3TA2A

A. fulgidus glnk3, mgatp/2-og complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
109
structure length
109
Chain Sequence
MKMVVAVIRPEKLECVKKALEERGFVGMTVTEVKGRGEQKGIRLQFRGREVEVDLLQKTKVEVVVSDDAVDEVVEAIVSSARTGKFGDGRIFVIPVEKSVKIRTGDEEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of disruption of the Amt-GlnK complex by P(II)-mediated sensing of 2-oxoglutarate.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Signaling protein
molecule keywords Nitrogen regulatory protein P-II (GlnB-3)
total genus 24
structure length 109
sequence length 109
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ta2A00
4RX6A 2J9DE 2J9DA 2NUUG 4YB5A 4RLEA 1UFLA 1PILA 4CO3A 4YB6A 4NYPA 4R25A 2NUHA 2GW8A 1UKUA 2XBPA 4CO5A 2XG8A 5L9NA 2RD5C 3O8WA 3M05A 3NCRA 4RWWA 3AA9A 1VFJA 1O5JA 1V3RA 1QY7A 4Y6IA 5D4PA 4C3KA 4RWXA 2V5HG 5DS7A 3X3UA 3T9ZA 2J9EA 4WK1A 4D3HA 4CO1A 1V6HA 2PIIA 2JJ4D 2XZWA 5D4NA 4WK3A 4USIA 3AH6A 1H3DA 2VD3A 2ZOMA 3HLUA 4CNYA 1HWUA 2EG2A 3NCPA 4IYQA 1Q1KA 4YB7A 1KR4A 4C3LA 4Y65A 4NYOA 1GNKA 2O66A 4USHA 4E98A 1O51A 4OZNA 1XK8A 1J2VA 3AA8A 2EG1A 5D4OA 2GX8A 1OSCA 3LF0A 2GNKA 1UL3A 1VHFA 1V3SA 3TA0A 4CO0A 2NS1B 1NAQA 4CNZA 4D3GA 4AFFA 2J9CA 3TA2A 3L7PA 4CO4A 3O5TB 3MHYA 1UMJA 5D4LA 1NH7A 2E66A 4ZK7M 2DCLA 2XULA 3NCQA 2O67A 1V9OA 3TA1A 4CO2A 2Z0GA 5DRKA 1NH8A 3GSDA 4OZLA 4USJC 4C3MA 3AHPA 3N5BA 1NZAA 4OZJA 1P1LA 2CZ4A 2ZFHA 3OPKA 3BZQA 3DFEA 3CE8A
chains in the Genus database with same CATH superfamily
2B4VA 1FNMA 3MCNA 5B0EA 4URQU 2FYXA 5F9NA 4DR3F 2J9DA 3C8YA 1LOUA 2ACYA 4JB8B 4RLEA 3HVWA 1A6LA 3MECA 4BWMA 1CQMA 3T6JA 4BDPA 1J5EF 3MXHP 4F0KA 1F6TA 3K5PA 4ATNA 1S6PB 4DMZA 2BABA 2XMKA 1BGXT 4DSFA 5DGBA 1IBCB 2HK2A 2BEFA 2H48B 1K47A 4DUTA 1DTTB 1FRMA 3CCRS 4JI3F 2XNRA 5F8NA 1JLGA 2I1RA 2MMYA 2B56A 5KAKA 4R25A 2OPQB 2UV8G 3TZYA 2VJVA 4FYXB 2D3OR 1EHWA 4DQSA 3D3CJ 5HANA 1X7VA 1HW8A 1YJVA 2GQ2A 2XMJA 4TY8A 1HBOA 1N36F 4NCAA 3M05A 4DL6A 2ERRA 2QEXS 2RE1A 3EM1A 1LK7A 5ETTA 3D1OA 1YJNS 3ILIA 3S7RA 3ZNJ1 2CPIA 1UWBA 4ID5A 2R7XA 1IJFB 2HSEB 1NO8A 2ROPA 4IFYB 4DHVA 1NKBA 2H4WB 1RWKB 5KFTA 3OL7A 2X7IA 4ED3A 4HH0A 3QWUA 4C8ZA 4DR2J 3T9ZA 2LVWA 4FDFA 4D3HA 2VL1A 4LRFA 4CT9A 3MR2A 3G6VA 1XMQJ 1H38A 3EX7B 2J6TA 2M8HA 1TMMA 2PO4A 1AYEA 4IH5A 3A13A 2LU1A 4ZN1A 5ETVA 1N34F 4JI4F 1VR6A 2PMHA 3UD3P 2CPYA 3M2RA 3I0RB 1VIXA 2UV8A 3M8QB 3TVZA 3AQPA 3RGIA 1RTZA 1FF2A 2CQPA 1NPKA 1PJ7A 4UZCA 3IAS9 5F8MA 4BBYA 3DOKA 1B70B 2DXEA 2YTCA 3NKYA 1KLMB 3SQGB 5F8GA 1L3UA 5I4MA 3M8WA 2ZE2A 1R8BA 2GO8A 4ZJLA 5C42B 3G8SA 3BSOA 2CWKA 3CD7A 3FCVA 2AYBA 3FCWA 3LH2S 1Z1ZA 2EFOA 1WOSA 3BR8A 3NGDA 1SKRA 1RWWB 2VBXA 2VQFF 2OPPB 3LP2A 1HBUB 4NRUA 3AA8A 4C11A 3AJ2A 4YHHF 4ZVGA 5H9EJ 4LBIA 1CJTA 1RU1A 1YJ7A 1SKSA 3PIOQ 2HHVA 1H74A 3EICA 1HI1A 1M5HA 2BXJA 4PG6A 3R5DA 1OPZA 2GZOA 4FVCA 3RUBL 3M8SA 3UCZP 1U1MA 4LFAF 2J8AA 3RU0A 2NREA 3GFHA 4CNZA 1LWCB 3CIMA 2UXCF 2WB1D 2J0WA 2C3UA 3THPA 4R5PB 3KLEA 3E51A 3TJ9A 2H54B 4WZMA 2WONB 2GVZB 1EAYC 1TKTA 1TKTB 4EBEA 2QA4S 4DFJA 2E66A 1JLBB 3I31A 2GVZA 2ZBIA 2V2ZA 4M8LA 3NWRA 3JAMY 2HHHF 4DR3J 1FHTA 2P6SA 2AZ3A 2DNRA 4HH1A 3Q23A 1SC4B 1T05B 3PKYA 1NK8A 3G96A 1NH8A 3D0HE 5KFXA 2J0SD 4J7CA 4OZ5A 4LF9J 2IA6A 1S7HA 2BX6A 2O1PA 2YX4A 5D0EA 4ZDNA 9ATCB 3BN4A 4FZVA 3J7YU 3FQKA 5T41A 4JI5J 4FF3A 3SCJE 2RJZA 4JI7J 4DL3A 2QGFB 5A6PA 3KG1A 2KT3A 1X4EA 1VJQA 3GFYA 3EZUA 4LBPA 2YWGA 4MK8A 4F3MA 5IT4A 1JNZB 1HW9A 2DXFA 4OJHA 5DO2A 5KFZA 2YQ1A 3OR2A 4B08A 5CYJA 5HVGA 1TL7B 2XC9A 4JI4J 1HL6A 1G6BA 3ELHA 3R6LB 4IFVA 5IWAJ 2JLGA 5DGAA 2MLZA 5D0RA 4DX8H 3KK2B 5IS2A 4KTQA 3WBZA 3FSYA 2DY1A 1OIAA 4OHZA 1I51B 5K20B 4X84A 4DQRA 3UD4P 3A8JA 3LGHA 4WP9A 4DX6A 2DR9A 3QQCD 3ZTOA 1G4CA 4WZQA 4ED1A 3CJRA 1VRTA 3DOKB 1FJEB 3MTJA 3BGLA 2KG1A 4J9UE 4NPOA 5I3PA 5KT6A 4DUYF 1HBNB 2OPPA 3MPVA 3O8WA 4PG7A 1UAWA 1EKRA 2IVYA 5HBMA 1I94F 2G2OA 2RILA 2V4JB 1RUSA 1RADB 5H1SV 1KS2A 3T1YF 2F1FA 3MR3A 2UUAF 2VG7B 3DLHA 3R2CJ 2OO4A 1RT6B 1RTIB 1CS4B 4R8UB 2WAQD 2VHGA 2Y9HA 2E7VA 2BW2A 1FESA 5D4PA 4XPEA 3EYZA 5CD4H 4ZPWR 3PEHA 5CH7B 4CO1A 2ZH9A 4NXNF 2IY5B 4TKTA 5KFJA 3W2WB 6AT1B 1NXIA 4XPCA 2GO9A 3TO8A 3MPWA 1REVA 2H51B 1EARA 3L9ZA 3UCGA 3UFCX 3ZZTA 1RTDA 2E9RX 2UXBJ 3FEZA 1QD1A 3OFHA 3Q8PB 2B7CB 3HLUA 3O6QA 1NLKL 4RNOA 2LEBA 1FWLA 2K8GA 1NB7A 3NNHA 2HURA 4ANCA 4F25A 3NCPA 3HCXA 2X1BA 4EI2A 2BR0A 1CEZA 1FXDA 2CQ2A 5DM7Q 1RT5A 4GVBB 2H65B 3D1HA 3OXGA 1UVNA 1HFEL 2A3JA 2IFXA 5HO4A 1IXKA 5F8IA 5GAHI 4OYOA 4OYZA 4Z7CA 3CIZA 5A0YB 4FYDA 3DDIA 3D2WA 3BO4A 3MM9B 1FWPA 3DHWC 3PRDA 4ICLB 5D77A 2BJEA 2W9CB 4WFNQ 4FS2A 1EETA 3GG0A 4C8LA 5HMYA 5KOXA 4PG4A 2AV5A 3K8VA 1UVLA 3AJDA 3MM7B 3PY8A 4DR7F 3LPEA 2VZ9A 2IHR1 2KT2A 3LF0A 4G65A 4W4MA 1O6XA 2NPFA 4JI5F 4GO7X 1HQ2A 2HHQA 2R42A 4G1PA 4PYDA 1S6PA 4PRFA 5HATA 3I5BA 3IC1A 4DR1F 1JLBA 3LA0A 1VRTB 2XLJA 1RKJA 1J27A 1L3KA 2ABYA 1WDTA 1RT7A 5C5JA 2XO6A 4C0HA 3OUYA 4RBTA 4DOZA 5DG9A 4DWIA 3VQTA 3JSMB 3CCES 3PW7A 4KE5A 3EVOA 4KT0C 1FKAF 5C25B 3N0VA 3PKMA 2V63A 3D0IE 1D1UA 1T9WA 1FKOB 1VRQC 2YXLA 1TL5A 2KFYA 2O67A 3KK3B 3D6FB 4OHVA 4CO2A 3PYDA 1TVRA 2A2DA 4UW2A 4TU9A 1XMOJ 2DGQA 3MPUB 1Q5VA 2HS4A 2APOA 3AD9C 4ZCKA 2HMIA 2DNHA 4YN3B 4TU7A 3KHLA 2CIMA 2JX2A 3D68A 1DLOA 1MU2A 3HHLA 1SKWA 2ZFHA 2V50A 3WQPA 3HZGA 1FDAA 4ED4A 1RA6A 2XZDB 1MMDA 3KHGA 3EZ5A 2D69A 3W63A 3IAM9 4ECUA 1Y7PA 4LF1A 1IM6A 1RACB 1RWXB 5B0FA 1HI8A 1T9TA 2MSTA 2J9DE 4Y2AA 3J7AN 1T9UA 4OI2A 1H2TZ 3EGNA 2AZ1A 3P45B 1HBMB 1KLNA 4I2QA 4KIAA 4XO0A 1UVJA 3I9V9 3LAKA 5CABA 1UPMB 1HPZA 1VOMA 2DHGA 4DUZJ 3KUEA 3M9MB 4P52A 1OQ6A 2VFTA 1XQIA 1OJ4A 2DIVA 1X60A 5IV4A 4ANEA 2M8DB 2QC3A 4N7TA 1NJWA 4HACA 1WNEA 3B82A 3BV8A 3ZZRA 1RT4A 4I2PB 3W3SA 3CD0A 3TZWA 4P6QA 5HMXA 3HHNB 1ZBTA 2KO1A 3P8BB 3IGVA 3A8KA 2LFVA 5B0DA 4Q43A 1WF1A 4WKYA 2FDNA 4A4JA 3VALA 4DS5A 4DL0C 1UA1A 2OFHX 4IR1A 2DYAA 2OH2A 1RBAA 1NSPA 4U8YA 5ETSA 2CZVC 2OEJA 3QJJA 2GHWA 5FLXU 2AMCB 2ZD1A 2V5HG 4LF4F 3M4XA 3ZZUA 2FVQA 2QN6B 3BH6B 1V6HA 1XWLA 3N9UC 1VK3A 4H4KC 4DCJB 3V6DA 2OPQA 2DPIA 1RAGB 1RLDA 2MQMA 2VDIA 3M8PA 4RJVA 5L1LA 3SFGA 1SV5A 1NHUA 2HWHA 4O3SA 2WW8A 4GC6A 2W4PA 1KRPA 2HRYA 1OYEA 4ES3A 3KOAA 1UW9A 4DU7A 1S4FA 2CPJA 4ZCLA 4MAKA 2I5JB 3UR3C 3UWTA 2I2YA 2ZBCA 3M30A 4ZVUB 1IKXB 2E1PA 1WC4A 2DKOB 1H73A 4RUBA 2HZVA 3ZZPA 4FYVB 1IQTA 2B8PA 5J2PB 2F8MA 3T5HA 2ZZTA 3N01A 1TZ0A 1JLQA 4ZVQB 3W8GA 1BQXA 2DVIA 1VQKS 5M2RA 5SUHA 4G3IA 4C9DA 1K0VA 2PMWA 3CCQS 1NJIT 1J5OA 3CDWA 1E6VB 2Q3PA 1JJ2R 2Y1IA 1W25A 4X4SA 1NJYA 2VV5A 2YKNB 2DEJA 1NPRA 3VWSA 2DPJA 4N8OA 3PJ9A 3W7BA 3C46A 1OSCA 2ZBRA 2QLJB 4Y2KA 4LFAJ 6FDRA 2LMIA 2XHWA 1T03B 3IWNC 2VU5A 4CM0A 1HBOB 1TL4A 5J2QA 3CC4S 1QSYA 3TVYA 3A3PB 2NPIA 1T11A 4IKAA 3KK2A 2D9PA 4B3MF 1GXTA 2P9EA 4IH7A 1JLGB 2DITA 1F5CA 1HHQA 2VJUA 1QLNA 4QBUA 4JOUA 2VA3A 1WDDA 2XI2A 5HAOA 4KFBA 3KDNA 3IP0A 2W9BB 2FVSA 3BQ0A 1FE0A 3S8SA 1VQMS 3BBFA 2DR8A 2VOPA 3MMCB 1BLUA 3B78A 3KK1A 2C3MA 1VBKA 1QE1B 1QE1A 1XJWB 2E1AA 5C7PA 1REGX 2IM2A 1MWQA 5BJRA 5HJYA 2R8HA 5ETRA 4J9NA 1C1BA 4H4MA 4JI1F 4UY85 3BGRB 3CJ4A 2XO7A 1T02A 3G87A 1FFSB 2L9WA 3DGPA 2XMAA 3OSPA 2IBKA 1FTCA 1QVFR 3R7BB 5DG8A 1TV6A 4LRDA 2WTFA 2WW4A 3KG4A 1JKHB 3PJXA 4AXIA 4QWEA 1AA1B 4JV1A 4LF8J 1F3FA 3PM9A 5HVFA 4DUZF 4NI2B 4N41A 4JP8A 2F8HA 3OPKA 1I5OB 1H98A 1WKLA 2E9ZA 2MJUA 3SI8A 1GX6A 4CLZA 2MLYA 1KSPA 2D9OA 2ZJPQ 2WB4A 2HFSA 5HROB 3MPYA 3IRWP 2ZH1A 2C2NA 3MOJB 2OELA 3CDBA 1UVIA 4PYAA 3W9JA 4F4WA 1O8BA 4USKA 2RQCA 1ZZFA 4ZP9A 2QX0A 4NCGB 4CLYA 2OEMA 1RHJB 4P9SA 5EWFA 1AB8A 3I0SB 3C3LA 1V3ZA 1FWKA 2HNYB 5AXLA 1OPIA 5HI7A 4NXMF 2IJNA 3BKUA 4Q8FA 3DMJB 2HVIA 4NL5A 1WKKA 1TELA 2HFVA 4KV8B 1B0TA 1UEVA 4TNOA 2OMOA 3KHHA 4IOAQ 2P5VA 2P9GA 2XYGB 4P10A 3MAAA 1RTJB 1I94J 4ECZA 2FLNA 1YITS 2N4CA 3IR5B 2HIQA 2JSXA 2BE7D 4NRTA 4Q0BA 2NQPA 4DV3F 2LU2A 4U6PA 3HSDA 4OYXA 2CPEA 4DN9A 1Q8IA 3EDQB 3I4HX 5J1NA 2W8LA 2KG0A 2XB2D 4WFBQ 1DFDA 3PX0A 2W2MP 4EU0A 1JJHA 2WK4A 2FJAB 3HD1A 1IWAA 2I0XA 4HR2A 2VQEJ 3F44A 2BQRA 5K5MA 2ZH7A 2BKNA 3MM8B 2VKZG 5KFHA 4IFYA 4OI3A 5RUBA 3MMAA 3EGVA 1UWBB 2YWHA 5HP1A 4AL5A 4MKBA 2HQIA 1NZ8A 2ASJA 3EWGA 2ZUGA 2BRLA 2V69A 1JX4A 2FHKA 2BM1A 1SV5B 2Y3YA 1M5KC 1S1XA 4WK3A 1FXRA 2CVEA 2XS7A 2VUGA 4IQXA 3MFHA 5E33A 4Y28C 1N5YB 1N5YA 4ECSA 4ZVRB 4ELTA 5L1JA 1ACMB 2DXDA 2XWYA 3W5YA 5KFSA 3NL0A 4P7VA 2AF6A 1N6QA 3GJQB 3H42A 3MI7X 2IDLA 3CT9A 4NLPA 2Z57B 4NA3A 5KFRA 3CJ5A 2COLA 3TJAA 2RS2A 3T1HJ 2RHQB 3GYXB 3CD5A 1SJ4P 4OHXA 2DRAA 1HNWJ 2WRMA 2XCAA 2FGCA 2DNLA 2UUBF 4FF4A 3PX6A 3C14A 3FJ2A 1X4GA 1ZPVA 1H0HB 2WOMB 2DNMA 4M63A 5I3UA 3IBFB 2Q6CA 3N4WA 5M2UA 1TV6B 3RAXA 1VQ8S 2HRUA 2GJ2A 2G4BA 2AU0A 1FK9A 1LWXA 5F0UA 2ATCB 3HVTA 4PKDB 2N3LA 2KJWA 1KWMA 1OQ3A 3PTWA 4NZ6A 1S48A 5GAEI 4DR2F 2KYXA 3ZZYA 3TARA 4K4YA 4LFBJ 3HFKA 4NA1A 2LXUA 4PWUA 4PXDA 5HJXA 5KFAA 4RW9B 5F8JA 3MPDA 1YJRA 2DH9A 4KV8A 2I6WA 3VTIA 3BBBA 2P8IA 2YNIA 3THVA 2WVEA 3SMZA 1S79A 3FFIA 4ILRA 3BGOP 3OHAA 3MHYA 4FBTA 3TWZA 2EPIA 2LECA 3OJUA 3KNGA 2CJYB 2DISA 1TKXB 3PRVA 1JLFA 1S0NA 2NSBA 2JL9A 2V8DA 1NDPA 2B6AB 2OEKA 1OSDA 4CYUB 1X5SA 2B9YA 3QIPB 2XLIA 5HLFB 2FVPA 4EBDA 2Z0GA 3B8HA 1U47A 1B64A 4CQ1A 1TVRB 3FNNA 3CCTA 5AE3A 3M32B 4CZCA 4DV3J 2ALZA 4LF7J 5GMKa 2H5IB 2XSFA 1JLFB 4DI6A 3ZTRA 5CXTA 2DR5A 3DLLQ 3WDOA 1XIQA 2HNDA 4RBVA 3I96A 2UXDF 2RH3A 4BWJA 3VVUA 1RBOB 4K0KJ 4OYPA 5I42B 1Z4UA 3DU5A 4WBFA 3IA0A 1SQGA 4CLPA 5T7LB 4R0JA 4TQRA 1T05A 2RB7A 3I6PA 4NLGA 1ZOTA 1FJCA 2XYHB 3FMWA 3MM9A 1S10A 2DGWA 4DSJA 2UUCJ 3THTA 2AX1A 4HKQA 1RYRA 2AT1B 5CYMB 4J9OA 4DV4F 3Q8SB 2HQCA 4LJMA 4NYZA 5KG5A 3M2RB 1JIHA 2A10A 2BE2A 3ZZZA 3RBEA 3DOMA 1YKWA 1MROB 4U96A 1YTYA 2Z8QA 1Q86T 2A6MA 2WVCA 2GA7A 2GW8A 1H2UX 1EJ7L 1LWEB 3D1QA 3D66A 3G82A 3U1NA 3CD6S 1IBLF 4ZP6A 4TLQA 1SC1B 2J0XA 2BACA 3ITHB 4O4RA 1N0UA 2QLFB 1YJTA 1KEKA 1CC8A 4QCLA 4CLKA 1S6UA 4QIFA 4RWWA 1XMQF 2MZJA 1VFJA 3QT8A 1FX4A 4MJKA 4EMDA 2AIRB 3F56A 4F3QA 3CJSA 2HQDA 5B0GA 1TKDA 2GIQA 3CPWR 3TP2A 4F7VA 2R8GA 4C3KA 1S9EB 1CS4A 4DV5J 1IJEB 1HYSB 1TAUA 2YWFA 3HMJG 2JZ5A 4WXOA 2C3OA 4PABA 4KSEB 2ZH2A 1Y5LB 4DF8A 4ERDA 3DLGB 2V2VA 2IYIA 3Q89A 4I6AA 4ZS6A 3UDLA 1HI0P 1LFPA 4CNYA 2HQFA 3BO3A 3DC2A 3I87A 2E1MC 1L5UA 1FT8A 4IYQA 2AD9A 2ZHAA 1FVSA 1GTHA 2ZKTA 3EJMA 4CH7A 4TQSA 1C4CA 2GJFA 5DETA 1S99A 5GAEU 1X9SA 3GMGA 3GV8B 2Q6BA 4DUYJ 2BQ3A 2HNZA 4RW7B 2IAJB 1LW2B 2DRBA 1GNKA 1OS5A 2FQQB 4M5MA 1R89A 2VKRA 2G0CA 3HKZD 2DJWA 2W2NP 1J2VA 1IKWA 2E29A 2H3EB 3BGUA 4DL7A 4DQPA 4FYWB 4EO8A 2W9AA 2HHXA 1XNQJ 2YNFA 2RDJA 2EFVA 1T94A 2MTLA 5IZHA 5KFCA 1RAJA 2HNYA 4KY3A 3DM2A 4OX6A 4QIWD 4WU2A 4ZVTB 3TW0A 2FJEB 3UCUP 1JK9B 4HT5A 4EGLA 4QWCA 1RT4B 2XY5A 1V3SA 1XMBA 2KXFA 2ZKUA 3BBCA 3BN7A 3I5CA 3HVRA 2XCPA 1UVMA 2DGTA 4W90B 3CC7S 3V4IB 3OR2B 3ENQA 4B9TA 2DT9A 3A8EA 4LQ9A 2IYGA 3RRGA 5IM0A 2ZM6J 3SV3A 4K4SA 3C15B 2KRRA 4RW6A 2RHSB 4QJVA 3VGVA 3HP6A 2H9ZA 5LMUJ 2AW0A 1JLCB 5KFNA 4XTTA 5D4LA 4Z2XA 1S5ZA 4ZK7M 3H40A 1LQ9A 5DDPC 2OSQA 3GIKA 5DG7A 2C2RA 2XWXA 2C2KB 3JTOA 1WC6A 3IRXB 1RJJA 4Q44A 3DLEB 1S12A 3PV8A 1Q82T 2XEXA 2W9BA 1QM9A 3W1YC 4DLGA 1I1GA 3KWMA 3WIVA 4CRJA 3KLVA 1Y9OA 1N5QA 1HQEB 2CQIA 2QV6A 4UOCA 5DZ7A 5E41A 4JI7F 1T9VA 4ZHRA 2DHSA 2Y1RI 2F40A 3HK2A 1UP1A 2HHWA 3TAMA 3BKTA 4OZJA 4DR5F 1FKPB 3MOZA 4V1Ak 1HIYA 3VGUA 2NR0A 3DFEA 3HZEA 2CZ9A 5K14A 3D28A 2AEFA 5CZVA 3B6BA 1IBMF 5KFPA 4IUFA 4DR4F 1N6QB 3TX0A 1E6VA 3OVAA 3OXFA 3AQOA 3N5FA 2VFVA 1U2FA 4DSLA 3LP1B 2CJXB 1JLQB 2XMTA 3NAHA 4NEYA 5A76A 4O4GA 4UY8T 3CWJA 4O3RA 2OTLS 3ADAC 3BDEA 5CCMA 2Y8YA 4RU9A 3JQJA 4YB6A 2YH0A 3EXYA 1PYOB 2KXNB 1CULB 2B9EA 4FN5A 4UQGA 2MB0B 5HMZA 5KTQA 3HM9A 5KG1A 2NLWA 3K5OA 3AAWB 3PHTA 4UTGA 2D7SA 2HVZA 4B17A 4ZN3A 3BM7A 4LIRA 5IT0A 1HBUA 4CH0S 5L46A 1Q7LB 1RAAB 2F9JA 4NMLA 5FD1A 4CLSA 5L9NA 3OTEA 2XMWA 2HKEA 4JI6J 3HHKA 5HQMA 1FK9B 2RUSA 3UNYA 4UUWA 3UNGC 1S0OA 3DOLB 5L1KA 1RHQB 4YQWA 4GC7A 4G6VB 5BYSA 1D0EA 2ZJRQ 1H7XA 1V3RA 1RK8A 1UJ4A 4ID8A 4OX9J 1VQSA 2GHPA 2K3KA 3HULA 2ZDOA 5HMWA 4WKRA 3S1TA 5FIIA 5J1EA 1A7GE 4AQYF 3MCSA 4ZCIA 3P5TL 4IDKB 2B51A 5E7OB 5KFIA 4PWDB 1JLEA 1S1WA 4N8NA 2M70A 2RQ4A 3I4PA 3H4DA 2F5GA 4GRSA 1RWMB 1HNIB 4ECRA 1QSLA 1LXNA 4QYZK 4LSLA 2K7KA 3BF4A 4KO0B 4KO0A 4DV6J 5IXUA 2AYGA 4F02A 1G1XA 1DTQB 2L9DA 2QSFA 1N32F 2UU9F 4FXVA 3LWMA 4M5LA 1KVKA 3M9NB 1JLEB 3VAFA 2G0IA 2OD4A 1G7CB 3FBEA 3H59A 3MZIA 4DFPA 4NCBA 1KVIA 2OTJS 1RAOA 3NS7B 4HI1A 4A8KA 2JVOA 3H2UB 1Q8BA 1R6YA 3TAMB 1BWVA 2LDYA 4QR0A 5KG4A 4C0BA 5J2MA 3ZNUA 2N4DA 2VG7A 3A12A 3KJNB 1U1OA 1TK8A 2KZZA 3BH7B 1IN0A 1QUPA 1S1TB 4ZHRB 3JAMU 2JHEA 2B4UA 4ELUA 5BYQA 2LLZA 1GH8A 3Q0AA 4DR5J 1AROP 1X4HA 2VG5A 2VASA 3BPDA 2BANB 3HHEA 1NK6A 1N32J 5CYMA 1RTJA 2DNQA 3LGNA 3MUMP 3UVJA 4I2QB 3V81B 1RA7A 5KFOA 3DMJA 2IM3A 4OZ2A 2HHSA 2R2SA 1HWKA 1WF0A 2J9CA 1FA0A 1PIEA 4OLOA 4F0MA 4NASA 1U1PA 1TUVA 1FDBA 2QL9B 1P9YA 4OV6A 4PZVA 4RUHA 4UT4A 4YY3J 4CO4A 4DFKA 4DN0A 4CT8A 4B3OA 2FZCB 1WG4A 1G3OA 2KU7A 2L9NA 4LRBA 5GVQA 4O3PA 5KFMA 1RWOB 4EYHB 1VC5A 2EKNA 4I7FB 1KP6A 5L8RC 1FE4A 3ETOA 1YSJA 3G71S 4Y3CA 3SEOA 1VBZA 4ZJQA 2BJ8A 2MHNA 4M5KA 4OLPA 4ZPTR 5DDRC 4YB1P 4O3NA 3BYRA 7FDRA 1O0PA 5GAGU 4OI0A 1LWFA 1PAEX 4QZVB 1B99A 4L72B 3LANA 3M7VA 3RRHA 1SC3B 1KDNA 1KD1T 4JI0J 4B9UA 1TKXA 5B0AA 1VK8A 1U1RA 1FVQA 5GMEA 2K06A 2Q79A 2MLXA 4LRAA 2HEKA 4CLLA 1S9GA 1LW2A 4Y2IA 4F50A 2DO0A 1C1CB 2HAIA 2VG6A 2GC8A 4RO0A 3UDCA 2NUUG 4OIXA 2FC8A 3JXOA 3CULA 4NLYA 4L76A 2EW9A 3FVYA 1ULRA 3VHQA 2Q43A 3OL8A 4K5SA 5FDLA 1ZM3A 1PC5A 1T9XA 1OY6A 5JUMA 1RT5B 2CPDA 2FPHX 3OTBA 2LQBA 4M5IA 2QYGA 4M5HA 1S59A 4I6YA 4ZVEA 2CRLA 4ZVFA 4XIUA 5D15A 1S1TA 2BJ1A 2YWEA 2NUHA 2ADBA 3OT9A 2AEJA 4ITSA 4WJBA 1NSQA 5A8WA 1N8RT 3M6VA 4WP3A 3CB4A 1IUJA 1FRKA 3W66A 4DCPB 2G1HA 5DM6Q 3J81U 4A8QA 2F7VA 3PJWA 5EX3A 5KFEA 1YZ6A 2BUNA 1C0UA 1RT1A 5H9FJ 3VGTA 4MKAA 2LCWA 1ZA1B 1PJ5A 2BKOA 2B9WA 4JI2F 3W2VB 2B4OA 1HNZJ 3AXKA 3OQ2A 3MAQA 1C0UB 1RT1B 3RR7A 2R7VA 3GR1A 5E2QA 2GIRA 3MEDA 1R8CA 2YY3A 1Q79A 1LW0A 2J7KA 1CQNA 3FZBA 4K59A 5KG0A 3GIIA 3DXSX 2PEBA 4TY8B 2FLLA 2J9EA 1ZM2A 4QW9A 4FBUA 2QG9B 1HNIA 2M0GB 3PNIA 2QYCA 1S9FA 2VPWB 2FHMA 2Y0BB 3C16B 5DJBA 3QLHB 7AT1B 1PYTA 4IR9A 2B9XA 2F4FA 5KT4A 3AOBA 4IG0B 4LR7A 2KB2A 2LA6A 4I68A 2V6AA 2F9DA 4UZBA 4QW8A 1X31C 3TOQA 4UF4A 3CSKA 2B7BB 1LKZA 5AT1B 3QSIA 4KKOA 4R8UA 4DPWA 4B9SA 3D0GE 1EKSA 4MH8A 4RR5A 1Q5YA 1WEXA 2R2RA 3HO1A 1M5VC 2W7AA 2CJKA 4DPUA 5HBMB 2O66A 1TQLA 2YNHA 1LXJA 4IFVB 1O51A 1MMNA 5EWGA 2VBYA 3HHLB 2OPSB 2QA4G 4JI0F 1B7FA 2GAGC 1PO6A 1C0TB 1LWFB 1U6FA 1NHVA 1MLAA 3AD7C 4KPCA 1KN6A 1FFGB 1WHXA 4PWWA 4KJIA 3OV7A 5IT9U 2GHVC 2MY8A 2Z4PA 4JI1J 2BJ7A 2MQOA 4J9RA 2F4VF 4JV5J 2HFZA 2JNJA 1S6OA 4RUCA 4A8FA 3W60A 2CPFA 3JTNA 5MAOA 2YKMB 3Q8RB 2FD2A 2OFGX 4CP5A 4YR2A 4U7UK 3CF5Q 1PC4A 4B3OB 4HHHA 2LYVA 4F26A 2QTWA 2J0QD 5FLXY 3KYLA 1AZSB 3C19A 1SH2A 5HN0A 1HKAA 1BD6A 3C6UA 1HBMA 4ZVHA 3GILA 2MKSA 2DGSA 3DLBA 3BDPA 1RE1B 3UR0A 1JLAA 4DZ6A 2KHCA 3MM5A 5T14A 2ATLA 3PFEA 2FGOA 4ZLPA 2U1AA 4JI8F 3GCWP 4M5DB 3KLHB 3MD3A 2V4QA 1LWCA 2FIUA 5DRKA 2Y1LB 2QJ3A 3QPIA 1EQMA 1N52B 1PG5B 1SH0A 2DY9A 2KM8B 2HBRB 3H4BA 2W25A 1SUQB 3DLEA 3BYPA 1VQOS 2EFNA 1Y5NB 4PEOA 4NXMJ 1P27B 3GFXA 4AXJA 4URGA 3MM5B 3KLFB 3R5CA 4WXWA 1TKZB 4A47A 5LJ5Y 1GMVA 2RDIA 4IO1A 1X4FA 3AOCA 2R9LA 1T03A 1TR0A 3V5RA 3FMBA 3ILOA 2BQUA 4WIIA 1M5SA 4OI6A 4A48A 3PVXA 1HWLA 4RX6A 3IS9A 4F36A 3PO5A 1IKWB 2MKCA 2V8HA 3DGVA 3GV7B 3RTVA 2XS2A 1KQGB 4PCQA 2OMLA 3OHBA 4KGMA 5CCLA 1YWXA 1DTQA 2CNKB 3EPIA 2E5LJ 1CJVB 4FPRA 2IAJA 3QAUA 5KT7A 1S0MA 4ELVA 2AX0A 4GVLA 1QSSA 1YJ9S 5KFVA 3HKWA 5CQGA 3VQSA 3VZIA 4LFBF 5CAAA 5LJ3Y 1RAHB 4A8MP 1XEZA 4P2MA 2OD6A 3O3LA 4YR0A 3R5JB 3V81A 2MKYA 3OL6A 2IA0A 4FXDA 1N54B 1IQZA 2R7UA 1KNZA 2P9CA 1XNRF 1I3OB 1U0HA 2K1RB 1EX8A 3NY0A 5LL6d 5K8MA 3UO0A 4X4OA 1L3VA 2PMZD 5AJ3J 3NXZA 5DQGA 4AD6A 1APSA 2POKA 4ZPAA 4M5JA 2CQ4A 1U7LA 2Z56B 5C42A 2J5AA 4X64F 1QTMA 4IRCA 3QFHA 3AB2B 4NWBA 1MWZA 1NPPA 4QPXA 2UVUA 3KNAA 4Q0BB 1MN9A 1QY7A 1RBLA 1Y10A 2HS0A 3J7A1 4O23A 2E5IA 4F4XA 3G9CA 1FNOA 3R3TA 2KM8C 1IVZA 3BSCA 5D6GA 3W64A 2CAJA 2QA2A 2A18A 4ECQA 3MM6B 1A9NB 3D6TB 2GFFA 2YPYA 3FSXA 5D4NA 3O1LA 3FSIA 1K0TA 2GGPB 3QMQA 1Y00A 2C3PA 5E3AA 3MUTP 3G6YA 3KMQA 3POTB 5KG2A 5HQLA 2HLTA 1ZAVA 1H3DA 2X3GA 3S6EA 2DR7A 5F8HA 2V68A 2HG4A 2KVQE 2P6TA 3BO2A 3RB3A 1NK9A 1WHYA 1WJ9A 3DI6B 4LF2A 1REVB 1UTAA 1OMSA 3ET6A 4NLUA 3RZAA 4N76A 2YQ3A 5A8KA 4X4TA 3JS9A 1J5EJ 1ZA2B 1MG7A 4H4OB 4M1KA 4NYOA 3CC2S 2UVRA 2G9OA 4JI8J 1GQEA 1U0SA 3UPFA 2H5EA 4K4XA 2UUTA 3VAHA 3NMAA 2DK2A 4ZPVR 1WI6A 5EDWA 3ILLA 4YMEA 1FEEA 1Y5IB 2OGUA 1SUQA 2BJDA 4Q2MA 4A8OA 3CUNA 3KJFB 3UN2A 1GAOA 2EBEA 4U95A 1VYAA 1RT2A 3W62A 3H2VE 2RKIA 1UA0A 1E6YA 3Q2SC 1VQYA 1U26A 4H54A 3J80U 2LKZA 1SJQA 3PR5B 4M94A 1JLAB 4WCEQ 2CXEA 4C97A 3TQ1A 3MECB 1NAQA 2BVZA 5KFYA 2HMIB 3KTQA 2AGPA 3ENVA 3I0SA 4FS1A 4OYBA 2AJFE 1RAFB 2RT3A 1SKUB 5T7LA 3PYFA 3GR0A 1VDHA 5DDOC 2C2EA 4V19X 3ISNC 4ES1A 1RAEB 4K0KF 3VR1A 1LFWA 1UMJA 2E7WA 3HD2A 4LSNA 4LSNB 3LP0A 6FD1A 4CLTA 2XULA 5CA5A 1WSVA 4USMA 1WOPA 5JMNA 4JYAJ 4RW8B 1UJ5A 5E0OA 4KB7A 3KJVB 4G1QB 1QVGR 2EBGA 3SCKE 4X62J 3QT5A 4MKYA 1RI7A 3D3BJ 1M5OC 3W9IA 4CTAB 2NYHA 1RKIA 1RXOB 2GQQA 2V9KA 2VB6A 2YQ0A 3GPAA 3M2VA 3SCLE 3MEGA 4ER8A 5AE1A 1FKOA 1HNVB 1KBRA 2JC0A 5KFDA 2YKAA 3VV2B 2EEYA 2D1CA 1HQEA 3A3OB 1Q81T 4B3MJ 3TUPA 3QGIA 1D9AA 1W7WA 4F4AA 3CMAS 2M3DA 5JVGQ 2NXJA 4KGZB 4LBHA 1D3WA 2YNIB 3MGJA 2W2PP 1HNXJ 4ZKAA 2MJNA 2WHOA 1S97A 1YRXA 2GV1A 2O3DA 4Q2LA 3PYEA 4HHUA 3LAMA 4EK2A 2U2FA 2V94A 3OL9A 2CDRB 5DQHA 3I0RA 3M8QA 4RNMA 3GV5B 4NYPA 5A2QY 4ILMA 3S01A 2XM3A 3QBCA 2KL8A 3UE2A 2FZGB 4BHQA 3M6UA 3C14B 2D3ZA 1S76D 2XBPA 1F9HA 2HFUA 4FKXA 2N7CA 4J37A 4BLGA 2RD5C 3PEJA 4ECXA 2YKPA 2FJXA 4H4OA 5KFFA 5IFMA 3MM6A 4YOEA 3C2PA 3HSJA 4PXCA 2WVFA 3AA9A 1HARA 4P7TA 2DGUA 4LF4J 1Y3JA 1YJUA 3OFFA 4B3TJ 2KRBA 3L7OA 4X4PA 3BQ2A 4EWTA 1NK7A 2LDIA 4WFXA 3VAKA 3IN5A 5A8WB 2OJ3A 1C2PA 4YS2A 1RB0A 1VS3A 2VF3A 3DOLA 5ETMA 3HXMA 4E0DA 4YDDB 4HVZA 4LF6J 2Z2LA 3KKFA 2N82B 1HWJA 1WUUA 2XI3A 3IWLA 4PWDA 1HMVB 1JJ4A 1K1QA 1N34J 2C2OB 2ZOMA 3R97A 4DF4A 4B02A 5J1EB 3RBZA 1KOHA 2IRXA 4ETXA 1DAXA 1OYDA 3IR7B 4N56A 1TP7A 1PJ6A 2PC6A 3M8YA 4FF2A 1GMWD 5KFQA 5J2NB 2RAQA 4LR8A 1KR4A 1WORA 2GMLA 4OYIA 3LGMA 2GVDA 2YNGA 2BZ2A 5CYQB 4ZITA 5B08A 1N0VC 3FRYA 3K89A 1XNQF 3RBDA 5DLGA 4FF1A 2HNDB 2HFOA 3GIJA 1IKVB 3SXLA 1DARA 4LF6F 3K5LA 3KLIB 3N79A 2GIFA 3HSZA 4USTA 3E01A 4JV2A 1MWYA 1SXLA 1WWHA 2LQJA 1TAQA 4E2FB 3BSNA 1B7YB 2RNEA 4DL5A 4X4UA 2HFNA 1BE4A 2EWHA 5HVHA 1YG0A 1S6QA 1N5TA 3ONQA 5DDQC 2ZITA 3Q8QB 3GIMA 4O44A 3LP1A 4CO0A 4DX5A 2RU9A 1X5PA 4NLTA 1FERA 1S49A 5KG6A 1PBAA 1F60B 3D4JA 4J90A 4QYRA 1JNRB 3CJ2A 3IG1B 4K4TA 2IVFB 1ZETA 2IVMA 2RRBA 2KN4A 3D7SB 4TY9A 3LWLA 3R1HA 2JEIA 2CPHA 1RTHB 1RTHA 3CCSS 4IO9Q 4F4KA 4YDXA 3I56S 2MPUA 3QJPA 3NGUA 3NCQA 1QUVA 1RHMB 1YRTA 2QMUB 1B0PA 4WYWA 1ZTTA 2R2TA 1BXNA 3ZZ0A 2YH1A 2HVDA 1QAJA 3DHXA 5E3RA 2W1BA 1Z2ZA 3TZZA 4DV7J 4B9VA 4K4UA 3PW2A 4FYYB 5LXYA 1GMUA 1U09A 3VAIA 3AJ1A 4USJC 3U1LA 3E8OA 1W2IA 3GG1A 4C3MA 3MEGB 5KFGA 4DV2F 4DR4J 1UCNA 3CCWA 2YWKA 4F8RA 1S1UA 4KH0B 1UWAA 2JEFA 4ZVSB 2HRTA 5JJBA 3IM8A 3FQLA 4XAKA 5IWAF 3F41A 1CJTB 3MMCA 5H9EK 4KRWA 3ZTPA 4X4NA 4CYUA 3H7HB 3OR1B 1T9YA 4WTYA 5LSLA 2V0NA 1QAIA 3D9BA 2KZMA 3TVKA 3V4IA 1NMEB 1TUWA 4IG3A 3TEHB 5G0RA 4X4RA 3SV4A 1P6TA 2PN6A 3AFGA 4LSLB 4CLWA 3OTOF 2D41A 3JSMA 4K4WA 4IOCQ 3J81j 1I6JA 4C8KA 4IOBA 1IBLJ 1VRUB 4DV2J 2MXYA 1IKXA 2BJ3A 1RTDB 4ED5A 1KLMA 3A4TA 1FDDA 2CQHA 4XDCA 1SIWB 1KVJA 3QGGA 4MFBA 1NDKA 2FTRA 1E6YB 4O3QA 1TK5A 2XG8A 2DHXA 3P96A 4AT1B 3GYGA 1NNDA 1VQLS 2OSRA 2BA9A 3KLGA 4PG5A 1FI4A 4K5RA 4RW7A 1MNEA 1VLYA 2G1DA 3NEKA 1WF2A 4I0WA 1EP4B 3FDSA 4ZP7A 1X5OA 3V6KA 1U48A 2B4PA 5J2MB 4Z7YA 3HJFA 3RB4A 4J9PA 4KR0B 2W9CA 1NK4A 2QL5B 4Y6IA 4Y2CA 1R0AB 4OHYA 3N28A 3I32A 1Q0NA 2Q1LA 2GMHA 3MAAB 4WFAQ 2Q66A 2IBOA 1RT3B 5C2CA 2YKOA 4Y00A 1T3OA 2AGQA 4ZJOA 1HNXF 3EXCX 3N6MA 3KG0A 3JTPA 1Y11A 3SDEB 4C48A 3QIDA 4Q5VA 2BYCA 5BYRA 4BCAA 3H90A 3VAMA 5HLFA 1RZMA 4J91A 2AEMA 3AH6A 2WSFC 3FCHA 3QO9A 1FD8A 4O4GB 1T7PA 2N3OA 2KH9A 3LOUA 4UUXA 4ECWA 1U1NA 4RU2A 3FGVA 1NKCA 3R7SB 1FO1A 2EG2A 4A8YA 1MROA 3ZFVA 1ZYQA 1S1XB 5KG7A 4V19J 4B3RJ 2C22A 4X4VA 1ZM4A 4YB7A 2DNPA 4TVAB 4MIAA 3SDEA 3J81Y 4ID5B 3X1LB 5EWEA 3PW5A 1Y4ZB 2DNZA 2DEIA 2BM0A 2KFNA 3MMAB 4Y65A 5CZXA 3MM8A 2BOPA 4K4VA 3NGSA 3FRZA 2BV3A 8AT1B 3CCVS 3CMQA 1XK8A 4N47A 4I6WA 4J5OA 4Y0FA 4PUOB 4ZLJA 3FEYB 3HHDA 3DCAA 4PQAA 4I4BA 3T41A 4C2MA 4DX7A 3P49B 5KFLA 3R27A 2GX8A 2V4JA 1NK0A 2BE2B 2LQ8A 3JYTB 2CDQA 2MSSA 2H1YA 1TUGB 2CUYA 2VPYB 4L74A 1RHRB 4ZVOB 4C8MA 2K1RA 3GB0A 9RUBA 4PQUB 4BC7A 2BJ9A 4C8NA 1DLOB 2DH7A 4NX9A 2ZH6A 3NOGA 1B4SA 1VC0A 1Q53A 3H0PA 2F63A 3IR6B 5IQ6A 3FZ2A 4AFFA 4DPYA 1D09B 3OTDA 2A1BA 4WPAA 3L7PA 3TA2A 5D3GB 2VG6B 4LF7F 2ZHOA 2M9KA 5LSOA 2HWIA 1KOOA 1YBAA 1BQMA 1R6VA 3U02A 4DL4A 1TL1B 5K8NA 3GJTB 1U2RA 1FTRA 5A8RA 2JVRA 3TQEA 3HSGA 3R1LA 4LSZB 2DCLA 4ZVPB 5E5NA 1SL0A 3RG6A 1HA1A 3RR8A 1DQAA 2WVDA 3A1YG 3FBFA 3JQKA 1VCTA 2VFUA 3DM2B 2HQGA 1WHVA 2DRDA 1YBTA 3GSDA 3HFVA 4FXWA 2HZCA 1F9EB 2MHEA 1DQ9A 3QSYB 3GJSB 4G1QA 3DDNA 4DPOA 1KONA 2V2QA 3R6GB 2B6AA 1K44A 3H25A 2HWTA 4RW4A 5GADI 1HQUB 3MEEB 3JSBA 1RCOB 3FUYA 4KGKA 2CZ4A 1K73T 4Q8EA 1S4EA 2AJ2A 2FHJA 3NAIA 4F2RA 2EFGA 2VG5B 2NXNA 4OJGA 2NXUA 4NLVA 4LRCA 3MM7A 3TZXA 2GVDB 2EK1A 2VBWA 1VJWA 2BE9B 2J7UA 4QIVA 3UDVA 4DL2A 1RGVA 3O44A 1SJ1A 1VGYA 2E5JA 3NGTA 2ZBPA 1DBDA 2I5JA 4YR3A 2V8VA 1NB2A 2Z58B 4MYUA 4OX8A 5LMUF 3T1HF 4BS2A 2ZWPA 4RPFA 1ITPA 1DY3A 2J8SA 2XLKA 2DHAA 1Q8LA 4JV5F 3C16A 3R7NB 1NRKA 2DBBA 2VDHA 4NOHA 2E44A 2W8KA 5EHHA 1XNRJ 4ED0A 4DR7J 4L6V3 2BW7A 1UKUA 4NZ7A 1JQGA 3OJSA 1S6QB 4GKKJ 1CSJA 1FXLA 2ZVIA 1SIZA 4NLDA 2I9SA 5K9FA 5GAGI 1KHWA 4L3KA 2ZH5A 1S72S 2SXLA 2UUWA 2WBRA 3NCRA 4FNHA 3R2DJ 1VMBA 2ZZMA 5L9XA 2YKNA 1H2VZ 2WCXA 3KXDA 3HVAA 1NKEA 1S1VB 1MN7A 3T5KA 1O5JA 4KGXB 2JLFA 1DURA 3B54A 3QT7A 2AJ1A 4KQZA 4OYAA 5GMDA 3TUJC 2BBEA 2RRNA 4PPZA 3WC0A 5BR8F 1RISA 1WOOA 4S0MA 3PW0A 2HNZB 1KHVA 3DDKA 1VI7A 3QATA 1YX2A 2FJBB 4WFYA 2W7OA 2EC0A 3DOMB 2ZC4A 1VQ4S 1WSRA 1EB0A 4ZCMA 2MY7A 3HHLC 3OVBA 2H4YB 5DZ6A 5EN1A 2DO4A 2R7WA 3C6TA 4USIA 3M8ZA 1R0CB 4ED2A 5HP1B 3K58A 4PR6A 1SQEA 2VD3A 2AJ0A 1HWUA 2B43A 3JQMA 2X51A 1HMVA 3ILJA 2CQ0A 1R27B 3OFGA 1ZAWA 1LK5A 1AUDA 3IMQJ 2EVZA 5ETOA 1NCLA 3U27A 4KHPJ 3T5JA 4UOGA 3KFWX 3PYGA 5L38A 4YFUA 1WKJA 4LVNP 2E5LF 5ETPA 5ETNA 4USVA 2UXDJ 4LREA 3W65A 4E8UA 2CG4A 4PAAA 2OAUA 1CJUA 5ETLA 2FLPA 2XSJB 1X4BA 4ZA1A 5ADZA 3K2YA 5LT5A 3EDRB 1P8GA 3OR1A 2I8EA 3MDFA 2RF2A 1X4CA 4FVMA 4L73A 3OXLA 1VQ9S 1T3NA 4LFCJ 3M2UB 4YHHJ 4YUDA 1L3SA 2L3MA 1UETA 2L48A 5LMNJ 1LV5A 3QIPA 3K5NA 3KK3A 4N5SA 1QJHA 3KLFA 3MURP 3JB9k 2B0GA 3WHIA 4DJBA 1X0FA 5G0RB 2NS1B 2DH8A 1B0VA 3VCDA 4B3SJ 4TYBA 2W4CA 2V67A 3BS9A 4D3GA 4QR1A 5C24B 3G8TA 3KMSA 1RWNB 1U6ZA 3F73A 2MKJA 4I69A 4WWSA 3U7JA 1VC6A 2UU9J 3HX9A 3DLJA 3PO4A 4ZP8A 1Q95G 3KDOA 2J6SA 2K2PA 3DYAB 2EFQA 1VBYA 3L95X 2FB0A 4C7QA 4A46A 2QO3A 1V9OA 2DNOA 1EIYB 2F8EX 3HPOA 1UPPA 3LALA 2B3TB 2LXIA 2ZVSA 3NGRA 1DZ5A 3EZOA 5AE2A 4U67Q 1SBRA 2CYYA 2L08A 3L4BC 4U8VA 5CHCB 3M6XA 4N77A 3RYLA 2ZJQQ 4ECVA 4X66F 3W5XA 3N5BA 4ZPBA 2G0JA 4URSA 2C28A 2BKPA 1MW7A 1YQHA 2V34A 3LUYA 3PDNA 3EVMA 1QAXA 3NBPB 1EZZB 2GCFA 4MK9A 4CTAA 3RB0A 1M0SA 3CCLS 4J9QA 4MTPA 4JUZA 2V8PA 1GK8A 1GXUA 1WEZA 2CQCA 2PDAA 2ZZNA 3D54A 1RWVB 3KJVA 2UZAA 4PXBA 3CCJS 1Z2LA 3R9LA 5AJ3F 3MCOA 2D3UA 2Z30B 1K9MT 1HD1A 4HYKA 4ED6A 3W61A 2QFJA 4HT7A 2OPRA 2CJQA 2GQCA 3MD1A 4OYWA 5ETKA 4W92B 2HLUA 3G8QA 2BDPA 1UFLA 2X1FA 2G2ZA 2G2YA 2FJWA 2M52A 2MQQA 1TTHB 4PQUA 2Y0SD 4KYZA 4OJ1A 4OHWA 1XC9A 2QA1A 3W2WA 3KHRA 4YY3F 5KT5A 3Q8YA 4EFAC 1MSWD 2HZAA 1WC0A 4YEAA 3CJ8A 2XSJA 4MT1A 2IMWP 4NZ0A 1SPBP 1R8HA 3DLGA 3LQVA 4CWBA 4LQ3A 1RYSA 2ZNYA 2V9WA 3PHEA 1VISA 3TNVA 2KT5A 4GMKA 2WOMA 3FK4A 1NU4A 1UZHA 1X5TA 3KLGB 3PCOB 2OHDA 2CWXA 3ISND 1KFDA 1SCJB 1M1KT 2UXCJ 1GX5A 1YGYA 2IC3B 2ZDPA 1H6KX 4HTIA 4ZIWA 4O0IA 3VAJA 3US5A 4DBQA 1CG2A 4CDIA 1UW4A 2K3IA 1CBKA 4P2SA 1NHKL 1WI8A 1HD0A 2JJ4D 3PG9A 3CJKB 4J9KA 1WELA 4J9MA 2AWZA 1F2GA 3ICLA 4LT6A 2YWWA 2UVWA 1NDCA 1UVKA 4HACB 3MR5A 3AD8C 3TX8A 2AYEA 3OBIA 1NJXA 2E5HA 3DKDA 1HR0J 2GGPA 1LW0B 1N5SA 1AFJA 4K2XA 1DTTA 2ZWOA 2RVJA 3CJKA 2F4VJ 1U4BA 3BQ1A 2UUBJ 4ALZA 2MQNA 3W2VA 2KYZA 4C3LA 3E2EA 3HJVA 3T1AA 4B3SF 5SZTA 3DLKB 3ITHA 4E98A 2M2BA 1TKZA 3Q86A 1KKHA 2IDEA 2XMUA 1XR6A 4RKUC 5LSRA 3AY0A 1JKHA 5AXNA 2KTQA 1VQ6S 1XR7A 3IBWA 1HNWF 5I42A 3KJQB 2IMOA 2JFKA 1WHWA 2LXFA 1F9FA 2QLBB 3GFZA 4DFMA 2J6UA 3BGFA 1IBKF 2ILZA 3U1MA 3IRXA 4EEYA 1UL3A 4NLWA 4Q45A 1D8ZA 1FRIA 3TA0A 4RBUA 1HNZF 2NZCA 2PA8D 3ZTQA 4K2JA 2AGOA 4DSEA 3SSQA 2MEWA 3PX4A 3GJRB 2KVIA 2AKWB 1CJKA 3H8YA 4J9VA 4HEA9 3ZO7A 4DXLA 4C4WA 1UEUA 1XR5A 3Q8VA 3IG1A 3KUGA 3CNQP 4P2FA 3I55S 4I67A 5I3QA 2VONA 3OW2R 4O0NA 3HF5A 4ZLLA 4QOTA 4K50A 2VFSA 3CW2C 2VQEF 3W9HA 3TA1A 2C2DA 2PE8A 1CJKB 1M1HA 4P2XA 3J7YI 5D3GA 4G1IA 4GKJF 2F65A 5B09A 2OP5A 4LR9A 3LPYA 2W24A 4QR2A 2LEPA 1C0TA 5F3ZA 4IQMA 4RW9A 4USWA 4XDDA 3AODA 3BREA 3K7RA 2XY6A 4C6AA 1WD6A 2FJVA 4F4ZA 3MMBA 4EZ9A 2A0FB 2CG8A 2JDJA 3SBMA 3ZC4A 1KQSR 4WF9Q 2R3VA 3NNAA 3V6HA 3IWXA 1XTZA 4PUOA 4YB5A 1LEOA 3NS5A 3PACA 4DV4J 3FBBA 1F1BB 2DHHA 4HTJA 5JXSA 3NG8A 5FJ4A 4X64J 3TAPA 4L3NA 4RUAA 5IM0B 2ZH8A 1AZSA 1AW0A 5A8KB 1PILA 3NMRA 2DNNA 1QDUB 3MMJA 3ET6B 1M90T 1TL3B 2FZKB 3F0NA 3EVWA 3GP9A 3DI6A 2ZBQA 3NS6A 3H98A 3BJYA 1YVFA 3M8PB 2IRUA 4EUVA 1KC8T 2QZ8A 1D8YA 3CCUS 2NXEA 2HK3A 3MTKA 2IRYA 3CJ0A 4ETZA 3QT6A 1PKUA 2NSCA 4OQJA 3CJ3A 4OZ0A 2ZD1B 3K5MA 5CD4A 2RSQA 1RP5A 3GWCA 3G6XA 4B3TF 2IM0A 1F3VA 2P2CB 3DLKA 3M2UA 3QAEA 5B7WA 3E01B 3LW5C 4HL9A 5AXMA 8RUCA 2MGZB 2VICA 2YNFB 1U8SA 4LVOP 3MR6A 1JJCB 4GVBA 2DB1A 2CFXA 2IC3A 2MGZA 4ECYA 4EO6A 1SL1A 3UN5A 4F0HA 1H72C 1R0AA 3H20A 4WK1A 2VPZB 1Y0HA 1YZ7A 3QRRA 2MKHA 5J2PA 2MYFA 4DPTA 5D8HB 2R7TA 5KT3A 5GADU 4NLRA 3T9NA 1CPZA 3LTOA 1VLOA 3M30B 3EGZA 3CVKA 1AFIA 1U0HB 1BC6A 4P71A 3CXCR 2DGVA 4OL8A 1RT3A 4HHJA 4DZDA 3ISZA 1U02A 3HDSA 3QRPA 2OLWA 1Q1KA 3CO0P 2CKWA 4OYMA 2C1EB 3R5GA 4OI1A 4KGVB 1FRXA 1T95A 5BXIA 4RZRA 3CCZA 3V6DB 3SYZA 2RRAA 1ZS6A 1DRZA 1YK9A 2MZ1A 4RNNA 2WSEC 4L75A 1U24A 1HHTP 2JRSA 2LQ9A 2CNLB 3VGSA 1JWWA 3T5LA 2FVRA 4CLFA 1HBNA 2KJVA 4M5NA 1CLFA 2VODA 1Q78A 2W2OP 4DR6F 1CVJA 3C66A 1PGZA 5D4OA 5K14B 3TYTA 2C42A 2R8KA 2W2QP 2HHPA 3M1VB 1VQNS 2GNKA 2DNGA 5HL7Q 4AL6A 3MR7A 3W8PA 1YJWS 2ILYA 5IC4B 3K17A 1P9QC 1SQFA 3CDUA 4KAIA 2HHTA 4NXNJ 5L39A 2HBQB 3TEGA 1TL7A 4WU3A 3GLJA 2VIHA 1TL3A 1NUEA 4P74A 3BGRA 4KBIA 1IR1A 3OSNA 4DS4A 4DSIA 2ZOFA 2HGNA 1TMJA 1C1BB 4H4MB 3TUZC 4WIQA 3DRPB 3MWBA 2IIHA 3G4SS 2R2UA 4Z37A 1NH7A 3IXQA 3H5XA 4NI2A 1Y3KA 2DD8S 3OLBA 1S7IA 1WTBA 2VBZA 1SC6A 3Q83A 2J7WA 4F3OA 3L7UA 2PI5A 1R0BG 2QT7A 3K8WA 3MMBB 1R3NA 1S9GB 1RT2B 5C24A 1JMTA 4X66J 1XBWA 5M2PA 3K57A 4J9LA 4KPYA 3OFEA 1WEYA 1U1KA 2E5GA 2IPOB 3WZ0A 5A2QU 2PFDA 1UZDA 3AHPA 4RW4B 1EETB 2FHJD 4QIGA 1FRLA 1NZAA 3UD5A 4XK8C 1FEHA 3DRSB 1IBMJ 4ICLA 3CGIA 3HI9A 2A2CA 4CCHA 3DYAA 4OI4A 4LF9F 2CVIA 3AT1B 3C6UB 5IOLA 4IRDA 1NDLA 2RDDA 1GEHA 1ICEB 3BZQA 3R5BA 5K8PA 4RW6B 1FX2A 4RW8A 1WC1A 3BPSP 3UDEA 2A6OA 2PT0A 1BQNA 5EUHA 4QWAA 1U6BA 1RWUA 3PFOA 1PSDA 1IKVA 4DPXA 3DXBA 2HAFA 5C25A 1KQFB 2V4RA 4PXEA 4CO3A 3MEKA 3QO9B 2DR6A 2VQFJ 1R8PA 1RT7B 3SSRA 4YP3A 5J2NA 5HSPA 1S1WB 4I1TA 2ZUAA 5HQ8A 3ENAA 1NSAA 4IH6A 4NLXA 2HPUA 2OKQA 5L1IA 4OZ1A 3SZ2A 2CQ1A 2L41A 1V5IB 1VBXA 1UFKA 2VC0A 2ADCA 2RKIB 2MQLA 2X1GA 2CADA 3MUVP 2X3DA 5GAHU 3P5BP 4LF5J 2AP6A 2FJDB 4WFZA 4KHMA 5F3TA 2QSWA 1GMWA 1G2EA 4MIBA 1EP4A 1F5BA 4MKVA 3RAMA 1YHQS 4AQYJ 1IR0A 2MDAA 3DU6A 1VQPS 2ZNZA 3HFZB 2W4DA 2IJRA 4KKOB 2M5YA 1FJGF 1W2BR 2DNYA 1OO0B 1RQ0A 2ZM6F 3SQGA 2EC2A 3VAGA 1T8EA 1CC7A 5ETQA 4Y2MA 3Q8UA 1S1VA 3AXMA 2CJ9A 3WX4A 1Q4RA 5D78A 1GFWB 4U7UD 1IKYA 3DRRB 1UEKA 4OX9F 1CULA 3I9ZA 3PW4A 1N5VA 4U9RA 2HHHJ 4B3RF 3WIUA 2FLOA 2D3O1 2ASLA 3RW7A 1HR0F 2D74B 5D0HA 4O3OA 3SIPB 4P75A 3D6HB 1Q16B 1SB6A 3R8YA 2FY1A 1SH3A 1BHNA 1ROFA 2PGCA 4NLSA 3SQOP 1RABB 3L09A 3B4MA 3MEDB 2GJIA 2M4MA 3W5ZA 3CCMS 5B0CA 1HPZB 3CDAA 4CM2A 4J9SA 3TI0A 4GKKF 5HROA 3QZ8A 2QMXA 1UJ6A 1NM2A 2JFDA 2VH7A 4USHA 4NEZA 4DLEA 3T3FA 2R8JA 2MKKA 1S1UB 4FP9A 2RS8A 3DRSA 2H5JB 5IQQA 4I2PA 1YBUA 2EG1A 4IRKA 2UXBF 2YBVA 4A8SA 3FKBA 3GONA 2O01C 3D67A 2KI2A 2CQ3A 1N88A 2EKYA 3VF0B 2HYIB 3DGPB 3NOCA 4FNIA 1URNA 3NRBA 3EE3A 4NMXA 3ULHA 1DHMA 1VHFA 3OVSA 2BMBA 2QE5A 1M5PC 1JB0C 2YVSA 3M32A 2JH3A 3P4UB 4USUA 5LM7E 1W26A 4TXSA 2XGQA 3DRPA 1VRUA 2FC9A 2WONA 4H4KA 4ED7A 2KKHA 1TK0A 3QJLA 4TYAA 1B3TA 1C1CA 2OI2A 3OTCA 1SJ3P 1OY9A 1RLCL 1LNQA 4ZPDA 1AT1B 4C8YA 4DV1F 5A8RB 2CJAA 2RU3A 3T1YJ 2UUAJ 2LA4A 4ZOSA 1GT8A 1NEEA 3T19A 1VHIA 4GKJJ 5DQIA 3IS9B 1DJ0A 1RAIB 2DNKA 2YX7A 1N33F 2AHOB 2KDOA 3CJQA 4DQIA 2MKIA 4B9NA 1FRHA 1GXLA 3JSRA 4OZLA 4DR1J 2HGMA 5D0GA 2OIHA 1AXQA 1OWXA 7FD1A 2RIJA 2WVBA 4DSKA 4F2SA 1XMOF 1D9DA 2CA9A 2YKQA 1J5OB 3LP0B 1D9FA 3QFWA 4F67A 4CLUA 5IV3A 3OLAA 4DV6F 2KFZA 3UQSA 3J80Y 1VQ7S 2YNGB 1YRUA 3BB5A 3P6YC 2ZE2B 4QPTA 2CNOB 5EX0A 3OUYB 1IM4A 4OJ3A 2KHDA 1WC5A 2XS5A 1KTVA 2EI5A 5KT2A 1Q7YT 3L3CA 3EUNA 4DV0F 2UVVA 1JLCA 3KK1B 1X0PA 2HS3A 2R4FA 1SVDA 1BUXA 2YX1A 3UVJB 2V2KA 4LFCF 3RBXA 5KFKA 2CQGA 1U25A 2MQPA 3C15A 3TAQA 2GAHC 4RNFA 1MMLA 4KH1B 4DG1B 5B0BA 1K8AT 4K8RA 1PBUA 4KFBB 3EGWB 4P72A 3JYTA 4WYLA 3AOAA 4FKYA 3K59A 2X1AA 1X4AA 2DCUB 1S9EA 5EGYA 4CO5A 1X9WA 2ASYA 2G13A 3M1VA 4KHRA 1FFWB 3QRQA 1HHSA 1T0TV 2HBYB 2QLWA 2FHOB 1IKYB 4W98A 4F04B 4F4YA 2VOOA 3CEDA 2RF2B 3MCMA 2OPSA 4MMOA 1Q8KA 5MLCV 2HBZB 3M8RA 4NLQA 4KHPF 2CJBA 2EXUA 2FY8A 2YNHB 4RL1A 4RWXA 3X3UA 3J7ZT 2MZSA 1F5AA 3DRYA 4JI2J 1FCAA 3GYNA 4UQTA 5G4DA 2NXCA 1F0XA 4JV0A 1RWPB 3PXGa 2CNNB 3D5MA 3OD2A 4DV5F 2FUG9 3BR9A 2XZWA 1A0OB 3ENWA 4M5GA 4DCOB 4HLBA 3TUIC 4PG8A 1HWIA 3EPGA 2ZC3A 3Q2TC 2YPZA 4MFBB 5F9LA 4AL7A 3J7Z5 5FDLB 3HT3A 3V6JA 3NWGA 2XY7A 1VIOA 3GE9A 3NP5A 4ZPCA 2ZEJA 1XERA 3C6TB 4ANDA 2UP1A 5C2GA 3SSSA 1NBEB 4TU8A 1N48A 2JWNA 3N6NA 4NCGA 4C8OA 1V5VA 1HYSA 3TJ8A 1U8WA 2ZHBA 1P1TA 2QRRA 3D6MB 1H7WA 1N33J 3V4MA 1R43A 2GMJA 2LQ5A 3A3NB 2K7JA 2AJQA 1FJGJ 1HQUA 3MEEA 1YDLA 3RB6A 3UN3A 3H2LA 1BWEA 2HVEA 4DV1J 4P73A 3M6WA 3GTYX 5THWA 1ZH5A 1BY9A 4WTOB 2UUCF 2Y1JA 2FVCA 4TLRA 4DQQA 2XZTB 3O2IA 1IWGA 2RQMA 4QU7A 1X9MA 3TR5A 4QU6A 1ZM9A 3PZPA 3FBCA 2VPXB 2R7RA 1CJVA 4CIOA 2OPRB 4ED8A 3P3DA 3RW6A 4ILLA 2HIYA 4U7CA 3TANA 2V8GA 4LIWA 1S77D 5E3CA 2RUGA 2XMMA 1TFWA 5H9FK 3WX8A 5U47A 4ES2A 1R8AA 2WSCC 3ZZOA 2B5JA 1BMQB 2MQ8A 4WE1A 2CQBA 2O5DA 2DTJA 2JC1A 2F3JA 5LOQA 2XGPA 1FKPA 4DV0J 5IT9Y 1UFWA 2ASDA 5KFWA 1TFYA 4PPDA 1QAYA 4C0OC 2BANA 4EBCA 4QIEA 2ROEA 5F8LA 4R0EA 2C3YA 3QZ7A 2ROGA 2QIFA 2CPXA 2R7QA 1X4DA 4ZMMA 2N7YA 4X4QA 4B9MA 4O44B 1PYSB 3PRBA 1MU2B 3G86A 1NJZA 2C2MB 3H5UA 1F2HA 2QMWA 1ELOA 1OY8A 5HK4A 1ZZNA 3HHLD 5J2QB 1KFSA 2Z2YB 4TN2A 2MZRA 1NSKL 2CPZA 3EMTA 3QNWB 4OFZA 5A0YA 4C98A 2VA2A 2HHUA 2PA3A 3CE8A 3ETMA 5KFUA 4CI0B 3LP2B 4C11B 3A8IA 4I7FA 3OTOJ 2IJFA 1FD2A 2YKMA 1KQKA 2M88A 4OV1A 5K8OA 1L3TA 3QYYA 3I82A 3GU0A 1TL1A 2GS8A 4OZ3A 3B4DA 5KOWA 3FC9A 3Q24A 1U45A 4LMZA 3POTA 2OUGA 1URRA 2PD1A 4X65J 2MZTA 3FFIB 3RRKA 2QL7B 5J1PA 4LF8F 1S0VA 1U1LA 2WZ1A 3IO1A 2HW3A 4DDFA 4IDKA 5IC6B 3DN9A 5F41A 2HVHA 4LF5F 2Z2ZA 1SJRA 3H5YA 5DLFA 2EK6A 1CJUB 3NGKA 4MK7A 2NZ4A 3QLHA 2XHCA 3BKFA 4UOFA 1RT6A 1RTIA 2R7SA 1WG5A 2HQ3A 1FJ7A 1ZPWX 1X8DA 1ZAXA 5CYQA 3PR4A 4NLOA 3NNCA 5I3UB 3V2UC 4FPIA 4AUKA 5LXRA 1U49A 3CTRA 2R8IA 3Q22A 8ATCB 2Y8WA 4UOHA 4JYAF 2DGOA 2XYPB 1RSCA 1YIJS 2PSZA 4ECTA 2RQKA 3IGNA 4WP8A 5DS7A 1S57A 2E7XA 2JEJA 4LUBA 3LO3A 3GZ7A 1HLWA 1WC3A 4IG0A 2WBMA 1FDNA 1QTNB 2BOAA 2PIIA 3QGPA 3RAQA 2ZOGA 2E1CA 2M7SA 5KG3A 1U1QA 1SI9A 3IBCB 2XQCA 4Q7AA 2LP4A 4HDGA 1N36J 3K0JA 2B8QA 3UI3A 3ZTSA 2IM1A 2HGLA 3VZHA 1R7IA 1RCXB 4HDHA 3MFIA 4EZ6A 5F0WA 2DIUA 2QFIA 3G2XA 2E1RA 4K7QA 1RDRA 1LWEA 2ACMA 3G82B 3IM9A 3NLCA 3QWPA 4NE9C 3SCIE 4DV7F 4B9LA 1JXEA 2XMVA 4QQBA 4JI3J 4BC9A 1TU0B 5KFBA 5LMNF 4QWBA 1BQNB 3DNCA 4I56A 5JVHQ 2CQDA 3DRRA 1R31A 2XTJP 3AB4B 3E3XA 5E3QA 1IR2A 3T6BA 4NA2A 4ZIVA 2VC1A 2PEHA 3MAHA 2QLXA 1NK5A 2PI4A 2VFRA 2E9TA 3IFEA 1PCAA 4OZNA 1FNXH 4M95A 3KUHA 3NBPA 4QYZJ 3CJTA 1IBKJ 2XNQA 1PAUB 4ENOA 5AXKA 4QWDA 1GTEA 2NCKL 3RJMB 1JXVA 2I38A 3SFUA 4A8XA 2AQ4A 3MF5A 1FRJA 4RNHA 1YI2S 3VVTA 4HI2A 4EYIB 4DG1A 3CDEA 4AYBD 1KTQA 1HNVA 2AYMA 1WG1A 3R5AA 2MZQA 3M2VB 3UW1A 1AUSL 1RU2A 4KC5A 3I5AA 3CMES 1JXLA 3FEXB 4K4ZA 1VQ5S 1YLXA 1SJFA 4DEZA 2J76E 2B5JB 2LEAA 3JSYA 3N6LA 3GCXP 4MYTA 3GIRA 4WE1B 2W01A 3ZXWA 2JOQA 5BR8J 2ZH3A 1N56A 1DQ8A 3TRGA 4R5PA 3KLEB 1C4AA 4GO5X 4ZLNA 4X2BA 3O5TB 3M9OB 1RHKB 3BEGB 4IG3B 4X62F 3QGHA 5ITHA 1N4LA 2JEGA 2BRKA 3WC2A 1XN9A 3DRXA 3GQCA 1BQMB 4Y34A 2EFPA 3BSAA 5A6WA 1ZTWA 2KXHA 2Z2MA 3G6ES 1SL2A 4DU8A 2DGXA 2C2ZB 3CO9A 2ALYB 2JLEA 2W7PA 3HT0A 1RHUB 2AJ4A 4CH1A 4DR6J 1WTFA 3KLIA 2PFFB 4JI6F 4AE5A 1WACA 2R7OA 4I64A 3GSIA 4JBCA 4X65F 2NYIA 1P1LA 2RMLA 4OMFG 4A8WA 5E3PA 1M1GA 3PIPQ 1K1SA 3HVTB 4MIWA 3H5SA 4M5DA 1U2CA 3KLHA 1EQ0A 2ZH4A 4OX7A
chains in the Genus database with same CATH topology
2B4VA 1FNMA 5B0EA 4URQU 4DR3F 5F9NA 2J9DA 3C8YA 1LOUA 2ACYA 4RLEA 3HVWA 1A6LA 3MECA 4BWMA 1CQMA 3T6JA 4BDPA 1J5EF 3MXHP 3K5PA 4ATNA 1S6PB 4DMZA 2BABA 2XMKA 1BGXT 4DSFA 5DGBA 1DTTB 1FRMA 3CCRS 4JI3F 2XNRA 5F8NA 1JLGA 2I1RA 2MMYA 2B56A 5KAKA 4R25A 2OPQB 2UV8G 2D3OR 2VA3A 4DQSA 1X7VA 1HW8A 1YJVA 2GQ2A 2XMJA 4TY8A 1HBOA 1N36F 4NCAA 3M05A 4DL6A 2ERRA 2QEXS 2RE1A 1LK7A 3D1OA 1YJNS 3S7RA 2CPIA 1UWBA 4ID5A 2R7XA 1IJFB 2ROPA 1NO8A 4IFYB 4DHVA 1NKBA 5KFTA 3OL7A 4ED3A 4HH0A 3QWUA 4C8ZA 3T9ZA 2LVWA 4D3HA 3G6VA 2VL1A 3MR2A 4CT9A 1H38A 2J6TA 3EX7B 2M8HA 2PO4A 1N34F 4IH5A 2LU1A 4JI4F 2PMHA 3UD3P 2CPYA 3M2RA 3I0RB 1VIXA 2UV8A 3M8QB 3TVZA 3AQPA 1FF2A 2CQPA 3IAS9 5F8MA 4BBYA 3DOKA 3NKYA 2YTCA 3SQGB 1KLMB 1L3UA 5F8GA 5I4MA 2ZE2A 1R8BA 2GO8A 5C42B 3G8SA 3BSOA 3CD7A 2AYBA 3LH2S 1Z1ZA 2EFOA 3BR8A 3NGDA 1SKRA 2VBXA 2VQFF 2OPPB 3LP2A 1HBUB 4NRUA 3AA8A 4C11A 3AJ2A 4YHHF 4ZVGA 5H9EJ 1SKSA 2HHVA 3PIOQ 1HI1A 1M5HA 2BXJA 4PG6A 3R5DA 1OPZA 4FVCA 3M8SA 3UCZP 1U1MA 4LFAF 2J8AA 3RU0A 2NREA 3GFHA 4CNZA 1LWCB 3CIMA 2UXCF 2WB1D 2J0WA 2C3UA 3THPA 4R5PB 3KLEA 3E51A 4WZMA 2WONB 1TKTA 1TKTB 4EBEA 2QA4S 4DFJA 2E66A 1JLBB 3I31A 2ZBIA 4M8LA 3JAMY 2HHHF 1FHTA 2P6SA 2DNRA 4HH1A 3Q23A 1T05B 3PKYA 1NK8A 3G96A 1NH8A 3D0HE 5KFXA 2J0SD 4OZ5A 2IA6A 1S7HA 2O1PA 2YX4A 4ZDNA 3BN4A 4FZVA 3J7YU 3FQKA 5T41A 4FF3A 3SCJE 2RJZA 4DL3A 5A6PA 3KG1A 2KT3A 1X4EA 3GFYA 4MK8A 3EZUA 5IT4A 2YWGA 4F3MA 5IM0B 1JNZB 1HW9A 4OJHA 5DO2A 5KFZA 3OR2A 4B08A 5CYJA 1HL6A 1G6BA 2JLGA 4IFVA 5DGAA 4DX8H 4KTQA 3KK2B 5IS2A 3WBZA 3FSYA 1OIAA 4OHZA 4X84A 4DQRA 3UD4P 2DR9A 4WZQA 4ED1A 3DOKB 1VRTA 1FJEB 3MTJA 3BGLA 2KG1A 4NPOA 5I3PA 5KT6A 4DUYF 1HBNB 2OPPA 3MPVA 3O8WA 4PG7A 1UAWA 2IVYA 5HBMA 1I94F 2RILA 2V4JB 5H1SV 1KS2A 3T1YF 2F1FA 3MR3A 2UUAF 2VG7B 3DLHA 2OO4A 1RT6B 1RTIB 4R8UB 2WAQD 2BW2A 1FESA 5D4PA 4XPEA 3EYZA 5CD4H 4ZPWR 3PEHA 5CH7B 4CO1A 2ZH9A 4NXNF 4TKTA 5KFJA 3W2WB 4XPCA 2GO9A 3TO8A 3MPWA 1REVA 3UFCX 3ZZTA 3UCGA 1RTDA 2E9RX 3FEZA 3OFHA 3Q8PB 2B7CB 3HLUA 3O6QA 2LEBA 4RNOA 1NB7A 2K8GA 3NNHA 4F25A 3NCPA 2X1BA 2BR0A 1CEZA 1FXDA 2CQ2A 5DM7Q 1RT5A 3D1HA 3OXGA 1UVNA 1HFEL 2A3JA 2IFXA 5HO4A 1IXKA 5F8IA 5GAHI 4FYDA 5A0YB 3CIZA 3D2WA 3BO4A 3MM9B 3PRDA 3DHWC 4ICLB 5D77A 2W9CB 2BJEA 4FS2A 4WFNQ 1EETA 3GG0A 4C8LA 5HMYA 5KOXA 4PG4A 2AV5A 3K8VA 1UVLA 3MM7B 4DR7F 3PY8A 2VZ9A 2IHR1 2KT2A 3LF0A 4JI5F 2NPFA 4GO7X 2HHQA 4G1PA 1S6PA 4PRFA 3I5BA 3IC1A 4DR1F 1JLBA 1VRTB 2XLJA 1RKJA 1L3KA 2ABYA 1RT7A 5C5JA 4C0HA 3OUYA 4RBTA 4DOZA 5DG9A 4DWIA 3VQTA 3JSMB 3CCES 3PW7A 4KE5A 4KT0C 1FKAF 5C25B 3N0VA 3PKMA 3D0IE 1D1UA 1FKOB 1TL5A 2KFYA 2O67A 3KK3B 4OHVA 4CO2A 1TVRA 2A2DA 4UW2A 4TU9A 2DGQA 2HS4A 2APOA 4ZCKA 2HMIA 2DNHA 4TU7A 3KHLA 2CIMA 2JX2A 1DLOA 1MU2A 3HHLA 1SKWA 2ZFHA 3HZGA 1FDAA 1RA6A 1MMDA 3KHGA 3EZ5A 3IAM9 4ECUA 1Y7PA 5B0FA 1HI8A 2MSTA 2J9DE 4Y2AA 4OI2A 1H2TZ 3EGNA 1HBMB 1KLNA 4I2QA 4KIAA 4XO0A 3I9V9 3LAKA 2DHGA 1HPZA 1VOMA 3M9MB 1OQ6A 2VFTA 2DIVA 2M8DB 1NJWA 1WNEA 3B82A 3ZZRA 1RT4A 4I2PB 3W3SA 3CD0A 4P6QA 5HMXA 3HHNB 1ZBTA 2KO1A 5B0DA 3IGVA 4Q43A 1WF1A 4WKYA 2FDNA 4A4JA 3VALA 4DS5A 4DL0C 1UA1A 2OFHX 4IR1A 3KNAA 2OH2A 2CZVC 3QJJA 2GHWA 2ZD1A 2V5HG 4LF4F 3M4XA 3ZZUA 2FVQA 4LQ3A 3V6DA 1V6HA 1XWLA 3N9UC 1VK3A 4H4KC 2OPQA 2DPIA 2MQMA 3M8PA 5L1LA 3SFGA 1SV5A 1NHUA 2HWHA 4O3SA 2WW8A 4GC6A 2W4PA 1KRPA 2HRYA 4ES3A 3KOAA 1S4FA 2CPJA 4ZCLA 4MAKA 2I5JB 3UR3C 3UWTA 2I2YA 2ZBCA 3M30A 1IKXB 3ZZPA 1IQTA 5J2PB 3T5HA 2F8MA 3N01A 1TZ0A 1JLQA 2DVIA 1BQXA 1VQKS 5M2RA 5SUHA 4G3IA 4C9DA 1K0VA 3CCQS 1NJIT 1J5OA 3CDWA 1E6VB 2Q3PA 1JJ2R 2Y1IA 1W25A 4X4SA 1NJYA 2VV5A 2YKNB 3VWSA 2DPJA 4N8OA 3W7BA 3C46A 1OSCA 4Y2KA 6FDRA 2LMIA 2XHWA 1T03B 3IWNC 5J2QA 1HBOB 1TL4A 3CC4S 1QSYA 3TVYA 4IKAA 2NPIA 3KK2A 2D9PA 4B3MF 1GXTA 2P9EA 4IH7A 1JLGB 2DITA 1F5CA 1QLNA 4QBUA 4JOUA 2XI2A 4KFBA 2W9BB 2FVSA 3BQ0A 1FE0A 3S8SA 1VQMS 2VOPA 2DR8A 3MMCB 1BLUA 3B78A 3KK1A 2C3MA 1QE1B 1QE1A 2E1AA 2IM2A 5BJRA 2R8HA 4J9NA 1C1BA 4H4MA 4JI1F 4UY85 3BGRB 3CJ4A 2XO7A 1T02A 3DGPA 2L9WA 3OSPA 2IBKA 1QVFR 1FTCA 5DG8A 1TV6A 2WTFA 3KG4A 4AXIA 1JKHB 3PJXA 4QWEA 4JV1A 3PM9A 4DUZF 4N41A 2F8HA 3OPKA 1H98A 2E9ZA 2MJUA 3SI8A 1GX6A 1KSPA 2D9OA 2ZJPQ 2WB4A 5HROB 3MPYA 3IRWP 2ZH1A 3CDBA 1UVIA 4F4WA 1O8BA 2RQCA 1ZZFA 4ZP9A 4NCGB 5EWFA 3I0SB 3C3LA 1V3ZA 5AXLA 2HNYB 5HI7A 1OPIA 4NXMF 4Q8FA 2IJNA 2HVIA 3DMJB 4NL5A 4KV8B 4TNOA 3KHHA 1B0TA 1UEVA 4IOAQ 2OMOA 2P5VA 2P9GA 1RTJB 4ECZA 2FLNA 1YITS 2N4CA 3IR5B 2HIQA 2JSXA 4NRTA 2NQPA 4Q0BA 4DV3F 2LU2A 4U6PA 4DN9A 2CPEA 2XB2D 1Q8IA 3I4HX 5J1NA 2W8LA 2KG0A 4WFBQ 1DFDA 3PX0A 4EU0A 1JJHA 2WK4A 2FJAB 2I0XA 3F44A 2BQRA 5K5MA 2ZH7A 3MM8B 2VKZG 5KFHA 4IFYA 4OI3A 3MMAA 1UWBB 2YWHA 5HP1A 4AL5A 4MKBA 2HQIA 2ASJA 2ZUGA 2BRLA 1JX4A 2FHKA 2BM1A 1SV5B 1M5KC 1S1XA 4WK3A 1FXRA 2CVEA 2XS7A 2VUGA 4IQXA 3MFHA 5E33A 4Y28C 1N5YB 1N5YA 4ECSA 4ELTA 5L1JA 2XWYA 5KFSA 3NL0A 4P7VA 2AF6A 1N6QA 3MI7X 4NA3A 4NLPA 3CT9A 1UVJA 5KFRA 3CJ5A 2COLA 2RS2A 2DRAA 3GYXB 3CD5A 1SJ4P 4OHXA 2WRMA 2XCAA 2FGCA 2DNLA 2UUBF 4FF4A 3PX6A 3FJ2A 1X4GA 1ZPVA 1H0HB 2WOMB 2DNMA 4M63A 5I3UA 3N4WA 2Q6CA 3RAXA 5M2UA 1TV6B 1VQ8S 2HRUA 2GJ2A 2G4BA 2AU0A 1FK9A 5F0UA 3HVTA 4PKDB 2N3LA 2KJWA 5GAEI 1OQ3A 4NZ6A 4DR2F 1S48A 2KYXA 3ZZYA 3TARA 4K4YA 3HFKA 4NA1A 2LXUA 4PWUA 4PXDA 5KFAA 4RW9B 5F8JA 1YJRA 2DH9A 4KV8A 3VTIA 2YNIA 3THVA 3SMZA 1S79A 3FFIA 4ILRA 3OHAA 3MHYA 4FBTA 2EPIA 2LECA 3OJUA 3KNGA 2DISA 1TKXB 1JLFA 1S0NA 2NSBA 2JL9A 2V8DA 2XLIA 2B6AB 3R1HA 1OSDA 5HLFB 1X5SA 2B9YA 3QIPB 2FVPA 4EBDA 2Z0GA 3B8HA 1U47A 1B64A 4CQ1A 1TVRB 3FNNA 3CCTA 5AE3A 3M32B 4CZCA 2ALZA 5GMKa 2XSFA 5CXTA 1JLFB 2DR5A 3DLLQ 3WDOA 2HNDA 4RBVA 3I96A 2UXDF 2RH3A 4BWJA 5I42B 1Z4UA 3DU5A 1T05A 3IA0A 5T7LB 4R0JA 4TQRA 2RB7A 3I6PA 4NLGA 1ZOTA 1FJCA 3FMWA 3MM9A 1S10A 2DGWA 4DSJA 3THTA 2AX1A 4HKQA 1RYRA 5CYMB 4J9OA 4DV4F 3Q8SB 4LJMA 4NYZA 5KG5A 3M2RB 1JIHA 2A10A 2BE2A 3ZZZA 3RBEA 3DOMA 1YTYA 1MROB 1Q86T 2Z8QA 3D1QA 2GA7A 2GW8A 1H2UX 1LWEB 3U1NA 3CD6S 1IBLF 4ZP6A 4TLQA 2J0XA 2BACA 3ITHB 4O4RA 1N0UA 1KEKA 1YJTA 1CC8A 4QCLA 1S6UA 4QIFA 4RWWA 1XMQF 2MZJA 1VFJA 4MJKA 4F3QA 3F56A 5B0GA 1TKDA 2GIQA 3CPWR 3TP2A 2R8GA 4C3KA 1S9EB 1IJEB 1HYSB 1TAUA 2YWFA 3HMJG 2JZ5A 4WXOA 2C3OA 4KSEB 2ZH2A 1Y5LB 4DF8A 4ERDA 3DLGB 4I6AA 2IYIA 4ZS6A 3UDLA 1HI0P 1LFPA 4CNYA 3BO3A 3DC2A 3I87A 2E1MC 1L5UA 1FT8A 4IYQA 2AD9A 2ZHAA 1FVSA 1GTHA 2ZKTA 4CH7A 4TQSA 1C4CA 5DETA 5GAEU 1S99A 1X9SA 3GMGA 3GV8B 2Q6BA 2BQ3A 2HNZA 4RW7B 2IAJB 1LW2B 2DRBA 1GNKA 1OS5A 1R89A 2VKRA 2G0CA 3HKZD 2DJWA 1J2VA 1IKWA 2E29A 4DL7A 3BGUA 4DQPA 4EO8A 2W9AA 2HHXA 2YNFA 2RDJA 2EFVA 1T94A 5IZHA 5KFCA 1RAJA 2HNYA 4OX6A 3DM2A 4WU2A 4QIWD 3TW0A 3UCUP 2FJEB 1JK9B 4HT5A 4EGLA 4QWCA 1RT4B 2XY5A 1V3SA 1XMBA 2KXFA 2ZKUA 3I5CA 3BN7A 3HVRA 2XCPA 1UVMA 2DGTA 4W90B 3CC7S 3V4IB 3OR2B 3ENQA 4B9TA 2DT9A 3A8EA 4LQ9A 2IYGA 3RRGA 5IM0A 3SV3A 4K4SA 2KRRA 4RW6A 4QJVA 3HP6A 2H9ZA 2AW0A 1JLCB 5KFNA 5D4LA 4Z2XA 4ZK7M 3H40A 1LQ9A 5DDPC 2OSQA 3GIKA 5DG7A 2C2RA 2XWXA 3JTOA 3IRXB 1RJJA 4Q44A 3DLEB 1Q82T 3PV8A 2XEXA 2W9BA 1QM9A 4DLGA 1I1GA 3KWMA 3KLVA 1Y9OA 1N5QA 1HQEB 2CQIA 2QV6A 4UOCA 5E41A 4JI7F 4ZHRA 2DHSA 2Y1RI 2F40A 3HK2A 1UP1A 2HHWA 3TAMA 4OZJA 4DR5F 1FKPB 3MOZA 2NR0A 3DFEA 3HZEA 5K14A 3D28A 5CZVA 1IBMF 5KFPA 4IUFA 1N6QB 3OVAA 1E6VA 3OXFA 3AQOA 3N5FA 2VFVA 1U2FA 4DSLA 3LP1B 1JLQB 2XMTA 3NAHA 4UY8T 4O4GA 3CWJA 4O3RA 2OTLS 3BDEA 5CCMA 4RU9A 4YB6A 2YH0A 3EXYA 2KXNB 2MB0B 4FN5A 4UQGA 5HMZA 5KTQA 3HM9A 5KG1A 2NLWA 3K5OA 3AAWB 2D7SA 2HVZA 4B17A 3BM7A 4LIRA 5IT0A 1HBUA 4CH0S 1Q7LB 2F9JA 4NMLA 5FD1A 5L9NA 1X9MA 3OTEA 2XMWA 3HHKA 1FK9B 1S0OA 4UUWA 3UNGC 3DOLB 5L1KA 4GC7A 4YQWA 1D0EA 4G6VB 5BYSA 2ZJRQ 1H7XA 1V3RA 1RK8A 1UJ4A 4ID8A 1VQSA 2GHPA 2K3KA 5HMWA 2ZDOA 4WKRA 3S1TA 5FIIA 5J1EA 1A7GE 4AQYF 3MCSA 4ZCIA 3P5TL 4IDKB 2B51A 5E7OB 5KFIA 4PWDB 1JLEA 1S1WA 4N8NA 2M70A 2RQ4A 3I4PA 3H4DA 1HNIB 4ECRA 1QSLA 1LXNA 4LSLA 2K7KA 3BF4A 4KO0B 4KO0A 2AYGA 5IXUA 4F02A 1G1XA 1DTQB 2L9DA 2QSFA