;  5DPR A;  4LDT B;  3B2F A;  3RNA C;  1Q5W B;  2CS4 A;  3ML8 A;  1D5Z C;  1WE6 A;  1FMA D;  2DZM A;  1AW7 A;  2NCN A;  4KIK A;  1EWY C;  3AN1 A;  3KW5 B;  2I1J A;  3NVY A;  3P42 A;  3ZJV A;  4MT5 A;  3LJ3 A;  3AE7 B;  1MHH E;  4YL8 A;  1JWS D;  2FCS A;  1ACC A;  4N59 A;  3T9L A;  3DBL I;  2GRI A;  2YVC A;  5LLI A;  1WGD A;  5G5H A;  4XGA B;  3N1Z C;  3DVG X;  4BVU C;  4DDG D;  1PFD A;  4RF1 A;  2RDH A;  3W2D A;  1E0Z A;  1TZ1 A;  4RNA A;  1P1A A;  1LXD A;  1WYW B;  4K7S A;  2DAJ A;  2Z59 B;  4KIK B;  1ET9 A;  2GBR A;  1UGJ A;  4MEL A;  4HCN B;  4MJS B;  5IAA C;  3Q2A C;  1UZX B;  3ZRF A;  1UD7 A;  1ROE A;  2KLC A;  2HTH A;  5GXG B;  3Q14 C;  4XX5 A;  4BZA A;  3EEC A;  3TBL D;  2JXT A;  2BS2 B;  1TKG A;  4PT5 A;  2L00 B;  3W9C B;  4KGT A;  2LGD A;  2EKI A;  4M00 A;  3PS6 A;  3KUD B;  1F2R C;  1RFA A;  4CO7 A;  2PJH A;  4JE3 B;  1WM3 A;  3QX1 A;  2KKC A;  2SEB D;  3X23 A;  3A4R A;  2ZEQ A;  5C23 A;  4G11 A;  2KWC A;  3LXF A;  4GDL B;  2FCM A;  1SB3 C;  1ZXH A;  2MSE D;  4BAX A;  3U4E G;  4K7W A;  1I4Q A;  4LNK A;  1V5O A;  2WX0 A;  5EE1 A;  1N63 A;  1SEB D;  1FFU A;  2K3U A;  4RM8 A;  3BIN A;  2KWV B;  3H1U A;  2MW5 A;  1ZPS A;  3RNC C;  3P1M A;  1F52 A;  2I2Y A;  1ZE3 D;  2V3P A;  1NI2 A;  3B2G A;  1WXQ A;  2CJN A;  3DBH B;  2N9L A;  2LI5 A;  4ANV A;  3IBE A;  2BS3 B;  3VH4 B;  4ZDV A;  4L2Y A;  1H4R A;  4WWP A;  1F77 A;  3RNB C;  1YJ1 A;  2WU5 B;  4IWP A;  4M8N A;  2J7Q B;  4IM2 A;  2V3N A;  1R4N B;  2L05 A;  4JGH B;  3RZW C;  2GB1 A;  2PPH A;  2ZW0 A;  4IWO A;  4RM9 A;  2MA9 B;  3AE4 B;  3ONS A;  1ISN A;  2G4D B;  4WJN A;  4GIV A;  2MJD A;  1YQ4 B;  4JLC A;  1C77 A;  1UGM A;  2Z0D B;  3QHT A;  3N3K B;  3U8Z A;  4JPS A;  2NBV B;  4S17 A;  2MP2 B;  2LVP A;  4USA A;  2C7M B;  3L0W B;  2K5P A;  2LZ6 A;  2QJL A;  1Y8R C;  5JZE B;  1QKZ A;  3H7S A;  2KN5 A;  2WNM A;  3OLM D;  3R8B A;  3ZJT A;  4NJC A;  5CHV C;  1WGR A;  1KLU D;  2WDR B;  4AWJ A;  1X1M A;  3GOE A;  4P1C C;  2M0X A;  1JQ4 A;  3L13 A;  1PGA A;  2WDT B;  2L1A A;  2WS3 B;  3X0W A;  3SFE B;  3H7P A;  3ZW3 A;  1ET6 A;  2KC2 A;  1BXT A;  1GC7 A;  1WM2 A;  2AQ1 B;  2NTT A;  2RDG A;  1XLQ A;  1T0R C;  2A4Z A;  1VR9 A;  1L4D B;  2CR5 A;  1HZ6 A;  1YMH E;  3WCQ A;  4A8X C;  3L08 A;  3CIR B;  4B6W A;  2OHF A;  1WX9 A;  1CK1 A;  2LHE A;  1VJK A;  2MH7 A;  1E8W A;  1LGR A;  1L7Y A;  3U52 E;  2XBB C;  3GE8 C;  3TCA A;  2IND C;  3HVZ A;  2QC8 A;  3GB1 A;  3AE6 B;  4AQ7 A;  4KV2 A;  4CYE A;  4EEW A;  1P3Q U;  1F9J A;  2N4F A;  1SF0 A;  3U7D A;  5CHF A;  3AE2 B;  3B1L X;  3URY A;  1TS3 A;  1E7U A;  4WQM A;  1OQR A;  1H8C A;  2KMA A;  3A4S C;  4NJ6 A;  5BO4 B;  1L6V A;  2JYE A;  1JRP A;  2O6V B;  3ZUN A;  4WQO B;  2OOB B;  1GPX A;  5D6J B;  3ECI A;  3H6N A;  3SR6 A;  2MBH A;  4GU2 A;  2NPT B;  3BYT B;  3RNE C;  3I3T B;  4WJQ A;  2ZPY A;  3RD2 A;  1LQB A;  3Q8C A;  1C4C A;  3QK0 A;  2KD0 A;  3UQA A;  4M01 A;  4JX1 C;  1DOI A;  3RYT A;  1KM7 A;  4MH8 A;  2DYO A;  4B0E A;  2W54 A;  2KAN A;  1V86 A;  2GBJ A;  3GS2 A;  3A1Q A;  1V1P B;  1OTR B;  2IZV B;  4HLE A;  2BWF A;  1C1Y B;  1FIQ A;  2DYB A; 
#chains in the Genus database with same CATH homology
 3QIJ A;  2KOX A;  5E6O A;  3N30 A;  3KUC B;  5J2R A;  4BKG A;  3ZIM A;  1WFY A;  4NNJ B;  2NBW B;  3EFU A;  2FUH B;  1WRD B;  1WR6 E;  1ZW7 A;  3JW0 X;  1PQS A;  3KVF B;  3PGE A;  5CX3 A;  1XT9 B;  4WWO A;  1WXV A;  1KJT A;  2JY6 A;  3A9J B;  2CKH B;  3HIZ A;  1YQB A;  1Q1O A;  2LGY A;  1R4M I;  1WIA A;  3EHV A;  2BYE A;  4KSK C;  5FR6 A;  4AJY B;  4JIO U;  4EKU A;  2O6V D;  4MSM B;  4ANU A;  2WYQ A;  2KFK B;  2OJR A;  3ENE A;  1RRB A;  3MHS D;  2B3A A;  2RGF A;  4HCP B;  5L95 C;  2UWQ A;  3VDZ A;  4K1R B;  3TL5 A;  2JWZ A;  4IG7 B;  2JF5 A;  4JQW C;  2BGF A;  2MBQ A;  3VUW A;  4MDK E;  3NOB A;  4PS3 A;  4F1S A;  2ZCC A;  4FA6 A;  2FAZ A;  2AWT A;  4GMV A;  1ZGU B;  5G55 A;  2HE7 A;  2AYO B;  1Z2M A;  3PHW B;  2IO1 B;  1JRU A;  5KHO A;  3T8M A;  3VTU A;  2BPS A;  3AI5 A;  4A20 A;  2LXA A;  2BYV E;  2XK5 A;  2W9N A;  1TGZ B;  2LD9 A;  3KUZ A;  4WWN A;  3UIP B;  1WX7 A;  2JUO A;  4AUQ C;  3L54 A;  5D2M B;  2RR9 A;  2XEW A;  1TTN A;  2WWZ A;  2L8J A;  2N1V A;  2RSU A;  3N32 A;  2O2V B;  1E8Y A;  3GZN I;  3PRP B;  4KZC A;  3ZNH B;  3WAN A;  4ANX A;  1P0R A;  4FUL A;  3QAQ A;  4HPL B;  3NZS A;  4GB9 A;  4TUU A;  3VQI A;  4PS7 A;  3CSF A;  3DVN U;  2XK5 B;  3QCA A;  2KO3 A;  5E6P A;  4TQ0 A;  4MJS A;  3H7P B;  3M63 B;  4W9J A;  4WAA A;  3V6E B;  2KDE B;  1M94 A;  3ZLZ A;  3NHE B;  4DBG A;  3B08 A;  2I1K A;  3ALB A;  4II3 B;  3AXC A;  5LXH A;  4MGI E;  4ICV A;  3R7Q A;  4NJ7 A;  1YX5 B;  2BF8 B;  1E5W A;  1T0Y A;  2MBB B;  4PYZ A;  4W9K A;  3ZNZ B;  4NAW A;  5D7G A;  2ZCB A;  4BFR A;  1OEY J;  2K25 A;  2DZJ A;  4I6L B;  4ZYN A;  4LJO B;  1EF1 A;  1XQQ A;  3PZD A;  1WJ6 A;  3D32 A;  3KYD D;  3UGB B;  4EOY A;  4OVU A;  2L3Z A;  5AZG A;  3ZNI D;  3ZRC A;  3PRM B;  4FHK A;  1WZ3 A;  1NBF C;  2PE6 B;  2BKR B;  3QWZ B;  3QAR A;  4MGK E;  4LDT B;  5DPR A;  3UIO B;  2M4N A;  4TV3 A;  1OEY A;  2A5U A;  4ZRI A;  2ZVN A;  1Q5W B;  3JSV B;  4W9H A;  3V6C B;  4KSL C;  1D3Z A;  4ANW A;  2CS4 A;  3ML8 A;  1WE6 A;  2NPT A;  2K6Q A;  1YIW A;  2DZM A;  2NVU I;  3S2A A;  1IP9 A;  4J6I A;  2KHW B;  1WY8 A;  2NCN A;  3CF6 E;  2DZI A;  3NS8 A;  4KIK A;  3KW5 B;  2I1J A;  3LJ3 A;  1WMH B;  2L0T A;  4BBN F;  2EMS A;  2JT4 B;  1C3T A;  1K8R B;  4YL8 A;  4G3X B;  1WR1 A;  3JYU A;  2K8C A;  2FCS A;  3TIX A;  5D94 A;  4GGQ A;  4TKN A;  4W9G A;  3P2B A;  3T9L A;  3DBL I;  4HXD A;  1E8Z A;  1V6E A;  1Q0W B;  4DDI D;  4F8C B;  1WZ0 A;  4MH0 E;  4II2 B;  2YVC A;  4ZRK A;  2C5L C;  4FN2 A;  3OJ4 B;  5LLI A;  1E90 A;  1J8C A;  1WGD A;  2VRR B;  3DBS A;  4EFO A;  2ZNV C;  1W6V A;  2CHW A;  2IY1 B;  3DVG X;  4BVU C;  4DDG D;  3HM3 A;  3R7R A;  2D10 A;  2V4L A;  4XZ4 A;  3UIN B;  2O6V A;  3L16 A;  4W9E A;  4MGY E;  3RUL A;  3ZKJ C;  1AAR A;  2O2V A;  1TZ1 A;  3BY4 B;  5GMV A;  1P1A A;  2MLB A;  1LXD A;  4LCD E;  1GNU A;  1WYW B;  4K7S A;  4KDI C;  2DAJ A;  2Z59 B;  5DPS A;  2N1W A;  3R66 C;  3WAM A;  2K8H A;  2MP2 A;  4EZK A;  5C1Z A;  1GG3 A;  4KIK B;  3DVG Y;  2GBN A;  1WXM A;  1WF9 A;  3Q3J A;  2GBR A;  3MJW A;  3SDL C;  4MEL A;  4A3P A;  4HCN B;  3VUY A;  3W1Y A;  4MJS B;  3U30 A;  3M62 B;  4IM3 A;  5IAA C;  4DWF A;  1I42 A;  1YX6 B;  1UZX B;  3ZRF A;  1UD7 A;  2V3S A;  3DQV A;  1EUV B;  2PE9 A;  3ZTC A;  2L76 A;  4EUT A;  3ZDM C;  2KLC A;  3WAL A;  1KOT A;  1WGH A;  2HTH A;  1E7V A;  1VD2 A;  4XX5 A;  3V61 A;  1WJU A;  2ZNV B;  1WX8 A;  3EEC A;  3TBL D;  2LJ5 A;  4EZL A;  5E6N A;  3ZO5 B;  2KFK A;  4GN1 A;  1TBE A;  2R2O A;  2K39 A;  2JRH A;  1V5T A;  3CST A;  2L00 B;  3EC8 A;  2MCN B;  2MQJ A;  2N9P C;  4W9C A;  4MM3 A;  4WJP A;  2DZK A;  2L0F A;  2LGD A;  2RPQ A;  5JH5 C;  1V49 A;  5JHB A;  3L10 B;  2FNJ B;  2KDF B;  3IFW B;  4DK5 A;  5L83 A;  3KH0 A;  3PS6 A;  1S1Q B;  2KJR A;  3KUD B;  3WIM A;  4HWI B;  1EO6 A;  4A3O A;  1RFA A;  4CO7 A;  5J18 A;  2KX0 A;  2PJH A;  2NBU A;  2JRI B;  1WM3 A;  4URK A;  4OVV A;  4XC2 A;  4AOF A;  2J0K A;  3IVF A;  3QX1 A;  2ZPN A;  2DX5 B;  2KQ7 A;  2KKC A;  2D2Q A;  1UEL A;  2M17 A;  3K9O B;  3KYC D;  2HD5 B;  4MEM A;  3X23 A;  2KZR A;  1SE9 A;  4ZRJ A;  3A4R A;  5AEK B;  1WJN A;  2ZEQ A;  3NY5 A;  2NR2 A;  5JHA A;  5C23 A;  3CMM B;  5IA7 A;  1SGH A;  4AJW A;  3PPA A;  4FHJ A;  3DOW A;  4G11 A;  2N9E B;  2KWC A;  3LMN A;  4GDL B;  2KK8 A;  1R4N I;  2FCM A;  4X57 B;  1NDD A;  2K1F A;  3OAW A;  2MSE D;  4FJY A;  4K7U A;  2FCN A;  2HJ8 A;  1WH3 A;  4K7W A;  2LUE A;  4M0W B;  4HDQ A;  3DBH I;  1V5O A;  4NAW B;  2WX0 A;  4W9F A;  3DPD A;  5LXI B;  1CMX B;  3AU5 A;  2MBO A;  3QC8 B;  4DHZ E;  2KFJ A;  4I6P A;  4FJV B;  2KLG A;  2KX3 A;  4RM8 A;  1I35 A;  3BIN A;  3RCZ A;  2KWV B;  3H1U A;  3PLU A;  2MW5 A;  3SD5 A;  2C7N B;  2QHO A;  3O65 B;  1NI2 A;  2FCQ A;  2N7D A;  4HPM B;  1GUA B;  4BOS C;  5AZF A;  4BKS D;  2KNB A;  2LGX A;  4ASW C;  4HVB A;  2LI5 A;  4ANV A;  1Z5S B;  3IBE A;  4G0N B;  3APC A;  3VH4 B;  4ZDV A;  1P9D U;  1H4R A;  4WWP A;  2AL3 A;  3W1S A;  2YLM A;  4LDT D;  4BKT A;  3VAW A;  3APD A;  3AUL A;  1EF5 A;  1V80 A;  1HE8 A;  1WGY A;  2DYM A;  2M1M A;  4LJP B;  2FID A;  3ZNG C;  1V2Y A;  2G3Q B;  2JXX A;  2MRP A;  2L7R A;  2C7H A;  2KDB A;  1YJ1 A;  4N9F 4;  3L17 A;  4IWP A;  4M8N A;  2J7Q B;  4IM2 A;  2FIF A;  4AP4 C;  2MWS B;  3B0A A;  2LRW A;  3TJP A;  2REX A;  3W1S C;  2L05 A;  4DXA B;  1U4A A;  2EKE C;  2ZZP B;  2C60 A;  3V62 A;  4FAD A;  1WXS A;  4JGH B;  5DCN A;  1V81 A;  3RZW C;  2PPH A;  3RZF A;  2G4S A;  4IWO A;  1BT0 A;  4RM9 A;  2MA9 B;  1VCB A;  3ONS A;  3VFK A;  1A5R A;  1UH6 A;  3QJZ A;  3WA0 A;  1ISN A;  2G4D B;  3IG3 A;  1LM8 B;  4WJN A;  4DHJ D;  4M8M A;  4GIV A;  4DHZ B;  3PTF C;  4PS8 A;  3A9K A;  1E8X A;  4JLC A;  4W9I A;  4W9L A;  1UGM A;  2Z0D B;  3QHT A;  2LAS A;  1LFD A;  2DEN B;  2LVQ A;  3N3K B;  3U8Z A;  2NBV B;  3VVW B;  2KTR B;  3V60 A;  2MP2 B;  2LVP A;  3JSV A;  1WJ4 A;  2C7M B;  3L0W B;  2Z0E B;  2LZ6 A;  3DVN V;  1Y8R C;  5G2N A;  5JZE B;  4IUM B;  2LWP A;  3H7S A;  2GBM A;  2KN5 A;  2AEH A;  2KXJ A;  3ML9 A;  3OLM D;  4GSW A;  3VHT C;  3UQB A;  3WAO A;  3K9P B;  3R3M A;  3PRZ A;  1WE7 A;  3OJ3 A;  5CHV C;  1WGR A;  1WXA A;  3MTN B;  2ZJD A;  3NZU A;  2JPH A;  2LRU A;  1WI0 A;  5CHW A;  4AWJ A;  2M8S A;  1X1M A;  4B95 A;  4NPN A;  4BKS A;  3HHM A;  1RAX A;  3GOE A;  2JZ3 B;  2IBI B;  4E74 A;  2M0X A;  2KJH B;  3L13 A;  4GOC A;  2KMC A;  1G6J A;  2WDT B;  5DPW A;  4NQK E;  3X0W A;  4IWQ A;  3WAP A;  3PSE B;  3H7P A;  2KVR A;  3ZW3 A;  2KC2 A;  3UF8 A;  2BWE S;  1FXT B;  3RT3 B;  2CU1 A;  3PLV A;  1GC7 A;  1WM2 A;  1UBI A;  2DAF A;  2A4Z A;  2J0M A;  2CR5 A;  1GJZ A;  1UBQ A;  2PEA A;  4HDO A;  5AZH A;  3A1Q B;  4GDK A;  2MX2 A;  3L08 A;  4MSQ B;  4B6W A;  4FJZ A;  4HK2 A;  3JVZ X;  3TMP B;  4GDL A;  2IO0 B;  1WX9 A;  2LXC A;  4ICU A;  1OGW A;  1IPG A;  3SHQ A;  4F7Z A;  1L2N A;  4MGZ E;  1E8W A;  3M95 A;  4KZ0 A;  3DCG A;  1L7Y A;  2K8B A;  3DBR I;  3HM6 X;  5J17 A;  1WMH A;  2XBB C;  1V9J A;  4FBJ B;  3TCA A;  4BBN C;  2JZZ A;  2GBK A;  4GXB A;  2WX1 A;  4KV2 A;  4CYE A;  4EEW A;  3Q3F A;  4B9K A;  1P3Q U;  1F9J A;  5CTR C;  4I6N B;  2AL6 A;  2N4F A;  3M3J A;  2N9X A;  4FLH A;  3U7D A;  1J0G A;  1RLF A;  3PRE A;  2CHX A;  3ZDT A;  3LDZ E;  5CHF A;  2IYD B;  2LVO A;  2KTR A;  2CHZ A;  4TQ1 A;  1MG8 A;  3B1L X;  4IW0 A;  3IHP C;  3QA8 A;  4JL9 A;  2D07 B;  3PVL A;  4WJO A;  4E71 A;  2DHZ A;  4CHK A;  1YD8 U;  2NS5 A;  3SU8 X;  3A33 B;  1QZE A;  2GOW A;  2RD0 A;  1E7U A;  1H8C A;  2KMA A;  3A4S C;  4NJ6 A;  5BO4 B;  2JVC A;  1S3S G;  2UYZ B;  2O6V B;  4PYU A;  1J19 A;  3ZUN A;  2IY0 B;  2KTF A;  4WQO B;  2OOB B;  4NQL B;  2EMT A;  4E3C A;  2KC1 A;  2Y5B B;  3ECI A;  5D6J B;  3H6N A;  4RMA A;  3AU4 A;  2MBH A;  3H9D A;  2KQS A;  4GU2 A;  1OQY A;  2NPT B;  4DHJ B;  4P7I A;  4K81 A;  3I3T B;  4WJQ A;  2C9W B;  2R2Q A;  2ZPY A;  2KWU B;  2IO3 B;  2D11 A;  1LQB A;  4NY0 A;  3RD2 A;  2KJ6 A;  2ASQ A;  1KLV A;  3PHX B;  2V1Y A;  4G50 A;  4BOZ B;  3QK0 A;  4IC7 B;  2KD0 A;  3UQA A;  4IM0 A;  3RUI B;  5HKH A;  1GC6 A;  4KVG B;  2D3G A;  3DDC B;  1ZKH A;  1XD3 B;  5KHQ A;  5DPT A;  1IYF A;  2BYF A;  3RYT A;  1KM7 A;  4KDL B;  2DYO A;  3PV1 A;  2ZVO A;  4EZJ A;  2KAN A;  3HK0 A;  3PT2 B;  1V86 A;  2GBJ A;  2IO2 B;  1WGG A;  3C0R B;  1P98 A;  3VH3 B;  3A1Q A;  4GDK B;  3VTW A;  3VTV A;  2K6D B;  3A9J A;  3A9K B;  1OTR B;  4HJK A;  3VXW A;  2BKF A;  2J0J A;  2MBE A;  2IZV B;  3ZTD A;  4HLE A;  2G45 B;  4W9D A;  3ZVV A;  3VUX A;  3QQ8 B;  3APF A;  2BWF A;  2KDI A;  1C1Y B;  2N7E A;  5TR5 A;  2GMI C;  2DYB A;  5EDS A;  1SIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...