3TA6A

Structure of mycobacterium tuberculosis triosephosphate isomerase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
255
structure length
255
Chain Sequence
RKPLIAGNWKMNLNHYEAIALVQKIAFSLPDKYYDRVDVAVIPPFTDLRSVQTLVDGDKLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAATALKHGLTPIVCIGEHLDVREAGNHVAHNIEQLRGSLAGLLAEQIGSVVIAYEPVWAIGTGRVASAADAQEVCAAIRKELASLASPRIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGGASLDGEHFATLAAIAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Structural and functional characterization of Mycobacterium tuberculosis triosephosphate isomerase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
total genus 94
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ta6A00
1VPXA 3KRSA 2QR6A 2RKXA 4ZQOA 4IMEA 4LTSA 2C14A 5D09A 2QAFA 1FCBA 5EL1A 3ELFA 4PL1A 4WY0B 3LX9A 1KV5A 4ZQNA 4KWWA 1I8JA 1EP1A 3I68A 5FF0A 1JVNA 1FXPA 2TMDA 1XUZA 5LHEA 3IGXA 4JTFA 4IWWA 2A4AA 1ZCOA 4QNEA 7TIMA 1OABA 2DZTA 3LHUA 4CQ8A 1TV8A 5G5IA 3TC7A 5E1QA 5TIMA 1DKWA 1GZGA 3CWNA 4RXFA 2WKJA 1Q6LA 2G5WA 4QM1A 3G1FA 5G4EA 2DZPA 4GWEA 3STEA 1FQ0A 2ZZ2A 1XCFA 3EEGA 2WSRA 3GNDA 3UWQA 4LS1A 5AHLA 1H7XA 2CZ5A 3TX9A 1T8XA 3I7SA 1AG1O 3P82A 4HNTA 2E6AA 4O19A 5T26A 4AF0A 2NV1A 4GE8A 3MBFA 3W3OA 1SU5A 4ALDA 2VFFA 1GOXA 2ABAA 3W7OA 1AW5A 5HR7A 3STFA 2YX0A 3M0ZA 3OEXA 4Q4KA 4RV8A 4N9DA 3FJ6A 5D02A 1H1YA 4HSNA 5L9FA 5KZDA 2A5HA 2C0AA 3FS2A 3W2JA 5G2IA 3TAOA 2ATSA 2FB3A 2DU2A 1H51A 3G1VA 2QKFA 2E5CA 3W7KA 1W3IA 1P4CA 4PEKA 3RK8A 4DF1A 2Y89A 1JQVA 4BFAA 2NXHA 3TW7A 2DORA 4IMCA 1JR1A 2E6DA 3NQCA 2CFFA 4UUIA 2Q8LA 2NLIA 5EBUA 3LTPA 2CZDA 4JICA 4S1FA 1WBHA 2FPTA 4DXVA 4NXKA 5LGXA 4GUJA 3LRKA 2OT0A 4KWVA 5LZLA 2PC4A 2GVGA 4XBSA 5DY2A 2G97A 2NUYA 3IVSA 3W7CA 2QCMA 2JKAA 4PODA 4FXSA 3KRZA 5AHMA 3GAYA 4HNVA 3CEPA 3G1XA 3QPYA 3CU2A 1IXOA 1AK5A 3B03A 1CW2A 4OHQA 2QCLA 3GZ3A 1FY6A 3L2IA 4MJZA 2JKEA 3NL3A 5LNWA 1GTEA 1LBMA 3NZ1A 4Z0JA 5AHNA 3C4UA 1TPB1 1SSDA 1W3TA 3N9RA 1KFCA 3KX6A 4HNUA 5FEWA 2A21A 1AW2A 1Y0EA 3G0SA 1GTHA 1ZAJA 2E09A 4ADSA 1OF8A 3GLCA 4PCFA 5F2LA 3O63A 1LZOA 2V5BA 3PC0A 1XC4A 5K9CA 2WJZA 4M6VA 2QUTA 3NDOA 8TIMA 1EP2A 1VLWA 1MXSA 3LV6A 1WX0A 3IGSA 4YCOA 4RXGA 3UPWA 3N34A 4EF9A 1UUOA 4K8HA 5BW6A 2GJLA 3PUOA 2E5BA 3PULA 5D2WA 4CNPA 4E2DA 3M16A 2Y7FA 3L0GA 2TPSA 4IMFA 1GYNA 1W37A 1EUAA 4WUIA 2YSWA 3IIZA 4LRSA 1JCYA 1B9BA 1U5JA 2A7PA 1W5QA 4HT3A 2YYUA 1ZAHA 3WJWA 2QF7A 4IUOA 4YMZA 3PBYA 5BOOA 4FO4A 3UWZA 1Z41A 5G4WA 3E12A 5HUPA 3G1AA 3GDMA 4AVFA 3C2VA 2E1DA 1DQXA 1EUNA 3P5YA 4N6EA 1RQEA 5EKYA 2P10A 3O1NA 5AYYA 4KKXA 4DEFA 3MI6A 1S5WA 1TIMA 2OZ0A 4D2JA 1G4EA 1VC4A 1SW3A 1VHNA 4JTSA 5KTLA 3A5VA 1S5TA 2VKZG 4HPXA 3K30A 1OFBA 4P2VA 3SGUA 4O1AA 5D2YA 3WJZA 3CT7A 3R89A 2FQIA 3TA6A 4UIOA 5CZJA 1ZY9A 3W1QA 3MWAA 2BTMA 2OJPA 3G1YA 3NPWA 1YXYA 3TSDA 2WOQA 3AJXA 3NPUA 3O16A 2J6XA 4I7WA 1GQNA 3SSJA 2RHGA 2BSLA 3MJYA 4UTTA 2WV8A 3MYOA 3W76A 4BI7A 1KTBA 1WA3A 3BGGA 3NGJA 3W2KA 3W7EA 1LOQA 4JYDA 1EWEA 1PIIA 3BV4A 2Z6IA 1K02A 4UTIA 1OFOA 4O0KA 1TPEA 3TXZA 1OK4A 3M41A 3EWXA 4A3UA 3U2OA 5DCBA 1E51A 3E96A 1X6UA 3N9SA 3EWYA 4NNCA 3CHVA 3TJLA 1AL7A 2A7NA 2I1OA 1R46A 4K38A 3W72A 2HS8A 1VJIA 1KM3A 5AYZA 3VE9A 2RDTA 1G4SA 1SZFA 4A22A 4TMCA 4FNQA 3INPA 5CPNA 1L6SA 1TCDA 2QEZA 1D3GA 4Q32A 3LGEA 4Y8FA 5LHFA 2AQWA 1SSGA 1AL8A 1QOQA 3W2LA 3JRKA 3P80A 4JGDA 3W2UA 1JUEA 1ZFJA 2FPYA 1DL3A 3RU6A 3EXSA 3LM7A 3FLUA 3NL5A 1J5TA 3W7DA 5HNRA 3G18A 1XBXA 3MHFA 3NZRA 2C16A 2V2HA 5EY5A 1R47A 4JTEA 2QJHA 4NJHA 2O7SA 5SWUA 3DFNA 4YLWA 2YYTA 2A6LA 3CWOX 3FYOA 3LBCA 3QMTA 3ZR4A 3TU9A 1OFAA 4K6AA 1ME7A 1JCXA 4NUWA 3KVLA 2ZCGA 2NZLA 2RH9A 3BGJA 1TTQA 5CGQA 1KLYA 1FX6A 3QQ1A 4K37A 1KM1A 3PM6A 3OA3A 5CZTA 3EX6A 1HO1A 3O6DA 4G1KA 3L66A 4N4QA 5HULA 3N2XA 3SECA 4GUGA 4DO4A 4JXCA 3C6CA 4Z1AA 3MHUA 2Q8ZA 4UFKA 2B7QA 4EVZA 3VI2A 3HOJA 1TPUA 5F1VA 4TU1A 3PBWA 1OFQA 2Y7GA 2P0OA 5I3JA 1TTPA 3I65A 3W7HA 1ICPA 3GIYA 4RZ6A 1NVMA 3GAKA 4KFPA 1JJKA 3NVTA 3KVJA 1HO4A 2J88A 4XTDA 3MBDA 3A23A 2QDGA 4WXYA 3IVTA 3HGRA 3FFSA 1QNVA 1FDJA 3P81A 4GUFA 2FJKA 1KFBA 3SFKA 4AXKA 4MUZA 1DHPA 4RLIA 2GOUA 3W1AA 3TDFA 4OU1A 5KZEA 2VFDA 3NQ2A 1P0NA 2ZRZA 1YLVA 1OJXA 4Y9AA 3GR8A 4NVTA 2BXVA 2DZSA 5FF7A 3TQ0A 5A8GA 1EWDA 3DKLA 4NU7A 3W7JA 1QR7A 1XUUA 2ZTKA 3E0IA 5D38A 1ZJIA 3MI3A 2ZRVA 1X7FA 3T78A 4B5NA 5BRBA 4LU0A 1YDOA 3G8RA 5D37A 3LI0A 3EWBX 5G1TA 2Y70A 1M5WA 4LWWA 2H3BA 3M6YA 1KM6A 5IBXC 4OT7A 3OBKA 4Z08A 3M9YA 4Q33A 5I3HA 5KINA 1WYIA 3CPRA 4A2RA 3E49A 4LVAA 2GQ9A 4A2SA 1G6CA 1J2WA 3P62A 3NM1A 4JTUA 2QCDB 2WNNA 1EPXA 3PG8A 3BLIA 1GVOA 3KAOA 3NPXA 2Q3OA 1EP3A 3NQAA 3S42A 4UTLA 1ME9A 3SGZA 3TAKA 4FNPA 4MYAA 3PAJA 2DZXA 2Y62A 3LDVA 2QCCA 4CQAA 4PL2A 1O95A 1TPDA 4HN4A 4AWTA 3OHIA 4O16A 1QFEA 1B3OA 2B4GA 1EA0A 1WBJA 4JTIA 3IIVA 3Q94A 1CI1A 4GJ1A 4CCDA 3QF0A 4MZYA 3ABRA 4CNNA 4DELA 4XUGA 3HBLA 5K4XA 4PTNA 3A21A 3U6WA 3O06A 4O14A 1PHQA 3NO5A 3PSWA 3NQ7A 4MPQA 3FA5A 1JRBA 5CZSA 4NZJA 1UJPA 1YDVA 3NR0A 3TSBA 4IMGA 1YXCA 3CEUA 4K7YA 4DF0A 1VQTA 4GC4A 4UFHA 4NX0A 4ZMGA 3GDLA 4UR8A 4WXZA 5AHFA 1VS1A 3DENA 3LLFA 4LVGA 2Z6JA 1WXJA 4BI5A 3PB0A 4MZ1A 5FEZA 1SR9A 4AHOA 4O11A 2C6QA 3HMJG 5DBTA 1M6JA 1H7NA 4EOUA 4AF0B 1OFRA 5A5WA 4UTJA 1N55A 3EX1A 4NJGA 5F2GA 3ZWTA 4X2RA 3L5MA 2XN2A 4QQ3A 3O07A 2BX7A 1RV8A 1IF2A 5AFDA 3C52A 5HJLA 4N9EA 3HG4A 1H7WA 1I4NA 2NX3A 3DBPA 1OX4A 3S5NA 1K7EA 2F84A 1R2RA 4POCA 1FCQA 1H61A 4I7VA 3W83A 5HWMA 4JY8A 1FWWA 3LXAA 4ML9A 4MLJA 2XFWA 2J9YA 5CPLA 5FF4A 4AWSA 4RZ5A 3QPZA 3GR7A 3A24A 3TKFA 3W2MA 3EKLA 4IQLA 2J9XA 3W87A 4PA8A 3W1RA 4XWUA 4CCEA 4ORIA 3MHGA 4JR5A 4ZL1A 2PRHA 2CU0A 4NJIA 4NNAA 1DV7A 3E9AA 5CKSA 4K7VA 2H8XA 3GYEA 2FB2A 4BWLC 2VEMA 4O54A 3MP5A 3W7QA 4QSHA 3NQMA 3GXTA 4N9BA 3UXAA 4HPJA 3PVFA 3QFEA 2ZA1A 1TYGA 1S3HA 2OMAA 2E68A 3L5LA 2C18A 1F5ZA 1GEQA 4O57A 1T99A 2V30A 3PF3A 1VLIA 2CLIA 3TXVA 4UNLA 4UC5A 2PCQA 1TTIA 1K8YA 2FTPA 1O60A 3CM4A 3CB8A 5AYXA 2HS6A 4LUIA 4O13A 2V5LA 3H55A 3HG2A 3IEBA 4ZQCA 4WZHA 3BG5A 3W1NA 2ZYFA 1UUMA 4CQ9A 2CLFA 1MEWA 1T96A 4EF8A 4ICNA 4RCXA 3LB0A 4O28A 4RK8A 2ZBTA 1LRQA 1R2SA 2LLEA 4A21A 4TIMA 5L6UA 3OVRA 1TPFA 3A5FA 2ZZ4A 3PSVA 4Z1BA 4DBEA 1JRCA 1FCVA 4FNSA 4O10A 4EWND 2Y61A 1KM0A 1NFBA 3LCLA 3S5ZA 5FI8A 2Z0IA 1RVGA 2ALDA 3NXFA 3O15A 1VCGA 4WD0A 1W54A 3QSRA 3W85A 3ATZA 3YPIA 4E2BA 3B8DA 3G1HA 3PWAA 2B7NA 1K03A 1GVSA 2WSYA 1OK6A 1LBFA 4UTWA 3OIXA 3EXTA 1GVQA 1FBAA 1W56A 1ZENA 3LI1A 1J4EA 2DP3A 3W07A 2XN1A 5DN1A 3UY7A 3LCIA 3WK3A 4LC6A 1I45A 5MHBA 1P0KA 4M6PA 3RLUA 2CZFA 1TJRA 2VC6A 3JS3A 3W7GA 2B7OA 4LW7A 3WJYA 1O5XA 2A85A 4UTMA 3IIOA 3R5EA 4NNBA 3NQVA 4PFMA 2EHHA 3LXBA 3W7PA 4IMDA 1D3HA 3W7MA 1FCUA 1KFEA 4P61A 4QITA 2Z1BA 3SY5A 3DAQA 4IJBA 4N9CA 1G69A 3GKFA 4DPQA 2A2IA 1LBLA 5D2VA 5LSMA 2RDUA 3ZFHA 1UBSA 2E5DA 5HWNA 3N73A 1GYLA 3NQEA 2J24A 1RR2A 3G0XA 3GKAA 2OX1A 1KV8A 1WOBA 2NUWA 2R91A 2FLIA 3DZ1A 5KMYA 3DHDA 4O1BA 2TSYA 5DCDA 1NAL1 4UTHA 3WK0A 3G22A 5ABTA 1BEUA 2QUVA 1VRDA 4BK9A 5K7JA 2H3DA 5DBUA 1K8ZA 4KFOA 2CLHA 4MVAA 2NV2A 1KTNA 3SW6A 4QAIA 5EPDA 2E77A 2YPIA 3KOFA 1XDMA 3KRUA 3B4UA 1GWJA 5BMWA 3MP4A 4IPIA 5G2WA 1FWSA 2ABBA 4O8RA 3W6YA 5EMUA 3C2OA 1EX5A 1TPH1 3LV5A 2EAWA 4N2YA 4JX4A 4DQWA 5G1YA 3MUXA 3E02A 3SJ3A 2ATMA 2EPHA 4R34A 3BW3A 4FB7A 4ADTA 4LV4A 3BW2A 4OE7A 4H3DA 2VENA 3LOTA 3PG9A 4RJEA 3NOEA 1M7PA 1OYAA 1TPVA 3NA8A 2R14A 2A6NA 3S5YA 4ZQPA 1JQXA 1Q3NA 3M7WA 4LY8A 1SW0A 1Q6OA 5I3FA 1LYXA 2J9ZA 3H53A 1MZHA 2QCFA 3W1PA 3RF9A 4UFIA 1MEIA 3DU0A 1FWRA 3QYQA 1F7BA 4FEZA 4AHPA 4OGZA 1VYSX 2A7RA 3TFCA 1Z42A 3ABSA 4X3ZA 2ZA2A 2G95A 2DZWA 3GXNA 1YTKA 3QMRA 3QRHA 4O1DA 2C13A 4FX6M 3C56A 4JTTA 1TREA 3NQ6A 3GDRA 3F4NA 3TC6A 2X1SA 3LLDA 3TCEA 4GUHA 2W6RA 3KVMA 3LHVA 3LERA 3GXPA 3LCWA 1WAUA 1PL9A 4O50A 1IIHA 1O94A 1HTIA 1W8SA 2WO5A 1C29A 4C1KA 4YXGA 4Z1DA 4O15A 3T44A 2ZQ0A 2A1YA 2GVLA 1SFLA 1YPFA 3F1QA 3LHTA 1ZNNA 4AEOA 3TNOA 1B4EA 4JDBA 1BTMA 5EYWA 1L6YA 1KM2A 4L4LA 2QCNA 1BKSA 3T55A 4LVDA 3FIGA 3MO7A 1DBTA 4CCCA 5DELA 5H2ZA 1M7OA 1RQBA 5D2TA 5AOUA 1H7RA 1PCKA 3C2RA 1GVFA 4LNYA 1F2JA 2V81A 1N7KA 4O1CA 5C6MA 1RQHA 3C3NA 3S1XA 1LORA 1T0OA 4QISA 3BO9A 4ADUA 3C2EA 2XN0A 3L21A 3T7VA 4WX2A 1KFKA 1SFJA 3BG9A 1JUBA 3CQ0A 4JYEA 3NEVA 1LTDA 5CPMA 4FHAA 1IXNA 2P1FA 4U4MA 5D04C 4ZQMA 1A5CA 1DJNA 4AMAA 2ZRXA 3HGJA 3B0VC 4MY9A 2CW6A 4J9JA 5HINA 3I6RA 2QDHA 3P67A 4FNUA 3EWWA 4AH7A 1JCMP 3UNDA 3W23A 4E0CA 2WPBA 4A29A 2PE4A 2GQAA 4Z0SA 5CG7A 5HWJA 5AN7A 2JKPA 1X1OA 4FNRA 3VCRA 3NAVA 2KZHA 3TFXA 1TB3A 2ZZ5A 1GPWA 5D2XA 2QAPA 5KZMA 3IGUA 4RX0A 3S8HA 4R7JA 1P1XA 1ALDA 1QDSA 2VEIA 1OYCA 3BK0A 1LLZA 5DY3A 2NX1A 2AAMA 4UTKA 4PC8A 3B05A 1DOSA 1KLZA 3QW3A 1ZALA 2YGYA 3L9CA 4O18A 5KITA 1ADOA 1TSIA 2Y85A 1EB3A 3NPVA 1AW1A 4WOQA 2H90A 4JDYA 2WNQA 3RMJA 1W5PA 1X8FA 4IXHA 3T40A 3FYPA 1SZNA 1DVJA 1WOAA 2E6FA 3LHWA 3B0PA 3LHYA 1IIGA 4NXSA 2CLOA 1FDYA 1OFEA 2X1TA 2YFOA 3V75A 4M19A 2WSQA 1KA9F 4O12A 5IM51 1LCOA 4AB4A 3W1UA 4AWUA 3TMLA 3C8FA 5H91A 5AC7A 2IQTA 1K7XA 3UY8A 1GT8A 4DF2A 4LOCA 4HNNA 4O17A 1JULA 2AGKA 2QCHA 3GDTA 3WJSA 4E38A 3UZ5A 3W9ZA 1RPXA 4N02A 4U28A 3OG3A 4XKYB 5AC8A 5F4SA 1W5NA 1IXPA 3N19B 4MOZA 3MYPA 1SUXA 2C3ZA 2PRLA 1TO3A 4M7TA 4JIQA 2GJNA 4LVBA 4W9TA 1FUYA 1ZAIA 1FWTA 2DZUA 4UNKA 2ZTJA 1G7UA 2NXIA 4GFSA 3P8IA 4AAJA 1HFBA 2EF9A 2ZRUA 2HTMA 3R12A 1VYRA 3LCFA 2ZA3A 5FF3A 3M47A 2H6RA 4L4MA 3MP3A 5F2MA 1CX9A 2VXNA 4DO5A 4ZVJA 1DORA 1I2PA 4UFMA 1JCJA 3HGSA 4MIMA 3TR2A 1OX4B 4JY9A 4XKYA 1KW1A 3TJXA 4H6KA 3O6CA 1OHLA 4X9SA 3HPSA 3HGOA 3L67A 4DO6A 3DI0A 4KFNA 4LVFA 1A5BA 4ONVA 1L2UA 3A22A 1EEPA 3IVUA 1HL2A 3L0NA 1ONRA 3P61A 3KHJA 3Q58A 1FDZA 4M6QA 3PUEA 1QAPA 3PR2A 4UMCA 1L9WA 3P5ZA 1UCWA 2VFEA 3GNNA 3R13A 3TH6A 1W5MA 3S1UA 3STGA 1QPRA 2QUUA 2W0UA 1ML1A 3TV8A 3DHFA 2C15A 1EIXA 5FESA 1Q6RA 3GDKA 4N4PA 2QCEA 3UD6A 3M5XA 2CLKA 1W3NA 3VNDA 4FX7A 3MW7A 3N2MA 3LCXA 5K3VA 3HPZA 3NQGA 1Q45A 3G3DA 4TR9A 5K9DA 1XBYA 1NEYA 3LCHA 5CSRA 1IXQA 4NJKA 1YTEA 3P84A 3W22A 2Y6ZA 3ZWSA 1G4PA 2GPTA 3W7NA 2TYSA 4NZFA 5DXYA 3BLFA 4FIRA 5I3IA 3S9YA 1ZHAA 4FX8A 1LDCA 3EX2A 4K8EA 4LS2A 1UASA 4QIUA 4LRTA 4XZ9A 3HB9A 5AB3A 2C1HA 2V82A 1QOPA 2WNZA 1W5OA 4H4IA 1SZEA 4Y90A 2GUUA 1VYPX 2Y63A 4JTGA 1QPNA 3UWYA 4HHPA 1H60A 2FPVA 1YYAA 4MY8A 5J5RA 4OBTA 2PRMA 5DXXA 1PHWA 1SW7A 2GQ8A 4JIPA 3C0JA 2CZEA 4O4WA 4JEQA 3QC3A 3TW6A 3UWVA 1VR6A 3V1PA 3G8EA 3W88A 3I7QA 1O5KA 2UV8G 4MFEA 3B0UX 3LRLA 3KFTA 4WY0A 3AO0A 3QEZA 3LRMA 3VKJA 4XQ6A 5E93A 2ZDRA 1KM5A 1YDNA 4WQ6A 4K36A 1WV2A 3RNDA 4UMBA 4DPPA 4IXXA 4JX5A 1TRIA 4UTTC 3M1ZA 5CPOA 1VZWA 4UFLA 2ZZ7A 4GBUA 3BLEA 1B57A 3S6DA 4R53A 3G1SA 4XBKA 5HQEA 1F74A 1SO5A 2JK2A 1OYBA 1HUVA 5K9XA 1JUKA 2QJGA 4JX6A 2DJLA 3EX4A 2RDWA 3L68A 3WJXA 5IBXA 1SQ7A 1VGAA 4UCGA 2FIQA 1IGSA 1FXQA 1MO0A 1A5SA 5FEXA 3TSMA 2RFGA 1NF7A 2G96A 3SI9A 3SZ8A 3DFPA 2VFIA 4M7SA 1G67A 3CIXA 1YTDA 3EB2A 1SO3A 3HQ1A 3QW4B 6TIMA 1I2NA 3W75A 4WY0F 1HG3A 3L65A 3G3MA 1DJQA 3L0KA 3C61A 5CSSA 3PBVA 1TV7A 1VHCA 1PVNA 2DJXA 2R8WA 3S5OA 3PB2A 1XFBA 2ISSA 2CLLA 3VFLA 3TK7A 4RZ4A 1OVDA 3UPBA 4UR7A 3THQA 1LROA 2QCGA 4I7UA 5TBOA 3IRDA 3FKRA 4M5PA 1H7PA 3DFTA 3OVQA 4QJ1A 4YCPA 5HMSA 3UZJA 1TQXA 4CLMA 1F05A 3MI2A 4FXRA 2YFNA 3EX3A 3UWUA 1W31A 3P74A 4IPJA 4NQ1A 4OQVA 1OFDA 1GVRA 3TE9A 3WK2A 1THFD 2E6YA 2VEPA 4IX0A 1AMKA 1YADA 2VELA 1F6KA 3W1LA 1H5YA 5CZ0A 4JYFA 4QNWA 4BI6A 3IIPA 2WQPA 2PURA 3O05A 3USBA 4WJEA 1PV8A 3CLMA 1TMHA 4I9AA 4R33A 2JGQA 3L5AA 4S2BA 1SPQA 3HG5A 3MMTA 3NQFA 4MFDA 1SO6A 3M5YA 3EXRA 1TQJA 5C2XA 1OX6A 2X2GA 1TV5A 2X1RA 1LOSA 4LC8A 1MSSA 2D73A 1YPIA 3STCA 3DXIA 4MKNA 4LUJA 3T4CA 5K4ZA 3UWWA 5F2IA 4GUIA 4IGHA 3PS7A 1TPC1 1OFPA 1PS9A 1LM1A 3B04A 1QPQA 3TIMA 2FDSA 3G0UA 3TMQA 1S5VA 4BWLA 1KFJA 1GG0A 5KSWA 3BG3A 4N6FA 1DQWA 3W2NA 1Z48A 2YCEA 2BZNA 1ICSA 1KFLA 1H7OA 1V7YA 4JTLA 1SO4A 2CWNA 3CIWA 4FF7A 5DLCA 5LNVA 2Z2UA 2NWRA 4Z1CA 2W79A 3LTSA 3DFQA 3BW4A 3PBUA 2O7QA 4MYXA 4TMBA 4WOZA 1A53A 4UTUA 4CNOA 1P5BA 3F03K 5BNKA 3UQNA 4O52A 1N8FA 4O4VA 2NUXA 3DFSA 3G24A 4JN6A 4UMAA 3N3MA 3Q2DA 2Y7EA 4RR4A 4LT9A 3VE7A 1VH7A 2EGZA 3LCGA 3ZS4A 1D9EA 1H1ZA 6ALDA 4DBDA 1OG0A 1TTJA 3QH2A 2V8ZA 4LS0A 1XM3A 2NXGA 3P8JA 5K2ZA 3QM3A 3QMSA 4LV9A 1NF0A 3NM3A 1U83A 3W1MA 3P7YA 3P60A 4MY1A 3HIJA 1K3UA 3GK0A 1O4UA 3A9IA 4O0ZA 5C54A 1VCFA 5J5DA 3H54A 4YL2A 1OF6A 3W70A 3HO8A 3WK1A 3S1WA 3O8AA 4MZ8A 2ZRWA 1YXDA 4UFJA 2FFCA 4HKPA 4EIVA 2VEKA 2ZZ1A 3DH7A 1V5XA 3KVKA 2X16A 4TX9A 5C55A 3EKZA 2DZVA 2B7PA 2QJIA 2V2DA 3NNTA 1GJPA 1PCWA 3GVGA 1LRTA 1XL9A 1R30A 2B0MA 5D32A 2ZZ6A 4C1LA 3QQ0A 3WFAA 1K8XA 4K39A 4JS3A 5I3KA 1SZGA 2YZRA 4JD4A 3THAA 4ZQRA 3W1TA 1G4TA 2TRSA 1TJPA 2CLMA 1K7FA 3W7LA 3SR7A 3HPXA 5D30A 2EKCA 5F1UA 3O6YX 3W1XA 3DFOA 5C5YA 2ZRYA 3Q37A 2R94A 3JR2A 5GVJA 4GRSA 3LXCA 1RZMA 2C19A 3BPWA 3PY2A 1NSJA 2H8ZA 1A50A 1GG1A 3RLVA 2ZZ3A 5AC6A 1TPWA 3U8GA 1I2RA 2HSAA 3NYZA 1KM4A 1XBZA 3W71A 1RD5A 5U7SA 3EWUA 3TUUA 1B4KA 1XI3A 2V0TA 2BWGA 2X30A 1XKYA 3QSTA 2JBMA 2GVJA 1QPOA 3M5VA 5AHIA 4GXMA 1KTCA 1QO5A 5I3GA 5E0KA 5U4NA 5D03A 5FF2A 2VOMA 3G1DA 1OX5A 4Y6GA 3NQ8A 1QWGA 5D05A 5D33A 3ATYA 1I2QA 3QZEA 1XDLA 4JNMA 3TROA 4HIBA 5DCEA 1QO2A 3W7IA 3DI1A 3F4WA 3PUDA 4S2CA 3M5ZA 1QCWA 1PE1A 1Z44A 2A0NA 4O53A 4OV4A 3FEMA 1C9DA 2X1UA 4NT0A 2JGYA 4ZZ9A 3HF3A 2CLEA 3LHZA 2YXGA 5G2HA 4XTIA 1KBIA 3M43A 1QMLA 3CTLA 1H62A 3DGRA 1JCNA 3S1VA 4JTKA 4YWIA 5F4WA 3BVJA 2NWSA 2V9DA 1F6PA 3IV3A 3DKJA 3R2GA 2OCZA 3RFAA 2I14A 3W7RA 2YDAA 4BF9A 1WDWA 4NJJA 3IIXA 2J27A 4MJMA 3GX9A 5LKYA 1JCLA 1WQ5A 2YW4A 4ORMA 5LGZA 5LNUA 5FEPA 1FWNA 1Q6QA 1G7VA 3HG3A 2OT1A 4Y96A 4IOTA 3ANYA 5BMXA 1KBJA 4X22A 3NL6A 2Y7DA 4IX2A 5TQLA 1X1ZA 1H50A 1F76A 2I9EA 4MLRA 1R2TA 3R8RA 4OWGA 5LNRA 3D0CA 2YR1A 4HSOA 2ZFAA 1XBVA 3FJLA 1TRDA 4AHQA 3EWZA 3TQVA 1C8VA 4FIQA 2V2CA 1XXXA 3C2FA 4JTHA 3TQKA 4UXDA 3CC1A 5EA9A 3W74A 2BLEA 3SIZA 4UTWC 4NX5A 3LBMA 5AHEA 1ME8A 5HR6A 1W0MA 1LP6A 3S0CA 3HJZA 1LRNA 1A5AA 1BWKA 2Y88A 2Q3RA 1H63A 3NG3A 1VCVA 3UXDA 2ISWA 2YW3A 3M44A 4RKAA 3NQDA 3I7RA 1LOLA 1F73A 3FOKA 1ICQA 3OVPA 1L6WA 2ISVA 4OV9A 3BARA 4PH6A 5HUOA 1BWLA 3FKKA 3W84A 3LTYA 3KXQA 1I2OA 3UYCA 2F7FA 1UB3A 2VFHA 5F4XA 3B06A 2VFGA 3NL2A 2QCDA 1W1ZA 3W86A 3N14A 1LLWA 3W73A 3ABOA 4GNJA 3QJAA 3ABQA 3GB6A 4FNTA 4JTJA 2HMCA 2NX9A 4BR1A 4TO8A 1MEHA 5LNSA
chains in the Genus database with same CATH superfamily
3KRSA 9XIMA 5D09A 3ELFA 4PL1A 3LX9A 3KTSA 3EDFA 3HQPA 1I8JA 4KWWA 2GUBA 2TMDA 1XUZA 5LHEA 2NSOA 3UXKA 4E8DA 2DZTA 3LHUA 3LZ3A 3H24A 4K3ZA 1H2JA 5E1QA 1DKWA 3CWNA 1UP2A 5B7YA 2WNWA 5EMJA 2DZPA 4IM4A 3UWQA 5FAGA 2WSRA 1JDAA 3IUDA 1H7XA 4ZO8A 1KCXA 3TX9A 4DYJA 4E4PA 4HNTA 3VTRA 3AZTA 2R82A 1PWLA 2YL5A 2AOSA 3W3OA 4C6CA 3MSDA 4ALDA 2ABAA 4TVUA 4GNVA 1AW5A 3BANA 2I57A 4N9DA 2Z2BA 2WJFA 3FJ6A 1H1YA 3UFYA 5HATA 4H8UA 4AYSA 3Q4DA 3FS2A 3TAOA 1UWRA 3UXLA 3W7KA 4PEKA 5EB8A 4GZ7A 3ZZ1A 3EOLA 2Y89A 2E6DA 4Q8PA 2Q8LA 3WLNA 3ISIX 3MTWA 4NY2A 1W9DM 4CNSA 2FPTA 4BS0A 3LRKA 2OT0A 4KWVA 3VKCA 3AISA 3R7MA 5LZLA 1OGBA 3LPFA 1J10A 4P8VA 3BAKA 5A6TC 3VILA 3WH9A 4FXSA 3KRZA 3G1XA 1VFMA 4CQDA 1LG1A 1TG7A 4OHQA 3BH4A 1XIJA 1EX1A 2FMNA 4HZ7A 2Z27A 2VR4A 1U1UA 5LNWA 1GTEA 3QKEA 4U3AA 2XPKA 3NZ1A 2WHLA 5CSUA 2OKOA 1DIEA 4HVXA 3N9RA 1WB0A 1NOWA 1OIMA 2QV4A 3CMGA 2J66A 1EJ7L 2NT1A 5HMEA 2WHJA 1VRXA 4WK9A 5F2LA 5CAKA 4NAEB 3VYLA 1DE5A 3O63A 2DUAA 1XC4A 4W8LA 3NDOA 1MXSA 4KRUA 1A5OC 2R1NA 5ABHA 2PDYA 3UPWA 4RE4A 1GJWA 8XIMA 3KS5A 2G3FA 3PUOA 3TTEA 3M16A 4EACA 3L0GA 1PZ1A 4IMFA 2C91A 3GZAA 4WUIA 5GNZA 3IIZA 4LRSA 1W1PA 3KOWA 1H11A 2NV9A 2HE5A 1V6XA 1W3HA 2PDMA 3GTFA 3IANA 3B8UA 2OQYA 4XAFA 3GFZA 3S2NA 5BOOA 4RNFA 4TXEA 5HANA 4S3KA 4JIHA 4AVFA 3T0AA 3WFLA 3BWWA 2E1DA 1Z89A 1DQXA 1EUNA 1Q2RA 4AZIA 5EKYA 4KKXA 4CU8A 2R1KA 3PJTA 2J7EA 1XGZA 4D2JA 1BSLA 1EOKA 3RRAA 2PTDA 1E4NA 1VC4A 2FZBA 4H6QA 3A5VA 5C9ZA 1BSIA 4R88A 4Y9PA 1S5TA 3FV9A 4ATDA 2ZUSA 4O1AA 1F3TA 5LIKX 3K4DA 2X05A 5FJJA 4R9OA 5CCZA 3W1QA 3MWAA 4W84A 1W3KA 1X96A 3UA4A 3TSDA 3S3GA 1MNZA 2J6XA 4QCFA 1GQNA 2RHGA 3GNRA 1Q4NX 4BI7A 3NGJA 3W2KA 4E4UA 3QOKA 4UTIA 3EZ4A 1E9IA 1TPEA 1RCOB 2Y8UA 1UIPA 3DC0A 4H04A 4A3UA 4ZEPA 4PUMA 4QGCA 3LN3A 1EJRC 1MXDA 3E96A 2INZA 1X6UA 3B40A 3EWYA 4GABA 1VF8A 4NASA 4Q7IA 1ZBWA 2PDWA 2OYKA 1R46A 4K38A 1T7LA 3W72A 1DP0A 5AYZA 2RDTA 1G4SA 1SZFA 4IT1A 3WQ8A 3GU9A 4Q6JA 1F3EA 3INPA 1S1RA 1AH4A 5LHFA 1AL8A 1F61A 2E4TA 4JGDA 3W2UA 1JUEA 4F0KA 3LM7A 1KQYA 1ADSA 1JEZA 3CAWA 1J5TA 1QJWA 3QTGA 4JCMA 1F8MA 1OQFA 2W3ZA 4HCHA 4HYWA 5EY5A 1R47A 1B9ZA 4NJHA 3I3BA 5SWUA 3DFNA 4WJXA 4MNJA 3TU9A 1OFAA 1HX0A 1ME7A 1R87A 3KVLA 2NZLA 5KEZA 2YKKA 1KLYA 3COTA 3IJDA 3QQ1A 5CZTA 3EX6A 5H8MA 1OT2A 4KCVA 3SECA 7TAAA 3TYCA 5A2CA 2PP3A 2A3BA 4UFKA 3VI2A 1C90A 3CAVA 4B3ZA 2Y7GA 2P0OA 4RZ6A 5LIYX 3MV01 1P7TB 1GKRA 1L0PA 3AIWA 5I5RA 4B5XA 4ACZB 4F2BA 2VL4A 3FFSA 1FDJA 1RA0A 2HISA 5AECA 3LZ5A 1DHPA 2GOUA 3WSUA 3URQA 1EC7A 5KZEA 3THCA 2Z25A 4UQAA 1RVKA 1VFHA 3AMLA 2BXVA 1NFPA 4RPPA 1FHLA 5A8GA 1EWDA 1CNVA 1XUUA 2ZTKA 1RSCA 4L6HA 5D38A 3MI3A 4GISA 1MUMA 4Z2LA 4LU0A 1PX8A 1XLMA 4ACZA 2QPUA 2Y70A 4C6BA 3ZT7A 3APYA 2H3BA 3M6YA 4OT7A 4HOZA 2PDCA 3OBKA 4Z08A 1RCQA 2ZVRA 3MB9A 5KINA 1O7AA 1P0BA 1JZ8A 4LAUA 1NELA 3SCTA 3JUGA 3NM1A 4JTUA 3PG8A 3VMNA 3VNLA 1PYMA 3NQAA 3VGFA 2OU4A 2P50A 3MUCA 4YVVA 1S2AA 5FJTA 3NO3A 4FNPA 4HNLA 4DAFA 2DZXA 2Y62A 3LDVA 3NOYA 1B3WA 1MRAA 4CQAA 4PL2A 3U5YA 3EDKA 2IKHA 1O95A 4BEUA 1EA0A 1UR8A 5BU9A 4F40A 1DWFM 1Z8AA 1IZCA 4JTIA 3Q94A 4CCDA 4D8ZA 5M17A 4DELA 4XUGA 4WGHA 3HBLA 5K4XA 1YNPA 3L4ZA 2PF8A 1A47A 1PHQA 3TOPA 3NO5A 3PSWA 1GNXA 2WMIA 1B0IA 1CLVA 1YXCA 3ZIZA 4DF0A 1VQTA 4IL2A 1P1MA 1U33A 2YCIX 4UR8A 8RUCA 2X09A 1VS1A 3LLFA 3BZJA 2GZXA 3G5EA 3VZYA 4RW3A 2GGJA 4MZ1A 4AHOA 4V28A 5DBTA 4GH1A 3QY8A 1JZ5A 1OFRA 4JQAA 1LT7A 4HU8A 5F2GA 4NJGA 2XN2A 3O07A 3PZGA 1R9ZA 3I10A 1QNSA 5AFDA 4R5EA 1POKA 3LS9A 3DBPA 1ZZMA 4KEMA 2CERA 1I6NA 4H9ZA 5BROA 1SFSA 1FCQA 1H61A 4I7VA 3EDEA 2OWXA 4FXFA 2DH3A 3SQLA 2J9YA 3EAUA 3W27A 3BV7A 2D23A 1YNQA 3S2JA 3QPZA 2UWFA 2XVLA 1H3GA 4HGXA 4S3GA 1JDCA 4RV3A 4LUSA 4CCEA 4ORIA 2VR2A 4JR5A 4NNAA 1DV7A 3E9AA 4K7VA 1NM9A 2V3DA 2VEMA 4O54A 3VIGA 4QSHA 4ZB5A 4GYPA 1PX3A 3UXAA 3VINA 4PE8A 3VD9A 3QFEA 1TYGA 2ZE3A 1UMYA 3CJPA 3GVQA 4ATWA 2VGFA 2WKLA 2V30A 2I56A 3PF3A 2WCSA 1MW2A 4R85A 1JFHA 1X8CA 2XSXA 3MCOA 2WZIA 1GHRA 4LUIA 3CUHA 3S2CA 3H55A 1V7AA 3IEBA 3WKZA 1M01A 2CLFA 2OB3A 5AC5A 2I5IA 1TZ9A 2INEA 3QY6A 5EMYA 2BY2A 1S2TA 4HJFA 4W8AA 2LLEA 4BZYA 4A21A 1RALA 4TIMA 2ZZ4A 1FCVA 5DMLA 4F4RA 3DFYA 1NFBA 3LCLA 4IQDA 4QJ3B 5FI8A 3S5SA 1ISXA 4PFHA 4GMEA 4WD0A 3ZSSA 3SBFA 3W85A 1V02A 1W3LA 4E2BA 3VZXA 3M0HA 2EPKX 3FSUA 1EYWA 2B7NA 3D6NA 1OK6A 1Q8AA 2VO5A 3EXTA 2VR5A 1RP9A 3AMGA 3N4AA 6A3HA 2O9PA 1SJCA 2DW6A 2DP3A 1KRBC 1K9EA 2Q02A 4LC6A 1KGUA 1P0KA 4QDMA 4JQ1A 5CAHA 3H4XA 3T2QA 4GQBA 1XLCA 2PWDA 4PUKA 2B7OA 2R1LA 2A85A 4UTMA 3IIOA 2CETA 2EHHA 2FMOA 1D3HA 5HOSA 1EKOA 4QITA 1CXFA 1HP5A 2OWWA 3GG7A 4IJBA 4CD8A 1E4IA 4Q7NA 4ZE4A 5HK4A 3GXMA 5LSMA 1WDSA 4OECA 1KR0A 2RDUA 5T9BG 2J24A 2NUWA 1KV8A 1M68A 2FLIA 3SO7A 2DIJA 5DMMA 1V08A 3B9DA 4D72A 3CK5A 5DCDA 4UTHA 3WK0A 4GJIA 2NQLA 5K7JA 1G0CA 3R8GA 2HJPA 3UR2A 4IIBA 1K8ZA 4DIAA 5FSDC 1FHVA 1KTNA 3C0QA 3SW6A 2E77A 3KOFA 4PUWA 1HNYA 3B8SA 1E43A 1K70A 3M0XA 4IPIA 1VJZA 1OINA 3EA3A 5G2WA 1FWSA 4O8RA 1CB2A 5EMUA 1EX5A 2EAWA 4ES4A 4PRRA 2IUZA 4INFA 4U2YA 4R34A 1FWAC 1V6VA 4HQVA 6ENLA 8XIAA 1TPVA 1O5QA 1S3TC 1OM0A 4PMUA 1JQXA 3WO8A 2C79A 3QOMA 3FA3A 2PGRA 1QHPA 5KETA 4XZIA 2DGAA 4GBDA 3QYQA 8CGTA 3GIPA 3G6LA 3WQ5A 3OPSA 3DYMA 3H8AA 2ZA2A 1BRLB 3AXKA 1YTKA 3QRHA 2XISA 4DLFA 3S46A 3C56A 1JF5A 5GPRA 1ONWA 5IOBA 5FJOA 4AW7A 3LHVA 4HPHA 1IIHA 1TVNA 1X38A 2PDLA 3R6IA 4BY3A 4Z1DA 3T44A 2ZQ0A 1U30A 4WDWA 1YBQB 1PTDA 3UVIA 3WQEA 3ZVIA 1H4PA 4ZFCA 3KZSA 2ZC8A 2ZE0A 3NXLA 5EYWA 3W53A 3RU8X 3UVAA 4GY7A 1UKSA 1BKSA 1XISA 1LF1A 3T55A 1BRLA 3V1HA 3FIGA 3H2MA 1DBTA 1OD8A 1ZB5A 5H2ZA 1I75A 5D2TA 1PCKA 1XLDA 4KF1A 4D6JA 5JU6A 4O1CA 1RQHA 2BOEX 2CLPA 4QISA 3L21A 1VEOA 1W6TA 4WX2A 4PCTA 3WDRA 1GYMA 2XINA 1JUBA 3CQ0A 3M0YA 2YDSA 3UWEA 1GEHA 2NLYA 1LTDA 4P8WA 2BY1A 4PBFA 4U4MA 4DYEA 4ZQMA 3GS6A 4AMAA 2ZUNA 2CW6A 3ITXA 4MKSA 3EWWA 1AZ1A 1EYEA 4QEHA 4HOXA 2PE4A 3OJGA 4Z0SA 5CG7A 5AN7A 5D2XA 5KZMA 2HXUA 4JQ3A 2ACSA 3VIFA 3S8HA 4R7JA 1P1XA 1ALDA 1HJSA 5D9PA 1OYCA 3BK0A 2OTDA 5IFPA 4O1FA 2AAMA 4PC8A 5DANA 2E9BA 3URBA 2YGYA 3L9CA 1H0GA 1ADOA 4G7EA 3B8VA 4MUPA 4JDYA 1P43A 1S2CA 3CQJA 5CC7A 1X8FA 1Z3NA 4IFKA 4IXHA 2O9TA 4ZOBA 3HMCA 3LHWA 4F9JA 4PTDA 3DG6A 3B0PA 3UETA 1IIGA 1E70M 4S3BA 1FDYA 2YFOA 3TN4A 3V75A 3V16A 2WSQA 1KA9F 5IM51 1BWVA 3BC9A 5REQB 4AWUA 3TMLA 1E4LA 4EP8C 1GVYA 3GFYA 2IQTA 1E1FA 4LOCA 2PZNA 3AXXA 1JULA 2AGKA 3GDTA 3WJSA 3UZ5A 3W9ZA 2XVGA 3L4UA 4XKYB 2PB1A 2UY5A 2P8BA 1EH9A 1SUXA 2C3ZA 5HA7A 2PRLA 1DXFA 2PDQA 4M7TA 4Y7EA 3M4HA 4JIQA 3MPGA 1FUYA 1ZAIA 4AY1A 3KL3A 5C71A 4OBSA 2EG6A 4G2DA 2EF9A 4QRNA 4IJCA 2HTMA 3CT2A 2H6RA 3MP3A 4QS5A 4PRWA 1UA3A 1XHGA 5F2MA 2VXNA 4DO5A 5JBEA 1DORA 1E6XM 1B1YA 2I7GA 4PRTA 4DM1A 2G8ZA 1OD0A 3CZJA 4E3VA 2EQDA 2YBTA 4XKYA 5A8QA 1KW1A 3VIHA 1OHLA 1XYLA 4H2CA 4X9SA 5LIXX 2F8QA 4WHBA 4LVFA 2GVEA 4XK2A 1ONRA 3P61A 3ZR5A 4CVWA 1AQMA 1FDZA 2A3EA 3PUEA 2DVTA 4M3PA 3XINA 2DZBA 4I5RA 1E6RA 3GNNA 3WDJA 2W0UA 1ML1A 3GHTA 5C9RA 3UD6A 4XD3A 1PSCA 3VNDA 1E3XA 4PULA 1FHDA 4CCZA 4EAMA 3LCXA 1CIUA 1AH0A 5K3VA 1J93A 2X40A 3A13A 1Q45A 2OOGA 5M03A 3WNKA 4AU0A 1XBYA 5CSRA 2WAGA 1IXQA 2VCBA 4OVXA 1YTEA 3P84A 3W22A 3ZJ8A 2GPTA 1CENA 3SURA 1XYFA 2Z26A 1J0KA 1V3LA 5AVHA 4LAKA 4FX8A 4LS2A 3HM7A 1TJ2A 3P93A 3AHYA 2PU1A 4DN1A 3T08A 4ENLA 2DT0A 4GCAA 3UWYA 2I16A 4XO7A 3ES7A 1YYAA 2XH4A 3HFTA 5J5RA 3PPCA 4H8VA 3VOGA 4OBTA 2PRMA 3QV9A 5DXXA 4JIPA 3C0JA 4BEQA 2CZEA 1BG9A 4FZIA 4JEQA 3V1PA 1Z6KA 4HK6A 3B8TA 1O5KA 1A5UA 5T91A 4GJJA 4R7WA 3WFZA 2FZMA 3KFTA 4KWSA 3U5UA 3AO0A 3QEZA 2JEPA 4BHYA 3LRMA 3U3HA 1ZQ5A 2ZDRA 1KM5A 1EDTA 4WQ6A 4MDPA 3MJMA 5M2FX 3ME3A 3VNJA 3KS6A 4UOQA 4HCDA 5MKGA 5CPOA 1DJHA 4UFLA 5BCAA 3ORWA 3R0DA 1JZ2A 2IPWA 3KDNA 3S6DA 2XWEA 3N3TA 2G0WA 1XIDA 3EMCA 1PUDA 3UJRA 4M51A 2YCKX 1DYSA 3L68A 2PLJA 1KXQA 4JCLA 1DWAM 3KBMA 2BASA 3GR4A 1FXQA 4CN4A 3TSMA 4S23A 1JIBA 3BCFA 4GPNA 3DFPA 2VFIA 4M7SA 4FXJA 3HQNA 3CIXA 3QW4B 3GTXA 3W75A 1RHCA 4CNUA 4AD2A 3PJWA 4HP5A 3PBVA 1UPPA 1TV7A 2GWGA 3S5OA 3NTYA 2ISSA 4HHHA 2CLLA 1M04A 4DZ5A 3U2CA 3UPBA 1C92A 1LROA 5TBOA 3EB4A 3WBWA 1LL6A 4QAWA 3PJUA 3KTCA 3AROA 4CLMA 3POCA 3P74A 3TE9A 1QBAA 4GKTA 1FWIC 1THFD 2VEPA 2W92A 1OCBA 2VELA 3WF2A 1RJPA 1F6KA 2F2HA 1H5YA 3PZ9A 1Q63A 2OYLA 3CHFA 3ARPA 4FALA 3L4TA 1KFWA 4UB9A 4ZENA 5LA2A 1US0A 3WEMA 3HPAA 1CPUA 4Z2IA 1WKFA 3MSRA 3MMTA 2XVKA 3UJSA 1SO6A 2IW0A 4CQBA 2X2GA 4YVPA 3VIJA 1LOSA 1ELSA 1ITQA 1V02E 3UWWA 1CGTA 3PS7A 1TPC1 1OFPA 2EPLX 3MT1A 2YA0A 2D3LA 4PTXA 2YCLB 4YWSA 1C93A 4BA0A 1XLEA 3VU2A 1JDDA 2YDRA 3TIMA 4R7OA 3G0UA 3SFWA 2XIMA 4FI4A 4PUJA 3BG3A 2PODA 2FGBA 1RLDA 1DQWA 1ZRQA 3REQA 1PYFA 1H7OA 1V7YA 3MMDA 1FWGC 1SO4A 2WVTA 4FF7A 5LNVA 2Z2UA 3OIHA 4GO8A 2W79A 5EBAA 3DFQA 3BW4A 5I06A 3IJ7A 1KXTA 1GW1A 4GQRA 3WG6A 1A53A 1V6UA 4UTUA 3WF0A 1TMQA 4CNOA 2OEJA 4C6KA 1IT0A 1P5BA 3F03K 2FVMA 3VIKA 3CZKA 4O52A 1K9DA 3T9PA 2BMBA 4IIFA 4JTAA 4EPDC 4O4VA 3DFSA 2ALRA 3T0TA 3D3FA 1WZLA 2YCLA 4UMAA 1R6WA 3UBPC 1GJUA 4RR4A 3MZNA 1VH7A 4YYFA 3W38A 1UP3A 1F9CA 1FWJC 3ZXWA 1E0UA 4LV9A 5EMMA 3VFCA 3RO8A 1NF0A 3UR7A 5I79A 1QHZA 1C91A 1XC6A 3GK0A 1O4UA 1HQTA 3A9IA 4O0ZA 5C54A 3NDZA 4N7QA 1UWIA 1BF2A 1OF6A 3HO8A 4FR1A 1W9PA 3UG8A 2J74A 4L6DA 2PDIA 3ES8A 2CKSA 2FFCA 4HKPA 3UT0A 3G6MA 1BVNP 4TX9A 3WNLA 3MUZ1 2R24A 2B7PA 3UA3A 2VOTA 3V3WA 3T2PA 1WP6A 1PDYA 3GVGA 4S38A 1LRTA 2B0MA 4C1LA 3WFAA 4K39A 4A4AA 3LUTA 4JS3A 3W1TA 3THAA 5ECUA 1KO0A 1TFVA 3BE7A 1TJPA 3W7LA 3C2YA 3THDA 1V03A 1TUXA 3VOIA 2ESCA 4D8LA 2QUNA 4AX7A 4GRSA 4HZMA 4H19A 3KHDA 1RZMA 4I3GA 1NSJA 3RLVA 4C6DA 2ZZ3A 1TPWA 3KM8A 4MTVA 3U8GA 1WE5A 1L8PA 3GO2A 3QVQA 3W71A 1KBBA 2QDEA 2X30A 1XKYA 2JBMA 4L56A 3VCCA 3TWBA 2PDUA 4GXMA 2P8CA 1UR9A 1KTCA 1QO5A 3SCPA 2VOMA 2GK1A 3AIVA 4Y6GA 2PDHA 2ZIDA 3ATYA 4JNMA 2HQAA 3TROA 3U2EA 2IPFA 2FZ9A 4MNMA 5DF0A 2DSUA 1QCWA 4O53A 2VX4A 3APGA 1C9DA 4CEUC 2X1UA 1UC5A 2JGYA 3ITLA 2YXGA 2NSXA 2OELA 4XTIA 3HURA 1KBIA 2OR2A 3TTQA 3CTLA 3KOZA 3TEVA 1JCNA 3K4WA 3VA8A 2NWSA 2V9DA 3R2GA 3RFAA 3DKJA 4V15A 2PWEA 2J27A 4MJMA 5LKYA 4FSAA 3UERA 2WSKA 5LNUA 5FEPA 4F0SA 3HFYA 4Y96A 4IOTA 3ANYA 5DRCA 4X22A 1IHIA 2Y7DA 5TQLA 5DMYA 4JTRA 1XGDA 5LNRA 4HSOA 3WF3A 4B4FA 3Q65A 4H9VA 3TQVA 3BDKA 4FIQA 5D4YA 1XXXA 4RE0A 3DBNA 3NVDA 3W74A 3S4TA 2BLEA 3BMVA 4WKAA 4NX5A 3H7RA 5AHEA 3GBDA 4GO9A 1W0MA 3HJZA 2PWGA 4JFSA 3R11A 1IEWA 1BWKA 2Y88A 3WZ0E 3NG3A 1MWOA 2ISWA 2GSEA 3I7RA 1I1WA 1LOLA 1DJZA 1PKYA 3TN5A 5HUOA 1WKYA 1BWLA 4UQEA 4DO7A 3JVAA 1PWMA 2F7FA 2O4MA 4L9YA 3F4DA 4E5TA 1MI3A 3CO8A 4RE3A 3VNKA 1XF0A 1YDYA 2PDXA 3ABOA 4GNJA 2IQDA 3QJAA 3NSMA 1XLHA 3TW9A 1MEHA 4W87A 5LNSA 1VPXA 3WNMA 5AYIA 3WD2A 3F5KA 4D6CA 2ADAA 2CHOA 4LTSA 1E6QM 5ENLA 1FCBA 2HVOA 1KV5A 2XGBA 3TJ4A 3I3EA 5FF0A 1FXPA 3E0VA 4JTFA 4IWWA 4WGXA 2BGQA 1ZCOA 1DXEA 3WUEA 3IJQA 4J35A 1FWEC 2WKJA 4UCFA 7ENLA 2G5WA 3FDKA 3G1FA 2PF0A 4QM1A 5G4EA 2D0GA 2W4XA 4GWEA 3T8QA 3STEA 1FQ0A 4Q8VA 2F6UA 4LS1A 1XV8A 3P82A 3WDIA 1QI0A 9XIAA 2E6AA 4MM1A 4O19A 3CS2A 3TTSA 4AF0A 3KBJA 1UR3M 2NV1A 3MBFA 3AMKA 3DEQA 4YHGA 1GOXA 2GDVA 3W7OA 3KEHA 3T0CA 3STFA 3K2GA 3M0ZA 3OEXA 4Q4KA 5BRQA 4H83A 5L9FA 4Q4PA 2OQLA 3VC5A 5KZDA 1EDQA 5G2IA 1DPMA 5XIAA 1W3IA 4JOMA 1NARA 3E0FA 1DQUA 4DF1A 2D2OA 4V2XA 4JFTA 1BYBA 4K2SA 3QBUA 1JDFA 3TW7A 2DORA 4IMCA 3NQCA 5HPOA 2NLIA 2OEMA 4S1FA 1WBHA 2D3NA 1JD9A 5LA1A 3H2AA 1ZPTA 4JTQA 2PC4A 3TZFA 5DY2A 2G97A 2NUYA 3IVSA 4Q8NA 1E9ZB 2QCMA 1BAGA 1IR1A 1FVPA 1GW9A 4AZHA 4WR3A 2PWHA 3OODA 3VDBA 3E5PA 2E28A 2WC3A 4DJEC 3RM8A 1JYXA 5T9CE 3L2IA 2OODA 4HBKA 2MUCA 1I60A 3I3DA 4S3DA 2CPUA 1N2VA 1W3TA 5HNUA 4QP0A 4HNUA 5FEWA 4HNCA 4GY1A 4ACYA 1AW2A 3FGCB 4OFCA 1GTHA 3UZXA 3ZYZA 1KC7A 3V7PA 1PDZA 3L23A 3A3XA 3SCRA 1LZOA 2CNCA 2V5BA 3PC0A 1OEPA 3MO4A 1LJYA 8TIMA 2VRKA 3KCOA 3TN3A 2Y5EA 3IS4A 3LV6A 3IGSA 1XLFA 2A79A 3CO4A 4M1RA 1QK0A 2GJLA 2YCJA 2QGYA 2C0HA 2WC4A 2TPSA 1H09A 1GYNA 3EKGA 2YSWA 4AQLA 3GIQA 2A7PA 2YYUA 1ZAHA 4E2VA 3S2LA 2PD9A 1VKFA 1Q65A 4FO4A 2XZ7A 3UWZA 3BOXA 1Z41A 4RUBA 3G1AA 3R25A 1CXEA 1M65A 3OGRA 3PK7A 1GKPA 3N6JA 1ZBVA 3O1NA 5AYYA 4DJFC 1SMAA 1EIBA 1G4EA 3R79A 4H2HA 3EPOA 4B9YA 2V69A 1VHNA 1EO7A 4HPXA 4US6A 3FY1A 3G77A 3OBEA 4UIOA 4LAOA 1B3YA 2XJ7A 2X0HA 2BOFX 5JMUA 4ERGA 3NPUA 2PWFA 3KUMA 4C6OA 1S5NA 4Y9MA 2XWDA 3SSZA 3SCUA 3K8MA 4B5TA 1WA3A 1LOQA 4JYDA 1EWEA 1MYRA 1PIIA 3BV4A 3WDHA 2JE8A 1X98A 1OFOA 4YTRA 1OK4A 1C3FA 2H9AA 3DC8A 4LSBA 3APTA 3RM4A 3TJLA 3N11A 4IGNA 2HS8A 1VJIA 9CGTA 4S3FA 1YPXA 1G9HA 5CPNA 2OLHA 1J9YA 4R3UA 3D47A 3VKDA 4QSFA 4Y8FA 3PZTA 2WMKA 3TN6A 4AIUA 5I09A 1QOQA 3M64A 3ZLFA 3P80A 3MDUA 4CKQA 5E9XA 3N12A 1ZFJA 1DL3A 3RU6A 1NP0A 4XKMA 4X60A 3NL5A 4D6HA 1TELA 1XIBA 3W7DA 1XBXA 3MHFA 3QLDA 3NZRA 2V2HA 1CXKA 2QJHA 4FOUA 3UZWA 2O7SA 2WW5A 4YLWA 2VDIA 2YYTA 3CWOX 3A9BA 1BYDA 3AHXA 3BUVA 1JCXA 2HRWA 4NUWA 2ZCGA 3OYZA 1Q13A 3LD5A 3DDMA 2WYSA 1UC4A 3BGJA 4B4HA 4F0HA 2DUZA 1GQKA 5CGQA 3SM0A 4K37A 2PS2A 2Y5JA 3OA3A 3O6DA 5CPSA 3GH4A 3WBYA 1IQ8A 3N2XA 1HT6A 1M03A 1DWGM 4GUGA 3ZJ6A 1HVQA 4NIRA 5C2CA 1WXYA 4TX6A 4I6KA 4NRSA 4EVZA 3HOJA 1UD2A 1TPUA 5F1VA 4TU1A 1AFSA 2HEJA 3PBWA 2J6VA 4ZXLA 4WEVX 4P7LA 3I65A 2V68A 3W7HA 4ZO9A 1O1HA 1NVMA 3QQWA 3CV1A 1N82A 1HO4A 2OXNA 3MBDA 3A23A 3MKVA 1QNVA 4U10A 1K1DA 2ON3A 3E2RA 1JAEA 4DJED 3WH6A 3WLPA 4MUZA 2X42A 1PZ2A 2CHRA 2OG9A 1J79A 3HTWA 4OU1A 3BOLA 2DSWA 1P0NA 2ZRZA 2E7FA 1OJXA 4Y9AA 4NVTA 5FF7A 4HSHA 3TQ0A 5CLTA 2WJDA 3DKLA 1WNOA 3E0IA 3BXWA 4U5KA 2ZRVA 1H5VA 5A6BA 1ESWA 2XUCA 4GLEA 5D37A 3D5HA 4YTTA 2D0HA 1KM6A 5IBXC 3B8WA 2Z00A 5BYWA 3PZIA 2WKGA 4J5NA 5HNTA 2B31A 2NVCA 1EFZA 2G37A 5I3HA 1QNQA 3UZYA 1UWSA 2Z2AA 2PGEA 2E40A 3CPRA 5GNXA 4A2RA 4LVAA 1G6CA 1J2WA 3P62A 3WLOA 3BLIA 1GVOA 3NPXA 2Q3OA 3QR3A 2G4FA 1WUFA 3ARTA 3VUPA 1KR1A 2X1IA 4UTLA 2FYMA 1R0MA 3TAKA 1KRAC 1BPLB 4A8NA 1PO9A 3PZVA 2QCCA 1F4HA 4HN4A 5CC6A 4JBRA 2ZXDA 1SJAA 4O16A 2JF7A 1YQ2A 2C1GA 1E71M 5JXQA 1V4YA 3IIVA 4PCPA 2ZUUA 4LEFA 4WJ8A 2EPNA 1R3YA 4O14A 1WZAA 1MW3A 3LENA 2DPEA 4IPNB 4MPQA 4AY8A 1JRBA 5I23A 4E2OA 3FHAA 3TSBA 4IMGA 1K77A 4AYGA 4K7YA 4NAFA 2XGZA 4CU7A 3RGTA 4UFHA 4NX0A 4D71A 1J12A 3GDLA 4WXZA 5AHFA 1NDYA 5DRIA 3DENA 4X61A 2Z6JA 3N2TA 1WXJA 2YOCA 5AKQA 4KEZA 1DJIA 1OZMA 1UQYA 4PTVA 4QS6A 3SRHA 2P0IA 3L5MA 3MU7A 3UR8A 1I1XA 3C52A 4N9EA 1K7EA 2F84A 1R2RA 5A6MA 3WDPP 2YBVA 4CNTA 5HWMA 1R7OA 4PMDA 2XFWA 5CPLA 4AWSA 4RZ5A 3WIJA 4JIRA 3LY0A 2BGNE 3A24A 3TKFA 4HMCA 1X6NA 1CYGA 3MKKA 1HW6A 4PA8A 4XWUA 3WD0A 3MHGA 1LWIA 3VAVA 2PRHA 4LF1A 4CD4A 1E4MM 1AODA 3NQMA 4DNMA 4RW5A 3OYXA 3IJIA 4ZOEA 3W6MA 3WUBA 4HPJA 3TLLA 3TONA 1IZKA 4GXPA 1S3HA 2E68A 1B2YA 1F5ZA 1QHOA 3GTIA 3FW6A 4O57A 1T99A 3KCJA 3SRKA 1TTIA 1RK5A 2VGBA 3WLQA 1FWHC 3DIPA 4AY7A 4B2DD 5H8PA 4KWUA 5AYXA 4WLCA 4NYUA 2ZYFA 3NO1A 1BKHA 3K5XA 4EF8A 4ICNA 3LB0A 4AFYA 5JIPA 4AC7C 5L6UA 1HZYA 2YIHA 4JL1A 3A5FA 4Z1BA 1JRCA 1BVWA 2ZWYA 4FNSA 5A8PA 4EWND 3NSNA 2Y61A 1AMYA 1KM0A 4K1GA 2Z0IA 1RVGA 3MUY1 1QI3A 1VCGA 2J78A 1W54A 3BURA 3ZVHA 3MVTA 3TYZA 3CL7A 3BCJA 3KLLA 5C0QA 1GVQA 3T4WA 5JUVA 2Y0FA 4JNYA 4L4OA 3AS3A 2E9MA 3SN0A 3WK3A 1IZJA 1VBJA 5FL1A 3G1RA 2W91A 4M6PA 1TKKA 3AS1A 2CZFA 2PDJA 4NG3A 3JS3A 4W5UA 1F6YA 3W7GA 3I6TA 2FDMA 3CMJA 2REQB 4A8LA 3WQGA 1UWQA 2BXYA 1GONA 1HGWA 3DHUA 3F7JA 1TX2A 3R5EA 4ZTYA 4KEUA 2PSNA 3QY7A 3V0UA 3CAQA 2I5GA 4GVFA 4QLLA 1GVEA 4N9CA 4LALA 2ZXAA 3GKFA 4DPQA 2A2IA 5BXPA 5D2VA 2J7GA 3UJFA 3RRXA 4B92A 2E5DA 1UROA 4LH8A 1TV2A 1N8WA 1PEZA 3NQEA 3GKAA 3CUXA 3HJEA 3AWNA 4O8AA 1UQZA 3DHDA 4XBJA 2W66A 3G22A 2IQ0A 4J1OA 4BK9A 2YXOA 3EYPA 2H3DA 3HV9A 4W7WA 4XD4A 3RG6A 1R8LA 4L9ZA 4KFOA 2E0PA 3CZ8A 2BOGX 1XLBA 4DY1A 2NV2A 3ARVA 2D0FA 1JPDX 1QTWA 2WHMA 1TWDA 2FHBA 1GWJA 2VX6A 1KXVA 3L4WA 3MP4A 4DHGA 3LV5A 4DQWA 5D9MA 3MUXA 3CAKA 1FFQA 1Q6FA 2EPHA 5I7GA 1UR1A 1W1IE 4UTFA 4LV4A 2I9UA 4GA8A 5IXEA 4OE7A 4H3DA 3NOEA 1M7PA 3C0SA 4PN2A 2R14A 3OG2A 4IISA 3ZT6A 3S5YA 3CQKA 3SQSA 3BSMA 1Q6OA 2VZUA 3MY9A 4AVNA 1TJ1A 1LYXA 3EB3A 2O9RA 3H53A 4KCTA 4UFIA 3PBGA 1AD4A 4AHPA 3KRBA 3O9NA 1VYSX 3TFCA 3PUGA 3ABSA 4AZCA 4L9XA 5RUBA 1IEIA 3AXIA 4KBXA 2J8GA 3WNOA 3ZLHA 3QMRA 1KWGA 1TREA 3MANA 3TCEA 2W6RA 4GOAA 3LERA 1Z32X 3GXPA 4RNJA 1PL9A 1XLKA 4HK5A 1Q5MA 1ZJHA 1C29A 3TA9A 3VXGA 4YXGA 3CLWA 1I0DA 2Y8VA 5HJXA 5A2AA 1IWAA 2OYMA 4UBPC 2EXOA 4HPNA 3VIOA 1ZNNA 4XVEA 1E73M 1HKIA 1KM2A 4L4LA 1X7IA 4QLJA 4DJEA 2QCNA 4LVDA 3QHNA 1RY0A 1W17A 4D6GA 1E56A 4CCCA 5HPCA 1RQBA 3LPPA 4CU6A 2ZUMA 1N7KA 5HJYA 4ADUA 3R94A 2XN0A 1SFJA 4KS0A 3M0LA 4DZIA 3VPLA 3TWAA 1BVZA 4PCSA 1IXNA 2ICSA 1DWJM 1EQPA 4GVGA 4IQJA 2G41A 5BWFA 1XLLA 5LIUX 3BL3A 3GHSA 1DJNA 2QMKA 2ZRXA 3HGJA 4MY9A 1TWZA 5H6HA 1JCMP 4GI8A 3W23A 1HJVA 3VDCA 2GQAA 3CIVA 3K8KA 1EPVA 1X1OA 2JKPA 4FNRA 4CQCA 2KZHA 3SGGA 3TFXA 3VGEA 5DT7A 4AIEA 3NQBA 1GPWA 3IRSA 3QLLA 4RX0A 3USZA 2ZX6A 2VTFA 4WDUA 4CGTA 3H26A 4S3EA 3IAQA 3ECQA 3QV6A 1OIFA 3UJ2A 1C9WA 1UP0A 3RM9A 3MWCA 3NPVA 1KCKA 1W5PA 1XYCA 3F2BA 2ZICA 4JKKA 2I5QA 1SZNA 3N9KA 2AL2B 1QATA 1NWRA 1M53A 3I4EA 2Y24A 4ZBCA 4NXSA 4DJFA 1TR9A 1OFEA 3UG3A 3SRFA 1IR2A 3DCPA 1HJXA 4O12A 4AB4A 3W1UA 3R0KA 1PX4A 5JQ9A 2BP1A 4IHCA 4GYKA 2WMJA 5ABGA 3KL0A 3BAIA 5AC7A 3AYVA 3N1AA 4JKMA 4DF2A 2DSVA 2WLZA 4HNNA 3RCYA 2BVDA 2QF8A 5BXSA 3AXMA 1W5NA 2WXDM 5FA5A 3OO2A 3HPFA 3N2CA 4LVBA 3OZYA 4M81A 3DG3A 1CTNA 2AL2A 4UNKA 2ZTJA 3N4EA 2NQ9A 4AAJA 4C6PA 1GHSA 3LCFA 1RJRA 2EPMX 1JCJA 1E0XA 1XCWA 3GU1A 2CIPA 3WLRA 3TR2A 1OX4B 3URAA 2NQJA 3MMUA 4H7CA 1A0EA 3B9NA 1S39A 4IG2B 3HPSA 1V3MA 3SCVA 4ONVA 1L2UA 4IF2A 5A94A 5C8BB 3FAWA 3KHJA 1P0EA 1YE4A 4M6QA 3UJEA 3F4VA 1QAPA 1WCGA 4TOQA 1L9WA 4B2DA 2VFEA 1AQFA 1MNSA 3R13A 1FP8A 4G8TA 4DBWA 4BKNA 3BLLA 5M3WA 1DTNA 1A5KC 3S1UA 3WNPA 3STGA 4ECLA 4HMNA 3DHFA 2PTXA 3RX2A 1Q6RA 3GDKA 2VD9A 4N4PA 1DEDA 4NSBA 3RX4A 3UCDA 2PCEA 3EOSA 3N2MA 4MG4A 5D9NA 4M29A 3UCCA 3SUVA 4MNKA 4GX9A 4IG2A 4YVXA 4ASTA 7XIMA 3A6OA 3G3DA 4TR9A 2VZTA 3PTMA 3AMCA 4HHLA 5K9DA 3JZEA 3CUFA 4QG9A 1QW9A 2Y6ZA 1IGWA 3RMEA 3BLPX 2TYSA 4NZFA 4Z2GA 3BLFA 1Q6CA 4KPLA 3KTXA 4K68A 1XIEA 3S9YA 3EX2A 4K8EA 1UASA 3PFRA 4QIUA 4E3TA 4LRTA 3U7VA 3R8HA 5AB3A 2WNZA 1SZEA 4Y90A 4LANA 1VYPX 2Y63A 2GGGA 4JTGA 4H9MA 3ICJA 3W0KA 1KGXA 3NEHA 1CECA 5E5CA 2WZMA 2G3JA 4N42A 4J3ZA 3UGRA 4W8BA 1A49A 3TW6A 3UWVA 2YL8A 3ONCA 3MZ2A 3UF9A 1T6MA 4P7RA 3NZQA 5FIPA 3VKJA 1P6WA 1ADDA 1YDNA 2ACRA 2E8ZA 1AQ0A 3RNDA 5D9OA 3CH0A 1TWIA 2WANA 4IXXA 4L4PA 4JX5A 4UTTC 3M1ZA 4TVCA 4QG8A 2BS9A 1JZ6A 3O2LA 3XISA 1XYZA 4R53A 3G1SA 4XBKA 1FWDC 3WQCA 4DJDD 1SO5A 4ZOCA 2NVAA 1HUVA 1GZJA 1JUKA 5K9XA 4UQDA 1UKQA 5E9AA 4C1NB 2RDWA 5IBXA 3FXGA 3E1F1 1MO0A 4PSPA 4S3JA 4FLQA 5FEXA 2RFGA 1NF7A 4ZOAA 1HL9A 4JFUA 2QYGA 1SO3A 3ARSA 6TIMA 1DWHM 2OFJA 3G3MA 2D20A 3L0KA 3C61A 4LX4A 1JPHA 3ZJ7A 3LQLA 1VHCA 2WZHA 2R8WA 3DYPA 1RK6A 3TK7A 1IE7C 1D7KA 1OVDA 2QCGA 1PZ3A 4I7UA 1M7JA 3IRDA 3FKRA 4C7FA 1H7PA 3DFTA 3OVQA 4YCPA 3CZLA 2I17A 4JQ4A 3SB0A 3WMLA 4NKCA 3AIBA 2YFNA 3GNXA 4BQ3A 3EX3A 4HU4A 3UWUA 3PZOA 2WK2A 2A3HA 4NQ1A 4MAZA 2E6YA 2PBOA 2FTYA 1JI2A 1AMKA 3KP1A 3O7UA 3AC0A 1MVYA 3ZMRA 3OLGA 1DIKA 4ZB2A 3WBEA 4C6IA 5A6JA 4PBEA 4B91A 4LYKA 4J27A 1XIGA 4WJEA 3B0XA 2ISDA 4R33A 1TV4A 4C60A 2JGQA 5A6SA 4JPGA 1QW7A 3NIYA 2VQTA 4XAYA 3TNBA 1TQJA 4S3CA 5C2XA 1N8IA 3STCA 1YPIA 5J04A 4LUJA 3T4CA 5K4ZA 4DBSA 4YTSA 3CUGA 1XRVA 1RUSA 4NAEA 2OZTA 4IZGA 1LQ2A 1LM1A 2UY2A 4QHRA 1M9HA 1WXZA 3H23A 1A4LA 1PKNA 2W61A 1J5SA 1EBHA 3K13A 3PTDA 1EHAA 4E6MA 3PN8A 1JAKA 1KFJA 1GG0A 5KSWA 4N6FA 4Q8OA 2YCEA 1Q6GA 5ECVA 3MQTA 4JTLA 5FCZA 3LQGA 3LTSA 3VC6A 4MYXA 4YPJA 1QBBA 4TMBA 4WOZA 2WZTA 3M46A 1H49A 4GH3A 2FTWA 2PWVA 4KEVA 3W26A 1IT7A 1OCJA 4QG6A 1KRCC 3N3MA 5A95A 2PFHA 2E1WA 3VE7A 4D6EA 4DBDA 4XAZA 2DVUA 3CGTA 3QM3A 4M1BA 4MKVA 3NM3A 4UR9A 4AISA 3E6EA 3P60A 4MY1A 2BHZA 3MC5A 1Z7AA 2WMHA 1K3UA 1JF6A 3AUJA 2VZSA 4F0RA 1VCFA 2YBUA 5DO8A 4PTMA 3LSBA 1VFLA 2BODX 3UXIA 4J2PA 2QT3A 4TV6A 3WK1A 1YXDA 1A80A 1B3XA 1FOBA 3SUUA 2JALA 2VEKA 3BJTA 2AQOA 2PEVA 5CJ5A 1XICA 3EKZA 5C55A 3CPUA 3WQVA 2PDPA 1ITUA 2HVNA 5DX7A 3FNDA 3OHMB 4ROPA 2ZZ6A 4CN6A 5BZAA 1XDJA 5I2UA 1K8XA 2AMXA 4X2PA 5I3KA 1SZGA 1ZS2A 4PB5A 4ZQRA 1EOMA 1K7FA 3SR7A 5D30A 3TZNA 3DFOA 3PZQA 4FOKA 3Q37A 3LXCA 1ZCCA 2YLLA 2C19A 3N13A 4EANA 1QUMA 3OZMA 2CXGA 4GI4A 2KX9A 4GK8A 4PUUA 2YLAA 2CKRA 4WSKA 2WVSA 1I2RA 3FSTA 3WQWA 3NYZA 1KM4A 3WLTA 1XBZA 1EC9A 1L6GA 3TUUA 3WL1A 2XH2A 2BWGA 2GDUA 3QSTA 3GU2A 3M5VA 2Z7GA 1FH9A 5FF2A 1XYAA 2VRQA 3G1DA 4H1ZA 5A2BA 1IEXA 3NQ8A 1X1NA 5D05A 2OSYA 5D33A 4O1EA 1I2QA 1MQQA 3UG5A 4REQB 4LUTB 3DI1A 4S2CA 1PE1A 1TVPA 2A0NA 3ABZA 3GVRA 2CESA 4NT0A 4ZZ9A 2Z24A 1XFCA 4EE9A 4H6EA 3M43A 3T2OA 1QMLA 4LY4A 1J0IA 9RUBA 3T42A 4V1XA 4WRHA 5XINA 5F4WA 3BVJA 1F6PA 3IV3A 2OCZA 2I14A 1Q7QA 1XR2A 2TODA 3HV8A 4KIRA 1JCLA 4ORMA 3QGVA 1O66A 4J3VA 3THUA 1Q7MA 4NI8A 4JIIX 3BJFA 1Y7VA 2ZUTA 2YJQA 4DI8A 3BJSA 1P7TA 3VGBA 1R2TA 4OWGA 2WM0A 1Q6DA 4LUTA 4XX6A 3VOJA 3OVGA 2V2CA 3PNZA 2PTWA 4JTHA 3TQKA 3WF1A 2G3NA 3WF4A 4E8GA 4RE2A 3LLXA 3NFUA 4UTWC 3UW6A 3LBMA 4I6VA 1MZRA 2J62A 3GE7A 1LP6A 3OZOA 1A5AA 1QI5A 4CD5A 2PLCA 4MB3A 1PIFA 4DWSD 4MSSA 4RKAA 1SVDA 3NQDA 2QMJA 1XJBA 3GVWA 5I00A 1J0HA 5AZ0A 3FOKA 2GGHA 1ICQA 1W1A1 3OVPA 4O0QA 4OV9A 3BARA 4PH6A 1U1JA 3FKKA 3W84A 3UYCA 3H2FA 5I77A 2NQ5A 5F4XA 1GQLA 4C7DA 3B9AA 3S83A 3DGBA 5IDIA 5DQPA 4QEEA 3PTKA 3A4JA 1W1ZA 4I5XA 2BHUA 3XIMA 2GVYA 2Y2WA 1VPYA 1E0WA 3VOHA 4JN7A 7CGTA 4LNCA 3GB6A 1JXKA 3LU2A 1ZU8A 4X0VA 2XFYA 1IEVA 4LB4A 4F2TA 2QR6A 4ZQOA 2UY4A 1HGYA 1JYNA 2AKZA 3GWQA 2BDQA 5EL1A 4WY0B 3CNYA 1F3XA 4P7NA 4ZQNA 1XRFA 4EXQA 1EP1A 4W7VA 1XINA 3ARYA 3GW0A 3IGXA 3KOYA 3TJIA 2A4AA 1ZTVA 1OABA 4H6RA 3HZ3A 1TV8A 2XM2A 5TIMA 4FOJA 4HYVA 4Y9OA 2IKGA 3V0TA 3GNDA 2ZZ2A 5AHLA 3AYSA 3GM8A 4KWOA 2V3EA 3FN9A 3ZLGA 3DHPA 1FWBC 1R3SA 3CL8A 5T26A 1FWCC 1VD6A 4NZ1A 4X9YA 1AJ0A 3SN1A 1SU5A 2VFFA 1JNEA 1NFGA 2QIIA 2HROA 4RNIA 4RV8A 3T6CA 2FJUB 4B15A 3FJNA 2FH6A 2QJJA 5D02A 2F9RA 5CBBA 3LPOA 2AGTA 2P53A 2A5HA 2C0AA 3C5QA 3W2JA 2FB3A 2DU2A 4H01A 4DXXA 5A6LA 4Y8EA 4IMAA 4XVDA 1PB0A 4KGJA 3VKKA 2DIKA 4MF4A 1JQVA 3EEZA 3WENA 1TVLA 3AHVA 3IJ6A 5EFFA 3QKZA 1JR1A 4JEJA 1V6WA 2CFFA 1G01A 2QIWA 3WUFA 1GVIA 1KBKA 5EBUA 4GKLA 2CZDA 1IT8A 3WD4A 1K6WA 4NXKA 1AQHA 4GUJA 4ERIA 2VP8A 4HMEA 7ODCA 3RHGA 4XIMA 4XBSA 5G1MA 3L4VA 4FLRA 1HJWA 2ZADA 4PODA 5I02A 2J47A 4A3YA 3CEPA 1J0JA 3QPYA 1IXOA 3M0VA 5FOOA 4RL3A 5DFAA 3VX0A 2Z7KA 1FY6A 3WQ6A 3NL3A 1LBMA 3EBVA 1CT5A 1LWJA 4H9YA 2Z1KA 1CBGA 4KW2A 4KERA 4UNIA 5C9XA 1XH1A 3L2MA 1TPB1 3ITVA 1SSDA 3CHEA 3KX6A 1D7FA 4D6IA 2A21A 3PTQA 1Y0EA 3G0SA 2DW7A 3BQ5A 2E09A 4F66A 3F5JA 2VNCA 3AU6A 3V5FA 1OF8A 4Z2KA 2YL9A 1E55A 2TAAA 1R9YA 4PMRA 4ATLA 3SEPA 3C0LA 5CPQA 1NJJA 1VLWA 1WX0A 1DXIA 2E3ZA 1U2YA 4RXGA 1I0BA 4RDVA 3WMSA 1ISZA 3N34A 5AC4A 4EF9A 2EPOA 3TQPA 2Q01A 4HJWA 4LCSA 1UUOA 2IXUA 2QGHA 1ZP4A 3G2GA 5BW6A 4R9XA 5D2WA 3PULA 5FJIA 1TA3B 1XG3A 3RJXA 3BMXA 5HQLA 2GGEA 1W37A 2ZVIA 3PWGA 4B3LA 1JCYA 2P88A 1JPKA 3MSYA 1U5JA 1ISVA 2X7WA 4I9JA 1C7SA 3V0SA 1LQAA 4HT3A 3WJWA 3SCSA 4B3KA 4IUOA 4YMZA 2WMGA 1V79A 3PBYA 1WZKA 5A1AA 3VD4A 5G4WA 3E12A 5HUPA 3GNPA 5T8GA 2WCGA 3GDMA 4MMWA 5CC3A 3OGSA 4C6NA 4A3QA 2QJMA 1RQEA 4ZGYA 3WLKX 1A5MC 4DEFA 3GSMA 2QPSA 1S5WA 1TA3A 4QXIA 3PNUA 3UPMA 1CGUA 3NUKA 4QJ4B 1UZDA 2R1MA 1ODZA 2DSKA 5KTLA 1BF6A 3TP4A 4U3CA 1K9FA 4S39A 2VKZG 3RCNA 2XIJA 1HKVA 3WJZA 1AD1A 3GC4A 3R89A 1D2KA 2FQIA 3WBAA 2XIQA 1ZY9A 2OJPA 1CXIA 3EDDA 2INFA 3NPWA 4JN8A 4JFVA 2WOQA 2PDNA 2VGGA 3L7RA 2ZDSA 4I7WA 2BSLA 4K8GA 1Q7ZA 2IPGA 3VNMA 3V18A 4UTTA 2WV8A 3MYOA 3H6OA 1BG4A 1XIFA 3BGGA 1EQCA 3W7EA 2Z6IA 1DIDA 1K02A 4O0KA 3M41A 3OZPA 3EWXA 3GXFA 1DTUA 2OO6A 3U2OA 5DCBA 1FA2A 1SZRA 3GFXA 1X39A 1E51A 3E3HA 1TWWA 3GUWA 1FHUA 4L5ZA 1DJXA 2J13A 4NNCA 4HMDA 3WQOA 1W3JA 3EGJA 3ZOAA 4F9DA 1AL7A 2A7NA 2V5JA 1QU4A 4XISA 4AD4A 4L65A 4W4QA 1HL8A 2VEFA 1W9BM 4FP1A 4A22A 4TMCA 2GSHA 4KIEA 4FNQA 1D3GA 3AALA 2CZVA 4Q32A 3LGEA 2NVDA 2AQWA 4BCEA 3W2LA 3JRKA 3UZZA 3QGKC 1V3KA 5AVNA 3FLUA 2C16A 2PDBA 3S1GA 4KMQA 3TOYA 4JTEA 3PPGA 3AYTA 2B81A 3BOFA 1A5NC 1UD3A 4QTGA 3FYOA 3LBCA 1DIOA 1J0ZA 3WMBA 4DWSB 3O0FA 3PBMA 1IYXA 1YBQA 1TTQA 3TYDA 4X63A 1FX6A 1UJQA 1OSEA 4OJYA 2W67A 1WKEA 1PZ0A 1LUCB 3L66A 2EBNA 3C6CA 4Z1AA 2EKGA 3RPTA 1JGMA 2HPIA 1VFTA 5HBFA 1EF3A 4J4KA 5I3JA 1DHKA 3H2OA 3WEOA 3GIYA 3GAKA 2V67A 4KFPA 3NVTA 3KVJA 1E15A 4G5DA 4PMOA 2J88A 4Z17A 4XTDA 2WWCA 2QDGA 4WXYA 3IVTA 4YTQA 3P81A 7REQB 1EC8A 4DBUA 4RNHA 1M3UA 1E5NA 4KQNA 1W9VA 3TDFA 4DUOA 2VFDA 5AZ1A 4AXNA 2WZEA 3P6LA 3GR8A 1AZ2A 5BWAA 3A64A 2GL5A 2ODOA 3N18A 4C5YA 3GQYA 5C9UA 4NU7A 3SUTA 1XW8A 4GINA 2HBXA 3RN6A 3ENLA 1TZ7A 1X7FA 3K8LA 2V3GA 2XDFA 1YDOA 4A35A 3G8RA 1PBGA 2GDQA 3LI0A 4GX8A 5HAOA 4ERAA 5B80A 2J8FA 4Q33A 2X41A 1Z69A 1P6CA 1WYIA 1K9TA 1F8IA 4A2SA 2CWXA 3AAMA 3WLSA 1UMLA 1YRRA 4M0XA 4HU0A 2QCDB 4Q4MA 1JD7A 3KAOA 4EPKA 4ZSUA 1UYQA 2P3ZA 2POTA 3S42A 4DZAA 1L2QA 3VO0A 1CEOA 3PAJA 4PGLA 2JIWA 3A4XA 4AZGA 2FZ8A 1SFTA 4AWTA 4E4FA 5REQA 1T5AA 2B4GA 3W6LA 4GY0A 1CI1A 4GJ1A 1XYBA 4MZYA 2OZ8A 3A21A 3QYSA 3LG3A 3GC5A 1W9XA 3EA1A 1S2VA 3NR0A 2V6AA 4DUWA 4AZ7A 2W27A 3CEUA 1R86A 4GC4A 4WKHA 4LVGA 3ZJKA 4BI5A 5JVLA 5FEZA 1SR9A 2CYGA 3SIMA 2C6QA 1M6JA 1H7NA 5A5WA 1NP2A 1NQKA 2OSXA 2BX7A 1RV8A 1IF2A 1J6OA 1RP8A 4MB5A 1I4NA 2J7FA 1UW9A 2J8TA 3S5NA 4GIYA 4CD6A 4POCA 4GYFA 4JY8A 1BGAA 4ML9A 4MLJA 2OOFA 2BV9A 5IRPA 3H70A 3GR7A 3N29A 2BG5A 3W2MA 1QVBA 4IQLA 2J9XA 1R9XA 1NWTA 3W1RA 3E38A 3QGAC 1O5RA 4ZL1A 2CU0A 3A12A 2GFTA 2H8XA 4BWLC 3GC2A 4N9BA 3EA2A 3II1A 2OMAA 5M1TA 3M0MA 3DERA 3RXZA 3W4RA 4DRSA 3Q67A 4NL1A 1NOFA 3ZT5A 3TXVA 4D1IA 4UC5A 1S2WA 3CUJA 1Z9AA 1XX1A 4GZIA 3QR1A 2X0YA 3CB8A 3EWDA 4PMZA 3VK5A 2HS6A 4JAWA 4XZMX 3HG2A 3GNOA 1RPKA 1M7XA 4ZQCA 4WZHA 3RR4A 1UUMA 4CQ9A 2HCVA 2NW0A 1OGGA 1MEWA 1T96A 1Q85A 2WVUA 1QRQA 2ZBTA 3R0UA 5G4HC 3E74A 1TPFA 1VPQA 2J25A 3PSVA 4GVIA 4DBEA 4J3XA 4GIAA 2WB5A 4O10A 5CJNA 3S5ZA 3L2LA 2ALDA 3QSRA 1JI1A 3OQEA 3ATZA 3A47A 3B8DA 4MB1A 3G1HA 4A05A 3PWAA 1OC5A 1K03A 1RLCL 4L64A 2WSYA 1LBFA 4UTWA 3OIXA 4LPCA 1W56A 3LI1A 1J4EA 3E5BA 5JIWA 4BF5A 3W07A 5DN1A 4RPQA 3LCIA 4C5ZA 1VJSA 4NZCA 3UNTA 5MHBA 3RLUA 1UH2A 3ARWA 4HOWA 4KCUA 2VC6A 3SCOA 5ABFB 1Y5XA 3WH5A 2YB1A 4Y9NA 4LW7A 3WJYA 3IAPA 1O5XA 1TUFA 3W7PA 3W7MA 1FCUA 1FRBA 1KFEA 4P61A 2Z1BA 5E6ZA 2GQ3A 1E0TA 1LBLA 1V0LA 3N2OA 3ZFHA 5TAOA 3SCQA 5HWNA 2F61A 1GYLA 1RR2A 3G0XA 3BAXA 3ITYA 2R91A 3V5CA 2DT2A 3F2CA 3DZ1A 4EK7A 3GRIA 1AVAA 4D8AA 1L6FA 1NAL1 3EOUA 4DZHA 1CLKA 4US5D 2BXZA 5ABFA 4EAYA 2QUVA 4CVUA 4GZJA 1VRDA 5CEWA 4E8CA 5DBUA 3SY1A 4MVAA 2WQDA 4QAIA 2YPIA 1XDMA 3B4UA 2ZC1A 5BMWA 2EJ1A 3ARXA 3VD7A 1TPH1 2DV0A 4N2YA 4JX4A 5G1YA 1W9UA 2ATMA 4B5UA 2XM1A 3BW3A 2AL1A 2VENA 3PG9A 4FF5A 1CCWB 3PAOA 1MW1A 1R3TA 3NA8A 2A6NA 5FD0A 3LPGA 4FS9A 1E0VA 4F0LA 1SW0A 3SADA 4BJHA 4ICCX 1REQB 4U2ZA 5I3FA 2J9ZA 1MZHA 2QCFA 3JU2A 3W29A 1M1BA 1MEIA 3DU0A 4XAGA 1FWRA