3T9YA

Crystal structure of gnat family acetyltransferase staphylococcus aureus subsp. aureus usa300_tch1516
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
147
structure length
135
Chain Sequence
MSIITRLFNNSDFEKLNQLCKLYDDLGYPTNENDLKKRLKKITNHDDYFLLLLIKENKIIGLSGMCKMMFYEKNAEYMRILAFVIHSEFRKKGYGKRLLADSEEFSKRLNCKAITLNSGNRNGYVSNTSGFTKQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyltransferase, GNAT family
publication title Crystal structure of GNAT family acetyltransferase Staphylococcus aureus subsp. aureus USA300_TCH1516
rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 32
structure length 135
sequence length 147
ec nomenclature
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3t9yA00
3NE7A 4GS4A 2VEZA 4NEXA 2ATRA 2CNSA 3PGPA 5DWNA 4XPDB 5HMNA 3D3SA 2B4DA 2B5GB 3TTHA 4KOVA 1QSOA 4CRYB 1BO4A 2FL4A 3GY9A 2B3UA 3I3GA 2ZXVA 3EXNA 4CAXA 1B87A 4II9A 3TOAA 5ISVA 1RXTA 2P6GA 4QUSA 4UWIA 4ONUA 5DWMA 3SXNA 2PRBA 3MGDA 2KCWA 2JDDA 5F49A 2JDCA 4FD6A 3R9GA 2PSWA 4IUSA 4KUBA 2PDOA 3T90A 3ZZIA 3TE4A 3S6KA 4MY0A 4NF1A 2NMTA 2OZHA 2B5GA 3BLNA 4AG9A 2D4OA 2CY2A 5I0CA 3R9FA 1XMTA 5IV0A 2WPXA 1NSLA 3JVNA 4YFJA 1Z9UA 3K9UA 3I9SA 4RI1A 1YX0A 4DNCA 4MHDA 4H6ZA 4QBJA 1WWZA 3FBUA 4XNHC 3H4QA 2FIAA 4R9MA 1I1DA 1BOBA 2GIVA 1IIDA 1MJ9A 3OWCA 2VZYA 3CXPA 1XF8A 3D2PA 4KUAA 1S7NA 4NSQA 2ZW4A 2B4DB 3SXOA 1S3ZA 2VXKA 4H6UA 1VHSA 2FT0A 3FRMA 1LRZA 4JWPA 1YREA 2VQYA 4JLYA 2H5MA 4IF5A 2BEIA 3P2FA 4R3KA 3F8KA 4UWJA 3E0KA 4R57A 2CNMA 4M3SA 5KTDA 4BMHA 2EUIA 2B3VA 2OZUA 3W6XA 4CAVA 4F0YA 5IB0A 4FD5A 1MJAA 1M4IA 2C27A 3RYOA 3JUWA 1XIXA 3UY5A 2AJ6A 1L0CA 2PC1A 4QC6A 2J8NA 3PP9A 4U5YA 4ORFA 2HV2A 5J8CA 4QB9A 2PR1A 1QSRA 1P0HA 1Q2CA 1ON0A 2I00A 2R98A 1YGHA 4L89A 4UBRA 1QSNA 1XE4A 2BSWA 1I12A 3FYNA 3V8IA 4KOXA 4CAWA 4I49A 4U9ZA 1Q2YA 4M85A 1IICA 1IYLA 1V0CA 4KOSA 2VBQA 5IX3A 1KZFA 4PK2A 2BL1A 2ARHA 2ZPAA 3EO4A 4H89A 3TFYA 2AE6A 3TO9A 1PUAA 4YGOA 2B4BA 3FIXA 2Y0MA 1Q2DA 4HNWB 3T9YA 2J8MA 2OZGA 2ZW6A 4KVOE 1WK4A 4MY3A 1MK4A 4KOTA 4JXQA 4AVBA 2FE7A 2R7HA 3FNCA 3ZJ0A 2HQYA 2Q0YA 3VWDA 3S6GA 4ZBGA 2Q4VA 3DNSA 3R1KA 1Z4EA 1Z4RA 2GANA 1UFHA 1U6MA 1I21A 4HNYB 1NMTA 2GE3A 2WPWA 4LX9A 1TIQA 1S60A 4UA3A 2Q4YA 2QECA 2B58A 4MI4A 3D2MA 3GKRA 1M44A 2CNTA 2REFA 4HKFA 2OB0A 5HH1A 4R87A 3R96A 2PQ8A 4KOYA 4MJ8A 4F6AA 2JLMA 2G0BA 4KZTA 1MJBA 2Z10A 2HUZA 4XNHB 2FSRA 4RS2A 1Y9KA 2R1IA 5F47A 3S6FA 3D8PA 2ZW7A 1S7FA 3G3SA 4OLLA 3TO7A 3R9EA 4E2AA 2FXFA 3FB3A 2Q44A 3PZJA 3DDDA 2A4NA 3IWGA 4PK3A 4HNXB 3IGRA 1S5KA 2P0WA 4K30A 3SHPA 3BJ8A 4AVCA 1PU9A 4QVTA 2G3AA 2Q04A 1OZPA 4Y49C 2F5IA 1S7KA 1P4NA 2IL4A 1B6BA 5GCNA 4XPKA 4FD4A 1QSTA 2FCKA 1YVKA 3QAHA 5EBVA 5KTAA 1R57A 1CJWA 4E8OA 1QSMA 2I79A 4U9YA 3G8WA 2K5TA 2JEVA 4KOWA 4L8AA 3VWEA 4KOUA 3F5BA 5H84A 4OADA 4B5PA 2RC4A 4KORA 1K4JA 1J4JA 5H86A 4X5KA 1RO5A 4NCZA 2R8VA 3DR6A 2QIRA 1M4DA 3C26A 3TOBA 4KVXA 3KKWA 4KVME 3TO6A 4AB7A 2P6EA 3W91A 2J8RA 3DSBA 2VI7A 4CRZB 2O28A 1N71A 3F0AA 4EVYA 1CM0A 4AVAA 1YR0A 2ZW5A 4E0AA 4MBUA 1M1DA 4FD7A 5CNPA 1YVOA 2X7BA 4AG7A 2BUEA 1S7LA 4CS0B 3GYAA 3LD2A 5EC4A 1YLEA 1KUVA 2EVNA 4PSXA 2PR8A 3P2HA 3QB8A 4XPDC 3BJ7A 4B5OA 3TT2A 3DR8A 2DXQA 3WR7A 1SQHA 2Q7BA 1IYKA 4Y49B 5JPHA 3CXQA 1YK3A 5C82A 4JJXA 4PV6A 2REEA 4KLWA 5C88A 2Z11A 2FS5A 2OH1A 4XPLA 1Y9WA 1GHEA 3B8GA 2Z0ZA 3EY5A 2P6FA 2OU2A 1Y7RA 4LUAA 2D4PA 5JQ4A 4B5PB 4YRHA 4OAEA 3R95A 2QMLA 3W6SA 5E96A 3FXTA 1KUXA 1FY7A 5F48A 2FIWA 5J8FA 1XEBA 4KLVA 4NXYA 4R3LA 3TCVA 1KUYA 5FVJA 2VZZA 4JXRA 4J3GA 1VKCA 3EC4A 1M4GA 4PSWA 3CXSA 5KTCA 2G3TA 4JD6A 3S6HA 3LODA 5F46A 3N7ZA 1NE9A 3EFAA 1IB1E
chains in the Genus database with same CATH superfamily
3NE7A 4UFVA 4GS4A 2VEZA 4NEXA 2ATRA 2CNSA 2PCUA 3V7ZA 4OP4A 2XEJA 3PGPA 4XPDB 5DWNA 3S9LA 5CBMA 5HMNA 2YNEA 3D3SA 5ELYA 2B4DA 3SI2A 4WWVA 1TXRA 2B5GB 3TTHA 3WABA 3BI0A 4MFKA 4KOVA 1QSOA 3K2KA 2YNCA 1BPNA 5AG6A 2ZEPA 4P44A 2ZEHA 4A32A 4CRYB 1BO4A 2FL4A 4MXUA 4PXDA 3GY9A 2Q43A 5DS0A 2B3UA 3SJFA 4C68A 3VARA 5HVGA 1A2ZA 2V8GA 4CYQA 1LAMA 3I3GA 2ZXVA 3FH4A 4B6ZA 3EXNA 4CAXA 4M6HA 3KQXA 2NSMA 2NYQA 1B87A 3FMCA 1DTDA 4OC0A 4II9A 3TOAA 2JBJA 5ISVA 1RXTA 2PJAA 2XEIA 2XEGA 2C6GA 2P6GA 4QUSA 4UF4A 4UWIA 4ONUA 3KL9A 5DWMA 3SXNA 1F57A 4P45A 4R76A 1CX8A 2PRBA 3MGDA 1IU8A 1TF9A 2KCWA 4UCPA 4YU9A 2JDDA 2V8HA 4P4FA 4O23A 5F49A 2IMOA 2JDCA 3D4UA 4FD6A 4UFXA 2PJBA 5EMIA 4MFPA 2PSWA 3R9GA 3WC7A 4IUSA 4UEEA 3D67A 4KUBA 1CPSA 2PDOA 1ZO0A 4Q36A 2C1CA 4WJBA 3T90A 3ZZIA 4A33A 3TE4A 3S6KA 4MY0A 3CPXA 3FX6A 2NMTA 4NF1A 5I4MA 4MRIA 3KQZA 5D29A 1ZLHA 4NGRA 5LYIA 2OZHA 4UCMA 2B5GA 1FT7A 2Z3LA 2D4OA 3BLNA 3D7GA 4PXBA 4RN7A 2CY2A 4AG9A 4Q38A 4EWTA 4MFLA 1Z8LA 1XMTA 3CDXA 3GUXA 3R9FA 5I0CA 4CYPA 2WPXA 5IV0A 1YW4A 3JVNA 1NSLA 4R8FA 2PRQA 4BD9A 3PB7X 4PXEA 4YFJA 2GLJA 3N5FA 1Z9UA 3K9UA 4JZ0A 3I9SA 4RI1A 4C2YA 1YX0A 4DNCA 4MHPA 4MHDA 4H6ZA 4C2XA 1Z8XA 4EFDA 2AFSA 4QBJA 3RBUA 1WWZA 1ZLIA 4KSAA 3FBUA 4C7IA 4XNHC 3FJUA 4NGTA 3H4QA 2YGWA 2PIZA 3IU1A 2V8DA 2GLFA 2FIAA 4R9MA 1I1DA 1BOBA 2EK9A 3NA6A 4X8IA 1ELLP 2GIVA 1IIDA 1XJOA 1MJ9A 1XMBA 3LWUA 1PYTB 2ZEOA 3OWCA 4MFJA 2VZYA 3V38A 2Z3MA 3CXPA 2PJ9A 2YNDA 1XF8A 3D2PA 4KUAA 1S7NA 1YMEA 2ZW4A 4NSQA 2VL1A 2B4DB 3SXOA 3NH8A 2PJ3A 1S3ZA 3IEHA 2ZEDA 3NH4A 2C6CA 2VXKA 5AGEA 1R43A 4TNUA 2AFOA 1DE4C 4KSFA 1F2PA 4H6UA 1ELMP 1HEEA 3S9MA 4IK2A 1VHSA 2FT0A 2V77A 3FRMA 1LRZA 4JWPA 1YREA 2VQYA 4P10A 4TWEA 4JLYA 2H5MA 4IF5A 1ARLA 2BEIA 3P2FA 4A38A 2PJ1A 4R3KA 2AFXA 4UEFA 3F8KA 4UWJA 2PIYA 3E0KA 4R57A 4P4JA 2CNMA 4M3SA 5KTDA 3GLJA 1OBRA 4RUHA 4BMHA 2EUIA 1F2OA 2B3VA 2QYVA 2ZEGA 2ZELA 2OZUA 4CGPA 3W6XA 4CAVA 4F0YA 1CG2A 3PB4X 5IB0A 3I1UA 4FD5A 5A27A 2BOAA 3KHXA 1MJAA 1M4IA 5G20A 1LOKA 4GM5A 2C27A 2F8HA 2WZNA 3IIBA 5LRJA 3RYOA 2AFUA 4Z65A 3JUWA 1XIXA 3UY5A 2AJ6A 2GREA 4B13A 1L0CA 2ZENA 2Z3KA 2PC1A 3SJEA 2IJZA 4R6TA 3NE8A 4LQGA 4QC6A 2AFMA 3D7HA 3H8FA 2J8NA 3PP9A 3D68A 4U5YA 4CGNA 3D7DA 2PJ5A 4ORFA 2HV2A 5J8CA 4YWYA 4QB9A 4ZX8A 1YLOA 4DYOA 2PR1A 1QSRA 2CF4A 3NFZA 1P0HA 1Q2CA 1ON0A 1TF8A 2I00A 1YGHA 2PVWA 2R98A 1QSNA 1XE4A 4L89A 4UBRA 2BSWA 5G21A 1EE3P 1I12A 3FYNA 4UFWA 1AUGA 2PJ2A 3V8IA 3B3CA 1XFOA 3B3SA 4EMEA 2J9AA 4KOXA 3QNVA 4CAWA 2C6PA 1ARMA 2DEAA 1VHOA 4I49A 2BCOA 4JYWA 3SJXA 3PB6X 1Q2YA 4KSIA 4M85A 4U9ZA 4OC1A 1IICA 1LAPA 3MRUA 3WC5A 3ISXA 5A28A 1IYLA 1V0CA 4F8ZA 4F9UA 4KOSA 2VBQA 5IX3A 1KZFA 4B11A 4PK2A 2BL1A 3H8GA 4H2KA 1YSJA 2ARHA 3VATA 1IGBA 1VGYA 2ZEFA 2ZPAA 3EO4A 2FVGA 2EK8A 4OKOA 4H89A 3A9LA 3TFYA 2AE6A 2WSAA 4OC3A 3TO9A 5JM6A 2Z3NA 1PUAA 4FUUA 4YGOA 1TKJA 2B4BA 3L2NA 3KR5A 3FIXA 5IB9A 2Y0MA 1Q2DA 3GB0A 4HNWB 4CGLA 3T9YA 2J8MA 2OZGA 2XEFA 2ZW6A 4G1PA 4KVOE 5LRGA 1VIXA 3FVLA 4MHZA 1RTQA 3SI0A 1WK4A 4MY3A 3RZAA 1MK4A 5LRKA 1KWMA 2QVPA 4KOTA 4Q7AA 2CTBA 4NGQA 2BO9A 4JXQA 4AVBA 2FE7A 2R7HA 3FNCA 3ZJ0A 2HQYA 5THWA 3FEEA 2Q0YA 3PB8X 3VWDA 3WT4A 3S6GA 4ZBGA 4FBEA 2Q4VA 3DNSA 3R1KA 1Z4EA 1Z4RA 2GANA 1UFHA 1U6MA 1HDQA 2CXAA 5G1ZA 1M4LA 1CP7A 1I21A 3S9NA 4HNYB 5BWAB 4NGSA 4NJRA 1Y7EA 2GE3A 1NMTA 2WPWA 1R3NA 4LX9A 1TIQA 1S60A 4MFQA 4UA3A 2Q4YA 3DLJA 4MCRA 2QECA 2B58A 2RFHA 3TC8A 4OIWA 4MMOA 4MI4A 3D2MA 3GKRA 4CYNA 1M44A 2CNTA 3KASA 2REFA 3FF3A 4HKFA 2OB0A 5HH1A 4R87A 4CYOA 3R96A 2PQ8A 4KOYA 2O53A 4PXCA 4MJ8A 4X3RA 3FEDA 4F6AA 1CPXA 2JLMA 2ZOGA 4M6IA 2G0BA 1UWYA 3D7FA 1MJBA 2Z10A 3BHXA 4KZTA 4NJQA 4CGMA 2HUZA 4XNHB 2FSRA 4RS2A 5K8MA 1Y9KA 2R1IA 5F47A 3S6FA 3CT9A 3IFEA 4ZI6A 3D8PA 3SJGA 2I3CA 2ZW7A 4X2TA 2RB7A 1S7FA 2PJCA 3G3SA 4OLLA 3TO7A 4C7HA 3R9EA 3PRTA 4DUKA 4E2AA 2DF5A 2FXFA 5K8PA 4CAEA 3FB3A 4NFRA 1Z5RA 2Q44A 3PZJA 1AYEA 4PQAA 1LANA 4P6YA 4UEZA 3DDDA 4MFZA 3H8EA 3DGVA 2A4NA 4FAIA 3IWGA 1CBXA 4A2ZA 4PK3A 4ZYQA 2F7VA 4HNXB 4ZX9A 3IGRA 1S5KA 4C2ZA 1ZG7A 3MN8A 2P0WA 4K30A 1Z8WA 3SHPA 3BJ8A 4AVCA 2CTCA 1VHEA 2HB6A 3CZXA 1PU9A 1CP6A 4NGPA 4QVTA 2G3AA 1IY7A 2Q04A 1OZPA 3KI9A 4Y49C 4ZY1A 2F5IA 1S7KA 3K9TA 4NGMA 1P4NA 5K8OA 1XOVA 1Y0YA 4OC5A 2IL4A 1B6BA 5GCNA 4XPKA 4OMEA 3HUVA 4FD4A 4DJLA 1QSTA 2FCKA 3FECA 1YVKA 3PBEA 1GYTA 3QAHA 5EBVA 5KTAA 3TX8A 1R57A 1CJWA 4E8OA 4UIBA 4R7MA 1QSMA 2I79A 5HXDA 5F09A 4U9YA 3G8WA 2K5TA 4K3NA 2JEVA 4KOWA 4L8AA 5CPAA 2HC9A 4KOUA 4MCQA 3VWEA 3T8WA 4CGOA 3D66A 3F5BA 5H84A 1YQEA 4OADA 8CPAA 4B5PA 1Q7LA 7CPAA 4UCNA 4B10A 2RC4A 2JEWA 3IWEA 1K4JA 4KORA 4A37A 4P4IA 1J4JA 4W9YA 2Z3OA 5AG5A 3IJ3A 5H86A 4OC2A 4X5KA 1RO5A 4NCZA 2R8VA 3DR6A 2DPTA 2QIRA 1M4DA 3C26A 2YNCC 3JTKA 3JRUA 3TOBA 2AFWA 3IU2A 3IC1A 4KVXA 3KKWA 4KVME 5HVFA 1NSAA 1QMUA 1Z2LA 2P6EA 3TO6A 3W91A 4F0XA 3PBBA 2J8RA 3DSBA 2AFZA 2VI7A 4CRZB 4NGNA 2O28A 3SI1A 1N71A 3F0AA 5J1QA 4EVYA 3KHZA 4MHYA 5JGFA 4IHMA 2EWBA 4BBHA 5HVHA 2PJ4A 4MCPA 5K8NA 4MCSA 2PJ7A 3NH5A 1BPMA 1CM0A 4AVAA 1LFWA 1YR0A 5LYDA 2ZW5A 3RO0A 4E0AA 4MBUA 1TKHA 1M1DA 1FNOA 2PJ6A 3LACA 4FD7A 5CNPA 1YVOA 4A39A 4AXVA 4B14A 4CAFA 2X7BA 4AG7A 2BUEA 5JH9A 4P4DA 1S7LA 2OR4A 4OIDA 3IWWA 2Q51A 4B12A 4CS0B 3BXMA 5AG7A 2IQ6A 3GYAA 1HDUA 3H5ZA 3LD2A 3VH9A 5EC4A 3RAMA 1YLEA 1KUVA 1JQGA 1YW6A 2ABZA 2EVNA 2Q4ZA 4PSXA 5G22A 4CPAA 2PR8A 3P2HA 3QB8A 4GXHA 4XPDC 4AB7A 5AG4A 3BJ7A 4B5OA 3TT2A 3KZWA 1QQ9A 3DR8A 2G9DA 2PVVA 2DXQA 3B3TA 3WR7A 1Y0RA 3B3WA 1SQHA 2Q7BA 2PJ0A 1IYKA 1H8LA 1JWQA 4KS9A 1XRYA 4Y49B 2PE3A 5JPHA 3CXQA 3KR4A 4OC4A 1IOIA 1YK3A 1ZG8A 3PB9X 4FWUA 3PFOA 5LYLA 2Z3PA 5C82A 1PCAA 4JJXA 4PV6A 4A30A 3IO1A 4ZY0A 2REEA 3PEIA 4KLWA 5C88A 4ONWA 2Z11A 4A31A 1LCPA 2FS5A 1Z8TA 2ANPA 2OH1A 4ZY2A 4XPLA 2EO8A 1Y9WA 3B35A 1GHEA 3B8GA 2Z0ZA 3EY5A 3PFEA 2P6FA 2OU2A 1Y7RA 2OOTA 4LUAA 2D4PA 4MHNA 5JQ4A 2ZEEA 4B5PB 3GIUA 4YRHA 4A95A 3BI1A 4OAEA 5D8NA 3R95A 2QMLA 4BINA 3W6SA 2ZEMA 4M6GA 5E96A 4PPZA 2JBKA 3FXTA 1KUXA 1FY7A 1BLLE 5F48A 2FIWA 2EBJA 3LMSA 5J8FA 1XEBA 1TKFA 4KLVA 1XBUA 2ZOFA 2PJ8A 4NXYA 4R3LA 3TCVA 2O4HA 1KUYA 3KGQA 5FVJA 2POKA 2VZZA 4P4BA 3HLPA 4JXRA 4J3GA 1BAVA 1VKCA 3EC4A 4A94A 2GFQA 2V8VA 1M4GA 2GU2A 3CXSA 3ISZA 4PSWA 1X10A 1ZG9A 3B2YA 4LQ6A 3CPAA 1AMPA 4ZGYB 5KTCA 4IAVA 2G3TA 2ODFA 4JD6A 3S6HA 3WC6A 2DPSA 4UIAA 5LYFA 2CIJA 4F9VA 3B3VA 4HPSA 2QJ8A 3B7IA 3LODA 3RNZA 3QAYA 5F46A 1X12A 1IOFA 3N7ZA 6CPAA 2WUUA 2Q7SA 1NE9A 3EFAA 4P4EA 1IB1E 2WYRA
chains in the Genus database with same CATH topology
3NE7A 4UFVA 4GS4A 2VEZA 4NEXA 2ATRA 2CNSA 3PGPA 5DWNA 4XPDB 5HMNA 2YNEA 3D3SA 2B4DA 2B5GB 3TTHA 4MFKA 4KOVA 1QSOA 2YNCA 5AG6A 4A32A 4CRYB 1BO4A 2FL4A 3GY9A 2B3UA 4C68A 4CYQA 3I3GA 2ZXVA 3EXNA 4CAXA 1B87A 4II9A 3TOAA 5ISVA 1RXTA 2P6GA 4QUSA 4UWIA 4ONUA 5DWMA 3SXNA 2PRBA 3MGDA 4UCPA 2KCWA 2JDDA 5F49A 2JDCA 4FD6A 4UFXA 4MFPA 2PSWA 3R9GA 4IUSA 4KUBA 2PDOA 3T90A 1ZO0A 4Q36A 3ZZIA 4A33A 3TE4A 3S6KA 4MY0A 4NF1A 2NMTA 2OZHA 4UCMA 2B5GA 2Z3LA 3BLNA 2D4OA 4AG9A 2CY2A 4Q38A 5I0CA 4MFLA 3R9FA 1XMTA 5IV0A 4CYPA 2WPXA 1NSLA 3JVNA 4YFJA 1Z9UA 3K9UA 3I9SA 4RI1A 4C2YA 1YX0A 4DNCA 4MHDA 4H6ZA 4C2XA 4QBJA 1WWZA 4KSAA 3FBUA 4C7IA 4XNHC 3H4QA 2YGWA 3IU1A 2FIAA 4R9MA 1I1DA 1BOBA 2GIVA 1IIDA 1MJ9A 3OWCA 4MFJA 2VZYA 2Z3MA 3CXPA 2YNDA 1XF8A 3D2PA 4KUAA 1S7NA 4NSQA 2ZW4A 2B4DB 3SXOA 1S3ZA 2VXKA 5AGEA 4KSFA 4H6UA 1VHSA 2FT0A 3FRMA 1LRZA 4JWPA 1YREA 2VQYA 4JLYA 2H5MA 4IF5A 2BEIA 3P2FA 4R3KA 3F8KA 4UWJA 3E0KA 4R57A 2CNMA 4M3SA 5KTDA 4BMHA 2EUIA 2B3VA 4CGPA 2OZUA 3W6XA 4CAVA 4F0YA 5IB0A 4FD5A 5A27A 1MJAA 1M4IA 5G20A 2C27A 3RYOA 3JUWA 1XIXA 3UY5A 2AJ6A 4B13A 1L0CA 2Z3KA 2PC1A 4QC6A 2J8NA 3PP9A 4U5YA 4CGNA 4ORFA 2HV2A 5J8CA 4QB9A 2PR1A 1QSRA 1P0HA 1Q2CA 1ON0A 2I00A 2R98A 1YGHA 4L89A 4UBRA 1QSNA 1XE4A 5G21A 2BSWA 1I12A 3FYNA 4UFWA 3V8IA 4KOXA 4CAWA 4I49A 4U9ZA 1Q2YA 4M85A 1IICA 5A28A 1IYLA 1V0CA 4KOSA 2VBQA 5IX3A 1KZFA 4B11A 4PK2A 2BL1A 2ARHA 2ZPAA 3EO4A 4H89A 3A9LA 3TFYA 2AE6A 2WSAA 3TO9A 2Z3NA 1PUAA 4YGOA 2B4BA 3FIXA 2Y0MA 1Q2DA 4HNWB 4CGLA 3T9YA 2J8MA 2OZGA 2ZW6A 4KVOE 1WK4A 4MY3A 1MK4A 4KOTA 4JXQA 4AVBA 2FE7A 2R7HA 3FNCA 3ZJ0A 2HQYA 2Q0YA 3VWDA 3S6GA 4ZBGA 2Q4VA 3DNSA 3R1KA 1Z4EA 1Z4RA 2GANA 1UFHA 1U6MA 5G1ZA 2CXAA 1I21A 4HNYB 5BWAB 1NMTA 2GE3A 2WPWA 4LX9A 1TIQA 1S60A 4MFQA 4UA3A 2Q4YA 2QECA 2B58A 4MI4A 3D2MA 3GKRA 4CYNA 1M44A 2CNTA 2REFA 4HKFA 2OB0A 5HH1A 4R87A 4CYOA 3R96A 2PQ8A 4KOYA 4MJ8A 4F6AA 2JLMA 2G0BA 4KZTA 1MJBA 2Z10A 4CGMA 2HUZA 4XNHB 2FSRA 4RS2A 1Y9KA 2R1IA 5F47A 3S6FA 3D8PA 2ZW7A 1S7FA 3G3SA 4OLLA 3TO7A 4C7HA 3R9EA 4E2AA 2FXFA 4CAEA 3FB3A 2Q44A 3PZJA 3DDDA 4MFZA 2A4NA 3IWGA 4A2ZA 4PK3A 4HNXB 3IGRA 1S5KA 4C2ZA 2P0WA 4K30A 3SHPA 3BJ8A 4AVCA 1PU9A 4QVTA 2G3AA 2Q04A 1OZPA 4Y49C 2F5IA 1S7KA 1P4NA 2IL4A 1B6BA 5GCNA 4XPKA 4FD4A 1QSTA 2FCKA 1YVKA 3QAHA 5EBVA 5KTAA 1R57A 1CJWA 4E8OA 1QSMA 2I79A 4U9YA 3G8WA 2K5TA 2JEVA 4KOWA 4L8AA 3VWEA 4KOUA 4CGOA 3F5BA 5H84A 4OADA 4B5PA 4UCNA 4B10A 2RC4A 3IWEA 4KORA 1K4JA 1J4JA 2Z3OA 5AG5A 5H86A 4X5KA 1RO5A 4NCZA 2R8VA 3DR6A 2DPTA 2QIRA 1M4DA 3C26A 2YNCC 3JTKA 3TOBA 3IU2A 4KVXA 3KKWA 4KVME 3TO6A 4AB7A 2P6EA 3W91A 4F0XA 2J8RA 3DSBA 2VI7A 4CRZB 2O28A 1N71A 3F0AA 4EVYA 4BBHA 1CM0A 4AVAA 1YR0A 2ZW5A 4E0AA 4MBUA 1M1DA 4FD7A 5CNPA 4B14A 1YVOA 4CAFA 2X7BA 4AG7A 2BUEA 1S7LA 4B12A 4CS0B 5AG7A 3GYAA 3H5ZA 3LD2A 5EC4A 1YLEA 1KUVA 5G22A 2EVNA 4PSXA 2PR8A 3P2HA 3QB8A 4XPDC 5AG4A 3BJ7A 4B5OA 3TT2A 3DR8A 2DXQA 3WR7A 1SQHA 2Q7BA 1IYKA 4KS9A 4Y49B 5JPHA 3CXQA 1YK3A 2Z3PA 5C82A 4JJXA 4PV6A 4A30A 2REEA 4KLWA 5C88A 2Z11A 4A31A 2FS5A 2OH1A 4XPLA 1Y9WA 1GHEA 3B8GA 2Z0ZA 3EY5A 2P6FA 2OU2A 1Y7RA 4LUAA 2D4PA 5JQ4A 4B5PB 4YRHA 4A95A 4OAEA 3R95A 2QMLA 3W6SA 5E96A 3FXTA 1KUXA 1FY7A 5F48A 2FIWA 5J8FA 1XEBA 4KLVA 4NXYA 4R3LA 3TCVA 1KUYA 5FVJA 2VZZA 4JXRA 4J3GA 1VKCA 3EC4A 1M4GA 4PSWA 3CXSA 4ZGYB 5KTCA 2G3TA 4JD6A 3S6HA 2DPSA 3LODA 5F46A 3N7ZA 2WUUA 1NE9A 3EFAA 1IB1E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NE7 A;  4GS4 A;  2VEZ A;  4NEX A;  2ATR A;  2CNS A;  3PGP A;  5DWN A;  4XPD B;  5HMN A;  3D3S A;  2B4D A;  2B5G B;  3TTH A;  4KOV A;  1QSO A;  4CRY B;  1BO4 A;  2FL4 A;  3GY9 A;  2B3U A;  3I3G A;  2ZXV A;  3EXN A;  4CAX A;  1B87 A;  4II9 A;  3TOA A;  5ISV A;  1RXT A;  2P6G A;  4QUS A;  4UWI A;  4ONU A;  5DWM A;  3SXN A;  2PRB A;  3MGD A;  2KCW A;  2JDD A;  5F49 A;  2JDC A;  4FD6 A;  3R9G A;  2PSW A;  4IUS A;  4KUB A;  2PDO A;  3T90 A;  3ZZI A;  3TE4 A;  3S6K A;  4MY0 A;  4NF1 A;  2NMT A;  2OZH A;  2B5G A;  3BLN A;  4AG9 A;  2D4O A;  2CY2 A;  5I0C A;  3R9F A;  1XMT A;  5IV0 A;  2WPX A;  1NSL A;  3JVN A;  4YFJ A;  1Z9U A;  3K9U A;  3I9S A;  4RI1 A;  1YX0 A;  4DNC A;  4MHD A;  4H6Z A;  4QBJ A;  1WWZ A;  3FBU A;  4XNH C;  3H4Q A;  2FIA A;  4R9M A;  1I1D A;  1BOB A;  2GIV A;  1IID A;  1MJ9 A;  3OWC A;  2VZY A;  3CXP A;  1XF8 A;  3D2P A;  4KUA A;  1S7N A;  4NSQ A;  2ZW4 A;  2B4D B;  3SXO A;  1S3Z A;  2VXK A;  4H6U A;  1VHS A;  2FT0 A;  3FRM A;  1LRZ A;  4JWP A;  1YRE A;  2VQY A;  4JLY A;  2H5M A;  4IF5 A;  2BEI A;  3P2F A;  4R3K A;  3F8K A;  4UWJ A;  3E0K A;  4R57 A;  2CNM A;  4M3S A;  5KTD A;  4BMH A;  2EUI A;  2B3V A;  2OZU A;  3W6X A;  4CAV A;  4F0Y A;  5IB0 A;  4FD5 A;  1MJA A;  1M4I A;  2C27 A;  3RYO A;  3JUW A;  1XIX A;  3UY5 A;  2AJ6 A;  1L0C A;  2PC1 A;  4QC6 A;  2J8N A;  3PP9 A;  4U5Y A;  4ORF A;  2HV2 A;  5J8C A;  4QB9 A;  2PR1 A;  1QSR A;  1P0H A;  1Q2C A;  1ON0 A;  2I00 A;  2R98 A;  1YGH A;  4L89 A;  4UBR A;  1QSN A;  1XE4 A;  2BSW A;  1I12 A;  3FYN A;  3V8I A;  4KOX A;  4CAW A;  4I49 A;  4U9Z A;  1Q2Y A;  4M85 A;  1IIC A;  1IYL A;  1V0C A;  4KOS A;  2VBQ A;  5IX3 A;  1KZF A;  4PK2 A;  2BL1 A;  2ARH A;  2ZPA A;  3EO4 A;  4H89 A;  3TFY A;  2AE6 A;  3TO9 A;  1PUA A;  4YGO A;  2B4B A;  3FIX A;  2Y0M A;  1Q2D A;  4HNW B;  3T9Y A;  2J8M A;  2OZG A;  2ZW6 A;  4KVO E;  1WK4 A;  4MY3 A;  1MK4 A;  4KOT A;  4JXQ A;  4AVB A;  2FE7 A;  2R7H A;  3FNC A;  3ZJ0 A;  2HQY A;  2Q0Y A;  3VWD A;  3S6G A;  4ZBG A;  2Q4V A;  3DNS A;  3R1K A;  1Z4E A;  1Z4R A;  2GAN A;  1UFH A;  1U6M A;  1I21 A;  4HNY B;  1NMT A;  2GE3 A;  2WPW A;  4LX9 A;  1TIQ A;  1S60 A;  4UA3 A;  2Q4Y A;  2QEC A;  2B58 A;  4MI4 A;  3D2M A;  3GKR A;  1M44 A;  2CNT A;  2REF A;  4HKF A;  2OB0 A;  5HH1 A;  4R87 A;  3R96 A;  2PQ8 A;  4KOY A;  4MJ8 A;  4F6A A;  2JLM A;  2G0B A;  4KZT A;  1MJB A;  2Z10 A;  2HUZ A;  4XNH B;  2FSR A;  4RS2 A;  1Y9K A;  2R1I A;  5F47 A;  3S6F A;  3D8P A;  2ZW7 A;  1S7F A;  3G3S A;  4OLL A;  3TO7 A;  3R9E A;  4E2A A;  2FXF A;  3FB3 A;  2Q44 A;  3PZJ A;  3DDD A;  2A4N A;  3IWG A;  4PK3 A;  4HNX B;  3IGR A;  1S5K A;  2P0W A;  4K30 A;  3SHP A;  3BJ8 A;  4AVC A;  1PU9 A;  4QVT A;  2G3A A;  2Q04 A;  1OZP A;  4Y49 C;  2F5I A;  1S7K A;  1P4N A;  2IL4 A;  1B6B A;  5GCN A;  4XPK A;  4FD4 A;  1QST A;  2FCK A;  1YVK A;  3QAH A;  5EBV A;  5KTA A;  1R57 A;  1CJW A;  4E8O A;  1QSM A;  2I79 A;  4U9Y A;  3G8W A;  2K5T A;  2JEV A;  4KOW A;  4L8A A;  3VWE A;  4KOU A;  3F5B A;  5H84 A;  4OAD A;  4B5P A;  2RC4 A;  4KOR A;  1K4J A;  1J4J A;  5H86 A;  4X5K A;  1RO5 A;  4NCZ A;  2R8V A;  3DR6 A;  2QIR A;  1M4D A;  3C26 A;  3TOB A;  4KVX A;  3KKW A;  4KVM E;  3TO6 A;  4AB7 A;  2P6E A;  3W91 A;  2J8R A;  3DSB A;  2VI7 A;  4CRZ B;  2O28 A;  1N71 A;  3F0A A;  4EVY A;  1CM0 A;  4AVA A;  1YR0 A;  2ZW5 A;  4E0A A;  4MBU A;  1M1D A;  4FD7 A;  5CNP A;  1YVO A;  2X7B A;  4AG7 A;  2BUE A;  1S7L A;  4CS0 B;  3GYA A;  3LD2 A;  5EC4 A;  1YLE A;  1KUV A;  2EVN A;  4PSX A;  2PR8 A;  3P2H A;  3QB8 A;  4XPD C;  3BJ7 A;  4B5O A;  3TT2 A;  3DR8 A;  2DXQ A;  3WR7 A;  1SQH A;  2Q7B A;  1IYK A;  4Y49 B;  5JPH A;  3CXQ A;  1YK3 A;  5C82 A;  4JJX A;  4PV6 A;  2REE A;  4KLW A;  5C88 A;  2Z11 A;  2FS5 A;  2OH1 A;  4XPL A;  1Y9W A;  1GHE A;  3B8G A;  2Z0Z A;  3EY5 A;  2P6F A;  2OU2 A;  1Y7R A;  4LUA A;  2D4P A;  5JQ4 A;  4B5P B;  4YRH A;  4OAE A;  3R95 A;  2QML A;  3W6S A;  5E96 A;  3FXT A;  1KUX A;  1FY7 A;  5F48 A;  2FIW A;  5J8F A;  1XEB A;  4KLV A;  4NXY A;  4R3L A;  3TCV A;  1KUY A;  5FVJ A;  2VZZ A;  4JXR A;  4J3G A;  1VKC A;  3EC4 A;  1M4G A;  4PSW A;  3CXS A;  5KTC A;  2G3T A;  4JD6 A;  3S6H A;  3LOD A;  5F46 A;  3N7Z A;  1NE9 A;  3EFA A;  1IB1 E; 
#chains in the Genus database with same CATH topology
 3NE7 A;  4UFV A;  4GS4 A;  2VEZ A;  4NEX A;  2ATR A;  2CNS A;  2PCU A;  3V7Z A;  4OP4 A;  2XEJ A;  3PGP A;  4XPD B;  5DWN A;  3S9L A;  5CBM A;  5HMN A;  2YNE A;  3D3S A;  5ELY A;  2B4D A;  3SI2 A;  4WWV A;  1TXR A;  2B5G B;  3TTH A;  3WAB A;  3BI0 A;  4MFK A;  4KOV A;  1QSO A;  3K2K A;  2YNC A;  1BPN A;  5AG6 A;  2ZEP A;  4P44 A;  2ZEH A;  4A32 A;  4CRY B;  1BO4 A;  2FL4 A;  4MXU A;  4PXD A;  3GY9 A;  2Q43 A;  5DS0 A;  2B3U A;  3SJF A;  4C68 A;  3VAR A;  5HVG A;  1A2Z A;  2V8G A;  4CYQ A;  1LAM A;  3I3G A;  2ZXV A;  3FH4 A;  4B6Z A;  3EXN A;  4CAX A;  4M6H A;  3KQX A;  2NSM A;  2NYQ A;  1B87 A;  3FMC A;  1DTD A;  4OC0 A;  4II9 A;  3TOA A;  2JBJ A;  5ISV A;  1RXT A;  2PJA A;  2XEI A;  2XEG A;  2C6G A;  2P6G A;  4QUS A;  4UF4 A;  4UWI A;  4ONU A;  3KL9 A;  5DWM A;  3SXN A;  1F57 A;  4P45 A;  4R76 A;  1CX8 A;  2PRB A;  3MGD A;  1IU8 A;  1TF9 A;  2KCW A;  4UCP A;  4YU9 A;  2JDD A;  2V8H A;  4P4F A;  4O23 A;  5F49 A;  2IMO A;  2JDC A;  3D4U A;  4FD6 A;  4UFX A;  2PJB A;  5EMI A;  4MFP A;  2PSW A;  3R9G A;  3WC7 A;  4IUS A;  4UEE A;  3D67 A;  4KUB A;  1CPS A;  2PDO A;  1ZO0 A;  4Q36 A;  2C1C A;  4WJB A;  3T90 A;  3ZZI A;  4A33 A;  3TE4 A;  3S6K A;  4MY0 A;  3CPX A;  3FX6 A;  2NMT A;  4NF1 A;  5I4M A;  4MRI A;  3KQZ A;  5D29 A;  1ZLH A;  4NGR A;  5LYI A;  2OZH A;  4UCM A;  2B5G A;  1FT7 A;  2Z3L A;  2D4O A;  3BLN A;  3D7G A;  4PXB A;  4RN7 A;  2CY2 A;  4AG9 A;  4Q38 A;  4EWT A;  4MFL A;  1Z8L A;  1XMT A;  3CDX A;  3GUX A;  3R9F A;  5I0C A;  4CYP A;  2WPX A;  5IV0 A;  1YW4 A;  3JVN A;  1NSL A;  4R8F A;  2PRQ A;  4BD9 A;  3PB7 X;  4PXE A;  4YFJ A;  2GLJ A;  3N5F A;  1Z9U A;  3K9U A;  4JZ0 A;  3I9S A;  4RI1 A;  4C2Y A;  1YX0 A;  4DNC A;  4MHP A;  4MHD A;  4H6Z A;  4C2X A;  1Z8X A;  4EFD A;  2AFS A;  4QBJ A;  3RBU A;  1WWZ A;  1ZLI A;  4KSA A;  3FBU A;  4C7I A;  4XNH C;  3FJU A;  4NGT A;  3H4Q A;  2YGW A;  2PIZ A;  3IU1 A;  2V8D A;  2GLF A;  2FIA A;  4R9M A;  1I1D A;  1BOB A;  2EK9 A;  3NA6 A;  4X8I A;  1ELL P;  2GIV A;  1IID A;  1XJO A;  1MJ9 A;  1XMB A;  3LWU A;  1PYT B;  2ZEO A;  3OWC A;  4MFJ A;  2VZY A;  3V38 A;  2Z3M A;  3CXP A;  2PJ9 A;  2YND A;  1XF8 A;  3D2P A;  4KUA A;  1S7N A;  1YME A;  2ZW4 A;  4NSQ A;  2VL1 A;  2B4D B;  3SXO A;  3NH8 A;  2PJ3 A;  1S3Z A;  3IEH A;  2ZED A;  3NH4 A;  2C6C A;  2VXK A;  5AGE A;  1R43 A;  4TNU A;  2AFO A;  1DE4 C;  4KSF A;  1F2P A;  4H6U A;  1ELM P;  1HEE A;  3S9M A;  4IK2 A;  1VHS A;  2FT0 A;  2V77 A;  3FRM A;  1LRZ A;  4JWP A;  1YRE A;  2VQY A;  4P10 A;  4TWE A;  4JLY A;  2H5M A;  4IF5 A;  1ARL A;  2BEI A;  3P2F A;  4A38 A;  2PJ1 A;  4R3K A;  2AFX A;  4UEF A;  3F8K A;  4UWJ A;  2PIY A;  3E0K A;  4R57 A;  4P4J A;  2CNM A;  4M3S A;  5KTD A;  3GLJ A;  1OBR A;  4RUH A;  4BMH A;  2EUI A;  1F2O A;  2B3V A;  2QYV A;  2ZEG A;  2ZEL A;  2OZU A;  4CGP A;  3W6X A;  4CAV A;  4F0Y A;  1CG2 A;  3PB4 X;  5IB0 A;  3I1U A;  4FD5 A;  5A27 A;  2BOA A;  3KHX A;  1MJA A;  1M4I A;  5G20 A;  1LOK A;  4GM5 A;  2C27 A;  2F8H A;  2WZN A;  3IIB A;  5LRJ A;  3RYO A;  2AFU A;  4Z65 A;  3JUW A;  1XIX A;  3UY5 A;  2AJ6 A;  2GRE A;  4B13 A;  1L0C A;  2ZEN A;  2Z3K A;  2PC1 A;  3SJE A;  2IJZ A;  4R6T A;  3NE8 A;  4LQG A;  4QC6 A;  2AFM A;  3D7H A;  3H8F A;  2J8N A;  3PP9 A;  3D68 A;  4U5Y A;  4CGN A;  3D7D A;  2PJ5 A;  4ORF A;  2HV2 A;  5J8C A;  4YWY A;  4QB9 A;  4ZX8 A;  1YLO A;  4DYO A;  2PR1 A;  1QSR A;  2CF4 A;  3NFZ A;  1P0H A;  1Q2C A;  1ON0 A;  1TF8 A;  2I00 A;  1YGH A;  2PVW A;  2R98 A;  1QSN A;  1XE4 A;  4L89 A;  4UBR A;  2BSW A;  5G21 A;  1EE3 P;  1I12 A;  3FYN A;  4UFW A;  1AUG A;  2PJ2 A;  3V8I A;  3B3C A;  1XFO A;  3B3S A;  4EME A;  2J9A A;  4KOX A;  3QNV A;  4CAW A;  2C6P A;  1ARM A;  2DEA A;  1VHO A;  4I49 A;  2BCO A;  4JYW A;  3SJX A;  3PB6 X;  1Q2Y A;  4KSI A;  4M85 A;  4U9Z A;  4OC1 A;  1IIC A;  1LAP A;  3MRU A;  3WC5 A;  3ISX A;  5A28 A;  1IYL A;  1V0C A;  4F8Z A;  4F9U A;  4KOS A;  2VBQ A;  5IX3 A;  1KZF A;  4B11 A;  4PK2 A;  2BL1 A;  3H8G A;  4H2K A;  1YSJ A;  2ARH A;  3VAT A;  1IGB A;  1VGY A;  2ZEF A;  2ZPA A;  3EO4 A;  2FVG A;  2EK8 A;  4OKO A;  4H89 A;  3A9L A;  3TFY A;  2AE6 A;  2WSA A;  4OC3 A;  3TO9 A;  5JM6 A;  2Z3N A;  1PUA A;  4FUU A;  4YGO A;  1TKJ A;  2B4B A;  3L2N A;  3KR5 A;  3FIX A;  5IB9 A;  2Y0M A;  1Q2D A;  3GB0 A;  4HNW B;  4CGL A;  3T9Y A;  2J8M A;  2OZG A;  2XEF A;  2ZW6 A;  4G1P A;  4KVO E;  5LRG A;  1VIX A;  3FVL A;  4MHZ A;  1RTQ A;  3SI0 A;  1WK4 A;  4MY3 A;  3RZA A;  1MK4 A;  5LRK A;  1KWM A;  2QVP A;  4KOT A;  4Q7A A;  2CTB A;  4NGQ A;  2BO9 A;  4JXQ A;  4AVB A;  2FE7 A;  2R7H A;  3FNC A;  3ZJ0 A;  2HQY A;  5THW A;  3FEE A;  2Q0Y A;  3PB8 X;  3VWD A;  3WT4 A;  3S6G A;  4ZBG A;  4FBE A;  2Q4V A;  3DNS A;  3R1K A;  1Z4E A;  1Z4R A;  2GAN A;  1UFH A;  1U6M A;  1HDQ A;  2CXA A;  5G1Z A;  1M4L A;  1CP7 A;  1I21 A;  3S9N A;  4HNY B;  5BWA B;  4NGS A;  4NJR A;  1Y7E A;  2GE3 A;  1NMT A;  2WPW A;  1R3N A;  4LX9 A;  1TIQ A;  1S60 A;  4MFQ A;  4UA3 A;  2Q4Y A;  3DLJ A;  4MCR A;  2QEC A;  2B58 A;  2RFH A;  3TC8 A;  4OIW A;  4MMO A;  4MI4 A;  3D2M A;  3GKR A;  4CYN A;  1M44 A;  2CNT A;  3KAS A;  2REF A;  3FF3 A;  4HKF A;  2OB0 A;  5HH1 A;  4R87 A;  4CYO A;  3R96 A;  2PQ8 A;  4KOY A;  2O53 A;  4PXC A;  4MJ8 A;  4X3R A;  3FED A;  4F6A A;  1CPX A;  2JLM A;  2ZOG A;  4M6I A;  2G0B A;  1UWY A;  3D7F A;  1MJB A;  2Z10 A;  3BHX A;  4KZT A;  4NJQ A;  4CGM A;  2HUZ A;  4XNH B;  2FSR A;  4RS2 A;  5K8M A;  1Y9K A;  2R1I A;  5F47 A;  3S6F A;  3CT9 A;  3IFE A;  4ZI6 A;  3D8P A;  3SJG A;  2I3C A;  2ZW7 A;  4X2T A;  2RB7 A;  1S7F A;  2PJC A;  3G3S A;  4OLL A;  3TO7 A;  4C7H A;  3R9E A;  3PRT A;  4DUK A;  4E2A A;  2DF5 A;  2FXF A;  5K8P A;  4CAE A;  3FB3 A;  4NFR A;  1Z5R A;  2Q44 A;  3PZJ A;  1AYE A;  4PQA A;  1LAN A;  4P6Y A;  4UEZ A;  3DDD A;  4MFZ A;  3H8E A;  3DGV A;  2A4N A;  4FAI A;  3IWG A;  1CBX A;  4A2Z A;  4PK3 A;  4ZYQ A;  2F7V A;  4HNX B;  4ZX9 A;  3IGR A;  1S5K A;  4C2Z A;  1ZG7 A;  3MN8 A;  2P0W A;  4K30 A;  1Z8W A;  3SHP A;  3BJ8 A;  4AVC A;  2CTC A;  1VHE A;  2HB6 A;  3CZX A;  1PU9 A;  1CP6 A;  4NGP A;  4QVT A;  2G3A A;  1IY7 A;  2Q04 A;  1OZP A;  3KI9 A;  4Y49 C;  4ZY1 A;  2F5I A;  1S7K A;  3K9T A;  4NGM A;  1P4N A;  5K8O A;  1XOV A;  1Y0Y A;  4OC5 A;  2IL4 A;  1B6B A;  5GCN A;  4XPK A;  4OME A;  3HUV A;  4FD4 A;  4DJL A;  1QST A;  2FCK A;  3FEC A;  1YVK A;  3PBE A;  1GYT A;  3QAH A;  5EBV A;  5KTA A;  3TX8 A;  1R57 A;  1CJW A;  4E8O A;  4UIB A;  4R7M A;  1QSM A;  2I79 A;  5HXD A;  5F09 A;  4U9Y A;  3G8W A;  2K5T A;  4K3N A;  2JEV A;  4KOW A;  4L8A A;  5CPA A;  2HC9 A;  4KOU A;  4MCQ A;  3VWE A;  3T8W A;  4CGO A;  3D66 A;  3F5B A;  5H84 A;  1YQE A;  4OAD A;  8CPA A;  4B5P A;  1Q7L A;  7CPA A;  4UCN A;  4B10 A;  2RC4 A;  2JEW A;  3IWE A;  1K4J A;  4KOR A;  4A37 A;  4P4I A;  1J4J A;  4W9Y A;  2Z3O A;  5AG5 A;  3IJ3 A;  5H86 A;  4OC2 A;  4X5K A;  1RO5 A;  4NCZ A;  2R8V A;  3DR6 A;  2DPT A;  2QIR A;  1M4D A;  3C26 A;  2YNC C;  3JTK A;  3JRU A;  3TOB A;  2AFW A;  3IU2 A;  3IC1 A;  4KVX A;  3KKW A;  4KVM E;  5HVF A;  1NSA A;  1QMU A;  1Z2L A;  2P6E A;  3TO6 A;  3W91 A;  4F0X A;  3PBB A;  2J8R A;  3DSB A;  2AFZ A;  2VI7 A;  4CRZ B;  4NGN A;  2O28 A;  3SI1 A;  1N71 A;  3F0A A;  5J1Q A;  4EVY A;  3KHZ A;  4MHY A;  5JGF A;  4IHM A;  2EWB A;  4BBH A;  5HVH A;  2PJ4 A;  4MCP A;  5K8N A;  4MCS A;  2PJ7 A;  3NH5 A;  1BPM A;  1CM0 A;  4AVA A;  1LFW A;  1YR0 A;  5LYD A;  2ZW5 A;  3RO0 A;  4E0A A;  4MBU A;  1TKH A;  1M1D A;  1FNO A;  2PJ6 A;  3LAC A;  4FD7 A;  5CNP A;  1YVO A;  4A39 A;  4AXV A;  4B14 A;  4CAF A;  2X7B A;  4AG7 A;  2BUE A;  5JH9 A;  4P4D A;  1S7L A;  2OR4 A;  4OID A;  3IWW A;  2Q51 A;  4B12 A;  4CS0 B;  3BXM A;  5AG7 A;  2IQ6 A;  3GYA A;  1HDU A;  3H5Z A;  3LD2 A;  3VH9 A;  5EC4 A;  3RAM A;  1YLE A;  1KUV A;  1JQG A;  1YW6 A;  2ABZ A;  2EVN A;  2Q4Z A;  4PSX A;  5G22 A;  4CPA A;  2PR8 A;  3P2H A;  3QB8 A;  4GXH A;  4XPD C;  4AB7 A;  5AG4 A;  3BJ7 A;  4B5O A;  3TT2 A;  3KZW A;  1QQ9 A;  3DR8 A;  2G9D A;  2PVV A;  2DXQ A;  3B3T A;  3WR7 A;  1Y0R A;  3B3W A;  1SQH A;  2Q7B A;  2PJ0 A;  1IYK A;  1H8L A;  1JWQ A;  4KS9 A;  1XRY A;  4Y49 B;  2PE3 A;  5JPH A;  3CXQ A;  3KR4 A;  4OC4 A;  1IOI A;  1YK3 A;  1ZG8 A;  3PB9 X;  4FWU A;  3PFO A;  5LYL A;  2Z3P A;  5C82 A;  1PCA A;  4JJX A;  4PV6 A;  4A30 A;  3IO1 A;  4ZY0 A;  2REE A;  3PEI A;  4KLW A;  5C88 A;  4ONW A;  2Z11 A;  4A31 A;  1LCP A;  2FS5 A;  1Z8T A;  2ANP A;  2OH1 A;  4ZY2 A;  4XPL A;  2EO8 A;  1Y9W A;  3B35 A;  1GHE A;  3B8G A;  2Z0Z A;  3EY5 A;  3PFE A;  2P6F A;  2OU2 A;  1Y7R A;  2OOT A;  4LUA A;  2D4P A;  4MHN A;  5JQ4 A;  2ZEE A;  4B5P B;  3GIU A;  4YRH A;  4A95 A;  3BI1 A;  4OAE A;  5D8N A;  3R95 A;  2QML A;  4BIN A;  3W6S A;  2ZEM A;  4M6G A;  5E96 A;  4PPZ A;  2JBK A;  3FXT A;  1KUX A;  1FY7 A;  1BLL E;  5F48 A;  2FIW A;  2EBJ A;  3LMS A;  5J8F A;  1XEB A;  1TKF A;  4KLV A;  1XBU A;  2ZOF A;  2PJ8 A;  4NXY A;  4R3L A;  3TCV A;  2O4H A;  1KUY A;  3KGQ A;  5FVJ A;  2POK A;  2VZZ A;  4P4B A;  3HLP A;  4JXR A;  4J3G A;  1BAV A;  1VKC A;  3EC4 A;  4A94 A;  2GFQ A;  2V8V A;  1M4G A;  2GU2 A;  3CXS A;  3ISZ A;  4PSW A;  1X10 A;  1ZG9 A;  3B2Y A;  4LQ6 A;  3CPA A;  1AMP A;  4ZGY B;  5KTC A;  4IAV A;  2G3T A;  2ODF A;  4JD6 A;  3S6H A;  3WC6 A;  2DPS A;  4UIA A;  5LYF A;  2CIJ A;  4F9V A;  3B3V A;  4HPS A;  2QJ8 A;  3B7I A;  3LOD A;  3RNZ A;  3QAY A;  5F46 A;  1X12 A;  1IOF A;  3N7Z A;  6CPA A;  2WUU A;  2Q7S A;  1NE9 A;  3EFA A;  4P4E A;  1IB1 E;  2WYR A; 
#chains in the Genus database with same CATH homology
 3NE7 A;  4UFV A;  4GS4 A;  2VEZ A;  4NEX A;  2ATR A;  2CNS A;  3PGP A;  5DWN A;  4XPD B;  5HMN A;  2YNE A;  3D3S A;  2B4D A;  2B5G B;  3TTH A;  4MFK A;  4KOV A;  1QSO A;  2YNC A;  5AG6 A;  4A32 A;  4CRY B;  1BO4 A;  2FL4 A;  3GY9 A;  2B3U A;  4C68 A;  4CYQ A;  3I3G A;  2ZXV A;  3EXN A;  4CAX A;  1B87 A;  4II9 A;  3TOA A;  5ISV A;  1RXT A;  2P6G A;  4QUS A;  4UWI A;  4ONU A;  5DWM A;  3SXN A;  2PRB A;  3MGD A;  4UCP A;  2KCW A;  2JDD A;  5F49 A;  2JDC A;  4FD6 A;  4UFX A;  4MFP A;  2PSW A;  3R9G A;  4IUS A;  4KUB A;  2PDO A;  3T90 A;  1ZO0 A;  4Q36 A;  3ZZI A;  4A33 A;  3TE4 A;  3S6K A;  4MY0 A;  4NF1 A;  2NMT A;  2OZH A;  4UCM A;  2B5G A;  2Z3L A;  3BLN A;  2D4O A;  4AG9 A;  2CY2 A;  4Q38 A;  5I0C A;  4MFL A;  3R9F A;  1XMT A;  5IV0 A;  4CYP A;  2WPX A;  1NSL A;  3JVN A;  4YFJ A;  1Z9U A;  3K9U A;  3I9S A;  4RI1 A;  4C2Y A;  1YX0 A;  4DNC A;  4MHD A;  4H6Z A;  4C2X A;  4QBJ A;  1WWZ A;  4KSA A;  3FBU A;  4C7I A;  4XNH C;  3H4Q A;  2YGW A;  3IU1 A;  2FIA A;  4R9M A;  1I1D A;  1BOB A;  2GIV A;  1IID A;  1MJ9 A;  3OWC A;  4MFJ A;  2VZY A;  2Z3M A;  3CXP A;  2YND A;  1XF8 A;  3D2P A;  4KUA A;  1S7N A;  4NSQ A;  2ZW4 A;  2B4D B;  3SXO A;  1S3Z A;  2VXK A;  5AGE A;  4KSF A;  4H6U A;  1VHS A;  2FT0 A;  3FRM A;  1LRZ A;  4JWP A;  1YRE A;  2VQY A;  4JLY A;  2H5M A;  4IF5 A;  2BEI A;  3P2F A;  4R3K A;  3F8K A;  4UWJ A;  3E0K A;  4R57 A;  2CNM A;  4M3S A;  5KTD A;  4BMH A;  2EUI A;  2B3V A;  4CGP A;  2OZU A;  3W6X A;  4CAV A;  4F0Y A;  5IB0 A;  4FD5 A;  5A27 A;  1MJA A;  1M4I A;  5G20 A;  2C27 A;  3RYO A;  3JUW A;  1XIX A;  3UY5 A;  2AJ6 A;  4B13 A;  1L0C A;  2Z3K A;  2PC1 A;  4QC6 A;  2J8N A;  3PP9 A;  4U5Y A;  4CGN A;  4ORF A;  2HV2 A;  5J8C A;  4QB9 A;  2PR1 A;  1QSR A;  1P0H A;  1Q2C A;  1ON0 A;  2I00 A;  2R98 A;  1YGH A;  4L89 A;  4UBR A;  1QSN A;  1XE4 A;  5G21 A;  2BSW A;  1I12 A;  3FYN A;  4UFW A;  3V8I A;  4KOX A;  4CAW A;  4I49 A;  4U9Z A;  1Q2Y A;  4M85 A;  1IIC A;  5A28 A;  1IYL A;  1V0C A;  4KOS A;  2VBQ A;  5IX3 A;  1KZF A;  4B11 A;  4PK2 A;  2BL1 A;  2ARH A;  2ZPA A;  3EO4 A;  4H89 A;  3A9L A;  3TFY A;  2AE6 A;  2WSA A;  3TO9 A;  2Z3N A;  1PUA A;  4YGO A;  2B4B A;  3FIX A;  2Y0M A;  1Q2D A;  4HNW B;  4CGL A;  3T9Y A;  2J8M A;  2OZG A;  2ZW6 A;  4KVO E;  1WK4 A;  4MY3 A;  1MK4 A;  4KOT A;  4JXQ A;  4AVB A;  2FE7 A;  2R7H A;  3FNC A;  3ZJ0 A;  2HQY A;  2Q0Y A;  3VWD A;  3S6G A;  4ZBG A;  2Q4V A;  3DNS A;  3R1K A;  1Z4E A;  1Z4R A;  2GAN A;  1UFH A;  1U6M A;  5G1Z A;  2CXA A;  1I21 A;  4HNY B;  5BWA B;  1NMT A;  2GE3 A;  2WPW A;  4LX9 A;  1TIQ A;  1S60 A;  4MFQ A;  4UA3 A;  2Q4Y A;  2QEC A;  2B58 A;  4MI4 A;  3D2M A;  3GKR A;  4CYN A;  1M44 A;  2CNT A;  2REF A;  4HKF A;  2OB0 A;  5HH1 A;  4R87 A;  4CYO A;  3R96 A;  2PQ8 A;  4KOY A;  4MJ8 A;  4F6A A;  2JLM A;  2G0B A;  4KZT A;  1MJB A;  2Z10 A;  4CGM A;  2HUZ A;  4XNH B;  2FSR A;  4RS2 A;  1Y9K A;  2R1I A;  5F47 A;  3S6F A;  3D8P A;  2ZW7 A;  1S7F A;  3G3S A;  4OLL A;  3TO7 A;  4C7H A;  3R9E A;  4E2A A;  2FXF A;  4CAE A;  3FB3 A;  2Q44 A;  3PZJ A;  3DDD A;  4MFZ A;  2A4N A;  3IWG A;  4A2Z A;  4PK3 A;  4HNX B;  3IGR A;  1S5K A;  4C2Z A;  2P0W A;  4K30 A;  3SHP A;  3BJ8 A;  4AVC A;  1PU9 A;  4QVT A;  2G3A A;  2Q04 A;  1OZP A;  4Y49 C;  2F5I A;  1S7K A;  1P4N A;  2IL4 A;  1B6B A;  5GCN A;  4XPK A;  4FD4 A;  1QST A;  2FCK A;  1YVK A;  3QAH A;  5EBV A;  5KTA A;  1R57 A;  1CJW A;  4E8O A;  1QSM A;  2I79 A;  4U9Y A;  3G8W A;  2K5T A;  2JEV A;  4KOW A;  4L8A A;  3VWE A;  4KOU A;  4CGO A;  3F5B A;  5H84 A;  4OAD A;  4B5P A;  4UCN A;  4B10 A;  2RC4 A;  3IWE A;  4KOR A;  1K4J A;  1J4J A;  2Z3O A;  5AG5 A;  5H86 A;  4X5K A;  1RO5 A;  4NCZ A;  2R8V A;  3DR6 A;  2DPT A;  2QIR A;  1M4D A;  3C26 A;  2YNC C;  3JTK A;  3TOB A;  3IU2 A;  4KVX A;  3KKW A;  4KVM E;  3TO6 A;  4AB7 A;  2P6E A;  3W91 A;  4F0X A;  2J8R A;  3DSB A;  2VI7 A;  4CRZ B;  2O28 A;  1N71 A;  3F0A A;  4EVY A;  4BBH A;  1CM0 A;  4AVA A;  1YR0 A;  2ZW5 A;  4E0A A;  4MBU A;  1M1D A;  4FD7 A;  5CNP A;  4B14 A;  1YVO A;  4CAF A;  2X7B A;  4AG7 A;  2BUE A;  1S7L A;  4B12 A;  4CS0 B;  5AG7 A;  3GYA A;  3H5Z A;  3LD2 A;  5EC4 A;  1YLE A;  1KUV A;  5G22 A;  2EVN A;  4PSX A;  2PR8 A;  3P2H A;  3QB8 A;  4XPD C;  5AG4 A;  3BJ7 A;  4B5O A;  3TT2 A;  3DR8 A;  2DXQ A;  3WR7 A;  1SQH A;  2Q7B A;  1IYK A;  4KS9 A;  4Y49 B;  5JPH A;  3CXQ A;  1YK3 A;  2Z3P A;  5C82 A;  4JJX A;  4PV6 A;  4A30 A;  2REE A;  4KLW A;  5C88 A;  2Z11 A;  4A31 A;  2FS5 A;  2OH1 A;  4XPL A;  1Y9W A;  1GHE A;  3B8G A;  2Z0Z A;  3EY5 A;  2P6F A;  2OU2 A;  1Y7R A;  4LUA A;  2D4P A;  5JQ4 A;  4B5P B;  4YRH A;  4A95 A;  4OAE A;  3R95 A;  2QML A;  3W6S A;  5E96 A;  3FXT A;  1KUX A;  1FY7 A;  5F48 A;  2FIW A;  5J8F A;  1XEB A;  4KLV A;  4NXY A;  4R3L A;  3TCV A;  1KUY A;  5FVJ A;  2VZZ A;  4JXR A;  4J3G A;  1VKC A;  3EC4 A;  1M4G A;  4PSW A;  3CXS A;  4ZGY B;  5KTC A;  2G3T A;  4JD6 A;  3S6H A;  2DPS A;  3LOD A;  5F46 A;  3N7Z A;  2WUU A;  1NE9 A;  3EFA A;  1IB1 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...