3TA6A

Structure of mycobacterium tuberculosis triosephosphate isomerase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
255
structure length
255
Chain Sequence
RKPLIAGNWKMNLNHYEAIALVQKIAFSLPDKYYDRVDVAVIPPFTDLRSVQTLVDGDKLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAATALKHGLTPIVCIGEHLDVREAGNHVAHNIEQLRGSLAGLLAEQIGSVVIAYEPVWAIGTGRVASAADAQEVCAAIRKELASLASPRIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGGASLDGEHFATLAAIAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of Mycobacterium tuberculosis triosephosphate isomerase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 94
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ta6A00
2WQPA 3EEGA 4PC8A 4TR9A 4DEFA 2TRSA 4N9BA 3BGGA 3W70A 4UTKA 1LBMA 4FHAA 4O4WA 1D3GA 3W7EA 3C4UA 5LNRA 2E68A 3M47A 2PURA 1SZEA 1OF6A 2AAMA 5FEZA 5J5RA 3TUUA 2HSAA 1Q6RA 2G96A 4UXDA 1O60A 2NZLA 3RF9A 5D38A 1IXNA 3A5VA 1QPOA 3NXFA 3TXZA 2Y63A 2WNQA 1G4SA 3PS7A 1OX4A 3PR2A 1ZAJA 5CPNA 1G4EA 1LM1A 5AB3A 3SGZA 1VJIA 2VEIA 3CT7A 3DXIA 1TPDA 1DJQA 2DORA 4AF0A 3O15A 5AFDA 5K2ZA 4K7YA 2H8ZA 2E6FA 3U2OA 2R14A 4NJIA 2Y7FA 3F4NA 1GZGA 5D09A 4M7TA 3BG9A 1LDCA 1K7XA 3N19B 3UZ5A 4IPJA 1OHLA 1OFRA 2ZA2A 5K9XA 4FIQA 4ADTA 4HHPA 5G1YA 5U7SA 5CSSA 4IMDA 1EUAA 3W9ZA 5FF2A 2X2GA 5F1VA 2E77A 3W2MA 3G1VA 5F4XA 1JUBA 1QPNA 1J5TA 3M1ZA 3S8HA 3LRKA 1SW7A 1DVJA 2BZNA 3GZ3A 3LCIA 3L5MA 2QUTA 1GEQA 3TSMA 4JIPA 3EWZA 1A50A 2V5BA 4N6EA 2YDAA 2E6DA 4IX0A 1OFQA 3P84A 5AHLA 2RFGA 4NX5A 4BK9A 2J9ZA 3W7QA 1KV5A 2P0OA 1K7FA 5C55A 2VFHA 1VC4A 1PE1A 3T55A 3W83A 2I1OA 3DZ1A 4IXHA 3W7JA 3JRKA 2YCEA 4CLMA 1L2UA 4UMBA 5I3FA 2E1DA 3W87A 1Q6QA 1GTEA 3N2XA 4NT0A 1KLZA 2E5BA 2WKJA 7TIMA 3IIXA 3HBLA 3B8DA 1AW5A 3GDRA 3HGSA 5AHMA 2NXGA 1TV7A 2E5DA 1D9EA 4UCGA 5G2IA 3KRUA 1FCBA 4LVAA 3T78A 4UTWC 2QUVA 3G1AA 1YXDA 1MSSA 4EWND 4M5PA 1EP2A 1FXPA 1FXQA 4DO5A 3GB6A 1EEPA 1OYAA 3MI2A 4UFLA 3M0ZA 5DXXA 4H4IA 1Z41A 2RKXA 5DN1A 5HR7A 2VFFA 1G4PA 1YTEA 1RVGA 1UUMA 2DJLA 2VELA 4OQVA 1QCWA 3OA3A 1BWLA 3HB9A 4ML9A 1LBLA 1P0NA 3PSVA 5HWJA 1XBVA 1EA0A 1S5TA 3WK3A 1I45A 3K30A 3NL5A 1LLWA 3W85A 3GKAA 5T26A 3STEA 2WSRA 1YTDA 4QITA 1Z48A 1LOSA 2B4GA 3Q37A 3MP5A 3PUOA 1ZHAA 2XN1A 2V30A 4O11A 3IVTA 4FNSA 3W1AA 4AWSA 2ISVA 2WV8A 2ZRVA 2QCGA 3UPWA 2O7SA 3KVJA 3NAVA 1YYAA 2WJZA 1CI1A 2G97A 4Y9AA 4NJJA 3VE9A 1W0MA 1WA3A 2FFCA 2ZRYA 1VLWA 3W2UA 2PRHA 3A23A 1RQHA 5FI8A 4MPQA 2J88A 1N7KA 4WZHA 3GXPA 2GPTA 1A5AA 4D2JA 1H1ZA 4Z08A 3BG3A 3GKFA 2QAFA 3CLMA 1JVNA 3NZRA 3CTLA 5HUPA 4EOUA 4XBSA 1U83A 3QEZA 4K8HA 2IQTA 1GVOA 3PULA 4WXYA 4XBKA 3GXTA 4UFKA 4IQLA 3QW4B 4IPIA 3B05A 3GDMA 5DLCA 4LUJA 3NQEA 1KM3A 3LHYA 2R94A 1I2OA 3E02A 5D2XA 2Y62A 4AH7A 3CEPA 1KBJA 3W88A 3SFKA 3DH7A 5AC6A 5IBXC 4QNEA 4FNRA 3L21A 5FESA 3W2NA 1JCYA 4NVTA 4HPJA 3IEBA 2ZZ4A 4WQ6A 1W5MA 3W1TA 4Y96A 3LCFA 4RCXA 4RZ4A 3BGJA 3L67A 1X6UA 3CM4A 3CC1A 1M6JA 4M7SA 3BK0A 1TREA 4GUHA 1FUYA 3NVTA 1QO5A 1X1OA 2WOQA 5KZDA 5LKYA 1B4EA 4GUJA 4WY0F 1H1YA 3W07A 2GVGA 3G3MA 3OHIA 3O6CA 4NNAA 4RJEA 3UNDA 3ANYA 4S2BA 3EX4A 3O63A 1F6PA 1EIXA 1LROA 4Z1DA 3W1MA 4WY0A 4CQ9A 1DORA 2PC4A 3Q2DA 4C1KA 1S5VA 2OT1A 2DJXA 3C8FA 3TSBA 2V9DA 3R5EA 4DPQA 3NR0A 1K02A 4TMBA 3ABQA 5U4NA 4ORMA 1YADA 3LHWA 4NQ1A 1X8FA 4UFHA 3HPZA 3EWWA 1SO5A 2WNNA 3M5YA 4AHPA 5KTLA 3NQ8A 3DFOA 3WK2A 4YCOA 1LP6A 3THQA 5KZMA 1XUUA 4RXFA 4KKXA 1LBFA 4DELA 3LCGA 1VCFA 1ZCOA 4XKYA 3PBVA 4NJHA 3MYOA 1PHQA 2VFEA 4JYFA 1TPB1 4KWVA 3WFAA 1EX5A 1K3UA 3A21A 3PF3A 1HTIA 1N8FA 4C1LA 1BWKA 2E6YA 2TMDA 4A2SA 3ZR4A 3LDVA 4M6VA 1VHCA 2QUUA 4TIMA 3M6YA 4OBTA 3M43A 3HGRA 3VE7A 3R12A 2CZEA 4YL2A 2ZZ1A 4R33A 3LGEA 4FNTA 3PWAA 3NQFA 2YFOA 2QJIA 5DCEA 2CLEA 4MKNA 2X1TA 3CQ0A 4ICNA 2CLLA 4M6PA 3NQ6A 4LRTA 4JX4A 3HG2A 3PY2A 3O07A 4UIOA 3EX1A 3CWOX 4CNPA 3FS2A 4RZ5A 3LI0A 2QCDB 3CIXA 4MFEA 1F5ZA 3PG8A 1TJRA 5A5WA 4UTTA 2OZ0A 1VR6A 3FLUA 1RR2A 4FXSA 1R47A 2ZBTA 3IRDA 1JCJA 3NL3A 1FCVA 3LTSA 1H63A 2WO5A 4DF2A 4JXCA 4A3UA 4O13A 2Y7DA 3G1DA 3S1WA 1OX4B 3W2JA 3CHVA 1M7OA 1OVDA 2A0NA 4ZQPA 3UXDA 1X1ZA 3NA8A 2RDWA 5K4XA 2GQ9A 3THAA 3E12A 1SU5A 3W6YA 4H6KA 1LCOA 4ALDA 2DZVA 4FX8A 5LGZA 2BSLA 4BR1A 2JGYA 1I2NA 1UBSA 3W1QA 1YDVA 3RMJA 5EL1A 1T96A 3QZEA 1THFD 3E96A 4K8EA 3W7IA 1ZNNA 1QR7A 3MJYA 4JTEA 3TFCA 2DZPA 4OV4A 2OT0A 4IMFA 4G1KA 1IIHA 1LOLA 3UQNA 3GDKA 5I3IA 1G7VA 3DFTA 1H7XA 5TQLA 3HMJG 2ZZ7A 3TMLA 4JEQA 5EA9A 3W74A 3BW4A 1KFBA 3MW7A 3LRLA 4AWTA 1E51A 3A5FA 3LBMA 4LC8A 5ABTA 4Q32A 6TIMA 2FLIA 4K36A 3PB2A 4MYXA 3GK0A 1IF2A 1WDWA 3EWUA 2RDUA 3DENA 4RKAA 4WOZA 5G4EA 3UPBA 4TX9A 2GJLA 3LCHA 2Z6JA 2ZZ5A 3ABOA 4O28A 3M5ZA 4QJ1A 4A22A 4N2YA 2QDHA 4S1FA 1K8YA 2YZRA 1OABA 1SO3A 3RFAA 4HSNA 2CWNA 2CLIA 3NL2A 3MBFA 3EWYA 1SSGA 2J6XA 2Y85A 3EX3A 4K38A 4UMAA 4UUIA 3UWYA 1ICSA 3DKJA 4LVFA 3ZWSA 4JY9A 1JULA 3B0UX 3GDTA 2ZCGA 3A24A 2A1YA 3LRMA 4JYDA 4LT9A 5I3JA 5L6UA 4LY8A 1L9WA 5LZLA 1LYXA 1VRDA 4IXXA 2VFDA 1ME8A 4YLWA 3MHFA 3HG4A 5EKYA 2ZZ6A 3NQGA 4ZQMA 3S5YA 5KINA 1F05A 4WJEA 3G8EA 4BFAA 4LU0A 4CNOA 3UWQA 2W79A 3WK1A 2C13A 4ZVJA 3NPXA 1QWGA 1TRDA 1QPQA 2R8WA 1JUEA 3LX9A 4HSOA 4Y90A 3QC3A 5FF4A 4O52A 2PRLA 1SZNA 4LTSA 4JICA 4NXSA 4GE8A 1IXQA 4HPXA 1W5OA 4RXGA 4UNLA 1H50A 4YMZA 1ZFJA 1F2JA 1QO2A 3GNNA 2H6RA 1LTDA 3DKLA 2ZZ2A 4DF0A 1Q45A 2Y70A 1VYPX 1G67A 3I7RA 4BI7A 5BMXA 4WXZA 2GVJA 1SFJA 4O16A 2CLHA 1VYSX 1XM3A 3S5OA 2NV1A 3O6DA 5EYWA 3W7PA 2WNZA 3TIMA 1DQWA 5CZSA 1OYBA 4WD0A 3C2RA 3L5LA 1W5PA 4W9TA 1QDSA 2RHGA 3SSJA 4JDBA 4ADUA 1G6CA 2E09A 3PBYA 3MWAA 5CGQA 1T99A 1FWTA 3EXSA 4O54A 1VPXA 4GXMA 4O10A 1H7NA 3LHVA 1ME9A 1OFEA 1ZENA 4H3DA 1TTIA 3QPYA 3FFSA 3C52A 1J2WA 3W7NA 2O7QA 3PBUA 2VEKA 1DBTA 4PODA 3KVKA 4JTKA 5KSWA 3W3OA 4AHOA 1Y0EA 3STGA 5AHNA 1I2QA 1OK4A 2C3ZA 2DZUA 3CIWA 4I7VA 1WQ5A 1TTQA 2NWSA 1O5XA 1SW3A 1C9DA 1YXCA 2A85A 2KZHA 3W7OA 1DKWA 3S9YA 1XBZA 4PTNA 3HIJA 3W72A 3R89A 5EMUA 3GR7A 5K4ZA 4M19A 4MLJA 3C2EA 4MY9A 1UJPA 3S1XA 3QRHA 1YTKA 4FO4A 5GVJA 3MUXA 3NO5A 3LBCA 3WJXA 3S5ZA 6ALDA 3LXBA 4Y8FA 2EAWA 3LV5A 3KX6A 3NG3A 5D04C 3L0GA 3O8AA 5C5YA 4N9DA 4EF8A 1DJNA 3O05A 3PG9A 3VNDA 1Q6OA 5HWNA 1QFEA 1A5BA 4OV9A 5I3GA 3BLIA 2FB2A 1TV8A 4B5NA 5K9CA 1WYIA 1KM2A 3W84A 4O12A 3KXQA 3EKZA 3LHTA 5A8GA 3MHUA 4O19A 3TJXA 1UB3A 3S1UA 1L6WA 1XI3A 4NNBA 4PL1A 3LV6A 2GQAA 2V0TA 4WUIA 1HL2A 1GOXA 3IGXA 1TPC1 3IIZA 3NZ1A 4X2RA 3NPWA 3UY8A 1AL7A 3VCRA 4WY0B 3HO8A 4K39A 3W1RA 1H51A 3LXAA 5KMYA 4LRSA 1K7EA 2VOMA 3BLEA 2E5CA 2A5HA 2V2CA 3AJXA 3OVQA 4OWGA 3GX9A 4X3ZA 5C2XA 4CNNA 2DZXA 4O15A 3CB8A 2I9EA 1QOPA 1WXJA 2JKEA 1OX6A 3QPZA 3KOFA 1DQXA 4ZL1A 3LLDA 2WSYA 2ZYFA 3G0UA 3UXAA 2NUXA 3F4WA 1H7RA 1TO3A 4MZYA 3TQ0A 5AYXA 4LC6A 5AN7A 4NNCA 2DP3A 3IVUA 4UFIA 4JTUA 1NEYA 4JX5A 5DY3A 4JTLA 1LRTA 1H7WA 2NX3A 2QCEA 3TKFA 4UTWA 4Y6GA 1L6YA 1OK6A 2Y7EA 5FF0A 3N9RA 1W3NA 4A21A 1H62A 1W3TA 5FEXA 1TPVA 5LNWA 3W7DA 1RV8A 4RX0A 4LW7A 5D03A 4AWUA 1TYGA 1VZWA 2X30A 3WJSA 2EGZA 3EX6A 2AQWA 3QJAA 3W1XA 3I68A 1PIIA 2J9YA 4AXKA 3B06A 5K9DA 3AO0A 1IXOA 2PE4A 2QAPA 2F84A 1KM0A 2NXIA 2RH9A 3G22A 3N34A 3S0CA 4QISA 4AVFA 1QPRA 3HG3A 3NDOA 5TBOA 2ZTKA 1JR1A 4LV4A 1XUZA 2JGQA 5HUOA 3C61A 3OIXA 3W86A 1TIMA 1AMKA 2QR6A 4R34A 1AL8A 1GG0A 3G18A 5D30A 3O16A 3DGRA 4MYAA 1B57A 4MJMA 2EHHA 4OGZA 4RV8A 3ATZA 1C8VA 2Z0IA 3DAQA 5G2WA 4JGDA 3LI1A 4AMAA 4JTSA 3SJ3A 3C2OA 4UTLA 2ZA1A 2NX1A 2ZRUA 2NUWA 3TA6A 4BF9A 1OFDA 4DO6A 3ABRA 2B7OA 2W0UA 1TPUA 1XKYA 3GAKA 3NYZA 4CCCA 3TNOA 2VKZG 2ZFAA 1HO4A 3W7GA 2V8ZA 2WPBA 2HTMA 1VLIA 5E93A 3P61A 1T8XA 5DCBA 3G1FA 1B3OA 3G0XA 1K03A 4ZQCA 2QCMA 4KFNA 2Y6ZA 3TQKA 3KRZA 3IIPA 2HS6A 4OE7A 1O5KA 2EF9A 3PSWA 1MEWA 2A7RA 2D73A 1SSDA 5DELA 5HNRA 2QF7A 1FBAA 3SY5A 4RLIA 1OFOA 3B0VC 3FKKA 4JTIA 4ZQRA 3DHDA 1R2TA 3NPUA 3BARA 3C56A 2X1UA 1I4NA 2DU2A 2YW4A 2OMAA 3NNTA 1F6KA 1F76A 2A21A 1G4TA 3TW6A 1QMLA 4XTIA 3PM6A 3LHUA 5D37A 3TH6A 4KFPA 1GYLA 2VC6A 4MZ8A 3S5NA 3GXNA 1JUKA 1TJPA 2QCDA 1S5WA 1SO4A 3WJZA 1OFPA 1KM6A 2GVLA 2Q3RA 2LLEA 1X7FA 5KITA 3DFPA 5AYYA 3W2LA 3UWUA 4BWLC 1SFLA 3B04A 3NQDA 2CW6A 3M41A 3LCWA 1YDNA 3HG5A 4DXVA 3QM3A 1O4UA 2GQ8A 3SGUA 4X9SA 4LVGA 8TIMA 5K7JA 4IUOA 3L68A 1R46A 3GYEA 4E38A 4AB4A 2R91A 2VEMA 5MHBA 1WX0A 4O50A 3C3NA 1LRNA 3IIVA 4N02A 3NOEA 4KFOA 4EF9A 1A53A 4JD4A 2JK2A 3I6RA 1W3IA 3LLFA 3W22A 1FCQA 3P67A 3ATYA 3ABSA 2BTMA 4I9AA 3MHGA 3EXRA 3S6DA 2GUUA 2C6QA 3OG3A 4IMEA 1YXYA 1I8JA 5LNVA 1H61A 4GWEA 3DBPA 3P60A 2QCFA 4PCFA 5BNKA 1VCGA 1W5QA 3G24A 1AW2A 1XBYA 3NL6A 4XWUA 1R2SA 2ZQ0A 3PUDA 4O8RA 3FYOA 1FX6A 3VFLA 2P1FA 3F03K 2B0MA 3M5VA 2YXGA 3QW3A 4IWWA 2X16A 1WAUA 3PC0A 4R7JA 4JS3A 4IX2A 4AF0B 3FA5A 1JCLA 1KTCA 1VH7A 3W1LA 3I7SA 3R8RA 2ABBA 3FKRA 4UC5A 4LS0A 1G69A 4XZ9A 1UCWA 4JDYA 1ME7A 3FIGA 3SIZA 3SZ8A 3HOJA 1EP1A 1QOQA 4GC4A 1GYNA 5IM51 2ISWA 1GT8A 1JRBA 4FX7A 4RK8A 4PFMA 4PA8A 4WOQA 5D2YA 1OF8A 2H3BA 1ADOA 3BPWA 3C2VA 3W7LA 3GAYA 3V1PA 1AG1O 4YXGA 1SPQA 2UV8G 4ZQNA 3W7KA 5FF3A 1L6SA 4LOCA 4HN4A 2H90A 3MYPA 2A7PA 1EPXA 2I14A 3M5XA 4UTHA 4R53A 2A2IA 1U5JA 2A7NA 1MEIA 3G0SA 5J5DA 1JCXA 1VS1A 2X1RA 1TPWA 3RLVA 1KFKA 2CZ5A 1ONRA 5LNUA 3RU6A 2W6RA 5HR6A 4ZMGA 4GNJA 4QAIA 3R13A 1I2PA 1EWEA 3HF3A 3QMTA 3TE9A 1JQVA 2QKFA 3LB0A 1KFEA 1YLVA 3G1XA 4U4MA 3STCA 2NLIA 1KFCA 1OFAA 1TPFA 1JRCA 1RQEA 2DZSA 2ZA3A 1GJPA 2CZFA 3HJZA 1FDYA 1CX9A 3KVLA 3N3MA 2JKAA 1ICQA 5I3KA 1FWNA 5HMSA 1Q3NA 1TPEA 1P5BA 1IGSA 1T0OA 3PVFA 4O0KA 3H53A 4E2BA 2Z1BA 3UYCA 3S1VA 3P5ZA 4NZFA 2BWGA 1TSIA 3MI6A 5D2TA 5C54A 4MIMA 3FJLA 1OYCA 3B03A 3GNDA 4FF7A 3P5YA 3BW2A 3DFNA 1HFBA 3SECA 5CZTA 4JX6A 3L0KA 4JYEA 3P8JA 3BO9A 4UFJA 3W7MA 2VFIA 3TMQA 2ABAA 5SWUA 1VQTA 4FNQA 3EB2A 1FDJA 2B7QA 5LNSA 5CPLA 5HWMA 1RQBA 3C2FA 2ISSA 1NSJA 3M16A 1OG0A 2C18A 1XC4A 4MJZA 3W23A 2JBMA 3W7HA 3L65A 1H7OA 1SR9A 2ZRXA 4MVAA 1RD5A 4JN6A 4UTMA 5CZ0A 5CSRA 3V75A 3DU0A 4HT3A 2ATMA 5D05A 2QCCA 1FQ0A 3ZWTA 4DBEA 4JNMA 3WJYA 5AHFA 1XBXA 3GDLA 2CLOA 1FWSA 4N9EA 4HIBA 3W1UA 1LZOA 4ZZ9A 4J9JA 3VI2A 3CU2A 3M7WA 2EPHA 1YDOA 3DFQA 5HINA 1NFBA 3MP3A 2J9XA 2P10A 4HNNA 2TSYA 4Z1BA 4UTTC 2A6LA 3BG5A 2OX1A 3KFTA 1DHPA 2J27A 1DV7A 3HPXA 4FNUA 4A2RA 1EWDA 4MOZA 2FQIA 3C6CA 1UASA 2NUYA 1VYRA 5D32A 1KFLA 2ZDRA 1KBIA 3IGSA 4AHQA 5D33A 3FEMA 3O1NA 1YPFA 3KRSA 5FEWA 1M7PA 2C16A 3H55A 3KVMA 3U8GA 2Y89A 3T7VA 4NUWA 2FIQA 5C6MA 2YYTA 1J4EA 3FJ6A 4TMCA 3G1HA 2RDTA 2H3DA 1OJXA 1WBJA 4Z1CA 3PB0A 4DF1A 3MO7A 1XDMA 4EIVA 1WBHA 3ZFHA 1QNVA 2C19A 1R2RA 2ZTJA 2G5WA 3EX2A 2Z6IA 3LXCA 4PH6A 3JR2A 2Q3OA 2NXHA 2FPYA 4QM1A 4NJGA 1MO0A 1FWRA 3IGUA 5DXYA 1S3HA 1F73A 5HJLA 4O1CA 3NM1A 3PAJA 1H60A 1DL3A 3UWZA 2YSWA 5AOUA 1GWJA 2FB3A 5DCDA 3L5AA 2XN0A 3TFXA 4IMGA 4JTTA 5CZJA 3FOKA 3OEXA 5AHEA 1MZHA 2AGKA 1W56A 4TO8A 3TR2A 4OT7A 1EUNA 3G8RA 3UD6A 3BW3A 2VFGA 3ELFA 2BX7A 1KW1A 5D02A 4HNVA 4RR4A 3TV8A 3OVPA 3QH2A 2YW3A 2WSQA 4KWWA 2V82A 1BKSA 2B7NA 1ML1A 3PUEA 3TX9A 3HQ1A 4I7UA 1TB3A 1LLZA 2C1HA 4O14A 2YFNA 5F2IA 1GQNA 1H7PA 1TPH1 4OHQA 4FB7A 2H8XA 1QAPA 3L2IA 1NAL1 2NX9A 4JY8A 4NXKA 4K7VA 3W76A 3W7CA 4QQ3A 5G2HA 3KHJA 4LS1A 3TXVA 5AC7A 3TK7A 2V5LA 4LWWA 1W31A 1TCDA 4HNTA 1XFBA 2BXVA 5DBTA 2EKCA 5AYZA 2FDSA 3LCLA 3PBWA 5HULA 1LOQA 3YPIA 1W5NA 3NM3A 1HG3A 3TJLA 3H54A 3TCEA 2E6AA 3FYPA 3C0JA 1P0KA 1HUVA 3G1SA 1XCFA 3QSTA 3W75A 3NEVA 2G95A 5CG7A 4JR5A 4TU1A 3CEUA 1XXXA 5F2GA 2FTPA 5I3HA 2CLMA 1GPWA 1BTMA 4UR7A 3L9CA 3F1QA 4HNUA 1Q6LA 3NQMA 2JKPA 1N55A 1O94A 5AHIA 3TROA 5LSMA 2A4AA 2FPVA 4HKPA 1KTNA 4UTUA 1RZMA 1V7YA 3GR8A 3Q58A 4K6AA 1WOBA 1WV2A 3P7YA 4IGHA 1GG1A 2C0AA 3HPSA 3IV3A 1TMHA 3W7RA 3IVSA 5F4SA 1GTHA 4UTIA 1KV8A 1LORA 4FNPA 1NF0A 3W71A 4P61A 4BI5A 3DHFA 1VHNA 3P74A 5K3VA 3EXTA 2QJGA 4O18A 3SI9A 4JTGA 1K8ZA 2Z2UA 4Q33A 4DBDA 3I7QA 5F2LA 3UY7A 4AAJA 1FDZA 3T44A 4E2DA 4FXRA 1ICPA 4YWIA 1C29A 1KM4A 1HO1A 2F7FA 4UMCA 2VEPA 2ZZ3A 3LM7A 5BOOA 3QYQA 2YR1A 3E0IA 5CPMA 5G5IA 1GVFA 1FWWA 1SO6A 3TAKA 5BW6A 3USBA 1K8XA 4LNYA 3TSDA 1KM1A 5EPDA 5LHFA 3NQ7A 2BLEA 1R30A 3TAOA 2J24A 5IBXA 3DI1A 1D3HA 1XDLA 4U28A 4O1AA 1W1ZA 4ORIA 4JTJA 3P80A 4N4QA 1PS9A 4O0ZA 5EY5A 3W1NA 3NQAA 3MMTA 3KAOA 2Q8LA 1TTJA 3L66A 2NV2A 2VENA 1ZAIA 2XFWA 1Z44A 3M9YA 5BMWA 2QDGA 3A9IA 2DZWA 1M5WA 3OVRA 2GOUA 3NPVA 3O6YX 4FX6M 1JCMP 1KM5A 2A6NA 3N2MA 1OFBA 1TV5A 2PCQA 4IMCA 4CQAA 1JCNA 4CCDA 2ALDA 3NQ2A 1OX5A 4MUZA 3QMSA 1EB3A 1JJKA 3SR7A 4O17A 1VCVA 2C15A 4POCA 1SUXA 2X1SA 5CKSA 1FY6A 2V81A 3CWNA 1SQ7A 3LHZA 4DO4A 4Z0JA 1MEHA 4EVZA 4OU1A 2QCNA 4GRSA 1P1XA 3TC7A 3T4CA 1CW2A 1PV8A 4O1BA 3HGOA 4GJ1A 3L0NA 3EKLA 3W2KA 1RPXA 2FPTA 3U6WA 4XUGA 4O53A 1SZFA 2Y7GA 1G7UA 1GVQA 3RLUA 4JTFA 2Y61A 2TPSA 3QQ1A 2CU0A 2HS8A 2QCLA 3LTYA 4QIUA 1ZY9A 4FEZA 5BRBA 4GBUA 3ZS4A 3EWBX 1O95A 1B4KA 4MLRA 1TQJA 2B7PA 3T40A 3GLCA 3LOTA 1W54A 4K37A 1AW1A 5CPOA 4BI6A 1P4CA 3TW7A 4E0CA 4QNWA 1Z42A 4MFDA 4UR8A 5L9FA 1V5XA 2VXNA 4UTJA 3M44A 2ZRZA 4PL2A 2DZTA 5D2WA 1IXPA 1NF7A 1EP3A 1AK5A 1KA9F 1NVMA 4UNKA 5E0KA 5HQEA 1YPIA 1SW0A 4IJBA 5LHEA 4GUGA 4N6FA 4O1DA 3RK8A 2ZRWA 4M6QA 3UWWA 4MZ1A 4QSHA 4O4VA 1BEUA 4I7WA 4JTHA 3QF0A 5DBUA 3WJWA 2C14A 4UFMA 2ATSA 4NZJA 1B9BA 4CCEA 3W1PA 1W37A 3NGJA 3DFSA 1PVNA 1PCWA 3IIOA 3EWXA 5LGXA 3STFA 3BVJA 4NX0A 3BV4A 1WOAA 2OJPA 1ZJIA 3CPRA 4IOTA 3WK0A 3P82A 5D2VA 3INPA 2NWRA 2YX0A 4XKYB 1FCUA 3MBDA 3Q94A 3QSRA 1F7BA 1XL9A 1PL9A 2V2HA 4ZQOA 1ZAHA 1VGAA 4NJKA 1TRIA 3A22A 3D0CA 1I2RA 2YPIA 4LVDA 3P62A 4RZ6A 3VKJA 1A5CA 2TYSA 1PHWA 3GIYA 4S2CA 5H2ZA 1H5YA 2OCZA 3P8IA 3RNDA 5DY2A 5KZEA 3LERA 4L4MA 1A5SA 2CZDA 3BLFA 5G4WA 1TQXA 1ALDA 2QEZA 3JS3A 2QJHA 4ADSA 5FEPA 3E9AA 2YYUA 3QMRA 5F1UA 4Z1AA 3G1YA 4DPPA 3E49A 3TQVA 4XQ6A 4MY1A 3O06A 4L4LA 1PCKA 4YCPA 3QQ0A 3NQVA 2QCHA 1ZALA 1DOSA 3DI0A 4N9CA 1MXSA 5EBUA 4NU7A 3I65A 3P81A 3N73A 3B4UA 3UWVA 1GVSA 4ONVA 3SW6A 3UZJA 2Q8ZA 3N14A 1KFJA 3GVGA 4X22A 4LUIA 1IIGA 1W8SA 2CFFA 5F4WA 4A29A 4DQWA 1SZGA 2YGYA 2CLFA 4Z0SA 3LTPA 4GUFA 2CLKA 3W73A 3OBKA 3G3DA 4GFSA 3HGJA 2FJKA 4LVBA 2PRMA 3TU9A 4P2VA 2GJNA 4PEKA 2V2DA 3TC6A 1KTBA 4WX2A 4AEOA 3TDFA 4LS2A 5FF7A 4O57A 5AC8A 4GUIA 3LCXA 4Q4KA 2Y88A 4JIQA 4XTDA 5F2MA 1TTPA 4FIRA 3B0PA 1F74A 4LV9A 3R2GA 4MY8A 5TIMA 3NQCA 3N9SA 1GVRA 4BWLA 3MI3A 4CQ8A 2HMCA 1LRQA 2XN2A 3MP4A 1UUOA 5E1QA 5H91A 5G1TA 3QFEA 3S42A 4N4PA 1JQXA 1KLYA
chains in the Genus database with same CATH superfamily
3WSUA 2D20A 2OG9A 4PC8A 3M0IA 3OIHA 3WLHA 4FHAA 4KIEA 3EA1A 4O4WA 5LNRA 3VNMA 3TW9A 1SZEA 1UR2A 1OF6A 4C7DA 1CENA 3L12A 1Q6RA 2G96A 4UXDA 2WANA 5D38A 3BE7A 4MWAD 3A5VA 1YNYA 4QEHA 2AKZA 4IT1A 3PR2A 1WKEA 1ZAJA 5CPNA 1BAGA 5HMEA 1VJIA 2VGBA 3F5JA 4AF0A 3S83A 1RA5A 4I9TA 3AIUA 2CERA 2YXOA 2H8ZA 2W91A 4ZSUA 1CNVA 2VZOA 1EH9A 2HK1A 3FA3A 3SCQA 4NJIA 2Y7FA 1LL7A 3N17A 1XLIA 2A3BA 4C6IA 2OELA 2DT2A 4M7TA 5LIWX 1Q63A 4Q8MA 3KWXA 2OZ3A 3ID7A 1OHLA 3JUGA 1IWBA 3E1F1 2ZA2A 1ZPTA 4FIQA 4W8BA 5TNVA 5U7SA 5CSSA 1NFGA 2Q01A 1EYWA 2X2GA 5F1VA 5H8UA 4LAKA 3NOYA 4JQAA 2AL2A 5C9XA 1QTWA 1DVJA 4EAYA 3SAZA 3I4KA 4YTQA 1M9HA 5LA2A 4FLRA 1S2AA 3VUPA 1VFMA 1C3FA 1GEQA 1N8IA 5J04A 4IM4A 2UZ9A 2GLKA 4PMJA 1WO2A 2DSKA 4C5YA 3W82A 2ZX5A 4G7EA 2EPLX 1O12A 2Y8VA 4KQNA 4IL2A 1IT0A 3URNA 4NX5A 4TTUA 4BK9A 3W7QA 2E9MA 5B7YA 2XSAA 3FXGA 2VFHA 1VC4A 3T55A 4I9JA 3W83A 4GZIA 3DZ1A 1IZJA 2XWDA 2HQAA 4CLMA 2V5CA 3VUSA 2TODA 3G6MA 3R43A 1Q6QA 1NP0A 2CCRA 2J8GA 2WCGA 1MW3A 3IIXA 1AW5A 2XVKA 4R85A 3UYIA 3GDRA 1UWAA 2NXGA 4LYPA 2XINA 3KEHA 3KRUA 3UNTA 4J2MA 1XRSA 5A8QA 4LEFA 1YE4A 3GB6A 1EEPA 2O56A 5DXXA 4WDTA 1YMYA 2RKXA 5DN1A 5HR7A 2PAJA 2NSXA 1YTEA 1RVGA 5AVHA 1H09A 2WKLA 4BF7A 3TTOA 4Q4PA 3OA3A 2VWSA 1BWLA 4GBDA 1AZ1A 1BPLB 4ML9A 1Y5VA 3SN1A 3PSVA 5CGMA 1EBHA 2Z26A 3AIVA 4HZMA 3CT2A 4H8VA 3GKAA 4XZNX 1Y5XA 1HVQA 3KTCA 4QITA 2ON3A 2P88A 3ARSA 1ZHAA 2XN1A 1GORA 2V30A 4GZJA 3IVTA 1HNYA 2WV8A 2ZRVA 2QCGA 4BQ5A 1ZBCA 3B8VA 4BY3A 1TWDA 3G1RA 3KVJA 3KHDA 3SQMA 2HV5A 2WJZA 4FR6A 1MMFA 1XIFA 2PDPA 4KRTA 4B2DA 3L4UA 2ASHA 1U5HA 4UOZA 1A5AA 2OO6A 4D2JA 1UD8A 3RAOA 1OT2A 3CUZA 3WDPP 3BG3A 3MMWA 3CLMA 3NZRA 4EOUA 4XBSA 4BEQA 4Q7IA 4Z2KA 3LPOA 2DDXA 2R1KA 1JZ8A 1Y8BA 4GKTA 5HPCA 6XIMA 3NQEA 3SB0A 1AMYA 3LHYA 2R94A 1I2OA 3PTMA 2DIEA 5D2XA 4AH7A 2FJUB 4IF2A 4D6JA 3QFWA 4QNEA 4XO6A 2GJXB 2HCVA 2WC4A 1BLIA 4HK5A 3LU2A 4HJWA 2Y0FA 5FD0A 1XSIA 2WPGA 3MZ2A 3OO2A 5C0QA 3PN8A 3WX7A 1W5MA 4RCXA 4IPLA 1HKJA 1X6UA 1R7OA 3OZOA 4KEMA 3IJDA 3HQPA 5E9AA 4GUHA 3PTDA 3NVTA 2WOQA 2BG5A 2CBJA 2CZVA 2J6VA 2PWUA 3AMDA 5MKGB 4J3VA 4WY0F 4XG1A 4QJ5B 3UEQA 4NNAA 1R7AA 4S2BA 4HOXA 2WNWA 5E6ZA 4Y9NA 1VRXA 1EIXA 3KW3A 1PTGA 4Z1DA 3UR8A 2NW0A 2EO7A 1DTNA 1FVPA 2ACRA 2X7WA 4DPQA 3NR0A 1XG4A 1EJ7L 5U4NA 3HQOA 2V3DA 3HPZA 2WSPA 1ZGDA 5C8BB 3GTNA 4YCOA 1BXBA 3THQA 4KKXA 3VD3A 1NFPA 3LCGA 1VCFA 5CEWA 4QXIA 1OGBA 3MYOA 1TPB1 3KDNA 3TNBA 4H41A 4PZVA 3TTQA 1QI5A 3VO0A 1BWKA 2PU0A 2VO5A 3AHYA 4C1LA 2E6YA 1ISWA 2YCJA 2XM2A 4DX3A 2JIWA 3DG3A 3ZR4A 1W9UA 1VHCA 3R1ZA 4TIMA 3M6YA 4D8LA 2Y5EA 3N18A 3H22A 1PZ2A 4YL2A 5A94A 3OTRA 4ZBCA 3NQFA 2IPGA 3GTIA 2QJIA 3CQ0A 3LGDA 3NQ6A 4JX4A 4A6GA 3HG2A 2RGMA 1SJCA 3GM8A 3FS2A 4RZ5A 1S38A 2HNEA 4MFEA 1B30A 4GC3A 1TJRA 2IKJA 1OINA 1GOWA 1P43A 1VR6A 5HQLA 1OT1A 1SJDA 2B81A 1C9WA 2VC7A 5T9CE 3VC5A 5C7HA 2Y7DA 3WLLA 4YHGA 4JTQA 1MXGA 1TCMA 1M7OA 4GQBA 2A0NA 3GVRA 3FGCA 1XIIA 2ZX7A 1X1ZA 4OECA 1YHTA 5K4XA 1XICA 2PDQA 3V18A 1SU5A 1BYBA 4ALDA 1I75A 5LGZA 3W1QA 3WBYA 3CLWA 5EL1A 1T96A 3QY7A 1QXLA 1THFD 4DNHA 3O3RA 4WDUA 3I6EA 2QJJA 6ENLA 4GVIA 3TFCA 3W6LA 2FZ8A 4H1ZA 3VFCA 1P0BA 4IMFA 3T07A 4G1KA 4Q8PA 5E0FA 3GDKA 5I3IA 3N15A 5B7ZA 3U7BA 2PDLA 3OLEA 4OBSA 1GW9A 4GYFA 3TMLA 1FH9A 1QHZA 5EA9A 2J7HA 1UQYA 3C0LA 3F2BA 3RILA 2PDCA 3FGCB 4AWTA 2VYOA 3EDJA 3LBMA 2XFRA 1HL8A 4KCVA 2UBPC 4CD8A 3SBFA 1UPMB 4RNIA 4WKAA 4F0MA 4MWAC 3WLJA 3DENA 4WOZA 4ZTYA 5GNZA 3E2RA 4GABA 1V0MA 3WQFA 4V15A 2AQVA 2ZZ5A 1LT7A 1W91A 4O28A 4QJ1A 3U4FA 4HHMA 4JN7A 4PUKA 4J1OA 3QTGA 4XAPA 2I16A 1DWFM 3GWQA 3NL2A 4HU0A 3DX5A 3B97A 4IIEA 2J6XA 4DZIA 2BY1A 3UWYA 5CLTA 5CSUA 4LVFA 1LG1A 2ZCGA 2ZUSA 2ANUA 3A24A 4EK7A 4LT9A 3MTWA 2PGFA 1YEYA 1WNOA 2VFDA 2DT3A 4PE8A 4YLWA 4CVWA 3MT1A 3F5KA 2X1IA 1IZCA 4E8CA 3S5YA 5KINA 1F05A 4WJEA 1XPYA 3WMCA 3T8LA 2WVUA 2ZVIA 2RAGA 2W79A 2ZUNA 2XIBA 1QWGA 1TRDA 2ZX9A 4H9UA 4NZ1A 3QHNA 4JICA 4NXSA 1AFSA 3ARYA 3T6CA 4YMZA 3UZYA 1U22A 2ZZ2A 3GBDA 1Q45A 4DF0A 1VYPX 4P8WA 3VOGA 3H7RA 5IXEA 2VM8A 3MDUA 2GSJA 4D6CA 2GVJA 2CLHA 4JQ3A 4JTRA 2X40A 2DSWA 2WVSA 3VDCA 3KBMA 5EYWA 5EFDA 3CB3A 2WNZA 4K1GA 4MB1A 2XH7A 1W5PA 4W9TA 4F66A 1J8VA 4HZ8A 4H6EA 1V0LA 4R5EA 5AYBA 1FWTA 1TUXA 2XZ7A 4K2SA 4HU8A 2DW6A 5IDIA 2DH3A 4H3DA 3LSCA 3W7NA 2O7QA 3PBUA 1MFVA 1DBTA 2V5JA 3TJIA 3KVKA 5AKQA 4C6OA 5AHNA 2YA0A 2J47A 4I7VA 1TTQA 3CHFA 4ZR8A 3ES8A 1SW3A 1C9DA 4MF4A 1UBPC 1JI2A 4ASTA 2WLYA 2YDSA 5HMFA 3W72A 3R89A 4MLJA 3S1XA 3QRHA 2PWDA 3BAYA 3MUXA 2HVOA 4XIAA 3LXBA 4Y8FA 2Z2AA 4QJ3B 4EX4A 3O8AA 2VVNA 4S3JA 2AL1A 5C5YA 3PWIA 2G3NA 3CZEA 4UZUA 2ZC8A 2XIQA 3LA4A 2FZBA 4WIWA 3R8GA 4H6RA 3WLOA 1JI1A 1UG6A 1BQGA 1EDGA 1EJWC 4B5NA 2D69A 5K9CA 1KM2A 3VIMA 1XYFA 1EL3A 1V51A 4B92A 1SGJA 2QPSA 3TJXA 4PL1A 2E3ZA 1FWHC 1KGUA 3H2NA 1AL7A 3VCRA 3FVMA 3W1RA 1GONA 4UQEA 4HYVA 1E0UA 3N25A 2VOMA 1BHGA 1DXEA 3F2CA 1LLOA 3MO4A 1RCOB 2A5HA 1NARA 1FWGC 3AJXA 1E6NA 4OKDA 4F0SA 3OVQA 2WC7A 4X3ZA 4UTFA 2DZXA 1FKXA 1UWRA 4O15A 3H4XA 2X09A 3IJ7A 1L0PA 1OX6A 2OQYA 4CQBA 4ZL1A 4DUOA 3UXAA 1OCQA 1H7RA 3H21A 4PUMA 5AYXA 2PMQA 3CAQA 1HGWA 3AHZA 4Q6XA 1QU4A 4Y6GA 4DM1A 3EMCA 1H62A 4G9PA 5FEXA 5BOEA 1UKSA 3W7DA 2I17A 3WD0A 1R3TA 1B3VA 4NSBA 4RX0A 3CUGA 2HBVA 2J8FA 3EYPA 1JYNA 3TYUA 5FJRA 1H11A 3W1XA 3DESA 4AXKA 1XIJA 1IXOA 2F84A 4CNTA 2NXIA 2Z27A 3G22A 3S0CA 1CBGA 3HG3A 3NDOA 5TBOA 2ZTKA 4KCUA 6CGTA 3FY1A 4MSSA 1XLMA 5HUOA 1W2PA 3W86A 3KLLA 1V02A 1AMKA 4L6HA 4DJFD 5JH1A 3G18A 4NL1A 2YZ5A 3DGRA 4MYAA 1LWJA 1B57A 4C6PA 1E1CB 4JFVA 5G2WA 1AQHA 3DG7A 5EMYA 4JTSA 2FH8A 1TKKA 2BVWA 2NX1A 4BJHA 2VUNA 3OZYA 1S39A 3ABRA 2B7OA 1DIOA 2VCAA 3CUIA 3BLPX 4A3QA 4CCCA 1PX3A 2OGYA 1AD1A 3RIKA 3M07A 3QXBA 2VOTA 1VLIA 5DMNA 2V63A 3P61A 2UY5A 1T8XA 4XSMA 5DCBA 1B3OA 4ZQCA 4KFNA 3DERA 2Y6ZA 4J5NA 1FH7A 3PZMA 3G6LA 4OE7A 1O5KA 3W00A 2A7RA 2D73A 5HNRA 3L4VA 2QF7A 3KZPA 4MWAA 5REQB 4JTIA 3DHDA 1R2TA 3GY1A 3C56A 1I4NA 2XUCA 3NNTA 1UD2A 1ECEA 4Q8TA 4KS0A 3TH6A 5D37A 4MZ8A 2VC6A 3LBOA 1PKLA 2WJEA 1JAEA 1SO4A 4J27A 1OFPA 2YCLB 4X9YA 4BA0A 4MB4A 3DG6A 4MM1A 3A47A 3B3DA 5AYYA 1XD0A 4GISA 3NQDA 1I1WA 4JN8A 3EOLA 3LCWA 1GOKA 2VRQA 4JL1A 4X9SA 2PDXA 4LVGA 1XYAA 4TVDA 5ECUA 5K7JA 3L68A 3PP7A 4DI9A 1B90A 3SRKA 3VD4A 3TOPA 4AB4A 2R91A 4EXAA 1O6IA 2OZ8A 4EKJA 4ES4A 1KCKA 3C8NA 1Z7AA 4JD4A 2IXUA 3I6RA 6REQB 9XIAA 2PF0A 3AZSA 1IR2A 2V5KA 1FCQA 4ZSTA 2OYLA 3ABSA 1OZMA 1ZSXA 2VZTA 3QV8A 1F8IA 5FACA 1D7KA 4LNCA 4F79A 1YXYA 1I8JA 5HOSA 4AC7C 1I6NA 2XVGA 1H61A 1IZKA 1ZP3A 5BNKA 1XBYA 4K3ZA 3NL6A 1Q8JA 2F38A 4XZIA 3FYOA 2DY3A 3SN0A 3QHOA 2FHCA 4QG8A 3IJ9A 3QW3A 3OGVA 3CGTA 2X16A 1EZ2A 1PDYA 5A69A 4R7JA 4IX2A 2V3GA 4AF0B 1VH7A 2DT0A 3R8RA 3V7PA 1KQYA 2HXUA 4HMCA 2NSOA 4XZ9A 4JDYA 3TN5A 1UQZA 4KIRA 1VFHA 3SZ8A 1WP6A 4PUDA 4QQUA 4AX7A 1GYNA 3UGVA 3CPUA 4PUEA 5D2YA 1HVXA 1H0IA 3W7LA 1E3XA 5T9BG 3V1PA 5JIPA 1VPYA 1Y7VA 2FHBA 3U2EA 1GQKA 4ZQNA 3W7KA 1P7TB 1R85A 4DLFA 1JZ7A 3VDHA 1WAWA 4LOCA 2ZXBA 3ECQA 2QDEA 1WB0A 1KWGA 6A3HA 3QR1A 2QHAA 5J5DA 2DQXA 2X1RA 3K13A 1C90A 1ONRA 5LNUA 3PPHA 3WEZA 5HR6A 4GNJA 5ABHA 1O68A 2R1LA 3HF3A 4LH8A 3IJLA 4DYEA 1JQVA 2QKFA 1BGGA 1RP8A 3D3FA 1HXJA 4U4MA 1TVLA 2NLIA 4S3EA 1TPFA 3U48A 1M68A 1EQCA 1QASA 3BAJA 2DZSA 4KGLA 1OM0A 1GJPA 3EMZA 1FDYA 1KNWA 2WMFA 2DIJA 3UCDA 3N3MA 1ICQA 5HNUA 3LG3A 5I3KA 1FWNA 1P5BA 1IGSA 4DWSD 2HNHA 2PD5A 5CJ5A 1TFVA 5A8MA 3S1VA 3P5ZA 2DUAA 5CH9A 3FJLA 3QOMA 2OQHA 3LMYA 1NTHA 3SQSA 1KR1A 2X0HA 4U33A 3BW2A 5FA5A 4D6EA 4AZ5A 1C8YA 1V08A 2QYGA 4FOKA 1VJZA 4UFJA 2DPEA 1UH2A 3H2EA 3ARXA 1UD6A 3DFHA 1A47A 5LNSA 2J78A 3T0BA 4CN4A 3C2FA 3DFYA 3M16A 1W1B1 1N2VA 2C18A 5A8OA 2YDRA 3MDWA 3W23A 1GGOA 1NWRA 3MKKA 4YIWA 1CLXA 3TYAA 1C7SA 2IPJA 4JN6A 2PUZA 3H4GA 5D05A 3V75A 1JD9A 3CZGA 3T0AA 1FQ0A 2XIIA 1LL6A 5A8NA 2QIWA 3GDLA 2EBNA 1PWLA 3W1UA 4HIBA 1S3TC 1ZU8A 1LZOA 4JIEA 3VI2A 3CU2A 2EPHA 1C92A 4NI8A 3WFZA 3QOKA 2TSYA 2VEGA 3UFYA 2OX1A 3KFTA 1DHPA 1DV7A 4JZ5A 4FNUA 1GPFA 4B3LA 4MOZA 3C6CA 3WH8A 1KFLA 1MRQA 1UR1A 4ERIA 2E1WA 3WCZA 1M7PA 1XKJA 4Z2IA 2BB0A 3T7VA 4NUWA 5C6MA 2YYTA 3VDAA 1J4EA 2YB4A 1NQ6A 4B3KA 1JYVA 3KCLA 1MQQA 2WVVA 3UETA 4US5A 1WBJA 4Z1CA 4DF1A 5C9WA 1XDMA 4HNCA 3WQCA 4M8UA 2A3CA 2ZTJA 1DE6A 4ROQA 2G5WA 5LIKX 2Z6IA 3N6HA 4NJGA 2WMHA 1RJRA 2F8QA 4PB5A 2OWXA 1G5AA 1XH0A 2TAAA 3GTXA 3NM1A 2ZE0A 3OYXA 4GY7A 3F4VA 2WMGA 5C7VA 1F61A 1TUFA 4QEEA 4JTTA 3FOKA 3UBPC 3TR2A 3S6OA 3NIYA 4IG2B 4ATDA 3CK5A 2VFGA 3ELFA 1KW1A 3ZOAA 1TG7A 1MUCA 4NAEB 1BYCA 2V82A 3TOYA 4CN1A 3PUEA 1U2YA 1J93A 3HQ1A 4ATLA 1LLZA 1E0TA 2XH0A 1G9HA 3MCOA 3SDOA 3B4YA 1ZBWA 2YOCA 2VDIA 4OHQA 4GKLA 5I03A 3QGAC 1EJUC 3L2IA 2NX9A 4JY8A 4JHMA 3B8TA 3HU7A 3KHJA 1ZCCA 4LS1A 3TXVA 5AC7A 5I2UA 3ZVHB 2VRJA 3CHCA 1E70M 4HNTA 2BXVA 1KXHA 1W9DM 2W61A 3FV9A 3LCLA 2VC5A 2WYSA 4Q6JA 4S39A 1ONEA 1LOQA 3YPIA 3WLQA 3BJTA 3H54A 3FYPA 1P0KA 1XCFA 3WN6A 3QSTA 5AZ1A 4PRRA 3NEVA 2G95A 1VP5A 4JR5A 3EPMA 4F2BA 3KTSA 2WW5A 1GPWA 1OY0A 1D8WA 4K1WA 3WD2A 3GG7A 1Q6LA 3PPGA 3WDRA 5AHIA 4YVXA 2A4AA 4ZO6A 2FPVA 1RZMA 3Q58A 1WV2A 1W9XA 2PFHA 3PPCA 2FGLA 3AMCA 5F4SA 1LORA 3MA8A 2VX4A 3VMNA 1R86A 1NF0A 4FP1A 2OSWA 3W01A 1SJAA 1UWQA 4NKCA 1EJSC 3WNLA 3WBEA 4AIUA 1XV8A 3EXTA 4DJED 2QJGA 1XDJA 4CCZA 4Z2GA 3B40A 1E9ZB 3U5YA 3I7QA 2I57A 1TWSA 3UY7A 4AAJA 3WDJA 4AZCB 1FDZA 3VD9A 4A05A 1KM4A 1ZZMA 4B91A 3IJQA 2W5FA 4TXEA 2WVVB 3FDGA 2JF7A 1FWWA 2QVNA 5BW6A 3USBA 4LNYA 5EPDA 5GNXA 3NQ7A 1R30A 1CIUA 4IJCA 5EMMA 1D3HA 3AYRA 4JTJA 4IJRA 4DVOA 2EQDA 1KKRA 3WUEA 3KAOA 2W4XA 3M9YA 5BMWA 3A9IA 2DZWA 4LAMA 4US6A 2VR2A 4PTVA 1JCMP 5HBFA 3MANA 4CQAA 1BKHA 3AIEA 3RPDA 3UF9A 3QMSA 4XD4A 5HDRA 2X1SA 4JQ1A 5CKSA 5JH2A 1V3MA 1NIUA 2D2HA 3AMKA 4GIYA 4AZ6A 4M56A 4OU1A 3QY6A 2EPMX 3VXGA 2ZUMA 4IFRA 5A6BD 3KCOA 3RN6A 1RPXA 2WJDA 4XUGA 1UPPA 3TTEA 4H01A 2Y61A 2TPSA 1GVYA 1PBGA 2QCLA 4JOMA 3SCOA 3LTYA 4QIUA 3EAUA 4WHBA 3E3HA 3ZS4A 3R94A 3PHAA 4L9XA 5I3DA 3GLCA 4K37A 1W54A 4HPGA 1AW1A 2F9RA 4QNWA 4MFDA 3ZMRA 4LUSB 2VXNA 3A3WA 4DXXA 3BMXA 1JZ4A 1SM9A 2G4JA 1RJQA 3TA9A 1JZ2A 1WE5A 5D2WA 3VIFA 3UXIA 1RBOB 4DUVA 4PMNA 2R6OA 2E67A 5HQEA 1BGAA 1YIXA 4I8DA 4E3TA 5LHEA 2FZDA 2WQDA 4O1DA 2JEPA 4J3UA 1RCXB 3UWWA 2AQOA 2MUCA 3WH6A 4QSHA 4O4VA 3DOPA 4I7WA 4JTHA 1Z9AA 4C6QA 3GNPA 1EC8A 3QF0A 1BRLA 1GHRA 4ZCWA 1DYSA 1E5NA 3PZ9A 4NZJA 1FP8A 3NGJA 1PCWA 2OLAA 3BVJA 4NX0A 2OWCA 1EPVA 2ACUA 3UPMA 1ESWA 2CNCA 4IOTA 3P82A 3LNMA 3OGSA 5D2VA 1EJVC 2NWRA 1UZHA 2IW0A 2BXYA 3PTKA 4GIAA 2GL5A 1XL9A 1PL9A 1K70A 1EGVA 3GXFA 3A22A 3VDGA 1J5SA 2YPIA 4IQDA 2A3LA 4LPCA 1W1PA 1R5YA 3VKJA 4EPEC 3VIHA 1A5CA 3GFXA 4XIMA 3MWCA 1RA0A 3S6TA 5KZEA 1EC7A 4L4MA 3BLFA 3VK5A 2QJHA 4ADSA 5FEPA 3E9AA 2YYUA 3FJNA 4ZOCA 4GPNA 3R0DA 4KH2A 4Z1AA 3E6EA 2P3ZA 2PTXA 3GR4A 4AIOA 3THUA 3O06A 4L4LA 1K4GA 2EG7A 2QCHA 1ZALA 1DOSA 3DI0A 4GO9A 4N9CA 1MXSA 5EBUA 1GOMA 1TV2A 3UWVA 1FOBA 3UZJA 2Q8ZA 3WBXA 1KFJA 4LUIA 4GLEA 1IIGA 1W8SA 2CFFA 3M0XA 1WDRA 5F4WA 1OD0A 2FDMA 4GYPA 4Z0SA 5ABEA 3HGJA 3WH7A 3TU9A 1DJYA 4GY1A 4PEKA 3WNOA 4YPJA 2V2DA 1HIZA 3GD6A 3ORWA 1KTBA 1TIWA 2G3IA 5FF7A 2J7EA 2YA1A 3LCXA 4C7GA 3WL0A 1G01A 4FMVA 3CMFA 4MY8A 2ZWYA 5TIMA 1GVRA 4OOUA 4CQ8A 4RNHA 2XN2A 2O4QA 1OADA 1POKA 5G1TA 3ITLA 4W87A 4TR9A 2TRSA 1CDGA 3BGGA 1LBMA 1X38A 3AXIA 1EKOA 3CNYA 3N2TA 1D3GA 2XH2A 3DC0A 3MZNA 3C4UA 3W7EA 2E68A 2NV9A 2J77A 5D9MA 5FEZA 4DO7A 3RGTA 4HA0A 1OEPA 4GGBA 1V6UA 4QCFA 4WK9A 3W0KA 1K6AA 3B0YA 2WNQA 1G4SA 1OX4A 1G4EA 4YJ5A 1W1YA 2VEIA 1S1PA 1DJQA 3KOYA 3R6IA 5AFDA 5K2ZA 4K7YA 2E6FA 4PMYA 4JPGA 4PGLA 3OU8A 3GH7A 4PMDA 4C6BA 3PAOA 3LUTA 3F4NA 5D09A 4GZEA 4MHBA 1EGZA 1JYXA 1LDCA 3K46A 2V67A 3NSNA 1EIBA 1K7XA 4DJDC 4G56A 3HN3A 2W67A 5AECA 4ADTA 3CUJA 3WF3A 3IUDA 1DTUA 1NWTA 3ZVIA 3W9ZA 2E77A 3W2MA 4YTUA 5F4XA 3E74A 3M1ZA 3S8HA 5CLWA 1SW7A 3IK2A 3C3UA 3GZ3A 4JNZA 3LCIA 4KPLA 3VNYA 4KCWA 1MNZA 4KRUA 3BXWA 3VMPA 1GZJA 1OFQA 4ZB0A 5AHLA 4PMZA 2J9ZA 2CXGA 1Q2SA 3C5QA 1K7FA 4A4AA 4GG9A 4IXHA 3JRKA 2YCEA 4QS5A 5I3FA 2XSBA 1LF1A 3N2XA 4NT0A 5LIYX 7TIMA 1UD3A 3UJEA 4W89A 3ARPA 1EXBA 3NGFA 5FSEC 5AHMA 4Q4OA 2X41A 3AS3A 2E5DA 4UCGA 4OVXA 3RJYA 4LVAA 2PEVA 4UTWC 3G1AA 1MSSA 4GXPA 4M5PA 1EP2A 1DIEA 1FXQA 2CHNA 3M0ZA 4IP4A 4H4IA 3SY1A 1P7TA 3BOXA 1UUMA 1VFLA 2P0IA 2DJLA 1X6LA 3R0UA 3BCDA 1G0CA 3HB9A 2GGEA 1E72M 3TP4A 4KEVA 3WQOA 3L2MA 4C1NA 1S5TA 1I45A 3K30A 8A3HA 5I78A 1CB2A 5T26A 2H9AA 3ZR6A 4O11A 4CQCA 1QK2A 4I8YA 4AZ7A 3WUFA 3I10A 2C91A 4Y9AA 1WA3A 3GHTA 1NY1A 8CGTA 1VIZA 2WMKA 4W86A 2Z2BA 3WF1A 4ACZB 3ITOA 2PRHA 1J10A 2CWXA 5A6KA 4MPQA 3SCTA 2J88A 1JDDA 5PTDA 4R7OA 3PJTA 3AUJA 2QAFA 3A13A 4BQ2A 3EDEA 1DXFA 4PCNA 1U83A 4K8HA 2BHZA 4O1EA 4MJ2A 4WXYA 5I5RA 1TZZA 4IQLA 4L56A 1A5KC 3AUOA 3WD4A 3GO2A 3GDMA 5DLCA 4LUJA 1KM3A 3E02A 1QHPA 1JFXA 4ZO9A 5FL1A 3SFKA 5AC6A 3MV01 3MUZ1 5IBXC 1EHAA 4FNRA 4EWJA 1QBBA 3L21A 3VOHA 1JCYA 4NVTA 4DWSB 4Q8WA 4CD7A 1BSIA 1FFRA 3IEBA 5BXPA 2V68A 2Z7KA 1C8XA 2DT1A 4AD3A 1QW7A 2J75A 3W1TA 6XIAA 4U3CA 3LCFA 4Y96A 4RZ4A 4XVDA 5EFFA 3CC1A 1SJBA 3AS0A 1M6JA 4GQ0A 1ZJHA 3MSRA 3HJEA 4QCEA 2AOSA 5KZDA 1QO5A 3AICA 3UG4A 4WGXA 4C6FA 5RUBA 5CBIA 3N6QA 3OHIA 3LN3A 4RJEA 3UNDA 4MAZA 3ARQA 2O9TA 5FL0A 3SY8A 3RM8A 1F6PA 1LROA 1DORA 2PC4A 2POZA 1CB7B 3WQWA 2OT1A 4OBRA 2CIPA 3C8FA 2V9DA 3R5EA 3VINA 3R4IA 1CLKA 2ZADA 3UJRA 1Q6CA 4ORMA 4EACA 4XSLA 1YADA 3LHWA 4UFHA 1WZKA 1S2UA 4HA4A 5M3WA 5KZMA 4Z2HA 4CD6A 3BLLA 4LYQA 2XH4A 4XKYA 3H2FA 1PHQA 2VFEA 4LYRA 3H12A 3WEOA 1U1HA 1LQAA 3PF3A 3A21A 1M65A 4XVEA 4JCLA 2TMDA 4GCAA 4A2SA 5A1AA 2V69A 2WB5A 3LDVA 3DGBA 4KWSA 4OBTA 2DUZA 3M43A 2WWDA 3R12A 3REQB 2OQLA 4J4KA 4ZA0A 5E9XA 3NZGA 1V0NA 3CO4A 3GC5A 4J7RA 8RUCA 2GJXA 1GVIA 5AVNA 4Q3MA 4CKQA 5BZAA 3LI0A 2QCDB 1JF5A 4DZAA 2FYMA 1NOFA 3PG8A 3UW6A 1ECQA 4R27A 3SCRA 4UTTA 2OZ0A 1UUQA 3FLUA 3ES7A 4ILSA 2ZBTA 3IRDA 3NL3A 3UVIA 3VOIA 1HJWA 2OB3A 4DF2A 3GC2A 3GG1A 4O13A 3S1WA 2OSYA 4AZGA 4ZQPA 3RG6A 2GQ9A 1A5NC 3V3WA 2OZTA 3W6YA 1QUMA 4H6KA 1XH2A 3MVTA 5KEZA 1U1JA 3PNZA 2EPOA 2JGYA 1H3GA 1NH6A 3ITYA 2Z25A 1OSEA 5A6JA 2C0HA 4K8EA 3W7IA 1O1HA 3MJYA 4GZ7A 3AZTA 4ERGA 2OT0A 4EPDC 1IIHA 3QV6A 4UQDA 3NZPA 4J3ZA 1G7VA 1R87A 2BOGX 2PCEA 4RDWA 1GQJA 3AIBA 4WDWA 5BRPA 1RBAA 1U1UA 5TQLA 1E4LA 4HQVA 2VR5A 2QQ6A 3SCPA 4JEQA 1EXPA 3BW4A 1KFBA 3MW7A 4GA8A 1W3LA 3MS8A 4JFTA 4EANA 5ABTA 2FLIA 3PB2A 3GK0A 1WDWA 2RDUA 3MB9A 4ZXLA 3E0WA 4TX9A 3BV7A 2GJLA 3MVIA 2GOKA 1UD5A 1L2QA 3T9PA 3ABOA 1GOOA 3M5ZA 1VKFA 3GC4A 4OZOA 2WMJA 1RD6A 2QDHA 1PB0A 3ZSTA 2EJ1A 1A5MC 1K8YA 1SO3A 5HA7A 2FGZA 2D2JA 2CWNA 3BOFA 4BQ4A 1XRTA 2CLIA 1QOXA 4NILA 1E56A 4XB3A 2JFEX 3W37A 1KGXA 4DJDD 3AI0A 3EX3A 4UMAA 2HVMA 1DHKA 4N7QA 1ICSA 4TV6A 2ZKMX 1ISYA 1BYAA 1JULA 1UROA 2A1YA 3UJSA 4MNKA 5L6UA 4KRZA 5EGRA 4IXXA 2BXZA 4OUEA 3M64A 5EKYA 2CBVA 4G2DA 4M51A 4ZQMA 3KTXA 1XSKA 3AXHA 2HDJA 3NTYA 4BFAA 4LU0A 4L9ZA 3CH9A 3GHSA 4ZVJA 3NPXA 3O7UA 3KS6A 1JUEA 3LX9A 4D6IA 4Y90A 1CGWA 5BU9A 4HMDA 4O52A 2PRLA 5I0DA 4YU1A 4GI4A 4NRSA 1W5OA 3ABZA 4I9MA 4UNLA 1H50A 1F2JA 4BKNA 3GNNA 1B5TA 3I7RA 3S2CA 3ERPA 2CBIA 3KE0A 3BURA 1SFJA 3RPMA 2NV1A 2OLSA 4CUCA 3TIMA 1DQWA 1OYBA 3L5LA 4BQ3A 1ZP4A 1QDSA 3RUBL 3SSZA 1G6CA 2E09A 3NFUA 1T99A 3EXSA 4O54A 1VPXA 2J13A 4GXMA 4US5D 2WAGA 3VGGA 1TTIA 4BHYA 3FFSA 3C52A 5IFPA 1UZDA 4PODA 1W2VA 3QKZA 3W3OA 3BZJA 3WZ0E 2F6KA 1Y0EA 3VA8A 1V93A 1BYDA 2NQHA 1OK4A 2ODOA 3CIWA 3LNPA 1FWCC 3EWCA 3CZLA 4UNIA 2QXWA 1YXCA 3PZUA 1E73M 3W7OA 3A4AA 2QGYA 2J8TA 1DKWA 3OYZA 3HIJA 4XZBA 3WLNA 5K4ZA 4M19A 1W9PA 4MY9A 4AZCA 2PDBA 4M80A 1YTKA 1ENUA 2E8YA 4DBSA 2WCSA 3VCNA 2F6UA 2J4GA 3LV5A 5D04C 1Q6DA 3L0GA 1YBQB 1A49A 1FHLA 1XR2A 2NQ5A 3UA4A 3UG8A 3PG9A 4GY0A 3EDKA 3UR7A 5HWNA 3KUMA 5BYWA 1A5BA 4OV9A 3ZT5A 2QJNA 1HT6A 1WYIA 2A3AA 1H2JA 4O12A 3KXQA 3TN3A 4DUXA 2QDDA 3EKZA 3VGBA 2WLZA 2QMJA 3LHTA 5A8GA 3MUAA 3MHUA 4KERA 1L6WA 2V0TA 1TPC1 3K2GA 3NZ1A 4HOWA 3NPWA 5FJIA 3HO8A 3ZIZA 3V16A 3LXAA 4LRSA 5DO8A 1R3VA 2E5CA 2PWFA 1IT8A 4W5ZA 5C2XA 4JQ2A 2WWCA 4NZCA 4U31A 1AH4A 4HB7A 2ZVRA 4C6CA 3IJ8A 4E4PA 3OJGA 3KOFA 3EGJA 2WSYA 2ZYFA 2NUXA 2D23A 4MZYA 1WZLA 5CJMA 2CPUA 5AN7A 4Y9PA 2DP3A 3IVUA 2PDGA 1NEYA 3U2ZA 5DY3A 2NX3A 2Z1XA 1Q2RA 3GDBA 1MQRA 1L6YA 1OK6A 1UWUA 2Y8KA 3QQWA 3N9RA 1W3NA 4R9OA 1AUSL 3HPFA 1RV8A 4AWUA 4LW7A 3TLLA 1TYGA 1VZWA 3NYDA 1Q7MA 3WJSA 3T2PA 5FAGA 2VGFA 2BHUA 2V3EA 3UCCA 3AO0A 2QAPA 1JPIA 1KM0A 2C1IA 2RH9A 4AVFA 1QPRA 3VGDA 4LV4A 3W27A 4FI4A 3VKCA 1CGYA 2JGQA 4P7NA 2WZIA 1V79A 2HK0A 1S5MA 3BJSA 2NLYA 2J62A 3TQPA 2OYKA 1AL8A 2BGNE 4KCTA 1GG0A 4RNFA 1E0VA 3RM9A 1PX4A 4OGZA 3M7SA 1C8VA 2Z0IA 3MC5A 3T81A 2I56A 4AU0A 4FK9A 3SJ3A 4MUPA 4UTLA 2WZHA 4B5TA 2ZRUA 2NUWA 3TA6A 5BOFA 3BC9A 4HZ7A 2OKTA 1TPUA 4V2XA 1V6TA 3BAXA 2C7FA 2W92A 1UOKA 3H8AA 4HJFA 4INFA 1BQCA 3G1FA 2QPXA 3IIPA 3MPGA 3BAWA 1BD0A 4DJFC 1SSDA 5DELA 3K4WA 4Q7NA 2VCCA 3SY5A 4RLIA 2BY2A 1W1TA 1F4AA 5BROA 1Q4WA 2X1UA 4OJYA 2OMAA 4GOAA 3U7VA 1A80A 1KXTA 1G4TA 3PM6A 3LHUA 4KFPA 1AVAA 9RUBA 1TJPA 2QCDA 3MJMA 2GVLA 1MQPA 3QVQA 1X7FA 5KITA 3W2LA 1SFLA 3E0VA 2CW6A 1XIEA 2PDYA 3RX3A 2EPKX 3IS4A 2YLLA 3HG5A 3KDOA 1UR8A 5XIAA 2GVYA 4XZWA 3SGUA 7REQA 1X8CA 2YLAA 8TIMA 4IUOA 1EX1A 4TUFA 1J0HA 1E6XM 4IIFA 7PTDA 3S9ZA 2VEMA 3SUUA 1P0EA 3DCPA 3FYYA 3SURA 4FOUA 1LRNA 1WKDA 2BGQA 3NOEA 1E15A 3LLFA 3Q67A 3TC3A 5HNTA 1RK5A 3ATYA 1B3YA 2BTMA 3WBWA 3CZKA 4I9AA 4NYUA 3MHGA 1ZQ5A 3S6DA 3FVDA 5I79A 3PNUA 4GI6A 2QUMA 5LNVA 1DJWA 2OWWA 4FZIA 1P0DA 3ALGA 3WDQA 2QCFA 3BQ6A 4PCFA 1ISVA 5FIPA 2OXNA 1W5QA 1EO7A 3LQGA 2ALRA 1R2SA 4HYRA 4O8RA 3CQKA 2PDNA 3N13A 3VFLA 1BG9A 1ZJAA 2P1FA 4PYSA 3AHVA 2YXGA 4LB3A 1A4MA 3T42A 1WAUA 3KL3A 1HX0A 3B9NA 2REQA 3FA5A 3EDDA 2W9MA 3W1LA 2ABBA 1SZRA 3FKRA 3TYEA 2GGHA 1ME7A 2Q71A 1K6WA 3GG8A 4S3KA 3S2JA 1JGMA 1EF3A 1EP1A 5DT7A 1QOQA 3FCPA 4PUNA 2ISWA 3MSDA 3XISA 4FX7A 1R3RA 4IIBA 1OF8A 2H3BA 1ADOA 3BPWA 3GS6A 1QVBA 3GAYA 2ESCA 5GJNA 3MSYA 4MDOA 1SPQA 3VKDA 1VEOA 2UV8G 4NP7A 1MDLA 1YQ2A 4FF5A 1EOKA 5MF5A 3MYPA 1XRVA 3QPEA 1O66A 4R53A 2YDQA 1MEIA 1PJ9A 1NWUA 3G0SA 1JCXA 1VS1A 5T91A 3NDZA 4K8GA 3RLVA 3N4FA 3UERA 4E8DA 4H7ZA 3RU6A 2Y5JA 1I2PA 4B90A 4Y9MA 3AXMA 3LZ5A 3QMTA 1XCXA 4YWSA 3LB0A 1YLVA 2PTYA 1PYMA 4U10A 4ZFMA 1HGYA 1RQEA 1BXCA 4H9TA 3WQ8A 1MZRA 1R3SA 2JKAA 3HA1A 5M5DA 3ARZA 1NQKA 3FXYA 1Q3NA 3APTA 1AA1B 3PVFA 4JFUA 3QY8A 3EB3A 1J6OA 4YVPA 2BWGA 1TSIA 3BZGA 4LF1A 5D2TA 5C54A 4MIMA 4GXWA 1J18A 3HQNA 2DIKA 2DV0A 3PJWA 3DFNA 1E6SM 1HFBA 4JX6A 3L0KA 5GQBA 1UWIA 3BO9A 4DNMA 1K8CA 1LJYA 1VQTA 1XLCA 2ZUTA 4L61A 2OODA 3QV7A 5HWMA 4DAIA 1NSJA 3CHDA 1UC4A 1QW8A 3VZXA 5B80A 3WDIA 3L23A 2G3FA 3TZFA 1SR9A 4MVAA 2PDWA 1XHGA 3UXLA 1JDEA 3ZWTA 4DYJA 1XSJA 4GINA 3GU2A 3H6OA 5AHFA 2CLOA 5CAKA 1FWSA 4N9EA 4RDZA 4ZZ9A 5CBBA 4IIGA 3DFQA 3NDYA 1NDZA 4NZ5A 4HNNA 5GJMA 1DP0A 4XK2A 4KETA 1EWDA 1LUCA 5C70A 3K1DA 1UASA 1CGUA 2CBUA 1VYRA 2FMOA 5TD4A 1VFFA 1KBIA 3R7MA 4XAZA 3FEMA 5EBAA 5FEWA 2QVHA 5IDZA 3D6NA 4IP7A 2DSVA 2BDQA 3RITA 3KP1A 4TMCA 4WR3A 2POTA 1ADSA 3G1HA 2H3DA 2NQZA 4DJDA 2WSKA 1B31A 2E7FA 3F5LA 1XC6A 2Q09A 3CPGA 4H9MA 1B2YA 1WBHA 1QNVA 1V8EA 4LUSA 2C19A 2D3NA 1WPCA 3LXCA 3JR2A 2Q3OA 1R0MA 3N4EA 5HJLA 1XLLA 2QF8A 1DL3A 5AOUA 4AIBA 1IWPA 4CVUA 2FB3A 5DCDA 1WKYA 3ARWA 5TAOA 2XN0A 5FSDC 3TFXA 3NXLA 5CZJA 3VM7A 3VC6A 1MZHA 1W56A 4JAWA 3PZGA 3BW3A 3M0YA 2BX7A 4N0RA 5D02A 4HNVA 3QHMA 3TV8A 3OVPA 2YW3A 1UP0A 3VZZA 4QJ4B 3R79A 1VEMA 1V6VA 4I7UA 1TB3A 4FLOA 1ITUA 5HK4A 4O14A 2ZWZA 1KD0A 1W9BM 1QAPA 5JUVA 3JZEA 2A3EA 2PSNA 4PMVA 3W7CA 3TYZA 1QBAA 4QQ3A 4ECLA 5G2HA 1HKWA 4F8XA 4LWWA 1W31A 1KQZA 1M01A 2FDSA 2GSHA 2OGJA 4P8UA 4J3SA 1VAHA 5HULA 1TMQA 2PP0A 3NM3A 3TJLA 2XPKA 1U33A 2E6AA 1JDFA 3GBEA 3ZJ6A 5D4YA 2O9PA 3I3DA 4TU1A 5F2GA 2FTPA 4W93A 2PBOA 5EB8A 4Q8NA 3N4AA 1XWYA 3NQMA 1C91A 4HHLA 4IICA 4PRTA 5LSMA 3A64A 1CEOA 4HKPA 1V7YA 3GR8A 2G4FA 3N12A 2Z1KA 3P7YA 4H9YA 2RGLA 4D71A 1GG1A 3IV3A 3MY9A 3IVSA 1GTHA 5JQ9A 3L4TA 3P14A 2OR2A 4F9DA 5K3VA 5A6SA 1M3UA 4FLQA 1K8ZA 2Y24A 2Z2UA 4DBDA 4ZE4A 4CNSA 1PIFA 1LG2A 1XCWA 1ICPA 1U5VA 2CXEA 4YWIA 2QULA 4ZB5A 4NYYA 5HXMA 4IIDA 1YX1A 3I6TA 3TYCA 2YR1A 1KR0A 4NAFA 1MXDA 4YTRA 4F4RA 5CPMA 4FLSA 1IGWA 4GCXA 4L7ZA 4XD5A 3GE7A 4C1NB 3NWRA 4H8UA 3N6JA 5CJNA 5LHFA 2BLEA 3APGA 2Z1WA 3AMLA 2VURA 4DB7A 1ITXA 4N42A 4W88A 4LEQA 1MNSA 3P80A 3UXKA 2JEQA 1EJTC 2BVDA 1PS9A 1FKWA 4O0ZA 2HE5A 5EY5A 1X97A 2PTDA 4GFIA 5ABFA 1WDPA 1TTJA 2NV2A 2VENA 4XKMA 2XFWA 5HJXA 1Z44A 1ODZA 2EXOA 4UB9A 5CC6A 4WSHA 3ONBA 4FX6M 4D6GA 1MVYA 2PCQA 1Q6FA 3VMOA 4IMCA 3WLMA 3Q45A 2GK1A 2ALDA 3M46A 4MUZA 3RU8X 4QGCA 3SCVA 4Z2JA 5AC5A 1JD7A 3RDKA 5JBEA 1GZ1A 1EB3A 4O17A 1VCVA 2ZIDA 3VTRA 4POCA 3RR4A 5A3HA 1FY6A 3CWNA 5HJYA 5FJTA 2FGBA 4E6MA 4D6DA 1T41A 1F6YA 1DWAM 2PWVA 3TC7A 3T4CA 3TYDA 1JZ5A 4GJ1A 1UOZA 4DY1A 4QDMA 4O53A 2Y7GA 1GVQA 4JQ4A 4ATWA 1NELA 1RY0A 3UJ2A 3STPA 3PJUA 3T0TA 1MUMA 5BRBA 1VBUA 3T40A 2FHFA 1UP3A 2R24A 1P4CA 3TW7A 4E0CA 4UR8A 1V5XA 4DIAA 1GOIA 4UTJA 4F2TA 2ZRZA 3O0FA 3P0XA 1XYCA 3EPOA 1NF7A 4BF5A 5E0KA 3BAIA 3AHXA 3RM4A 1SW0A 4IJBA 5BXSA 5XIMA 4RL3A 4AD0A 1T6MA 3DC8A 4M6QA 3H2AA 4MZ1A 3SCSA 5DBUA 3AZRA 2C14A 1QI2A 4CCEA 3W1PA 3HTWA 4P8VA 3IIOA 4P7QA 1TVPA 3FEQA 1R38A 1ZJIA 3CPRA 3HV8A 3NJ3A 5GPRA 5EMLA 4YTSA 4XKYB 2YX0A 3RRXA 1JF6A 1FCUA 1S2CA 1F7BA 2I5GA 2GGIA 3LS9A 3OLGA 1ZAHA 1JXJA 1POJA 3WELA 1FWEC 2WBKA 1MUWA 3P62A 2SFPA 4KF1A 3GIYA 1NJJA 5H2ZA 2V5DA 4E3VA 5AC4A 3VD5A 1CECA 3LERA 1JPDX 4H9VA 3KOZA 3FW6A 3PZIA 4MMWA 4Q4QA 4C6LA 3JS3A 1P6BA 1PUDA 3ITXA 1HKKA 3C86A 3G1YA 1FWBC 4DPPA 1DJGA 3IGHX 4XQ6A 4OUIA 2ONEA 2GJRA 1FH8A 1TE1A 2FMNA 3FSTA 2Q8XA 4YCPA 3QQ0A 1XQLA 4GQRA 3AWOA 1PZ3A 4TV5A 2F2KA 3W29A 2NVDA 2EJAA 4DN1A 3OHMB 3BCJA 3V35A 2PWGA 4LANA 3GU1A 2DW7A 2INFA 2NQ9A 4GNVA 1IR1A 1S1RA 4DQWA 1SZGA 3TN4A 2YGYA 2CLFA 3G3DA 3PFMA 4LVBA 4P2VA 1MWOA 3CIVA 2XFYA 4YHEA 1UZ4A 3RX4A 4TQTA 1E6QM 5E6YA 4Q4KA 2NVCA 1E43A 4XTDA 5FJJA 3VOFA 3SQLA 3TJ4A 3ZT6A 3GG0A 4Y9OA 1UUOA 4IPPA 5DMLA 2E40A 1Q7ZA 3QFEA 4XUYA 3S42A 4F0HA 3LD5A 4DEFA 4NRRA 5A6LA 3EOSA 3W70A 4JHOA 1M1BA 4G7FA 2BOEX 5IFTA 3POHA 4IGSA 1VIWA 1SR0A 3M47A 2QV5A 2HSAA 1O60A 2NZLA 3RF9A 4OIFA 1IXNA 4Y8EA 3PS7A 4A8LA 4QS6A 4Q22A 4F9JA 3P0WA 3CT7A 1ADDA 1H1NA 1TPDA 3WKZA 1EGMA 2PB1A 3GXMA 3SEPA 4GGHA 2FZMA 1OWQA 3GVWA 5LIUX 2RJGA 1SFSA 3TZNA 3N19B 4IPJA 4HVXA 3VD7A 4AD2A 1OFRA 4V1XA 3URBA 4MGGA 4GO8A 2XHYA 4HHPA 5G1YA 4ICCX 1QWKA 2C1GA 2HXTA 1EUAA 3WQ6A 3N2OA 1WZMA 3G1VA 3DHPA 1IV8A 1QPNA 1J5TA 1ZTVA 4UQBA 2W62A 1GUVA 1WDSA 3S2NA 3UZXA 2OYMA 2Y1HA 3M0JA 2BZNA 2ZXAA 3AWNA 2QUTA 1RPKA 4JNYA 3TSMA 4BS0A 3HV9A 1JFHA 4JIPA 3EWZA 4HHHA 1A50A 2V5BA 4N6EA 4D8AA 4DJFA 2Y5SA 2RFGA 4IZGA 4KESA 1PX8A 1KV5A 2RJHA 3ITTA 1PE1A 4QG6A 2YL6A 4UMBA 1A3WA 3W87A 1KLZA 1O1ZA 4GH1A 5LIXX 1E3ZA 1F3XA 3HBLA 5I07A 3B8DA 3S1GA 4JTAA 2ISDA 4PTMA 3PTQA 4M81A 3A3HA 5G2IA 3ARRA 1FWIC 3T78A 2QUVA 4JEJA 3F4DA 1XIMA 2HBXA 4EWND 1JL8A 4DO5A 1NDVA 4Y7EA 3K5XA 1Y5WA 5A6AA 1E0WA 1Q6GA 2VQUA 2D24A 1F9CA 2VFFA 1G4PA 1DWIM 2RDXA 5ECVA 1QCWA 4R7WA 1AQFA 4H7VA 3KZSA 3EKGA 4H2HA 1LBLA 1EA0A 4HCDA 3IK4A 4JKKA 4C90A 1FRBA 1TVNA 3NL5A 3AS2A 3W85A 1UH4A 5DFAA 2WSRA 3WQVA 3W53A 1Z48A 1HP5A 1LOSA 3H26A 3MP5A 3Q37A 4AISA 3PZOA 1DE5A 4ZEPA 3AAMA 3OQ8A 2PTZA 3UPWA 1OGSA 1PPIA 3BCFA 3A4XA 2G97A 4NJJA 4QTGA 3VE9A 1W0MA 3VVGA 2FFCA 2HE8A 2A3HA 3UG3A 1E9YB 1XLFA 1KRAC 3MQTA 4AVNA 3A23A 1RQHA 3BWWA 5FI8A 1N7KA 3GXPA 3VIKA 1H1ZA 1WXZA 3GKFA 1RLCL 1JVNA 3QEZA 7CGTA 2PDFA 4MADA 3KS5A 4PSRA 4HTYA 4XBKA 3GXTA 1TWWA 3QW4B 4IPIA 4CEUC 2YL5A 4GIRA 1TR9A 4DJEA 2O4MA 4XAGA 3CEPA 3CV7A 1KBJA 3W88A 3DH7A 4B4HA 2AKMA 4PMUA 2F6XA 4WF7A 1JNDA 4MJ4A 2V38A 1I0BA 1LL4A 1W8GA 5FESA 1FA2A 1CLVA 4HPJA 2GDQA 4WLCA 2ZZ4A 2I5QA 5DRIA 4ZOAA 1UMYA 4GJIA 2CC0A 2E4TA 3K8LA 1SMAA 4D6HA 3F2DA 4M7SA 3BK0A 3QTPA 4PMXA 4AYSA 3PWGA 4C6KA 2JIEA 3E5PA 4GVFA 5LKYA 3WBAA 4GUJA 1H1YA 4MDPA 1TX0A 2PDIA 4HTBA 3O6CA 1K9FA 1JZ3A 4HCHA 3ANYA 1PEZA 3EX4A 1M7XA 2J7CA 2J7GA 2UY4A 3W1MA 1C93A 4WY0A 4TX6A 3GZAA 5I06A 3Q2DA 4C1KA 3W26A 4W5UA 1S5VA 2IPFA 3WLRA 2DJXA 4LQ1A 1K02A 3PBMA 2ISFA 3ABQA 3B9DA 3TWBA 2XVLA 5I77A 3VNLA 3EWWA 1SO5A 3RR1A 2PI6A 5KTLA 3NQ8A 3W25A 3DFOA 1LP6A 2OO0A 1OB0A 3QKEA 4RXFA 1TE6A 1LBFA 3CQIA 4Z2LA 2BNJA 4NJHA 3WLPA 1X7IA 4KWVA 1VENA 1OG6A 1K3UA 5ENLA 2CHOA 3N04A 2PGEA 2OEKA 1NP2A 3GTHA 4QE1A 1L6GA 3N2BA 1ONWA 3HGRA 4AFYA 2CZEA 4PCPA 4FNTA 1PAMA 3PWAA 2YFOA 5DCEA 2CLEA 5E0CA 3WD1A 2CLLA 1W1IE 4PMRA 1EJXC 4LRTA 2CEQA 3PY2A 3O07A 3EX1A 3CWOX 4PTDA 3W81A 3I3BA 1XYLA 7A3HA 5FJUA 3CASA 3BGAA 3CIXA 2ICSA 2Z4GA 1F5ZA 2OPJA 4GACA 4IFKA 1R47A 5BXTA 1UKQA 2VVSA 1FCVA 2YKKA 1OGGA 3GUGA 4JXCA 4A3UA 4DBWA 1OX4B 5JBDA 3O2LA 3W2JA 2Z00A 3B9AA 3CHVA 4RV3A 1OVDA 3NA8A 2RDWA 3W4RA 4PR4A 3VNJA 3E12A 8XIAA 3HPAA 2VEFA 4FX8A 4BR1A 3MKVA 1YDVA 1RALA 4HD5A 1XIHA 3LPGA 1MDRA 1XLKA 4J2PA 2WM1A 3KBVA 1IWAA 2NT1A 4JTEA 1P6CA 1UYQA 3S46A 2DZPA 1GQLA 3WDHA 5D9PA 4S3BA 2IS7A 2CYGA 3VNIA 2BODX 4IHCA 3DFTA 3VYLA 4AEEA 1W3HA 3G2GA 2WMIB 3HMJG 1K1DA 1TA3A 3A4JA 1KXQA 4YN5A 4C5ZA 3W74A 4KBXA 3ITGA 1QNRA 3MUY1 1E51A 3A5FA 4K36A 4MYXA 1XINA 1JDAA 2VRKA 2VX5A 4AY8A 4RKAA 4F48A 3AJ7A 2YXXA 4MKSA 4R88A 5JXQA 3W24A 4A22A 4AW7A 3BQ5A 2X7VA 1D8CA 2DFAA 3EA2A 2WK2A 1OABA 4P8XA 4QROA 4UBPC 4HSNA 3RFAA 3MBFA 1E5JA 1FWFC 1SSGA 5AZ0A 3ITVA 2PGWA 2Y8UA 2Y85A 4ERAA 3DKJA 4JY9A 5CPQA 2ZOXA 3GDTA 3LRMA 4JYDA 3AU6A 4HNOA 4LY8A 2J74A 1LYXA 1VRDA 2PPGA 3ANUA 1BSLA 2ZZ6A 3NQGA 1J79A 4KWOA 4HMNA 3G8EA 3LSBA 4CNOA 5TF0A 1HP4A 3WK1A 2YIHA 5HATA 3VIJA 1QPQA 1XYZA 2IKGA 4HSOA 2VMFA 1V0KA 3QC3A 2XDFA 3L4ZA 1XRFA 4JKLA 2NT0A 3TLQA 4LTSA 2WZMA 1RVKA 4GE8A 2ZUVA 3SRHA 2ZXQA 4HMEA 1QO2A 2XYLA 2H6RA 2VCBA 2Y70A 2Y2WA 4ICMA 1G67A 4BI7A 2VHLA 1TR1A 3UESA 1XH1A 3DECA 4WXZA 4O16A 3W02A 1XM3A 3S5OA 3EMQA 1RK6A 4QDPA 3W7PA 1VFTA 4HOZA 2H9AB 3HMCA 4QLJA 4WD0A 3C2RA 4IPNB 2RHGA 3EOEA 1AJ2A 4MWAB 2CHRA 2ZX8A 3MWAA 3PBYA 1GKQA 4AZBA 4LCSA 2INZA 1YPXA 2PLCA 3LHVA 3BJFA 3AS1A 3BMWA 1ME9A 4GVGA 2WBGA 1OFEA 4JHZA 3VKAA 1DEDA 4AD4A 4PBFA 1KCXA 4L4PA 2VEKA 4PMQA 4HK7A 5CPTA 3STGA 2FH6A 3WF4A 2KAUC 2DZUA 1WQ5A 1A0DA 1O5XA 3HFTA 4A8NA 1P1MA 4H2CA 5I23A 3PUGA 1NU5A 1W17A 1XBZA 4HBKA 3U9IA 1UJPA 1FWJC 1X6NA 3WMBA 4QE5A 2HWGA 5GVJA 1HQTA 3NO5A 3WJXA 4JTCA 3JW7A 4V28A 1IEQA 4I6VA 3S5ZA 3TN6A 6ALDA 4AYGA 3ZLFA 2EAWA 3NG3A 3KX6A 6REQA 1DWJM 4N9DA 4EF8A 1DJNA 3O05A 1DJXA 2R82A 5LA0A 4EAMA 1TV8A 2O0TA 3WMSA 2WHMA 4ZTXA 2FVLA 4LSBA 3VNKA 4QHRA 3WH9A 4O19A 1UB3A 1XPGA 3LV6A 4WUIA 1HL2A 3IACA 3IGXA 2JE8A 4UWMA 2VQTA 4XAYA 3UY8A 2HROA 3AMGA 1KBKA 4PB4A 1AD4A 3WF0A 1XYMA 1KC7A 3ZXWA 3BLEA 2G0WA 2V2CA 1VBJA 1KRMA 3GX9A 2X2YA 3LPFA 3CB8A 7TAAA 2YL8A 2JKEA 1V4YA 3D47A 3QPZA 4Y2WA 1DQXA 1UKTA 3LLDA 3AXXA 3RJXA 4C6EA 1M04A 3ICJA 1H49A 1TO3A 1QI3A 1AQMA 3TQ0A 1J96A 4MKVA 3ARUA 4S3AA 4UFIA 4CU7A 1Q6EA 4LUYA 4JX5A 3T08A 4JTLA 5IRPA 1H7WA 3TKFA 5E5CA 1E6ZA 5FF0A 3VAVA 3PZQA 3CO8A 1HF6A