3TA3C

Structure of the mouse cd1d-glc-dag-s2-inkt tcr complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
203
structure length
202
Chain Sequence
TQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Unique Interplay between Sugar and Lipid in Determining the Antigenic Potency of Bacterial Antigens for NKT Cells.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 45
structure length 202
sequence length 203
ec nomenclature
pdb deposition date 2011-08-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ta3C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ta3C02
1UKSA 4M7LT 2QKIB 4XMKL 5SWZE 3WSQH 2OZ4A 3WIIL 4QRUB 1EXUB 5I71B 1DUZB 2X4UA 3HZMB 2ZUQB 4HUUB 2GJZA 2X4RA 4ZAKD 4RMVA 3FQNA 4L5FL 1Q9KB 5IW1B 1RULH 1RJZB 3UPRA 2WQRA 2IGFH 5C07A 4Z18A 2IQAA 3HFML 2CIIB 4DGIH 2MKLC 2MCPL 3SGKC 5AWNH 1E27A 2PW1B 2JJSC 4QXUH 2QJDA 1U8LA 2A77L 2L7JA 3OAZK 2CRMA 4UB0H 2DLTA 3BPCA 4TRPH 1YMMB 3QUYB 2P4AB 3TCLA 1MSPA 4D0DB 5JXAL 4PJBA 1OM3H 4L3EE 3MJ9L 1QFWL 3P9MA 4PJIF 1CXKA 4AG4H 5J9PA 4GXUM 4LLAA 4TUJA 4FTVA 1SMAA 3V52H 4P4RB 3VGBA 4HJ0D 4OF3A 3U1SH 4C4KO 1YECH 5E08L 4CN1A 2KQMA 5DK0B 5EFIA 5C0GB 4X9IA 4WI5A 4RGMC 5C08B 4KK8D 3J8F7 2G60L 2R1WB 4MXVF 2DMKA 3GK8H 2UZXB 1EHNA 5C07D 1PZ5B 3ESUF 2ESVE 3MNWB 5HGBB 5C8JB 3BP4A 4HIEA 3W9DB 4A6YA 1YYLL 3O3DA 5FHAL 1IBGH 1S8DA 1B4RA 2VXVH 5AG8A 4NP4L 3UC0L 2PYEE 2FX7H 5TDPB 3SO5A 4KROB 3JWOC 2X4OB 3OPZH 4G9DA 4EDXA 4FTVD 2CO6B 5I8OL 3VDAA 1I9EA 5IFJB 4K7PY 1ADQH 2VXSL 4J6RL 4AL8L 4PRPE 1I4FB 1J0ZA 3LSOB 2ICEB 3MUHL 2VTFA 1FBIH 1H9VA 2E7BA 5EOCL 3HNSL 3DX8A 3PP3K 1UXWB 4L8SA 1JFQH 4P2RB 4ZO6A 2N1KA 3WNKA 1G7MA 3CK0H 5GRJL 1IGIH 4HBCL 4MMXC 4XPBH 4BQBA 3Q5YA 2JCCE 3SCMC 5D7SL 1QR4A 1QSEB 5KVMC 2BSSA 3A6BL 5ESQA 3H9HB 3CH1B 2QEJA 4DW2H 4CAGA 4DUWA 3W0WE 4OZFA 1BFTA 5EZLB 5TFSH 2VWEE 1JPSL 3LV3A 4NM4L 5I16A 1U8JA 3HAEH 5A2KH 3ECBA 3L1OL 5FHBH 3EO1B 3WL9A 4XVSH 1VADB 1B6UA 4EBQH 4EN3D 1AJ7H 3GRWH 1ZLWH 4EQ3A 2MHAB 4QOKB 4C56A 3V5DB 4TPRH 2BMKB 2XWJB 2X4QA 3LN4B 4K7FA 1S7SA 4P2CG 4QTIL 4ZFGH 3OJMB 3OR7B 1XZ0B 4GRWE 1CTNA 4LSVH 1GVIA 4X7DC 4KK5C 4WENB 1MCWW 4FQLH 4LLUA 5GS0L 1T3FB 1IGFL 2Y72A 3GI8H 5JW5A 4WI8A 3D25A 2D7QA 4LLWA 4K3HA 3UTQB 4TVPD 3TEUA 5DK2B 2AJSL 4WUUA 3SCMA 5IIEA 3LQAL 2JE8A 3P30L 1EDQA 4OCYL 3LIZH 3ULSB 5HI5D 3D69A 3CZFA 1MY5A 3QXAB 3C2AH 4PB0H 1N2RB 5HHVL 1ZEAH 4YHOL 2VE6A 1T0NA 2A74B 2YD1A 5FYLH 4MYWB 3KPPA 2ZP0T 3FB7A 3PWPE 3FOMB 5A1AA 3BO8B 1J12A 1VFMA 5IMMA 2V2WA 4EVNB 2Z4QB 1Q94A 1DQLL 4JHWH 3WIFA 1DJSA 1ITBB 3O3AB 2EXWD 2I5YL 4NQEA 4OLUL 3WHE0 4TNVF 5IMLB 2J8UF 4LSRL 4PJ7A 4JM2C 4JLRA 4C56D 4LRNL 5IUSA 4EIGB 4QHMB 1T21B 3ULUD 4MS8C 1RIVH 3AS1A 1XCTA 4MB4A 5F96L 1IZKA 4M00A 4J2XA 3O3EB 1CI5A 3RZCA 2OL3B 4XAKD 2KZ1B 1NBYA 1AGFA 1F6LL 5LBSL 1A1OA 3NIFF 3I3DA 4WUUD 2CLZB 2F53B 5DHVA 3TPUB 4M8VA 1U93A 2WUCL 4D9QD 2DM2A 4X4YA 3MGTB 3CU7A 3VH8G 1KJ3H 1MWAH 3K3QA 3WO3B 1T7WA 4ZFZA 1LE9B 4MD5A 5E8EB 1NC4D 4LIQE 3RPIA 4Y2DC 4N9OB 1R3IL 2VISA 2IMMA 1UB5B 3S4SB 3TIDB 1AI1L 4IIQB 5CCKH 1KF9B 4PRIB 5C0EB 5ISZE 1BMGA 1NAML 4HW6A 1B0RB 3ARDB 3T04D 3VI3E 4Z7UA 5D2LE 3NCJL 3ZTNH 5M94B 3TVMB 1I7ZA 4Z0BH 4G8GD 5EC1B 1U3HA 3THML 3D85A 4HK0A 5F21B 2H9GB 1W0WB 3L7EB 3D9AH 2RCSL 3RZCD 1NAKL 2B20A 2I9LA 4YJZL 2F9BT 5SWZB 3ZL4H 5CILL 5TDOA 1F3DH 5EBGA 5FV2A 1HHIA 4V2BA 3QIBD 2UV3A 5ID1B 4XP5H 3GM8A 2OXHA 1HQ4B 1JPTH 4JRYA 1I3RB 1YEIH 3RX5A 3NFNB 3QEUB 4RGNE 3WE6A 1AP2B 4WFHD 3NACH 2CPCA 4NGHH 1HQRA 4RMQA 1HOCA 1G6VK 2NY4B 2DRUA 2R15A 1T0MB 2B5IB 3MREB 3SDYL 3NCMA 2J8UE 5IJKA 1UQSB 4MAUH 4GOSA 3MV8A 4IRJC 1VFBB 2NNAB 5HHOA 1U3HD 4O2CB 3D85D 1T22B 2DQEL 2A6DB 2JELL 5F3HA 2BRQA 1UT9A 2BOCA 5LXGH 4G6FD 3T4AB 2GTZA 1PYWB 2VLKD 5I73B 4XH2A 4M6NL 4P2QA 4DGVL 2B8OT 1A02N 1EIBA 4OCNC 4ZO9A 4Q9QH 2KZWA 3MJ7A 5JW3L 2VXQH 3KHQA 2R39A 3X13A 1ZT1A 3QISA 2HFEB 1FZJA 1EERB 4X6BB 4U6XB 3LZFL 4TUKH 1T5XA 2BRRH 5HHME 3PQYB 2VLJE 2XN9A 2BCKA 3O8XB 3LEVH 1S3KL 3ZKMD 3W5MA 3WLWC 3WO4B 1VESA 3C6LA 1KGCE 4KMLB 1Q9LB 2B2XL 4LSQL 4F7EA 1DBAH 3SKOB 2BXZA 2ESVB 5C09D 1G84A 1BQSA 1YN6A 4R97C 4F9PA 3KPMB 3MLVL 1BIIA 3UJIH 1PLGL 4LPCA 4OZHA 3M8OH 3QCVH 1MIEH 3DXAB 4XHJD 3MV8D 5LGHH 2HKFH 4HS3B 4M62L 5C7XH 5C0CB 1FIGH 5HHOD 5C6TH 4JM4L 5TGBA 5I18H 3TFKD 1FNHA 1Z5LB 3FFDA 4I5BB 1KULA 3Q48A 3QDMA 2NXYC 1RHHA 4P2QD 1LWRA 3KPNA 3MRCB 3LDBC 3B3IA 4M4RA 5A43C 4PJGA 5CHNA 1GGTA 5DYOB 4HUVB 4M03A 4B7LA 3WKML 1FL6A 2JB5H 3SDDA 5BRZE 1KPUB 1EFXB 1TZHA 2F58H 1DSFL 3ZMRA 2XN9D 4GLRI 4OUUB 4I18A 2HTLC 3KG5A 1AHWC 4HCRH 4CDHA 2DM4A 4FZ8L 3L3DB 3WFHB 1ADQA 5D1XA 3C6LD 1IKFL 4MLSA 4ELMA 1P4BL 5ANME 3GDBA 1X4XA 3QXDB 3EUUA 1FGNL 3MGOA 5FV1L 2FHFA 1LP9F 1DQTA 1ETZB 5D96B 1QNZL 1TTFA 4I13B 5JIKA 4ZFOL 2DN7A 2E6QA 3ROLB 1FHGA 5FGSA 2FX8H 2YSSA 5HYIA 4LLYB 3QDMD 4PJIB 2XXCB 5T3XH 2NTSP 2D9CA 1MLBB 2KBGA 3QI9B 5FECA 3NCEB 5C2BH 1VENA 6FABL 3T0EE 3I84A 3JV6B 3SDDD 3HAEA 5D1QB 5MEPA 4MAYD 3T1WA 2A9NH 4U1SB 1WZKA 3K74B 4OQTA 1LDSA 3D18A 5EPMA 5D1XD 4CVZB 1BQUA 2J4WH 4W70A 1CFVL 1DQDH 3S37X 2APXA 1NMAL 1NMBL 3MRMA 1Y18B 4XNQB 3VDBA 2XY2A 3FO1A 1CF8L 1J9CT 2PUQT 5CEZD 2D7OA 4PJ5B 1VB9A 2OS7A 3JV4A 2ADFL 4QYOA 2K9UA 1D5BA 4D3CL 5GZND 3LQZB 3BDBA 4J23A 3I3BA 4XPTL 2QADD 3R06B 4XBEL 1NFIB 2EH7L 4JQIL 3LHPH 5JA9A 3VD3A 3K7UA 1FN4A 5DJAA 3KYKL 5IGXH 4UUJB 1Q0YH 1U8IB 4JY4A 4V1DA 1JHKL 1IC4H 4ZPVB 3IDYB 1Q0XH 1XGRA 2VDRH 4HUNB 4P4KB 3ZKSD 4G6AC 4AENB 2EIZA 5F9WC 5DTFA 1IAKB 4MNQD 3FRUB 4BZ1H 4F7MB 1ZLUH 5IQ7L 4JKPH 4HLJA 1U92A 3OKEA 5BV7H 1H3TA 1CLOH 2YPLE 4I9WE 3RWDA 4LCYA 4P23C 3MOBL 1S78D 3FFCA 1E4WH 1YMHB 2R0KH 1JL8A 5H2BA 3UBXB 3G04A 4FQCL 1IAIH 5GHWH 3W9EB 1JPGA 2V5MA 2IALA 2DL9A 5DLML 2J5LC 1YEKH 4XBPB 4Q6IC 4EI5D 1NGQH 3MR9B 1MWAA 3QEHB 4JFZL 4LFHD 4RZCB 1P4IH 3KLSA 2FSEB 1TZIB 1JF1A 4MQTB 2D2OA 3CSBA 5DMIL 2ATKA 4H25B 4XNYH 4CN6A 4F33B 5DJXB 4R2GD 2M8XA 3C08L 3N9GL 1BOGB 3H0TB 2HFGH 4NQCD 2YA2A 5GIRB 1RUAH 3X14B 3LQMA 1BX2B 4NCDA 3C8HA 4P23A 4NC2B 2VDML 5CD3B 2HT3D 3QRGH 5D8JL 4PJDF 4GAFB 4YPGA 2IWGA 3FFCD 4QXGL 1QSFE 1M05B 3MV01 3EDEA 2X1XR 1RZJL 3O41B 1A21A 2D9QB 1WICA 4JDTL 1HSBA 4Q6IA 4NKIH 1J05A 3DETD 1JUFA 4Q74A 4UQ2B 2H8PA 3O45A 3B4NA 4CMHC 4MGXA 4G7YL 5SWQA 2BOBB 2H2SD 4LVOB 4NNXA 1DE4B 1FCCA 3UROR 3EYSH 4MHHI 3OB0H 1CD1A 4J8RB 1RZ8B 4XPFL 3RIAK 1ED3A 2C3VA 1KNOB 3L3JA 4XNMA 3DVNB 4M5YH 2HJLA 1EHAA 4WNQA 2DIBA 4L9LC 3QCTH 3EYQC 3PV7A 3OJDB 5F9JA 4DKFL 3Q3GA 3BPLB 1P6FA 4XTRD 1EJOH 4XPGH 3MROA 1LO5B 4WU7A 4UDTB 5HHMB 3QJHB 4JFPB 2VLJB 2VYRE 4OAWB 4EQ2A 1BEYH 1EEYA 1LO4L 3FMGH 4KMQA 1FNLA 2CR6A 5E2UH 1XF1A 4PJXF 1W2KT 1PDKA 2NY3C 5HHPA 2PCPA 1ZGLB 2IADA 5ADOL 2VDNH 2VRAA 3N1MC 4MA3A 4X6CF 2AEIT 4H88L 3V6ZB 1JNNL 3DRQA 4GQ9H 2R69H 3LRGA 3QEGL 3C9NB 1T83A 3SO3B 3UTOA 3VFNA 5IB1B 4OCSH 4L9LA 2VSDA 3LEYL 5HJ3B 1J88A 1UYWL 1WAAF 1MRDL 4OCRH 2VZ3A 1L0YA 3IFLH 3MV7A 2Z91A 2YPKB 3FTGB 1YEGL 2ZCKH 4OTXL 1KACB 3SE4A 5E95B 4PJDE 3QPQC 5DDHA 4Y1AE 3BN3B 1ZA6B 1OSPL 3AXLA 4NRYA 4YFLI 2AJXL 3V4UL 2A1WL 2F19H 3BE1L 3B2VH 1FL5B 3QUKA 4P5TC 4OCWH 4QEGA 5GRZA 4B5EA 3RHWF 2ZJSL 4YWGL 5ANMB 1ZVYA 1GGIH 1VFOA 3FQTA 4JHAL 4FQHA 3VWKB 3IFNH 5AYUL 4HCRA 1XF3A 1MPAL 1ORSA 3B9KC 5C1MB 1FO0L 3BH9A 3PE9A 5IJVA 3O2WH 2ADJB 4W6YB 1BZ7B 1F6AA 4KXZH 5AD0A 3ULUL 1KENL 3VXMB 3MRJA 3MV7D 2Z8VC 3ARBC 4OB5H 3U36A 3RY6C 1F6FB 2W0PA 4X80L 4L9DA 4YHYC 5KANI 3UTTE 1DANU 2AABH 4AEHH 1ACYL 1AO7E 2V7HB 4D0BA 1NBZB 5DUML 5FYKU 1FL3B 1FVDA 2BHUA 5DMJB 4CRPA 1ULVA 1FNAA 5ADPL 2A9MH 1RIUH 4RRPA 2DQTH 5EC2A 3KPLA 4P5TA 2VLRE 2CQVA 4F57H 1D5MA 3X3FH 3CFEA 1I3GH 1BBDH 1PG7H 4MVBD 4AEIL 2XZAL 1JYWA 1U3YA 4LEXH 4OCMC 1U8NA 5ID0A 3P11H 2H6PA 4X6CE 3SKNB 1S7XA 3O11A 4S1RH 2PETA 5KTEH 4ODXA 5LKNA 1Y6NR 4IMKC 5K9JL 2RFXB 1LVEA 5TQ2L 5JDSB 4K94L 1LGVA 4DCQA 1CGSH 3ARXA 4AH2B 4YR6B 3BN9D 5BV7C 5E8OB 4R7DA 4PJFF 1NDMA 3GHBH 3QHTC 1Y0LB 4ZUWB 1G7IA 4M5ZH 2CRZA 1F4AA 4WFGD 3MCLL 2NYYC 2VXUL 4YDIH 3H6JA 1H8NA 1SVZA 5T3XD 5E8NA 4PR5B 3KPRB 5CKAA 1WBXB 4U0QB 5DHYB 2EDYA 2CD0A 2GT9A 1Z9SA 2CDEA 2E7HA 3BWAA 3GIZH 3VH8B 2FJHA 1LEGB 3MCKA 1NBVL 1C5DB 4LVNB 1P2CA 3MLTB 3MLSH 1B0GA 4JFYA 5GS2D 2Y5TA 3TV3L 5EO1A 1HYSC 1LP9B 5GZOD 4ONGH 3TNNA 4CW1B 1X5AA 4IOIA 5HDLA 1XR9A 4IMKA 4JRXA 4U6YA 4R4NC 2OR8A 4JFEB 4N8VA 5EOTA 3ARWA 2DL2A 4YBQD 3VXOA 4YHLL 4FZEL 3ET9F 2A0LD 2V9QA 4FFWC 5K9KB 2RAMA 2AAVA 2CJUL 1S7RB 4OFPA 3T3MF 5LGKA 2H26A 4MWFA 3SGJA 2B1AL 5DSCB 1BD2E 4S1QL 3LD8C 1KB5H 3LH2L 5IF0A 3UTSB 3SDCC 1EMTL 4HS8H 4NC1E 1PD6A 3QXUA 2IANE 2BVPA 4YIQA 2K7QA 5FOBB 4HWEL 4JFQA 1YA5A 1UM6L 4N90D 5E2TH 1A7QH 4PV9B 5I6XB 5IESH 1I9IH 5DMKA 2XWTA 5KSBE 3D3VB 5E99H 2FECL 4U6VL 3VDCA 1SYSB 2DJSA 3WUWG 5BXFA 4CADB 2DWEA 2BJML 4LHJB 5CZXC 4PV8B 1Q9WB 3MNVB 4XCYB 3CVIH 1OCWH 1GZQA 1HNGA 4YH6A 1V5JA 1PQZA 5DZLA 3AMKA 3HC0A 4J4PD 1WZMA 4M7ZB 4YDKH 4N0FA 1UZ8B 1WLHA 3BD4A 1N59A 3SDCA 1KEGL 2HJFA 2H2PC 4GAGH 3IAGC 3SE3C 2I9TB 1HHGB 5DO2C 3L7FA 1P53A 4MSWA 5FO9A 1UVQA 1V3JA 5BZDB 2R0ZH 3HZKB 3MRIB 2G2RB 1I85C 4HIXH 5FYKL 1I8MB 4FQJH 3FQUB 1VGEH 5IFHH 3W2DH 3RRQA 3E6HB 4JPIA 1I7TA 3P4MA 3R0MA 4K23H 3C60D 3HNVL 1IL1B 4KQ4H 4D94A 5HI4C 1Z9MA 5C0AE 2WNGA 1HHKB 3PXHA 4ODUA 1A6WL 3OQ3B 3VWJA 5C0JA 3W11C 3O6KH 4R96B 2NY0B 4GMTL 5CJ5A 3OL2A 5FB8B 1WIPA 4EZMA 1JN6A 3MMEA 3T3ME 2DS4A 3O4OB 1G1CA 1XF2A 1NAMB 3LS4H 5IWLC 3JBG7 3B9AA 1VHPA 5DRZB 3SDCD 3DX6A 1SYVA 2KH2B 5ITFB 4NO0A 4LDLB 3SE3A 5C0FB 3VE0B 2HT2D 3HG1B 4RQQA 3F5WB 1WBYB 5DFTA 3DPBA 5D71H 5MEQB 2XRAH 1CT8A 1W8OA 4L29A 1JHLL 1TVHA 3C5SB 4DZ8B 2M26A 4JZJC 1N4XH 1G0DA 4WGVB 4I48B 3E3QE 4CVXB 1SJVA 4TSBH 3UZQA 1FYTD 4XRCA 2YD2A 4AIXA 1T04A 4HWBH 4PJDB 5DD3H 1FJ1A 5I1CH 12E8H 1YJDL 3T4YB 3SE9H 5FYJE 3VWJD 1F5WA 4I2XE 5CMAB 2Q1EA 2XY1A 2ERJB 2B7DT 1OD9A 3DVGA 4P5KA 1I9RH 3GHEH 1JK8B 2X9XA 1QA9A 3OKKB 5CEZL 1WIOA 3MRNB 4UV4H 5BW7C 2YBRB 1G7QA 3BZFB 3G5ZA 4Z78A 1I8IA 4JANB 5IB4A 5L2KA 3GIVB 3LKNB 3DBXB 4PJ9B 2YPVL 4BH8A 4LQ1A 1NCAH 3VXSB 5LCVL 5TE7H 4UNTA 2H1PH 4M7LL 3P77A 1I8KB 2QL1A 4GKZB 4O2EB 4PFEA 4FQ1H 5I15H 2OLDA 3BKCH 1LK2B 2XNAB 1CLCA 4JFHE 4MJIE 4PLJD 1P7QA 5IVXA 3TWCL 4GW1B 4JZJA 2BZDA 3R8QA 3FO2A 3T2OA 2DQCH 4PJEA 4Z77A 3O6LL 1AY1L 1J5OL 2XV6B 2FX9L 1KTLB 5K59F 1X5ZA 1MI5A 1AD9A 3RY5A 3H2WA 4M1GH 4JY6B 2KL6A 3HTLX 4UOW1 1PX3A 4PPTA 1YEEH 4KHTH 3JWDL 4YXLH 1A8JH 1A4JA 1XF4B 4QLRA 2HT4D 4PJXB 1HH6B 5KVDL 1KB9J 3IJHA 2DB8A 3QSKB 1LDPH 1QO3A 4H1LG 5E5MB 5F6IC 5T1KD 4X6CB 5CBEB 3U0PB 4N0UB 3OX8A 4ALAL 3OBAA 4CU7A 2ATPA 5IHUH 2P7TA 4PY7A 4JN2B 2G9HA 4U33A 1S9KC 4R6UA 4X4XA 5D7IA 1N5YL 1AQKL 4GRLC 4M1CD 3T2QA 5FUZH 2VDLL 4MXQD 3SDAB 4IOFD 2V5TA 3TF7C 3MV9E 1TNMA 1DVFB 3RL2B 1AXSB 4XP4L 5J0BA 2MSPA 5ACZA 1TTGA 3HZVB 1J8HA 1C08A 4NOFA 1MI5D 3PWNA 1A9EB 3R8BB 2FIKA 2OTPA 3IXTA 1KTDA 3QJFA 5JHDA 5ITBH 4KY1L 3PJSB 5HDBF 3KXFA 4DN3H 4LVHC 2VDKH 2PO6C 2D31A 2AV1A 3GEWB 2VH5L 1NEUA 2R4SL 3MJ6A 3GSWA 1A1MA 1UGNA 4P46C 1WC7B 3DSNA 3QULB 1CFTB 1DBJH 2XXMB 5D6CB 3MUGB 1U8QA 3HI6H 3BIBX 4ZSOA 5DVMA 2JIXA 4LCUB 5T3ZE 3FB6B 4ZFOB 3HI1A 2HH0H 1GYAA 4UNUA 4UINH 4NNPL 2X4NB 1CZ8H 3FO9B 1V3KA 3VFOA 3NMEA 3PGCB 3WS3B 3L3GB 1MLCB 3QQ9C 4ODHL 2DQGL 5DGRA 5EORL 1U8OB 5SWSA 4ZNCD 1J8HD 5HHXH 1EPFA 5K59E 1Z3GL 3WUZA 4M7JL 1BOYA 3IXAA 5JHDD 3SGDI 5KSAB 43CAB 3KXFD 3Q0HA 2F8OA 3CSGA 2IANB 3Q6GL 4N0YH 3ARFC 1T7VA 1WVZA 3EYVB 5I74C 4QHKJ 3MSPA 3K4ZA 4LCCB 4U1JA 3RWFB 3T65A 1ZTXH 1KB5A 5GS1B 1EAPA 1JWMB 2A83A 1BAFL 1KCSL 2X09A 4KVNH 4NRZA 1C5CH 1ZANL 1YDPB 4R90H 2FJFB 4RFOH 4N5UA 2JIXD 2HJKA 2XA8L 1FCGA 1FNGB 1UC6A 2FHCA 4F3FB 4YAQB 5EUKA 5JW4N 2FYYB 3RVUC 4GG8A 1H3PL 4FG6D 5MEOA 4YK4B 1JNJA 2J3SA 4LFHG 4PJFB 2CR3A 1YPZE 3ZHKA 1CE6B 4OSUL 4QF1B 4JREC 4Y4FC 2DIJA 2LABA 5SWSD 2VUYA 3QG7L 2UWEF 1A7RH 3MJ8B 4GBXC 3V5KA 1JGLH 4BQ6A 4ZUSA 3X11B 1YY9D 1D9KA 2NY2C 1A3RH 3ARFA 3CDGB 1NEZG 5C9JA 4JGJA 2E9WA 4C55A 5CJQH 1E6JL 3A6CH 1HZHL 5DJ0A 3V0AC 5IMOB 5HVHC 4I77H 3U7YL 1Q72L 4M61A 3RL1B 3EOBA 3KJ6H 5CSZB 2BY0A 3OG6B 4UT6H 1PFCA 2Q8BL 5FM5O 4PJHF 3MBEC 2Y07L 3BP7A 5F9OL 1FZKB 4X5XA 1FAKT 3KYNB 3UYRL 5IK3A 4O5LH 3V6FB 3RY4A 4GG6A 4YE4H 32C2A 4YNYB 4Y4FA 4ZNEE 3QDJA 1IC7H 2LU4A 4L4VE 2OP4L 1U95A 4OLXH 3U0TB 2AI0H 4OKDA 3U2SB 5ESVB 5HBBA 1F13A 4S2SA 1OTUD 3V7AE 4CL7A 1D9KD 4HF5H 2BVOA 3QAZB 3LN5B 1DBKH 2BDNH 3IU3A 2WBJA 3VFUB 4NDMA 4LF3A 4OV5A 2FNBA 3CFJB 2CGRL 3D39B 2EICA 5C07B 4CNIA 5MI0C 4OD3L 5A16A 4W81A 3G6JF 4EXPX 1HHHA 1J1PL 3NIDF 4I2XB 3E2HB 2PXYA 4XGZB 1ZHNB 5F7KC 1ND0A 3Q6FA 1E28B 1TJGL 3GSXB 3KPSD 1U8PA 3AREC 4XMPH 2IFFL 4Y4FD 2XG4A 3QUXC 2ICWI 4HWBA 1E4KA 5F9DC 1BM3L 4KTEL 4JO2H 3VRLF 4F7TB 5J9PB 2DBLL 1CGWA 5HYJE 2UWEE 5DS8B 4KI5F 1XIWC 2X7LA 3TP4A 3I6GB 3I50H 2FGWH 3WIHL 4Z7WF 4XC1H 1XGQB 5GGVH 2EYRA 2AJVH 2FD6L 2WBJD 4Z95L 1TQBC 1MREH 3DSFH 1XH3B 4XVUC 1YQ2A 5FYKE 3V9FA 4Z7OE 2AKRA 3DMMC 3S88L 1MJ8L 3RVWD 2ITCB 4S1DD 1UWEL 4KV5E 1I1AA 5A3ID 4IMLB 5J56B 5HGDA 3IJYA 2PXYD 4NWUH 4PBWD 1RSFA 1GZPA 4OGAD 3AREA 5D5MA 3VFGL 4U0RB 5JQHC 3TESA 2HRPH 3JTSB 1IRAY 1I7RB 1OP5K 1W8NA 2VERN 1YEDB 1YNTA 2QQQA 3HMWL 1NFDA 2CRIA 4DZBA 4TTGA 4R9HA 3QUZA 4MDIB 4EN3B 4XVJL 5JOPE 4PREB 5F97E 3TBSB 5HYSA 1XF5B 5J11B 2OSLB 5FFLA 2D0HA 2YN5A 1LO3L 2WMPA 1N5AA 1CU4H 3LMJL 5EU5A 5I8KH 3G6AB 4UDUA 5GSVA 3B5GA 2PKDA 4M7KH 1YEFH 1Z9LA 1M7IA 2D4FA 7FABH 1I1AD 2Q8AL 3NIDE 4GW4B 1AGEA 3FB5A 3O3BB 2XTJE 4M6ML 3RKDD 4ZDHB 5L8KB 5L9DL 1HDMB 1ZSDB 3PNWB 4HDIA 2AXFB 1SJEA 4L3CB 2X70A 1R3KB 3GB7B 2Q7YA 3TCXA 1K4CB 4KI5E 3QUZD 3BYTA 5LG1A 2CLRA 3MXWH 4OIBA 4HX1B 4OLZH 4U31A 1FO0B 4NPYB 5LAXB 2F15A 1P1ZB 3V5HA 1WV7T 3HCVB 5DJ2B 5I17A 1V3LA 5E1AB 4Z6AT 1INEH 4WHTA 1RJLB 4RX4A 4TTDC 4PBVC 3NN8B 4PRAB 4OZIF 2NZIA 2R4RH 4WEBH 3X3GH 4PRHA 4PB9L 5HGAB 1F2XK 2NX5E 2X4PA 3C5JB 2H45A 3NZ8A 3VFSB 1AGCA 2R8SL 4Y19B 3ZE0F 2EDOA 3T2NL 1ZT7B 1QRNA 5DEGB 1EEZA 3KGRA 3ZLQC 1LK3L 1OGTA 1JCKA 1PX4A 3UTZB 3WUWB 1NC4B 4JQXC 3DUSA 3VFMA 1FLRH 2NW2A 2VN7A 3HE6A 5IOPA 1L0XA 2DQIL 1FORH 4X99A 3MPCA 5C0BD 1QEWA 4NHCH 4G8GB 1T03H 3SKMA 5FUOL 4JGUA 2NXZD 1SQ2N 1SHMA 4RX4D 4HHAB 2P24B 2ADGA 5B3JF 2PW2B 3REVA 1HI6A 4WY7H 4AYFA 4JFFB 3ULVH 4PRHD 3CH8A 2R1XA 5CJOL 1A9BB 1JGUH 5D9SA 5IKCB 4OZ4A 4DGYL 1GJIA 1A7OL 1BQLH 4WW2C 1KC5L 1PBYA 1QRND 3QIBB 4MX7B 1QFWI 2Y23A 3GJFA 4QRPE 3V0VB 2R56L 4JZOB 1NJ9B 3L3KA 1NUDA 3RPIB 4F2MB 1A5FH 3HE6D 2AJ3B 3NCCB 1R0AL 1MH5A 2VL5B 1MCSA 3IF1B 2Z8RA 4G6MH 2Y06L 5EUOE 5IT2H 5GRVK 4ACPA 3SGEH 3PHQA 3QNZB 4JVWA 5IQ9A 3BSZH 3NA4A 5I9QC 3ZKXC 1G9NC 3BWUC 3QNYB 4RSVA 4G8FA 5B22A 3DO7B 4UAOB 1QLFA 5CJBA 3GNML 3ZDYE 5FGCE 4QRRE 1OPGH 1PKOA 3C5ZC 5DRNB 1MUJB 2VLKB 4OZIE 4GSDL 1WEJL 3JUYA 4TUOA 2A6IB 4OCXH 1QVOA 4JB9L 5CLWA 5JORA 1EFQA 4JVPA 5IB5B 1DEEB 1FVEB 1NCTA 2E27L 4ONHB 4WW2A 5JHLL 1HHIB 4AIZA 3D6GA 5D7LB 5DJDB 5I8CB 3PWUA 3ZE0E 1A7NL 4NUGH 3U9UA 1ZVSB 1W72L 4LBEB 1KYOJ 3LRHA 3UAJD 4YDJB 3SOBH 5KG9B 2W65B 4R0LC 3WE6B 3MLUH 2DQUH 5F8QC 5C09B 2NPLX 4JPKH 3VFTB 4POZC 4X8JA 4DKEH 1EEUA 2OL3H 3INUH 2ZCHL 1S9WA 1BVZA 4XPHH 1K6QH 1F45A 2ARJA 4X6EA 3B6SA 4LPUA 4M6OH 3RWGA 2ED9A 2W92A 4KK6D 3OAUL 2P43B 5JPNA 2F8XC 4FQ2H 1V7MH 1MCJA 2UWEB 4LCWA 5FGBC 1FGVH 1KXVC 4I0PB 3GUTA 1CICC 2Y9RT 2YRPA 4HXAH 2D7NA 3A67H 5IG7B 5TE6H 1OHQA 4FFYH 4G7VL 3PDDA 2BSTB 5CWSA 2VR9A 3MNZA 3O9WC 1A2YB 2XN9B 3SBWC 3FRPA 4ZS6D 5J1AA 1X9QA 4F15C 5ACMA 5HDQL 2DYPB 3AM8C 4E5XA 3CAFA 15C8L 1LQSR 3PGFL 1ERNA 1U8HA 3P3YA 5GSRB 4BFBD 4PJHB 4Y4HA 3NA9L 2C4FU 2VLMD 1BLNA 4H1LB 5I1GH 4DVBA 2KPNA 1OARL 5EBLB 3BGFB 3H9SE 5B4MC 5TJWK 2DQHL 2VITA 1R5IB 1J7VR 1AGBB 3QEQE 3TIEA 5LQBH 3B3IB 4LCWD 2QKIA 4NQSB 4DVRH 4QRUA 1EXUA 1G7JB 3SDDB 5AZ2L 5B39G 1KLGB 5L0QC 1DUZA 3DYMA 2MJWA 4HWUA 3HZMA 4M48H 4HUUA 2A73B 2IPKA 2YXFA 1E6OL 4RISH 5JO5B 4MAYB 4F37F 1II4E 1OSZB 3F58H 3B9EA 1Q9KA 5IW1A 1RJZA 4QGTA 2DLIA 3DARA 4ESKA 3QWOB 2CIIA 4MNHB 3SN6N 1IQDB 2RIKA 4KTDH 2PW1A 4S0SD 3D0VB 4Y4HD 4YXHH 3G6JB 1WWAX 2X40A 5GRUH 5D2NE 4JO1H 1PSKH 3SY0B 3BPOB 3O4LB 3G9VA 4ODSL 3QFJB 1YMMA 4KVCL 3QUYA 3VFVB 5DVKA 4D0DA 3LY6A 3DX7B 1JZ3A 3GSVB 2GUOB 3CFIC 4KROC 4U4BA 4LAQL 4P4RA 4UT9L 4P9MH 2OI9C 1AE6H 4QKXB 5L7XH 4U6HB 1LO2H 3FO0H 1IT9H 5IB2B 4Z7WB 4GUPB 2VXTL 3U4BH 5C2UB 4WTWA 5CP3H 1MCPH 1FDLH 2DM7A 2WUBL 4NN7B 3BGMB 2EH8H 4LHUD 3WD5H 2R1WA 4JY5H 4R4FL 4Z7VF 1N0XH 1PZ5A 4MNQB 1UACH 3FT2B 3RWHB 3MNWA 5HGBA 1YNLL 4JG0L 3MRMB 4L1HA 5C8JA 3E3QC 4X6FB 1T1XB 4NWTH 1MCOL 3NFSH 1MJUL 1CK0H 3V4PH 1YMMD 4XCEB 3QUYD 3D87B 1E4XH 1KTRL 1UXSB 2GSGB 3CFKB 4FQXC 2WW8A 4X6DE 5TDPA 5BMFH 3ULVC 1P7HL 4PJAE 5ABDE 1RZKC 3QHZH 2X4OA 4LSPH 3DGGB 5I0DA 2N56A 3MZTA 1K3IA 1D5XB 4GQPH 3NOIA 5DJZA 4EI5B 1B6DA 3KYOB 3PDOB 2ZUUA 5DJAB 5DJYB 2WM0A 3KLHD 5CJXA 1I4FA 2AK4B 3MLXH 3LSOA 2ICEA 3MLRH 1UXWA 2A2QT 4HQQL 4P2RA 2L0DA 5I1HH 1B2WL 1NEZB 1G9ML 4IDLA 8CGTA 4NQCB 2LE9A 4NO2B 1KCUL 1MQKH 3MX0A 5GGVY 4I0CC 5DR5H 1HHJA 3T8XB 2VJXA 1QSEA 3H9HA 2P5EB 3CH1A 2R2HB 4YHPB 2ZG3A 5EZLA 2HYMA 1HXMB 4RAUB 5ESAB 2Q6WB 4UILH 1OWRM 4AIOA 5M7QA 1RJYB 2FZ3B 3EO1A 3EO0B 3G04B 1VADA 2GJ6B 5DRXB 4UTBH 4KRPD 3LAFA 5DT1H 4G9FA 4N0RA 2MHAA 4QOKA 1IAOB 1KCRL 3V5DA 4R8WH 4Y4KB 1TPXB 2BMKA 2XWJA 3LN4A 4O58H 3PHSA 2ZKHH 1CLZH 1XZ0A 3TJEL 4P2RD 1T3FA 3QG6B 4OZIB 4P59H 5INCB 3UTQA 2AQ2A 4TSCL 1ODAA 2O93L 3OKYA 5T5NG 4JKKA 1PKQE 1QBMH 3DYPA 3ULSA 5HYQB 4KDWA 5IVNA 3QXAA 3U48A 5IBLC 3QPXH 1N2RA 3EOTH 1U8MB 4NJ9L 3ULVD 5D72L 2VO5A 2A74A 3MBXH 4JE4B 2EDFA 3FOMA 3JWOL 3BO8A 3EJZD 4ODVL 2DQFB 3GJEB 5ILTL 3WDJA 4KZDH 2Z4QA 3O3AA 3S7GA 4G9FD 1LO0H 3SDXB 1CG9A 4QOKD 43C9B 2WWKT 3ARDC 3V8OA 3VI4F 5IFAH 4PD4K 4QHMA 1SBSL 4JVUA 4X4ZA 5SX5K 3TVMC 2FEDC 2X42A 5I66B 4PUBL 2WINB 1DQMH 4JHZA 2BNRD 3HB3C 3L3JB 3O3EA 4FABL 2C3HA 2OL3A 3ARGC 2HVKB 4HMDA 2Z31D 2WP3T 2YUZA 5BVPH 2IG2L 3M1BB 5KW9H 1AR1D 5FUCC 2CLZA 3DVIA 3UTPE 1FG2B 1AKJD 2F53A 3TPUA 1YEJL 3BKML 1GIGL 3EOAA 4C58B 4KKAD 3T0AA 3HZYB 3MGTA 5DUPH 4S1SL 1N7MH 1KCVH 4EIZC 3FZUC 3QDGE 1LE9A 5E8EA 1A7PH 4WTZG 1OTSD 4YBLB 3WFEL 5H8DA 2DOCA 3S4SA 3VRJB 1UB5A 1AXTL 3TIDA 2OXGA 5JUEH 4IIQA 5C0EA 4PRIA 1JGVH 4LMQE 3F7YB 2OBGA 1B0RA 1L7TH 3ARDA 2IADB 4TNWK 4YUEL 4P2OC 2J6EA 2IF7A 3TVMA 4WCYL 1CBVH 4ERSL 1FNEB 4JO3L 1KBGH 5EC1A 2QQLL 1OOAA 3H9SB 1BGXH 2CDGB 2P8PB 1KEMH 1GGBH 2HKHH 2H9GA 1W0WA 3L7EA 1GCFA 3F65A 3L5IA 1K8DB 5IW6B 5SWZA 1NC2A 4ONFH 2AQ1A 4PLNC 2ZG2A 4XP9L 5ID1A 4KKCD 3NCYP 1HQ4A 2WIIA 4KKLD 1KN2L 1I3RA 4DK6A 4NOBA 1DLFH 2R2CA 3NFNA 3QEUA 1U6AH 4FRWA 1AP2A 4M43H 1IAIM 3BFOA 3TT1H 4KJWD 4K8RD 4JKWA 1SY6H 3HC4L 4G6JH 1RMFH 4H5SA 1RUPL 1T0MA 3MREA 3OGCB 3TVMD 3MQIA 1VFBA 2P5WB 2NNAA 1T22A 2A6DA 4K3DL 1MAML 1EO8H 3T4AA 1PYWA 2EE6A 2OR9H 5E6IB 3UZEA 5SWZD 1NC2D 3VCLB 2MPAL 4XCFH 1U2CA 1R3HB 2HFEA 5T5FL 4X6BA 2R1YB 4U6XA 5JNYA 3CMOH 2BVQA 3O81A 3PQYA 2X6MA 1OAXL 1IM9B 5GJSL 5T5NF 5JIHA 5EC2B 1ACZA 3O8XA 2ED8A 3JWNC 1A3LH 1UJ3C 4HIIB 1KPVA 1CDHA 1Q9LA 3SKOA 2ESVA 2NY4D 2ED7A 5J6GB 4DTGL 5CP3A 3KPMA 1U8NB 1RK1B 2QHRL 4XCNB 4HPOH 5ID0B 5JA8B 5MENE 2I07B 4TOYH 2B1HL 2M1KA 4HS3A 3ZHLA 3BRDA 5C0CA 4XMKH 2J7LA 3SQBA 1JPST 4NC0B 3MA7B 1FH5L 4ISVB 2E7LC 3WIIH 1VEOA 1Z5LA 4I5BA 1PGRB 2LV4A 5DF0A 3MRCA 2Y7QB 5C6WH 8FABB 5MP6H 4DEPB 3NPSB 5DYOA 4HUVA 4L5FH 2V5YA 1UEYA 3QI9C 3VXTB 1AC6A 1RQ5A 5F7DB 1KPUA 4EUPG 3HFMH 3KPQB 2P48B 5D1QC 4MJ5B 2MCPH 4OUUA 1FNSL 5GGQL 5E8NB 3STZA 3WFHA 1QBAA 3L3DA 4UOJA 3O8XD 3FT3B 3V52L 3BQUD 2KQNA 4YZFF 2ESVD 4DAGL 5C0IB 3QXDA 1CDGA 1EO7A 1T6VN 3IAQA 2WWMD 2JB6B 3MJ9H 1ETZA 1QFWH 3KPOB 4KK9C 2E8YA 2DF3A 2Z93A 5C0CD 2E7LA 3ROLA 2KDGA 1OP3H 3VXUE 3WDHA 4LLYA 5H35B 5E08H 4PJIA 3BXNB 2HA1A 3DIFB 4GO6B 5BOPA 1MLBA 3QI9A 1C5BL 2H26B 4Y5YC 2G60H 4PJ8C 1NMCC 3A0OA 3JV6A 3U9PH 5D1QA 2DI9A 5IF0B 4D2NA 4XC3H 2OX5A 3RDTA 3ILQD 4ODTH 1OAQL 4U1SA 1MCCA 5K9QG 3P4OB 4RFEB 4CVZA 1YYLH 2NY1B 3NH7H 5FHAH 4JFQB 4WO4C 4Z7VB 3MYZA 5TE4H 4NP4H 4QTHB 3UC0H 4YQXL 1YYMH 1PKQB 3TO2B 1Y18A 4XNQA 1IKNC 4XX1G 5EZOH 3C60B 4KDTA 3CJJA 5GGTH 5ICZB 5I8OH 4NZTL 3L3OB 3CK0L 4PJ5A 2VXSH 4J6RH 4AL8H 4OZGF 3LQZA 2EIEA 4PJBE 3ZT5A 5DRWB 1PQZB 3R06A 3V4VH 5EOCH 1NFIA 1MCKA 1UM5L 3CLFL 4ZUTB 4Y89A 1S7TB 2YC1B 2YEZB 1HH9B 2APWA 1TENA 4FTVE 5HGHB 3CSYB 3HPJA 2GSIB 1U8IA 3FQXB 4UUJA 5GRJH 2I27N 4IHOB 4ZPVA 3RDTD 3CXHK 4KKNA 4P4KA 3EHBC 1PY9A 4XVSL 5D7SH 5TF0A 3A6BH 2FBOJ 4EBQL 4W6WB 1MF2L 5DD0L 1IAKA 3FRUA 4YZFE 4F7MA 1CGTA 5F9AC 2VIRB 5CUSH 4O51B 4NM4H 1N3NB 3JVGA 3L1OH 1FYTB 4KRLB 4MHHG 4HKBB 2F74B 4J3SA 2NR6C 5MERA 3L95B 3T0VA 3CUPB 4PJ5D 1WFUA 3MGAA 3QXWA 2EO9A 3KWWB 3PWPD 3UBXA 1QPPA 3MLWL 3W9EA 1R5WB 4QTIH 2YK1H 1HKFA 4MQXC 4XBPA 4U05A 5ISZA 3MR9A 2FCBA 3QEHA 3BPNB 3QFDB 4EDWH 2DDQL 4PB0L 1CXFA 2FWOB 4RZCA 1ZEAL 5GS0H 1IQWH 2WLZA 5FCSH 2UZIL 3MFGB 5EWIL 4AMKL 3RVTC 5FYLL 1RU9L 2FSEA 2AJSH 1TZIA 3P30H 4P4KD 3IFPB 4PGCB 4YHNB 4PP2B 4F33A 5DJXA 4JHWL 2E6JA 1I9JL 3H0TA 2I26N 5GIRA 5B39B 1U58B 5HHVH 1MRFL 5KSVB 4YHOH 3X14A 5D7JC 3GI9L 5CD5D 1BX2A 2RGSA 5CD3A 5FAAA 3BJ91 1B0WA 4TVPE 5FCUL 1T1ZB 1IZJA 5L88L 3H3BC 1QQDB 4R3SB 3BPLC 1FJ1B 1DQLH 1GC1H 2DD8L 1M05A 4OLUH 2I5YH 4LSRH 1W72B 1CL7L 3RNKB 1WT5A 3O41A 3SE8L 3DVGB 4LRNH 4QWWC 5I19L 1TVBB 3KNBB 5I76B 5ISZD 4LU5L 2DKMA 5F96H 3BT2L 4UQ2A 1G7LB 2J8UA 3QZWG 5T1KB 1VFAB 5DUBB 4HC1L 4HKJB 4PLOB 3BYYA 4JM2F 5LBSH 3K8KA 35C8H 1DE4A 3TH4T 4JFOB 4JHBA 3HE7C 4X7TB 4C56E 3IVKB 3CC5A 4J8RA 1RZ8A 2XWBB 3VFPB 2P46B 4PGBB 1KNOA 4P0DA 3DVNA 2WUCH 1H3XA 1TLKA 3NGBC 3SKJL 1WWCA 1XR8B 3OJDA 4M9PA 3DHMA 4XVTL 3GBNL 3U4EB 3FQRB 1U9KA 1R3IH 4R26L 1MI5B 1AI1H 1LO5A 4UDTA 3D9AL 1IVLA 3F6LA 3FRPG 3QJHA 4JFPA 2VLJA 1NAMH 4OAWA 3LKPB 2EDJA 2EDEA 4RGND 5EOQL 3QXTA 1BFVL 3NCJH 5EB9A 4AK1A 3OJ2C 3THMH 1ZGLA 3X17A 1BFOA 1BVLB 4FP8L 3V6ZA 2RCSH 4NQEE 1NAKH 1R5VB 2BK8A 3DUUA 4YHIB 3DVFA 4PJ7E 4NKMB 1H8SA 2YKLL 3C9NA 5CILH 3QNXB 2MOVA 3MLPA 2VQ1A 5IB1A 1IM3B 5HJ3A 1C7SA 2AW2A 4LLMB 1OP3K 2JJVA 1I3UA 2EIDA 2AQ3A 4NO3B 4ONOA 2YPKA 1KPRB 3FTGA 1X3DA 4BSWB 3WEXB 4KPHH 1FP5A 3F7QA 5J57B 3IDGB 2YUVA 2HVJB 1B90A 2QSCH 5HHMD 1ZA6A 3BUYB 2VLJD 3QIWC 4LHUG 3HR5B 4EEEA 5KAQF 3S35X 3PGDB 3CNKA 2D31B 2HMID 2AV1B 3H7BB 1FL5A 3HRZB 4LOUD 4O4YL 4QXTB 4X83A 4NKDB 5ANMA 3TA3C 4Z8FH 4WWKD 2DQEH 3ESVF 4WFHE 2JELH 3VWKA 4TUKL 2C1PB 5DA0B 3MRGB 1T7ZA 5DQDL 4M6NH 4DGVH 2AJYL 4Z7UE 4ZUUB 3RGVB 4K3GA 1URLA 3RVVC 4AEEA 2ADJA 1BZ7A 1J11A 4XI5C 3MJ9A 3LZFH 3UJIL 1CXIA 3UMTA 3M8OL 1MIEL 1P84K 4KAQL 4LPWA 2EO1A 2LTQB 2V7HA 2APBA 1KJVB 1NBZA 5JR1L 4RCAA 5I18L 1FL3A 3L6FB 3WKNA 4E42B 1HILB 5JXED 2DLFL 5J1SC 5D70L 5F7EL 3MLVH 4UT7L 5DD6B 1PLGH 5E56A 4JRYE 2W91A 2NZ9C 2ZNWA 4M62H 1YNKL 4XX1E 4BZYA 5INDB 4QHUB 2IMNA 3RI5K 4ETYA 3MRHB 3VWKD 4JM4H 3LCYA 4APQA 2ZUVA 2HTKD 3KR3L 4D8PA 3SKNA 1CLYH 3RVXC 2H3NB 3GMLB 2GY5A 5CZVL 5GGRB 3MV8E 4HJJL 4Y5XB 2RFXA 5D2NC 5HDOA 1JPFA 5HHOE 5EBWB 5JDSA 3WKMH 4AH2A 3KAAA 5E8OA 4OIIL 3JZ7A 2YZ8A 3ZT6A 1Y0LA 3HLAB 5I8EB 4ZUWA 1K9TA 3T0ED 1IKFH 3VGEA 2VOTA 1P4BH 1REIA 1Q9OB 3H42L 1VPOL 4NZJA 3VD7A 4P9HL 3CVHH 1FGNH 4PR5A 3KPRA 1FRGL 1WBXA 4NM8L 1QNZH 5DHYA 5EBMB 2YOCA 4JEGB 1IGCL 2OR7A 5GS0C 4XP6L 5F7WC 1LEGA 3B9DA 1ES0B 1C5DA 5T33L 3MLTA 4APQD 5I6XC 5GQBA 1LP9A 3EGSB 2X89A 1A22B 4CW1A 4OZHE 3U30C 4GAYA 1I7UB 4JFEA 3PV6A 6FABH 1G6RH 1L0QA 3MZGB 2HFFB 4JZNB 5K9KA 3KPSB 2X4SB 3QDME 4WI3A 1PJ9A 1S7RA 4KDVA 4N9GB 4QHLB 1UJTA 1JGEB 3VG0L 4PJGE 4H20H 1GC1C 2BNUB 5DSCA 4M7ZC 2KUTA 3BP5B 1CFVH 4PBXA 1N64L 3UTSA 1NMAH 2LFGA 2MNUA 1X5HA 1NMBH 5BVJA 3KPRD 5JPMB 3RUGF 1H5BC 2J8OA 1T20B 3BISA 5FOBA 1CF8H 1UM4L 4K07A 1TIUA 4PV9A 5B21A 3PF2A 1WQVT 4ELME 3OJVC 2ADFH 3SHSA 2YPLD 4I9WD 5JQ6L 1ZLSL 1HN1A 2X89D 4D3CH 3D3VA 2VDRL 4TN9A 4XPTH 1SYSA 4XBEH 4JQIH 2EH7H 3VXNB 4JFED 5I0ZA 4CADA 3ZHDA 3KYKH 4PV8A 1Q9WA 3MNVA 3BDXA 4OZGB 4XCYA 4HFWA 3DYOA 4YXKH 5BV7L 3L5XL 1OF2B 2AERT 1JHKH 2O26U 3WJJC 2NY0C 1OAKL 3MRBB 2GCYB 3GKWL 1UZ8A 1BQHG 1N6QL 2OMNA 4CVUA 5FA4B 2R0KL 3UTSD 5IQ7H 9CGTA 5FA3B 2I9TA 1KFAL 3QWRA 4FFVD 3S35L 5GS0D 5BZDA 3HZKA 3MRIA 4WJ5B 2G2RA 3MOBH 1OLLA 1F3JB 4JDZB 1I8MA 4HFUH 3FQUA 5IB3B 2ZWLT 3E6HA 3D3VD 3K81A 4E41B 5DLMH 1IL1A 1HHKA 4JFZH 4MNGE 4GXUN 1BVKB 1IMHC 2EDKA 1I1YB 4KJQD 4BJLA 2HWZL 5FB8A 3M17B 3GZKA 1ITCA 4LLQB 1DBBH 1S7VB 5DMIH 1NAMA 3R0NA 5C3TA 5I2IB 3CFBB 5DRZA 3C08H 3N9GH 1A6PA 4PJ9C 5ITFA 5DC4B 5C0FA 3VE0A 5FYLE 1T66C 5CEYB 4KZEL 3LN9A 3HG1A 3MRFB 5C9KA 3F5WA 4V1DE 1WBYA 4TQEL 3G5YB 5MEQA 3C09B 5JW4R 4EUPB 3C5SA 4DZ8A 4D0CA 3B43A 4I48A 1RZJH 4CVXA 4JDTH 1M7IB 4PJDA 3OWEA 5FO8B 2UVEA 1UWGH 3T4YA 3TBTA 5CMAA 3S34L 3FFCE 5AAWA 3C2SA 5B8CA 4G7YH 4DJMA 1VA9A 4FQQB 4KUCF 1MFCL 1JK8A 1EV2E 3OKKA 5IBUG 3MRNA 3MYJB 2YBRA 3MRPB 3ZDXE 1G9EA 4JANA 4XPFH 4U1GB 4LNRB 3GIVA 3LKNA 2X1WL 3DBXA 4PJ9A 3SQOL 1D3CA 3VXSA 3IKKA 4JM2B 1SM3L 1I8KA 3DV6B 3DECA 4GKZA 5GXBB 5TQ0L 4W4NA 5CGYC 2VAAA 3I2CL 5E2UL 5IHZB 2EXYC 1LK2A 5C0BB 2XNAA 4JCLA 3FHAA 1CDCA 3QR2A 1TXKA 2Y5EA 2NXZB 4M8QB 4RIRA 2W9EL 3OR6B 3RIAF 5JW4M 1LO4H 3RNQA 1DVFC 3BHBB 1KTLA 4Y1AD 5CGMA 4JY6A 4YBHA 4JKMA 5ADOH 2BFVL 4H88H 1JNNH 3N85L 5EU4A 4Y2DB 3QEGH 3BW9B 1KN4H 1XF4A 4PJXA 1HH6A 4JR9L 1RZIB 4Y8AA 5E5MA 4PJ9D 3LEYH 1UYWH 4X6CA 5CBEA 3VXSD 4BZ2L 1MRDH 4OGYL 3U0PA 4QT5B 2F19L 4JN2A 4XXDA 4M6AA 4I0KA 3K1DA 4OCWL 1YEGH 3IAPA 1GGCL 3GMQB 4OTXH 5AZEL 1S5IL 5DMGC 5FM5M 1WAAA 1MY7A 1BJ1J 4L3AA 4YGVB 5HD8D 5DJ6B 2Q7NA 3SDAA 4LQFL 1OSPH 4NO5B 3RL2A 1AXSA 25C8H 2AJXH 3V4UH 2A1WH 3BE1H 4OUOA 3HZVA 1T1YB 1OTTC 1AO7D 4NQXB 5BO1L 4F9LA 2EC8A 4WI9A 1A9EA 2QBWA 2ZJSH 4YWGH 4QXWA 4NIKB 3PABB 3PJSA 1RVFH 5AYUH 2VLRD 4YHML 1EAJA 4PG2A 3QIUC 1MPAH 4LCCC 2BNQB 3PP4L 1WC7A 5F88A 1H15B 1FO0H 1IC1A 3UP1A 3QULA 1CFTA 5D6CA 1P7KA 3MUGA 1ZHLB 1A6VL 3ULUH 1KENH 1RIUL 4XB7A 3ELAT 3K1KC 4LCUA 4IRJB 3VG9C 3K8LA 3FB6A 4ZFOA 2YMXL 5J4MA 4X80H 5EIIA 4WV1C 4JFDB 1ACYH 2X4NA 3FO9A 2FB4L 3PGCA 3WS3A 1I75A 3L3GA 3PL6D 1MLCA 1QZ1A 2XPGB 3P11L 5SX4I 3SDAD 4YK4C 3S9DB 5ADPH 2R0WH 4CVWA 5FGRA 1U8OA 4Q7DA 2ICWJ 2C7UB 1RUML 2DJUA 1TDQA 3WNOA 1LEIB 2EE3A 3ABZA 2XZAH 1QVOB 1RURL 3NBNA 4KMTL 5K9OB 1T5WB 5KSAA 43CAA 4W4OC 1QHPA 2IANA 2YD7A 2BVTA 4LASH 3EYVA 4PIRF 3MXVL 2LU7A 3RWFA 1DANT 5GS1A 3ZKQD 1FQ9C 1HCFX 1JWMA 1KLUB 2JK5B 4M5ZL 2LAGB 4ZOCA 5K9JH 2QLVB 4ZAKC 1RHFA 4KWUA 4R97B 1YDPA 2OMBA 4YDIL 4K94H 4RAVB 1T2QL 2FJFA 4HUKB 3U0WL 2DJ4A 5D93B 1UKQA 5F89B 3L9RB 2V17L 2FYYA 1GAFH 5FDWB 3QZWB 2FL5B 5DHVH 5ETUB 4I3RL 2VXUH 4PJFA 2F5BL 2V2XB 4WU5B 4YO0B 1KIQB 1CE6A 4QF1A 5KN5B 2GEEA 1JI1A 2XQYK 3O6ML 4W4OA 3X11A 2F54E 5KSAD 1NBVH 1VGKB 3CDGA 4WFGE 2IAND 1JZ5A 1AHWB 4HJ0C 3QAZC 5T3XE 1VCAA 5HY9B 2AP2A 5IMOA 4IS6B 4ZS7L 3IDXL 3OKLB 4YHLH 3RL1A 4FZEH 3WNNA 4KK8C 5CSZA 3UO1L 3UJJL 5CEXB 1X5JA 3L5WB 2YD3A 2CJUH 4Y4HB 1FZKA 3KYNA 2ITDB 2B1AH 4S1QH 2BY3A 3A6OA 2BX5A 3LH2H 5IESL 1CCZA 4YNYA 2ICES 2NY7H 4HIJB 1ZLVH 1J1OH 5E99L 3QA3A 1Q1JL 4HH8A 3MJGX 3U0TA 4P48A 4HWEH 3U2SA 5BQ7B 5ESVA 4OJFH 3BVNB 3VW3L 3FQWB 2W0KA 4URTB 3IDJB 3CVIL 4G8IB 1Z2KA 3AAZB 5EIQA 3LN5A 4AZ8A 1A6AB 3PHOB 3OF6A 3RUGB 3TN0A 1M71B 2LQRA 3GGWB 4U6VH 3VFUA 2IPKB 1TFHA 3WFDL 4YDKL 4P2YA 1RY7B 3VFRB 3TH2T 2VN4A 4LHUB 3CFJA 2BJMH 2VZVA 3D39A 5AYQA 1OB1B 3TNMB 1OAUL 5I75B 4F7CB 4LEOB 5A2FA 4LGRB 2JCCF 1RFDH 5E5UB 4PP1D 1QFPA 4F58L 4I2XA 4JRXE 4Q0XL 3P0YL 3BUTA 4XGZA 1HSAB 1ZHNA 1E28A 1KEGH 3GSXA 1C16B 1VGEL 3W2DL 3KYMB 4U0RC 2LVEA 1YC8A 1B3JA 5DEFB 4F7TA 1MVUB 5DS8A 5E9DB 4N1CA 5FM4A 3I6GA 3E1F1 4N68A 3CCHB 3DRTB 4EN3C 1I1FA 1XGQA 2A6KB 3MRRB 3OF6D 3TN0D 4KUZL 4MJIA 5J11C 3HNVH 4B7IA 5F9WB 4GRWF 1XH3A 1JRHL 2NTFB 1A6WH 4PGZA 3S8WA 4H1LH 4L8SC 1KIRB 1S9VB 3D39D 1DQJB 3FCTB 4MDJB 4QNPF 4GMTH 2ITCA 3CLEL 4LARL 3OTTA 4EI6B 2YZ1A 1TJIH 4IMLA 2BY2A 2GTWB 3IRPX 5HI5C 3TYFB 3WLBB 1N4XL 1CWVA 4HWZA 3IU4L 1ZS8B 4ODWB 5EU6E 4C54A 3ARTA 3JTSA 3O0RL 2J5LB 1I7RA 4L4TB 3F12A 1YEDA 5I1CL 1A14L 1YEHL 3DI3B 2DMBA 4D9LL 4I3SL 4MDIA 4EN3A 3QO0B 5DJZB 1JHLH 4KRPB 4PREA 2I25N 3TBSA 2ICCA 1I9RL 3GHEL 4PJCB 2EXWC 1XF5A 4U7SA 2OSLA 4UV4L 3O6FB 1EZVX 4MJID 1XGYL 1KELL 2ZCLH 3BIKB 1YJDH 4PRBB 3ULUC 3G6AA 2APTA 4CU6A 4FQ1L 5KVEL 4ZUVB 4ZYKB 5CEZH 4NFDA 1HHJB 1HWHB 1OGAE 4GW4A 4UU9B 5D1ZA 2YPVH 3O3BA 3EZJB 1U8KA 3BEWB 3BEVB 5LCVH 1CR9L 4ZDHA 4M7LH 1HDMA 1ZSDA 3PNWA 2Z0BA 2AXFA 3HKFA 4MJ6B 4L3CA 1R3KA 3GB7A 4OF7A 4L4JA 4CJ1A 1K4CA 3KLAB 2V7NB 3TWCH 3VD9A 4OQTH 5JW4Q 1JHTB 4P3CL 3VI3F 3CIQA 4G9FB 2ARJQ 5D2LF 3BESR 4HX1A 1MFBH 2GYSA 3O6LH 1FO0A 4MCZB 1AY1H 4NPYA 2W1NA 1NCBH 5LAXA 1J5OH 1P1ZA 2FX9H 5EOCJ 1QYGL 4OBRA 3HCVA 5DJ2A 5E1AA 5D7IF 5E1HB 2E7CA 3ARZA 2BNRB 3ILPB 2UUDK 4DOHB 1RJLA 3LPGA 3NN8A 4PRAA 3HMXL 5IHUL 2Z31B 3RZCC 4QNPE 3JWDH 5HGAA 2Q76B 1AKJB 3C5JA 5EDXA 3VFSA 3C6SA 5KVDH 4YDVB 3LB6D 4Y19A 5D1ZD 1TQCC 1MEXL 1ZT7A 5DEGA 2C1OB 3QIBC 3UTZA 1JGDA 4WEMB 3WUWA 1NC4A 2ZUSA 3MRQB 3BRGC 3TM6A 2NY3B 3FN0L 1RK0B 4H0GA 1AQKH 1N5YH 1NLBL 5L2KE 5EA0L 1F4WL 1ZHBB 2VDLH 4J3XA 4C59B 3OG4B 1CG9B 3EYUL 1KJMA 2CK0H 4HZAA 1BQHB 1YN7A 1NCDL 4G8GA 1A6TA 3QO1A 1DBJL 2XQBL 3M07A 2FBJL 3EOYG 2ORBL 1A6UH 4KY1H 1U3HC 3JXAA 5IVXE 4GKNB 1IEBB 4HHAA 2P24A 1Z0MA 2PW2A 4NQDB 2MQ0A 1OWWA 4LSSL 4LKCB 3QP3A 1UA6L 3QYCA 4JFFA 5IBTL 4PJEE 2R4SH 4L8BB 5GJTL 4Y88A 1A9BA 5IKCA 2F54B 5GISL 2D0FA 3MCG1 3EOAB 1F90L 4OV6F 5EH1A 1CVSC 2FJGB 4Y19D 3QIBA 4MX7A 3PG2A 3EAKA 3V0VA 4B53A 3PXJA 4K3JH 4JZOA 1NJ9A 1OP9A 5KVFL 4KKBD 3IYLW 2HLFD 4F2MA 1ZXQA 4Z7NF 2AJ3A 3ZKMC 2QQNL 2YWZA 2VL5A 3IF1A 4ODHH 5C70A 5E4EC 3NAAL 3FB8B 3B9KB 5KJRL 5EORH 3QNZA 1NLDL 5HPMB 1T1WB 2BVYA 3QNYA 5IJKC 4XHJC 1Z3GH 2NY6D 3DO7A 4M7JH 4R90L 3V6BR 4Q58C 5D7IE 5GPRA 4RFOL 3ARBB 1FFNB 2K7PA 3P4NB 3Q6GH 5DRNA 1MUJA 4L4VA 5FEBA 2VLKA 3TFKC 4QRTB 4JFFD 2A6IA 2C5DC 1NC2B 5IB5A 1DEEA 1FVEA 1BAFH 1KCSH 4ONHA 1J8HE 5JIPA 5I1EL 1ZANH 2P8MB 1LEKB 5D7LA 5DJDA 1HEZB 5I8CA 4DQOL 2XACC 3NABL 2COQA 2X1PA 4G43B 4QY8B 1VSCA 1ZVSA 2IAMA 2WIIB 2XA8H 1FC2D 4LBEA 4MD0B 4Q97A 2C9AA 2EKSB 3EJYD 4GJTB 4YDJA 5KG9A 3B83A 2W65A 1H3PH 4NRXB 3VFWB 3N1FC 5C09A 3C6LC 3VXRE 3VFTA 4H5SB 4F8QA 3KVQA 5IBUB 1F4YL 4ZSOE 4F9PC 1QBBA 4OSUH 5A40E 4IRSD 3QG7H 5I30H 5CIPB 2X9YA 3RBGA 5BV7B 4GG6F 4L3EB 3MUZ1 4L4VD 1SJHB 4MMZC 3AU1B 2VR5A 1E6JH 2UWEA 4NBXB 1HZHH 3IDIA 4I0PA 4UV7L 5SWSE 3U7YH 3AY4A 5F8RC 1Q72H 5IG7A 5D7LD 4YE4L 2DKUA 5JNYB 1IC7L 1K2DA 2BSTA 2P44B 3F7VB 2BVQB 2Q8BH 3SDDC 2IAMD 1A2YA 4K9EH 4HJGB 1FE8L 2Y07H 5F9OH 4OLXL 1EHLL 1INDL 4MAYC 1FFRA 3UYRH 3Q5TA 4I18C 3BQUB 2DYPA 1KPVB 5F70A 5D1XC 4Z7NE 2PNDA 4HUMB 1QPXA 1RZGB 5I1LB 5GSRA 5KBNC 4PJHA 1MHEB 2OP4H 1G9NL 4H1LA 3RZWA 3AS0A 2I24N 5EBLA 2IPUK 1R5IA 1KB9K 4G42B 1CYGA 2PYEB 1AGBA 5EU6B 5GRVL 3ALPA 2XIDA 5HYJD 1X44A 5C0ND 4I0PD 5GZNC 3LD8B 4NQSA 3ZYZA 4LDEB 2QADC 1CXHA 4PRPB 4NSKA 1G7JA 2CGRH 4OFVA 1X4YA 1KLGA 1ZLWK 2A73A 5JO5A 4OD3H 4MAYA 2AV7A 1FFOB 1OSZA 3STZB 3ARVA 1WCBB 3UXFA 1J1PH 4G5ZL 5FYKD 2DYPD 2D03L 2AEQL 2UYLB 2B0SL 3EFDL 5FYJU 5E2VL 2FGWL 5GGSB 5FKAB 3QWOA 4FXKB 4MNHA 1QRKA 4FMFA 2BERA 1IQDA 2IFFH 4MA7L 3D0VA 1BM3H 2JCCB 3G6JA 4KTEH 4Y16D 3NCFB 2I60L 5JTWA 1LNUB 3HC3L 1MREL 3T09A 1QLRA 3IS0X 4IJ3B 3SY0A 2Z93B 3O4LA 3W0WB 3QFJA 3WNLA 3VFVA 1S78C 1WF5A 3WIHH 1F02I 5GRXG 4GG6E 4XWOD 3DX7A 4XAWL 2YRZA 3GSVA 3QDJE 2FD6H 3CFCL 4Z95H 2GUOA 4V2CB 5JOPD 1T4KB 1DUYB 1X5IA 4U6HA 4EI5C 5IB2A 4Z7WA 4GUPA 2N7AA 2DTML 6CGTA 3S88H 1MJ8H 3RDTB 1UWEH 3UPAA 3S96B 5GS2H 1HNFA 3FN9A 3R1GL 4GRWB 3BGMA 3S3PA 1UENA 4R2GC 3VFGH 2IH3A 4MNQA 3FT2A 4K2UH 3RWHA 4RNRA 1T0PB 4X9BA 4TSAL 4X6FA 1T1XA 4ZOEA 4OI7A 3HMWH 3RGHA 2HT3C 2XTJD 3O4LD 1FV1B 3QFJD 4XCEA 3OZ9L 1UXSA 1IGYB 4M7KL 3I3EA 2GSGA 3CFKA 1N8ZA 3PWPB 3ZSSA 1ZHKB 1LO3H 3DGGA 4KI5D 1U91B 2VDPH 1D5XA 3WFBH 3LMJH 4EI5A 1TMCB 1EEQA 3KYOA 3F8UB 3DETC 3PDOA 3HUJF 2FH8A 2V6HA 3GSNL 5DJYA 1OVZA 4NBZB 3WNMA 2L4OA 4FOMA 4WHYG 2AK4A 3HPJB 4ZFFB 1W0VB 1ZGLM 2EIBA 1TPXC 2H2SC 4GMSL 3ZKND 2Q8AH 2GAZB 1MFAL 4X5LA 1NEZA 2P42B 5A2LH 4WRLA 4NQCA 4M6MH 4NO2A 2ICWB 2HRLA 3T8XA 5DVLA 1WISA 4RMRA 3N50A 4PTUB 4DUXA 2P5EA 4X8XA 2R2HA 3HNTL 4YHPA 4XTRC 1WWBX 4Y7MA 5MERB 4RAUA 1HXMA 4H26A 5ESAA 2R4RL 5D5ME 2Q6WA 1CXLA 5DQ9B 1RJYA 2FZ3A 3TZVD 3EO0A 5K9QI 1MJ7L 4UIMB 2GJ6A 4M93B 5DRXA 5ISZB 1GPOL 1NFDE 3RTQD 4PGDB 4EXKA 5D2LB 1IAOA 4NT6B 2AK4D 4Y4KA 3BZEB 4PB9H 3RIFK 3G9AB 1SEQL 4OM0H 2R8SH 3QG6A 4HZLB 4OZIA 3T2NH 5INCA 1LK3H 1J0YA 1X7QB 3MOAL 3IETB 1QFWM 5HYQA 1X5GA 2NLJB 2P5ED 2AS5M 1U8MA 2DQIH 5FYJL 3KJ4C 1QBLL 1EHXA 4RGNB 5F44A 2PYFB 2FGZA 1JGUL 1EA9C 1P9MC 1RZKL 3GSOB 1M6OB 2DQFA 3GJEA 4YBLC 5F6IB 2GJ6D 4HIHB 4IDJL 3VXRB 4Y2OA 5FUOH 1PAMA 1JZ8A 3SDXA 2J8UB 3HUJE 1TCMA 43C9A 1N26A 4JG1L 4K9EC 5DJ8B 4Y4KD 4LPYA 3EFFB 1LHZA 1CGVA 5I66A 4O2FB 5CJOH 4BKLB 1MJJB 2DLHA 4GRLB 3CC5B 2WINA 5IP4A 3FOLA 5BS0E 4DGYH 1A7OH 1KG0B 1D7FA 1T83C 2HVKA 4U1MB 1KC5H 3QQ3B 4DN4L 1ZGLP 3M1BA 1FG2A 4UQ3B 2R56H 3VRIB 4ZQKB 5KS9F 4PRHE 3HZYA 3RWIB 4WW2F 2PO6B 1OPGL 3SE4C 1R0AH 2IPTL 1MCFA 2Y06H 1QRNE 3IRZA 1P9MA 1FPTH 3VRJA 2R23B 3LKQB 1NGZB 1KIPB 4UIKL 1QG3A 4MVBC 5JOFB 4WWKB 3F7YA 3GNMH 4DKAA 1BFOB 2W38A 4NUGL 3CDCA 3DUUB 4GSDH 1WEJH 3AB0C 1FNEA 1T7XA 4LPXA 4LNVA 3VMNA 3H9SA 4JB9H 4ZTOL 2CDGA 2P8PA 4Z5RB 2E27H 4G3YL 2VQ1B 1NGWB 5JHLH 3QEQA 2H32B 5ELIA 2AK1L 4HBQA 1A7NH 1K8DA 5IW6A 3INUL 3BN9C 2ZPKL 1WTGT 1K6QL 1AC0A 2EYSB 3NTCH 4EKXA 5HHQB 1NCCL 4M6OL 5BRZB 5FO7B 1RUQL 4PG9B 5I74B 2GKIA 2EC9U 3QHFH 3BZ4B 4POYA 4HWNA 5CLTA 1FGVL 4NZUL 4YDLC 4I3GA 1RIHL 2W60B 2AJUL 1C12B 1JP5A 4FA8A 2EDLA 3OGCA 1J0JA 3OAUH 4WHCA 5T3ZL 2P5WA 5GZOC 2BHYA 3H9SD 5DGQA 2YUXA 4L8CB 4LSUL 4R4BA 4U2YA 3QEQD 1DL7L 1ORQB 4G7VH 4U1KB 4YBQC 4JREB 2VDQL 4HKXB 5E6IA 1AGDB 1M4KA 4HUXB 2A0LC 4GBXB 5E00A 4YGAB 3VCLA 1Y6KR 3N1QC 3NPSC 1R3HA 3T0EB 5HDQH 2NY2B 3WIHA 3VXPB 5KS9E 2Q87A 2R1YA 5B38G 15C8H 1MCDA 3PGFH 2BY1A 1MIMH 3SPVB 1IM9A 4UNVA 3HS0B 5LQBL 5DK3A 3NA9H 3DX9B 4N1EA 4HIIA 5H37G 1R3JB 4PLKD 3W39B 4DVRL 1OARH 3G08B 5J6GA 2DQHH 1AIFB 3B9VA 5AEAA 1JV5B 1RK1A 4XCNA 4APQB 4M48L 4RISL 4X9FA 4D8PB 1ZLUK 5KSBF 2I07A 2DQDL 2P5WD 2CKNA 3VXQB 2RBLA 3HR6A 1MHCA 2E5EA 3MA7A 4ISVA 1U3ZA 4P5MB 1JPFB 1D5ZB 3UJTL 4PD4J 2BVEA 2DIAA 5DQJB 3UYPA 5HPOA 2C4FT 1OAZL 2Y7QA 5E6ID 8FABA 4NN5B 1TJHL 1E6OH 5GRUL 5IV2B 1PSKL 4LCWE 2HN7B 1ONQB 3VXTA 5F7DA 4J4PC 4QHNA 1CL7I 3SGJC 2EEDA 3KPQA 1WK0A 4MJ5A 1JNHB 1IM9D 3TO4D 3FT3A 3PWVB 4P9ML 1G7PA 4ODSH 5C0IA 1LO2L 2EDRA 1O0VA 2JB6A 2OJEB 2YPLB 3KPOA 3P9LB 4RWYL 2EH8L 4JY5L 4LAQH 3C60C 3EJJX 4GAYB 3PV6B 2R0LL 3QUXB 4XWGL 5H35A 2VXTH 4HEME 3BXNA 1CVRA 3JTTB 1P4LB 3DIFA 3QCUL 2MFNA 3ALWA 4NWTL 3NFSL 4JKLA 2EDTA 1XIWB 2WUBH 5C71A 4J4PA 4OFKA 1JJUA 1XCQB 4FXLA 4R4FH 1E4XL 3MRKB 1O7SA 2NW3B 4KJPD 4QRSB 2O5XH 4JGMA 1YNLH 1TQBB 4NQVB 5BVJB 1HK6A 2HT2C 4BK4A 3P4OA 1MCOH 4KU1A 1UZ6E 3OB0K 4RFEA 5KVGL 1MJUH 4MXWL 4Z7VA 3O2DA 5M95B 4QTHA 2IBBA 2J2ZA 3BP6B 2CSPA 4RFNC 2DLEA 1PKQA 3TO2A 3K4DA 1T7YA 1RJCA 3C60A 3TYGL 4JN1L 1QSFB 5ICZA 3NCBB 4OGXL 3L3OA 4YHKH 4OCLC 5J3HD 3V0WL 2XZZA 3VWJC 4HFWB 1F4XL 3OKMB 3HN3A 4JPVL 5DRWA 4HD9A 1XGTA 1INQB 2APVA 1WITA 4ZUTA 1S7TA 2YC1A 4HQQH 2YEZA 1HH9A 3HUJB 5HGHA 1B2WH 3CSYA 2GSIA 4PS4H 3FQXA 3QH3B 1G9MH 5EN2B 4KTYA 3VU2A 1EBPA 4IHOA 1KCUH 2VB5A 3LPFA 4HGKC 5BS0B 4NQTA 1EO5A 1FSKC 2SEBB 2FLBT 2NY1D 5C08E 3I6LE 3P0GB 4PLJC 1NCNA 2VIRA 3U6RA 4O51A 5J12C 1N3NA 1CIDA 4GFTB 2VLLB 4O58L 3S5LG 2ZKHL 1FYTA 5L8JB 4HKBA 3OAZH 2F74A 4HK3J 2YS4A 3MACL 4JFXB 3L95A 5EU3B 3E8UL 2FEEL 3CUPA 3FT4B 4P59L 1IEAB 1KCRH 3KWWA 3RWEB 1R5WA 3ES6B 5F6HJ 3QFDA 3TJEH 2HT4C 2FWOA 3EOTL 3WN5B 3MBXL 3B2UD 1QR1B 3S98A 4TSCH 4DUVA 1DBML 4ORZC 1Y6MR 1YQVL 3IFPA 4PGCA 1UH2A 4YHNA 4PP2A 4OLYH 3RPKA 1KV3A 1MCEA 5C0DB 5HVGB 5F3BB 5B39A 4P2RE 3V7AG 1U58A 3OKDB 5KSVA 4NJ9H 4X4MA 1EUUA 4M1CC 3UTPD 5D72H 4D0CB 4XNZB 5IFAL 4MXQC 4IOFC 3DLQR 1T1ZA 5ICXA 3JWOH 4R3SA 1QQDA 4GLRH 1AQDB 4ODVH 5ILTH 2VABB 1QSEE 4Y1AB 4D9RE 3HI5L 5ENWB 3QDGD 3TBTB 3BMWA 1W72A 3RNKA 3TPKA 3JV5A 5BVPL 2OJZL 5B8CB 3ULVE 2ZOLB 2B4CL 1TVBA 2C3WA 1A0QL 3KNBA 5I76A 4PUBH 4WFFE 5DUPL 4UI2A 1G7LA 5T1KA 1VFAA 5DUBA 4FABH 4HKJA 3P40A 4JFOA 3L3IB 4QOKE 2IG2H 4X7TA 4KHXH 1A3QA 3IVKA 3BKJL 2XWBA 1YEJH 3VFPA 2VAAB 3BKMH 3Q1SL 1GIGH 4PGBA 5JUEL 5L6YL 4S1SH 2FH6A 3GO1L 3FAWA 5BCAA 1GL4B 1XR8A 3BIAX 4RIRB 4BFIB 1FFPB 3U4EA 2C4XA 3UTTB 3RNQB 2X1OA 3WFEH 3FQRA 4X7SL 1BGXL 5KS9B 1AO7B 1F3RB 1OQOA 3GMRA 3WFZA 1AXTH 3E0GA 2HKHL 3O3UN 1QUNA 3LKPA 3PDGA 1V3MA 4ZXBD 4YUEH 1OAYL 5E8DL 5FF6B 3ROOB 2VLRB 1VEMA 4RMTA 4WCYH 1E0OB 5EU4B 2QSQA 4BFEA 4JO3H 4ERSH 4LP4A 2QQLH 4LCIL 1BVLA 2CXGA 2IBZY 3NPZB 1R5VA 4YHIA 4EUPH 3L3HB 3ZKXB 4NKMA 3P0VH 1R24B 3J7HA 1YUHB 3QNXA 5E5RB 4M43L 3HHRB 1NSNL 4XXDB 4ENED 4TNWF 4XCCL 1IM3A 1CIUA 1SY6L 1MHPL 4XP9H 4UBDD 4LLMA 1DQQB 5GRYA 4WW1B 1W0YT 3PL6B 4FG6C 4NO3A 1KN2H 1KPRA 1YPZF 4Q9CA 3EYOA 4BSWA 3WEXA 4YEFA 4WDIB 4HUWB 1S5HB 2XFXB 1U41A 2F53E 3IDGA 2R9HD 1VACB 2HVJA 2LTQC 3HC4H 3BUYA 1YY8B 5JZ7D 5MHSE 2OR9L 1RZ7L 3HR5A 5F7HA 1YY9C 5EO9B 1UG9A 1GXEA 3PGDA 3H7BA 3HRZA 5ALCL 4QXTA 4R0LB 4NKDA 4PYGA 1NDGB 5FK9A 1WCQA 1CFNB 5F88B 2Y6SC 3VGAB 4K3DH 1MAMH 2C1PA 3MRGA 1P7KB 5MEND 4PRIE 5LJYH 1IAII 4Q6YA 3OSKA 3P2TA 2FR4B 2J88L 5CINH 4LRIA 4ZUUA 3RGVA 3BKYL 4AQOA 2XT1B 2MPAH 1LILA 5EIIB 3TC9A 1TETH 5DI8A 2DLGA 4H8WH 5T5FH 3IDUA 5I1IL 4FS0A 4NKOA 4GAJL 1WTLA 1OAXH 5FUCE 5GJSH 5IROC 1CICB 1BD2B 1KJVA 3L6FA 4C4KT 4E42A 4KC3B 3T3PE 1HILA 4DTGH 4L1DA 3T1FB 3O9WB 3KYAA 1OTUC 2QHRH 3B8YA 5DD6A 5MP6L 1D9KC 2B1HH 4F15B 3I75B 3RWCB 1ZA3B 5INDA 2EDDA 1H3VA 4QHUA 4QGYA 1FH5H 3MRHA 3BDYL 1G9MC 5KSBB 2H3NA 3GMLA 2Q3ZA 1L4IA 3RGVD 4P57B 5GGRA 2GIYA 1A4KA 4Y5XA 5H94B 3VXUD 5EBWA 1V7NL 5F7YC 5IROA 3RX8A 3HLAA 5I8EA 1X5LA 1FNSH 1X5KA 4RMUA 5GGQH 4GKSB 4NN6B 3GSNB 4UTAL 3GJFH 2DQJH 3MLZL 3UDWC 1D6EB 5L0QB 1NGXB 1Q9OA 3TJHD 4DAGH 1JMZA 1JWUB 1F8TL 3B5TA 3UX9B 2DWDB 3PQYE 2VUOA 1EVTC 5F72S 1Z9OA 5EBMA 1J0KA 1OW0C 2Y6SD 4PYHA 2WBJC 3U9PL 1ES0A 4N0CD 4X7EC 1IEHA 2W07A 3SGKA 4XC3L 4Z7OF 3STLA 2JJSA 4WTZA 4RDQG 3EGSA 4ODTL 4XMLL 1TZGH 3G6DL 4KV5F 3WXWH 3GMMB 2Y36L 3DXAE 1F11B 3EYFB 3RVWC 5C0AB 1I7UA 2CMRL 1C5BH 3NH7L 4S1DC 5C0CE 4OD1L 2EZ0D 5TE4L 2HFFA 4RBPH 3ZYIA 1L7IL 5A3IC 5C0RL 4JZNA 1PVHA 1JVKA 5KOVC 2PXYC 5ERWB 1YYML 3KPSA 2X4SA 1JE6A 1QFUL 4OGAC 5E7BA 5F7UA 2OTUB 1OAQH 4N9GA 3MC0A 3ZE2F 5EZOL 4QHLA 3REWB 1JGEA 4I4WB 4RA3A 1E4KC 1WFOA 3QA3B 3UDWA 2OI9B 5GGTL 3MFFB 2BNUA 2V9TA 3BP5A 4HKZB 1C1EL 3NZHL 3IB4A 4OLWL 3AC0A 4YQXH 5JPMA 4ZPTB 1U2HA 4MQ7B 3TN0B 1OW0A 1T20A 3V4VL 1KT2B 2QR0B 4YHZL 4M3KB 2BC4B 1OLZA 4NZTH 3ORJA 3ISWA 2DKSA 3GFUA 3LRSB 5I1AB 2YD9A 4I8DA 4EOWL 4ELKB 4KQ3L 4KI1A 1DEDA 5D7KD 1IGJB 3VXNA 1UM5H 2MMXA 3GBML 3CLFH 3OKOB 3BD3A 1MAKA 1I1AC 4FQXB 5DC9B 1B88A 4OZGA 5CUSL 4OLVL 1OF2A 5IEKB 3IFOB 2VZUA 1QHOA 1RUKL 1NCWL 1KCLA 4PJIE 3MRBA 3RKDC 2GCYA 5T1DH 3BAEL 4XNXH 4KXZI 1MF2H 2DMCA 5DD0H 5FA4A 3IGAB 1P84J 4MD4A 4GW5B 4F80A 5FA3A 3QUZC 1I1FB 1D6VL 1BECA 2YK1L 4MJIB 2GFBB 3CX5J 1JWSB 4EDWL 4WGWB 4WJ5A 3C09C 1F3JA 4A2LA 5DD1L 1CDBA 5B38B 1IQWL 1NCUA 4JDZA 3OHXB 4MXVE 3WYRA 3G5XB 1AFVH 4YC2B 5IB3A 4PY8I 1QLEL 2EEBA 4E41A 3MLWH 5CZKA 4U7MA 3CDFA 5GGRY 2DDQH 1BVKA 2UZIH 3RA7L 5EWIH 4K55A 1GHFL 1I1YA 4NZRL 4PJ5E 4PTTB 3TT3L 4AMKH 3M17A 1RU9H 4HWZB 4LLQA 1S7VA 3ZE2E 3F12B 1GC1L 2OCFD 3AROA 3CFBA 1I9JH 1H3UA 3EZ8A 3QUML 4U1GC 5I2IA 2GY7B 3P9WB 1MRFH 1R3LB 3GI9H 5CEYA 4LLDB 4LKXB 3MRFA 4S11A 4XZUB 3G5YA 5FCUH 4E0RB 3CFDB 5L88H 3LKRB 2VMFA 4EUPA 2DD8H 3LVEA 3MV9B 1F58H 35C8L 1JTOA 1CL7H 2NY5L 3AFLA 2NXZC 3V7MA 3EDFA 3SE8H 3SCMD 1A6ZB 5EO0A 1QD0A 3I9GL 5ALBL 4E41D 1IGML 5I19H 2X41A 4X5WB 5FO8A 4HAFA 1WZ1L 4H8WC 4LU5H 3BT2H 3TBYB 5HGGS 2DAVA 3BH8B 4HXBL 1K8IB 1WUNT 4HC1H 5D1ZB 4ZTPL 4FQQA 4RDQF 1U8KB 2ZSVB 3MYJA 3MRPA 2EYTB 1CDIA 3CU1A 1LD9B 2VZSA 4H0IA 4LNRA 4XNUL 1T6WA 4NQED 1S7UB 4JM2A 3MV11 1IC5L 3EO9L 3SKJH 3DV6A 5EUOF 3HE6C 5E6YA 2WBWB 3SKUD 4XVTH 3GBNH 1XGPB 4NCC2 5IHZA 5C0BA 4KK5D 2XZQL 3ARGB 4R26H 4TULH 5E2WL 3AS3A 3V6OC 1MFNA 3ZDYF 4M8QA 3C87A 5IR1B 1QACA 3G5VB 1MHHB 3OR6A 4GS7B 1FZMB 3OKNA 3OXSB 3SJVE 5EOQH 1BFVH 1FG9C 1FIEA 3O2DL 1K85A 3BHBA 4CUCA 1IE5A 3ZTJG 4K7PX 1CQYA 3RAJL 3M45A 2Y25A 3C6SB 3GJFK 1EGJL 4FP8H 1CFSB 2WK2A 4HT1L 4Y2DA 2FIRT 3BW9A 1SEBB 4KPHL 3NIGF 4HPYL 2YKLH 1JGDB 2JKXA 1RZIA 2QSCL 3LOWA 2PTTB 3UAJC 4JM2D 4P2OB 4QT5A 4WUKL 1QKZL 3MTRA 5CBAB 4HH9B 4OM1L 4MS8D 3GSUB 1KJMB 3RQ3A 1ZWIB 3GMQA 3V6OA 1YN7B 4Z8FL 4YGVA 1A6TB 2NY6B 3QO1B 4NYLB 5DJ6A 4NNYB 3RP1A 4OT1L 4RBPK 1JNLL 2D7TH 4NO5A 1YPZB 1SBBA 5HXMA 3NIFE 1NL0L 1T1YA 4NQXA 4O4YH 4KK6C 3T2PA 3U7AA 1MFDL 5TDNB 3PABA 2VC2L 2ADIA 4JRYD 3MA9H 3QBTB 5DQDH 4IRZL 3S5LB 2AJYH 4Y2DD 2BNQA 3RX7A 4HAGA 1H15A 3GMOB 3NFPB 1ZHLA 2W9DH 4ZS6C 4BM7A 3D5OF 4IRJA 1F00I 1RZFH 2V2TB 3S97C 4KAQH 2Q86B 2ZSWB 5D93C 4IRSB 1JRHI 4JFDA 5JR1H 2CDFB 2R29L 2XPGA 2L7UA 1CLYL 2DLFH 5D70H 3U46B 5F7EH 3T0XA 4UT7H 4L4VB 3CXDL 2C7UA 1S7QB 1YNKH 1LEIA 2OTWB 4M1DL 5K9OA 1K5NB 1T5WA 1KJ2L 2G75B 4PGEB 4RMWA 3KR3H 1A47A 4RWHA 5CGTA 2XZCL 5J13C 2B39A 1UJ3B 2IAMB 2XKUA 2BNQD 1KLUA 2JK5A 3NIGE 5CZVH 3TBWB 4HJJH 3S36X 5EIVA 3RU8L 1H3GA 4RAVA 3CVHL 4MA1B 4YFEA 1MCWM 2QSVA 4OIIH 4IRJD 3MRLB 4DK3A 3RI5F 1JZ4A 5F89A 3L9RA 2D4DA 4Y4HC 3VD5A 5FDWA 3QZWA 4JFDD 2FL5A 2XA3A 5ETUA 1IFHL 2P1YA 1VPOH 3H42H 4J3OC