3TA6A

Structure of mycobacterium tuberculosis triosephosphate isomerase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
255
structure length
255
Chain Sequence
RKPLIAGNWKMNLNHYEAIALVQKIAFSLPDKYYDRVDVAVIPPFTDLRSVQTLVDGDKLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAATALKHGLTPIVCIGEHLDVREAGNHVAHNIEQLRGSLAGLLAEQIGSVVIAYEPVWAIGTGRVASAADAQEVCAAIRKELASLASPRIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGGASLDGEHFATLAAIAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Structural and functional characterization of Mycobacterium tuberculosis triosephosphate isomerase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
total genus 94
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ta6A00
2WSRA 2HSAA 3IVSA 1OFDA 1OFRA 1JVNA 4LV9A 3MI6A 4EIVA 1VLIA 4EOUA 5F4XA 5KINA 2GJLA 1OFAA 1JR1A 3FKRA 1I45A 1VJIA 3DENA 2YFOA 4JGDA 4UFJA 4Q4KA 3W2MA 4O12A 3MYPA 3QW3A 4N02A 4ZQMA 1H5YA 4FX6M 1WAUA 1G4TA 1OYCA 1H50A 1G7VA 2V8ZA 1ZHAA 2QCMA 5D32A 3USBA 3G1YA 4K8EA 5AYZA 2J9ZA 1PVNA 3NA8A 4KWWA 4H4IA 2Y85A 2P10A 1FWRA 3TUUA 4S2CA 1XKYA 1ZAHA 2H8XA 2NV2A 1SUXA 2ZZ4A 3W74A 3PAJA 3W7PA 2FIQA 2HS6A 3G24A 5G2HA 5KTLA 5HWMA 3AJXA 1FXPA 5D04C 4BF9A 2ZRYA 4GXMA 2FPVA 5KZDA 3BLIA 1QPNA 3L5LA 2GVJA 1SW3A 3GNDA 4CNPA 2DZPA 1W0MA 4IOTA 4JICA 2B7OA 3TXZA 4C1LA 3OVQA 5FF3A 1GTHA 5BOOA 2Q3RA 2V82A 4K7VA 3IGUA 1J4EA 5D33A 3HOJA 4IPJA 1LCOA 3NPXA 4NXSA 4IMGA 1DJQA 2NUXA 1QOPA 2E68A 3U8GA 3EWYA 2C14A 3SGUA 4JS3A 3GKFA 1RQHA 3MBDA 3S9YA 1EEPA 4LV4A 3QF0A 4LRSA 5H2ZA 1VR6A 4NX0A 4QNEA 4RZ6A 4AAJA 1F6PA 1O5KA 1JCXA 4OE7A 4AWTA 3LHWA 1B3OA 4L4MA 2Y88A 1LTDA 3FYOA 2ZYFA 3SSJA 1RD5A 1KM6A 1XXXA 1OABA 3WJWA 1SO5A 1OFOA 5K7JA 3N9SA 5L6UA 1L2UA 1MEHA 3F4NA 4TR9A 5LNUA 3S5ZA 4UTMA 4N9BA 4DELA 1YXCA 3ZS4A 3W7GA 2ZA1A 2FTPA 2TSYA 1OX4A 3PB2A 3W2KA 1TPDA 4FX7A 3G3DA 3S1UA 3OA3A 5GVJA 4ZQCA 4RX0A 4KFNA 3PSVA 4IMCA 3PUDA 3NL3A 4JTJA 1ONRA 2Y89A 2JGYA 2JKEA 1FCVA 3PS7A 4LW7A 1W31A 3QQ1A 1TPWA 2IQTA 2Z6JA 5HINA 2KZHA 2CLHA 1B57A 1I2QA 1HTIA 5AFDA 3MJYA 2DZSA 1B4EA 1I2RA 1UUMA 3FYPA 4AEOA 3IGSA 1VYPX 1HG3A 3UXAA 4JIQA 4UMCA 5FI8A 3QW4B 3NXFA 3HPZA 3NNTA 2YW3A 3TFXA 3MWAA 3LERA 1PCKA 1KFCA 3SFKA 3PUEA 3CTLA 3RK8A 5CG7A 5J5DA 3PR2A 3CC1A 3IV3A 2ISVA 2CLEA 1GYLA 2NUYA 3E0IA 2CZ5A 2X30A 4AHOA 1A53A 2E09A 1TREA 4M19A 4XTIA 4JY9A 3S5OA 3R89A 1YDOA 3NQCA 4YWIA 2A4AA 4O53A 1OK6A 3DI0A 4XTDA 5CPOA 3G0SA 4WOQA 5D38A 4QNWA 3TQKA 2PRHA 4RXGA 1F5ZA 3R5EA 3SJ3A 1SU5A 4JDYA 4MJZA 3IVTA 3MUXA 3HPSA 3TROA 3TMQA 3C2VA 3W1QA 3OHIA 3HG5A 3QYQA 3EWBX 3MI2A 1XBYA 1NEYA 4GUGA 1LORA 4U28A 3OIXA 3P84A 1QPRA 1OFBA 1DJNA 3CB8A 3I7RA 4O54A 4UNLA 3WJZA 3TIMA 1K7XA 5IM51 7TIMA 3T55A 4TX9A 3CLMA 2OT0A 1OX4B 1NFBA 5TIMA 3G1XA 4S2BA 1WDWA 1G69A 4JTKA 3JRKA 1CW2A 2WNZA 2ZCGA 5D37A 4LY8A 2C13A 3QC3A 3L2IA 4CCCA 3MYOA 2A0NA 2ZDRA 1TMHA 2YPIA 3IIPA 2QAFA 3CU2A 3NYZA 3P8IA 1EB3A 3CEPA 5LZLA 1FCUA 2H3BA 1KM3A 4AXKA 2VEMA 4M6QA 3DXIA 4UTTC 1EX5A 4W9TA 5I3FA 3DH7A 4I9AA 5D03A 3UWWA 2WPBA 3OVPA 3I7QA 2ZRWA 1LM1A 2VEPA 1YTKA 2CU0A 3UNDA 3L5MA 1JJKA 2VFIA 5K9XA 1R47A 3PY2A 3W7HA 1WBHA 3N2MA 1OF8A 1C9DA 3GLCA 5HWJA 1PL9A 3TXVA 3M5XA 4DPPA 3KXQA 3QQ0A 4MFEA 1TV5A 4RKAA 2C1HA 4K7YA 3OG3A 1LRTA 5AC8A 3M1ZA 3FS2A 1U5JA 1JULA 1JCYA 4JTEA 3TCEA 1OX5A 2B4GA 4QJ1A 4UTTA 1TPEA 1KM1A 1Z48A 1VZWA 2TYSA 2A21A 4RXFA 1K8ZA 5KZEA 4NQ1A 3C2FA 2V30A 1SO3A 4MPQA 2Z2UA 1FXQA 4Y6GA 1ZY9A 3BARA 4AB4A 1ICQA 1YXYA 3LCXA 1EP2A 3NQ7A 1EWEA 1GG0A 1X1OA 3MP5A 3LGEA 4TO8A 3DAQA 1XCFA 3EXTA 4GBUA 5MHBA 5DELA 4DPQA 3CM4A 4FB7A 3W1LA 2QCCA 4O14A 4O18A 3W84A 1ADOA 1XC4A 2DU2A 1SO4A 4BFAA 3W7IA 4WJEA 5I3KA 3NZRA 3T78A 4K36A 3BG5A 1L6WA 3TX9A 4BK9A 4RJEA 1P1XA 3TC6A 4AVFA 4UFMA 4LC8A 3MBFA 1GPWA 3M47A 5D09A 1SZGA 4JXCA 3M16A 1FWTA 2W6RA 4NZFA 4UUIA 1W56A 1G4PA 3NQVA 2ZZ5A 4MYXA 3UPWA 3FKKA 4JX4A 2FLIA 3ZFHA 2ZZ6A 1JCMP 1OFPA 5FF4A 2YGYA 3ATYA 2RDWA 1N55A 1MZHA 3H54A 2EF9A 3O16A 1BWLA 3LRMA 3W7EA 3LRKA 4K37A 3ZWTA 4A29A 3ZR4A 2QR6A 4CLMA 4NJHA 4L4LA 1TV7A 4NU7A 1THFD 5HR6A 3W7MA 3GX9A 1TCDA 2ZQ0A 3PBUA 2I1OA 3A21A 4JR5A 4POCA 1WOAA 3DFTA 4MFDA 5CKSA 2ABBA 6TIMA 2V5LA 3W1PA 3EX6A 1LRQA 1KLYA 1VC4A 4TMCA 2ZZ7A 3BLEA 2A5HA 2NXIA 4CQ8A 1TTIA 5AC7A 4BWLC 3QMTA 4FHAA 4HPXA 3QPYA 2QJHA 3I6RA 4LVGA 3GDRA 1J5TA 4IMEA 2ATSA 2H8ZA 4ZQPA 3NEVA 3PG9A 2DZWA 5AHMA 3M5YA 2A7PA 1N7KA 3QPZA 3L68A 2XN0A 1QO2A 1FBAA 1MO0A 3TQ0A 3IRDA 4JTFA 1LLZA 3EWWA 4GC4A 4DQWA 4LS0A 2A6NA 4G1KA 3GYEA 2P0OA 1K8YA 4BWLA 1IGSA 1IXQA 1QMLA 1A50A 1SSDA 4NNAA 4UMAA 4IJBA 2BXVA 4Q33A 3O63A 3G3MA 2QEZA 2B7PA 2VELA 3QMRA 4NNBA 5D2TA 4DF0A 3A24A 3PVFA 2Q3OA 3GZ3A 5HR7A 1LOSA 3O07A 2YFNA 5HUPA 3LXAA 3NQAA 5AB3A 2OT1A 2PCQA 4ONVA 2FPYA 5CZJA 2Q8LA 4E2DA 1TQXA 5DXYA 1Q6LA 4JYEA 1R2TA 3HPXA 3P81A 1Q6OA 3HG2A 3N9RA 3PULA 3UY7A 4ZL1A 1JCLA 1RQEA 4DF2A 3UWUA 3LRLA 1KTNA 2E6YA 3A22A 4LU0A 2E5DA 4O16A 5C55A 1DOSA 3UZ5A 3HG3A 5F2LA 3N34A 1WV2A 3STGA 2ZA3A 4QM1A 2E6FA 1NSJA 1VYRA 1YDVA 4UFHA 1AMKA 1I8JA 3RMJA 3DFNA 4JTIA 4O10A 3W1NA 1IXNA 1W5QA 5E93A 3S8HA 3UD6A 1DV7A 5AHIA 1KFLA 3UWVA 5HULA 4QIUA 3LXBA 1IIHA 1YTEA 4NNCA 4BI5A 3EB2A 4M6VA 3NL2A 3FLUA 4TMBA 3UY8A 3P80A 1YADA 4IQLA 4O4VA 4M6PA 3EWUA 3EXSA 1TRIA 3G1HA 3HG4A 4N9EA 2TRSA 3TK7A 3RNDA 2A6LA 3DI1A 4E0CA 2C18A 5D05A 5E1QA 1TRDA 3U2OA 3G8RA 4N2YA 4XBKA 4WY0B 1KFEA 2FFCA 4JN6A 3C4UA 4OQVA 1SZNA 1F6KA 4IMDA 1C8VA 2A1YA 1R2SA 3DBPA 4LVDA 2QCFA 4Z0SA 3MO7A 5K3VA 1VCVA 4UXDA 1W54A 5CPLA 3LHVA 4CCEA 2NXHA 4GUFA 4TIMA 1QO5A 2VOMA 4MJMA 3O05A 3HMJG 2GUUA 4GUHA 4WQ6A 3R8RA 1VS1A 5CPNA 1GQNA 4GRSA 5KSWA 2ZZ2A 1W3NA 1Q3NA 1XDMA 4LS2A 3IIXA 3BV4A 3LI1A 3KVJA 4Y8FA 1T96A 3MP3A 5G2WA 1ZAIA 2ZRUA 2J9YA 3GDMA 5EKYA 4WX2A 1YYAA 4GNJA 3B4UA 5LSMA 2A2IA 2VEKA 3MHFA 4O1AA 3ABRA 8TIMA 1QR7A 4UR8A 4JYDA 3EX1A 3P7YA 2G96A 2I14A 4Y9AA 3UYCA 1TTQA 3N19B 4LVAA 4NJGA 1K02A 1NF7A 3TJLA 4UTUA 4MIMA 1UB3A 1DQXA 2X1RA 4O4WA 2OMAA 3H55A 4DXVA 2XFWA 1H7WA 1WQ5A 4AWUA 1LBFA 3P5YA 2WJZA 5BMXA 2V0TA 2UV8G 1GJPA 3G1VA 1PCWA 3UWYA 3NR0A 1QDSA 3GXTA 1ME7A 1HL2A 2GOUA 3EX2A 5AHNA 5D2VA 1FCQA 1E51A 3W71A 1HUVA 3RLUA 2BZNA 4JTLA 1SR9A 3S1WA 2HTMA 4HNVA 4HPJA 5A5WA 3L67A 5CZSA 4M5PA 5EMUA 1QPOA 3M44A 1TJPA 1GVQA 3DFQA 3L9CA 3I65A 3M9YA 5FF7A 4PODA 1ALDA 3DKJA 5FESA 2RDTA 1ZJIA 4UTWC 1TPC1 1VHCA 3M43A 4O1CA 4UTJA 3O06A 3NPVA 3G22A 5CZTA 4AF0B 2Z6IA 2GQ9A 4ADSA 1TV8A 3HQ1A 2QF7A 1H7OA 3DHDA 1FCBA 4GFSA 1TTJA 2J88A 3NDOA 1TQJA 4DO5A 3HJZA 2TMDA 5K4ZA 1DBTA 2BWGA 5IBXC 1R46A 4LOCA 2XN1A 2WNNA 3TMLA 1AK5A 3NGJA 1M7OA 3C2RA 5G1YA 1DL3A 1XL9A 3PBVA 4O28A 3QM3A 3ABSA 1SW0A 4NUWA 3H53A 1H61A 4BI7A 2GQ8A 2FPTA 3LTYA 3PG8A 1BTMA 3W2NA 1JRBA 1O4UA 4UTWA 1O94A 3LB0A 3UPBA 3G1AA 3T7VA 1OJXA 3B03A 2DP3A 2A7NA 5F2GA 2OJPA 2YX0A 1H7RA 1T99A 2H6RA 3KVMA 3Q94A 4MKNA 4GJ1A 3LV6A 3M0ZA 1J2WA 1VQTA 2VENA 4Q32A 3STFA 2PRMA 4O15A 1KM5A 1KBJA 1H7PA 4FXRA 5IBXA 5FEWA 3VCRA 3KRZA 1ME9A 2E6DA 4A2SA 4JYFA 2DZXA 2WKJA 2CZFA 2E5BA 3V1PA 2QCHA 4OBTA 1DORA 4IMFA 1S5WA 1DKWA 1TPVA 2WSYA 3YPIA 1TSIA 1KV8A 1OG0A 2QJIA 2ZZ1A 3GDTA 3N14A 1EA0A 3G0XA 3GIYA 5LKYA 3FIGA 4NJJA 4PCFA 4JEQA 4RV8A 4M7TA 1KTCA 1EP3A 4RR4A 4E2BA 3W2UA 4D2JA 2RFGA 1H60A 3L66A 3P60A 3SIZA 3KHJA 4O8RA 2ZRZA 4OU1A 1F76A 4LVFA 4J9JA 1L6SA 1VLWA 3SECA 3W83A 4NVTA 3W1RA 1T0OA 3W7CA 4MOZA 1TPFA 2H3DA 4OT7A 2RDUA 1PIIA 1YDNA 1O60A 1TPB1 4GUIA 4PEKA 4A3UA 3A9IA 3R12A 5CPMA 4PTNA 3W23A 2YXGA 3CWOX 1YPIA 3PUOA 4WUIA 3DZ1A 1S5TA 4A21A 3BLFA 3W7LA 1TJRA 3ANYA 1KA9F 3LI0A 1TPUA 3P82A 2E5CA 2Y7FA 3JS3A 3K30A 3R13A 2QUTA 1A5CA 4I7WA 2RHGA 3Q2DA 4OV9A 4UMBA 1OYBA 2H90A 2ABAA 3C2EA 3HGJA 3BW2A 4FEZA 4ZZ9A 1O5XA 1VHNA 3N3MA 1KM2A 4FF7A 2W0UA 1W1ZA 2Z0IA 4JIPA 1SFLA 3OVRA 4UTLA 3VE7A 3G1FA 3EXRA 1RZMA 2BTMA 4JDBA 2BLEA 1FWNA 2Y70A 2FB3A 2NX9A 1LDCA 4FNTA 3TC7A 3OBKA 1XBXA 3CHVA 2V81A 1YTDA 2NX3A 1SFJA 4R34A 1VCGA 2ZZ3A 3B06A 1T8XA 5F4SA 2C15A 2GJNA 1GZGA 3Q37A 4ORMA 3BK0A 3NQFA 3E9AA 4JX5A 2B7QA 5EA9A 4K38A 3S1XA 3NPWA 3NQ6A 3W85A 5D30A 2QCGA 4LVBA 1GVSA 5TBOA 2CFFA 1JCJA 3GKAA 1OHLA 5FEPA 2BSLA 5K9CA 4KFOA 2QCNA 4UFIA 3G18A 4QAIA 3BG9A 3S42A 3W1TA 1DQWA 3S5YA 5L9FA 3KAOA 4JTSA 2JKAA 2V5BA 3PBWA 3B8DA 3TE9A 3TJXA 1SQ7A 1V7YA 5C2XA 2QJGA 3NOEA 2E77A 5BNKA 4RCXA 3E96A 4HT3A 3VI2A 4LWWA 1WA3A 2WOQA 3WFAA 2QCDB 3B0PA 4UFLA 2VFDA 1A5BA 1UASA 2GPTA 2CLLA 4ZVJA 3LCLA 4LRTA 1TYGA 3GR7A 1HFBA 1VCFA 5KZMA 3GK0A 3NQMA 3NL6A 4NT0A 4K39A 1AL7A 1YXDA 2JKPA 1Q6RA 1ZAJA 2QDGA 1H1ZA 2G97A 3IIOA 2AGKA 3BVJA 1P0KA 4K8HA 3W6YA 2EGZA 5AN7A 5TQLA 3BGJA 3LBCA 4IGHA 4UCGA 3L0KA 5LHEA 2WSQA 3NPUA 4R53A 1XBZA 3A23A 4BR1A 3ATZA 5AHLA 2C0AA 4A2RA 1G7UA 1VGAA 5AHEA 5H91A 1ICPA 2VKZG 2Y7DA 2D73A 3M41A 2PC4A 4AHPA 1SZEA 3P5ZA 1KV5A 4RK8A 2QDHA 1CX9A 2FB2A 3CIXA 3M5ZA 2NXGA 4FIQA 3HB9A 1LP6A 4YL2A 3QZEA 4OWGA 4O11A 3ZWSA 2J27A 5CSSA 5K9DA 3W1UA 4OGZA 5F1UA 3WJXA 3HBLA 3MHUA 1PS9A 1VYSX 3BO9A 2EKCA 1XDLA 4LC6A 4LTSA 1F74A 5D2WA 3UZJA 1D3HA 3W76A 4CQ9A 3B0VC 5EPDA 3IEBA 3BPWA 4C1KA 4K6AA 4UR7A 3P67A 3HIJA 1AW5A 2F84A 4WY0A 1XUUA 1W8SA 1B9BA 3MMTA 4FIRA 1KBIA 1LBMA 5F2MA 3TW6A 4O0KA 3BW4A 1N8FA 2ZA2A 2DJXA 3UXDA 2DJLA 2DZUA 3WK1A 2YDAA 2XN2A 4Y90A 2WV8A 3PSWA 1Y0EA 5DLCA 1TTPA 3W22A 4FO4A 3MHGA 3PC0A 4IX2A 1WXJA 1ICSA 2QUVA 2G95A 3DGRA 3O1NA 3F03K 4JNMA 3HGOA 1S3HA 5DBUA 1LYXA 4MVAA 1K8XA 3FJ6A 2OZ0A 2W79A 3W2LA 1UUOA 4FNQA 1I2PA 1BWKA 2NWSA 4RLIA 1X7FA 2CWNA 2RKXA 1M6JA 4OV4A 4NJIA 3LHYA 4XKYA 1X1ZA 3WK2A 3TSMA 3I68A 3TDFA 2DZVA 3N73A 3W7DA 4Z1BA 4GWEA 3UQNA 5C54A 4LUJA 1UCWA 1A5SA 1GVRA 2CLFA 2ZRXA 3HO8A 1GVFA 3M5VA 1BEUA 1DVJA 3T4CA 1M7PA 2A85A 1C29A 3NL5A 1K7FA 1GWJA 4QSHA 5C6MA 2X2GA 3STEA 3EX4A 1H1YA 4JTHA 1MSSA 3LXCA 1IF2A 4ICNA 2Y7EA 5EBUA 1LOLA 1FWSA 3E02A 4FNRA 3VE9A 2B0MA 1Q6QA 2LLEA 3WK0A 2YZRA 3KX6A 3NM3A 4PFMA 3LTPA 4X9SA 1JUBA 4DBDA 4X2RA 1IXOA 1OFQA 5HUOA 3W7KA 1HO4A 3LBMA 4Y96A 2NUWA 1HO1A 3INPA 1H63A 3A5FA 5K4XA 2J24A 3P74A 2O7SA 1RVGA 6ALDA 3W1AA 4IUOA 4HN4A 3P62A 5AHFA 5HWNA 1H7XA 1WOBA 3NVTA 5AYYA 2QCLA 5U7SA 3THQA 4NX5A 2X16A 5ABTA 4CNOA 4R7JA 4ZQNA 3S5NA 3W7QA 4PA8A 5D02A 3MP4A 2F7FA 2CZEA 4I7VA 3I7SA 1JQXA 1H62A 4MZYA 1I2OA 1KFKA 5EY5A 3TA6A 1KW1A 5I3IA 4XKYB 1K7EA 3M6YA 1ZFJA 4UFKA 4AF0A 3Q58A 4U4MA 4ADUA 1PV8A 3LCFA 1ZALA 5FF2A 1XI3A 3VNDA 4AMAA 1F2JA 4N6EA 1SO6A 3P61A 3QEZA 2R94A 5F1VA 2HS8A 3TSBA 1EIXA 1PHQA 1G4EA 3DFSA 3KRSA 3LV5A 3NQ2A 3LTSA 2E1DA 1AL8A 1LLWA 3NAVA 5FEZA 2Y62A 1KFBA 3G0UA 3L0GA 5I3HA 3LHZA 1VRDA 4AH7A 4YLWA 1ME8A 3ELFA 1XUZA 2X1UA 1WX0A 2HMCA 1KM4A 1XBVA 3L21A 3LCIA 4FNPA 2DORA 2PURA 4OHQA 3N2XA 1WBJA 4NZJA 5D2YA 5BW6A 3O15A 1OFEA 4O17A 2Z1BA 2VXNA 3FA5A 1QOQA 4HNUA 1QWGA 2JGQA 5LNVA 3GXNA 3LOTA 4O52A 5F4WA 2O7QA 5G5IA 4DO4A 3FEMA 3QJAA 2NWRA 3S6DA 3EWZA 1S5VA 2YYUA 3W2JA 3WJYA 4QQ3A 1EUAA 3IVUA 2V2HA 3GDKA 4KKXA 4ML9A 3FOKA 3THAA 1ML1A 1OF6A 4E38A 2RH9A 3PM6A 2R91A 3R2GA 1TO3A 1ZCOA 3O6CA 3PBYA 3TAKA 1YPFA 3W7NA 3LLDA 2WNQA 4ZMGA 4Z1CA 3DU0A 3E12A 2ISWA 2FDSA 3NQEA 3ABOA 5D2XA 1FY6A 1VH7A 4CCDA 3GVGA 1TPH1 2OX1A 1TB3A 3C56A 2ZFAA 5BRBA 4EF8A 2GQAA 1RR2A 2X1TA 1JUEA 2ZTKA 2Y61A 2X1SA 3LM7A 2GVLA 1W5OA 3B04A 4NXKA 2E6AA 1PHWA 2C16A 4WY0F 1DHPA 1LRNA 4ZQRA 1R30A 1VPXA 2FJKA 2ALDA 2CW6A 3C52A 3A5VA 2QUUA 4MY9A 1ZENA 4CNNA 2DZTA 4HSNA 3PF3A 4JY8A 3DHFA 3F1QA 3DKLA 3GR8A 4IPIA 2Q8ZA 4FXSA 1EWDA 1QFEA 4N4QA 3KRUA 1MEIA 5G2IA 4MLJA 2V2DA 3W72A 2NZLA 5DXXA 3W7RA 3GNNA 2P1FA 3UWZA 3NQDA 3V75A 1W5PA 4O0ZA 2CLOA 4XUGA 4O1BA 3RU6A 3SR7A 3SW6A 4ALDA 3QSRA 3TKFA 3TQVA 2CLKA 4FX8A 4TU1A 3UWQA 5LGZA 2QKFA 1OK4A 1FDZA 5F2IA 2R8WA 4R33A 4O13A 1P4CA 3W3OA 3QH2A 3F4WA 3NO5A 4MY8A 3TW7A 1NAL1 3CWNA 5LNWA 1GG1A 3BGGA 2NX1A 1L6YA 4RZ4A 3SGZA 3WJSA 5LGXA 2I9EA 2YYTA 1GTEA 1ZNNA 5I3JA 1H7NA 3W1MA 4XBSA 4PH6A 3QRHA 1EPXA 2VEIA 3TR2A 3C2OA 1EUNA 4XQ6A 3T40A 3FFSA 3QSTA 3PWAA 1OVDA 1G4SA 2QCDA 3HGRA 3C3NA 3LCHA 5DCEA 5KITA 4IX0A 5DY3A 2PRLA 4AWSA 1FX6A 3QFEA 2TPSA 3W70A 4JD4A 2ZRVA 5HJLA 1W37A 5DCBA 3W88A 2JBMA 4UTIA 2JK2A 4HIBA 2QCEA 2YSWA 3KFTA 4GUJA 4RZ5A 3W9ZA 5DCDA 1D9EA 2NV1A 2R14A 4XWUA 3HF3A 4I7UA 4WXZA 4IWWA 2G5WA 3C6CA 4ZQOA 1JCNA 3S1VA 1JRCA 1B4KA 2C19A 1YLVA 5T26A 1XM3A 2WO5A 1QNVA 4H6KA 3VFLA 5G4WA 3KOFA 2A7RA 3WK3A 1X6UA 4NJKA 1K03A 1AG1O 4KWVA 4WOZA 4UTKA 1UBSA 1M5WA 2VFHA 3EX3A 4UTHA 5I3GA 1AW2A 3LDVA 4HSOA 1LBLA 3ABQA 1G67A 2VC6A 3KVKA 4LS1A 3CPRA 3EKZA 3NZ1A 4JTUA 4N9DA 3B05A 1EP1A 4MZ8A 2Y6ZA 3MI3A 4EVZA 3G1SA 2CZDA 3CEUA 4Z1DA 3W7OA 3W07A 2PE4A 1KTBA 3EEGA 3TV8A 2ISSA 1OYAA 1OX6A 4MUZA 3BG3A 1GOXA 1BKSA 3KVLA 3O8AA 4BI6A 1AW1A 2VFEA 4HNNA 3G1DA 5CZ0A 2EAWA 3OEXA 4JTTA 3RLVA 2CLIA 4N4PA 1P0NA 1X8FA 1Z42A 3GB6A 5LNRA 2AAMA 1Z41A 3TU9A 2V9DA 2NLIA 2OCZA 5AYXA 4AHQA 3C0JA 1F73A 1IIGA 3S0CA 4YCOA 1I2NA 3LCGA 5J5RA 1L9WA 3T44A 1U83A 1SSGA 4WXYA 4A22A 4EWND 1QAPA 1R2RA 3TSDA 4MLRA 3D0CA 1W3IA 1QPQA 3W86A 1JQVA 1IXPA 2VFFA 4XZ9A 3CT7A 4WZHA 3HGSA 4O1DA 2ZTJA 4HHPA 3L65A 4P2VA 4YMZA 4JX6A 4LT9A 3RF9A 4O57A 2ZBTA 2B7NA 2EHHA 2Y7GA 4YCPA 4ORIA 5CGQA 1KLZA 4MY1A 1RQBA 2C6QA 1UJPA 4QITA 3L5AA 3NQ8A 2QAPA 3LX9A 3STCA 5FF0A 4H3DA 3TNOA 3L0NA 3U6WA 2J6XA 4S1FA 4IXXA 5E0KA 3QMSA 4PL1A 1MXSA 4QISA 4EF9A 1Z44A 3CQ0A 3GDLA 1FDYA 1SZFA 4MZ1A 5BMWA 5LNSA 1FUYA 2WQPA 1XFBA 4HKPA 1FWWA 2Y63A 3NQGA 1LZOA 4M7SA 5FEXA 2YW4A 4X22A 1W5NA 2FQIA 1FQ0A 4DEFA 3P8JA 1SW7A 5HQEA 3IIVA 3LLFA 5HMSA 1V5XA 4DF1A 4JTGA 4B5NA 3SZ8A 1F7BA 4KFPA 3G8EA 5LHFA 2VFGA 3AO0A 1SPQA 4PC8A 4UIOA 1QCWA 3C8FA 3O6YX 5A8GA 1W5MA 1NF0A 3E49A 3IIZA 3NM1A 1G6CA 4LNYA 5K2ZA 1GT8A 2EPHA 1RPXA 3C61A 1LROA 5DBTA 4X3ZA 3IGXA 1FDJA 4LUIA 1GYNA 3SI9A 4N9CA 1W3TA 1K3UA 3W73A 3W7JA 1CI1A 5DN1A 1I4NA 5SWUA 4FNSA 1F05A 4DBEA 5G4EA 3B0UX 3LCWA 2C3ZA 1GVOA 3GAYA 3VKJA 4O19A 3SY5A 5DY2A 3O6DA 4YXGA 1JUKA 3W87A 3W1XA 4ADTA 4MYAA 3EKLA 3W75A 3EWXA 4GE8A 1PE1A 3FJLA 5EL1A 3M7WA 5EYWA 4PL2A 4Z08A 2AQWA 4UC5A 2CLMA 5AC6A 4FNUA 4Z0JA 3DFPA 1MEWA 4P61A 1H51A 2YR1A 3TH6A 4HNTA 2YCEA 3LHTA 1P5BA 3BW3A 5C5YA 1A5AA 4UNKA 4O50A 3MW7A 5U4NA 1TIMA 3TFCA 3RFAA 4WD0A 5AOUA 4Z1AA 2GVGA 5CSRA 3DFOA 4IXHA 2BX7A 4N6FA 1LOQA 1D3GA 3NG3A 5HNRA 4DO6A 1Q45A 2V2CA 3GAKA 1KFJA 3GXPA 1O95A 1NVMA 1RV8A 5G1TA 5KMYA 1GEQA 1WYIA 1KM0A 3TAOA 2J9XA 3CIWA 4CQAA 3PB0A 2ATMA 3LHUA 3JR2A
chains in the Genus database with same CATH superfamily
2HSAA 2V5KA 3IVSA 1OFDA 1JVNA 4LV9A 4F0KA 3MI6A 3CMFA 4KEVA 4ZODA 3WQVA 4HPNA 4GY0A 4Q8VA 1X38A 1VJIA 3CNYA 4UFJA 1NDWA 6XIMA 2NW0A 1XWYA 4MB1A 1H5YA 1OYCA 1G7VA 3KE0A 4RNHA 2HEJA 1ZHAA 3HU7A 1MNZA 1V51A 3USBA 1NFGA 2CLPA 4CNSA 4KPLA 5I79A 4H4IA 2Y85A 1F07A 1E3ZA 1FWRA 4E4PA 2IXVA 3TUUA 4S2CA 1W1VA 1SUXA 2ZZ4A 4IG2A 3TYCA 5ABHA 1MW0A 1C9WA 1FXPA 1R3WA 3QR1A 4GXMA 4H41A 3BLIA 1DIEA 1QPNA 2GZXA 2DZPA 1J11A 3LYEA 1MWOA 4IOTA 3OA5A 2B7OA 3N11A 4RDYA 1Z7AA 2BY2A 3RLGA 2NVCA 5BOOA 3FVDA 4BHYA 3WCZA 4YTRA 3NPXA 2ZVIA 1NY1A 1J79A 4IMGA 2NUXA 2C14A 1LQ2A 3SGUA 1OSEA 3R58A 4AZCA 3F5LA 5H2ZA 4NX0A 4BQ3A 1SJDA 4AAJA 3UCDA 1Q6EA 2OZTA 4OE7A 4XZMX 4C91A 5CSYA 1LTDA 4J4KA 2ZYFA 1BHGA 1E6NA 4G7FA 1XXXA 3U0HA 3N9SA 1V3KA 1L2UA 3NSMA 1MEHA 2QJJA 3F4NA 5LNUA 2QUNA 5FD0A 1UR8A 1YXCA 2BVDA 2ZA1A 3S1UA 3T0AA 1UG6A 2AQVA 4ZQCA 2AMGA 3EAUA 3KOYA 2QLYA 4KFNA 3PJTA 3PSVA 2J78A 3S2CA 4JTJA 1POKA 4XD3A 2DVTA 1M3UA 1W31A 2ZVRA 1EC8A 5HINA 1R3RA 2Q8XA 3MU7A 1B57A 3OZMA 3IGSA 3CL8A 4DVOA 4DX3A 1E0XA 4ROQA 5FI8A 1HXJA 3RJYA 2YB1A 3K1GA 2E40A 3TA9A 3MWAA 3E3HA 3A6OA 3U4FA 1WPCA 5C71A 3FVMA 2JQXA 1X98A 4C7GA 2I56A 3QGKC 4D71A 1OWQA 1P43A 4MDPA 5G1MA 2ISVA 3NJ3A 5JBEA 3SCOA 2NUYA 2X30A 2PUZA 1A53A 2Y1HA 4C5YA 3SFWA 1TREA 1U5HA 4XTIA 2V67A 3R89A 3GTHA 1YIXA 3MPGA 1S5MA 1OK6A 4DN1A 3DI0A 4DI9A 3T81A 1HVQA 1XIHA 4RXGA 2MANA 1XLCA 1KRAC 4RUBA 3IVTA 3MUXA 3CYJA 1EYWA 3QYQA 1CXIA 1NEYA 1QPRA 1TE6A 1OFBA 1XF0A 3WJZA 4O54A 2A3AA 3ITVA 3TIMA 2QHAA 3LY0A 1DTUA 4TX9A 3CLMA 6CGTA 1NWTA 1XYFA 4NZ1A 4S2BA 3PZ9A 1ZLPA 1JPDX 3JRKA 2ON3A 2WNZA 2ZCGA 5DRIA 4P8UA 4HK7A 3H6OA 3L2IA 2W9MA 2A0NA 2YPIA 3WH5A 4WKFA 3WBWA 2H9AB 3P8IA 2RGLA 3CEPA 1V77A 2F61A 2VEMA 1W9UA 1A5NC 4M6QA 3DXIA 4RZBA 3VOJA 4UTTC 1XIMA 4W9TA 5I3FA 3DH7A 5LIWX 2WZMA 2YBVA 2EXOA 4B5SA 2WPBA 1NELA 2ZRWA 2VT0A 3QV8A 4EKJA 1BF2A 1JJKA 4FXFA 3QTGA 4JN7A 2Y24A 1R47A 1WBHA 3WQEA 1X7IA 3N2MA 3N6JA 1PL9A 3QQ0A 3RR1A 2DT2A 4MFEA 1TV5A 3OG3A 2OYLA 4W86A 1FP8A 3AC0A 1ZPTA 3FS2A 3O2LA 4RE0A 4G5DA 5BU6A 2WZHA 4HNCA 2ZC1A 3TTEA 1VZWA 3EPOA 5I3DA 3VDAA 4DJDC 4XD6A 5A8MA 2WPGA 3H4WA 4MPQA 4PTMA 3QVQA 4IQJA 3MO4A 3L12A 1UR3M 1ZY9A 3BARA 3VIIA 1ICQA 1YXYA 3EDJA 3N13A 1HL8A 1GG0A 1X1OA 4WDUA 3RGTA 2BVWA 3DAQA 1XCFA 2F38A 1CIUA 4FOJA 4CD5A 2PDQA 2QCCA 1UW9A 1R3QA 4JIIX 3QV6A 3CXOA 5I3KA 4ML4A 3T78A 1JL8A 3BLDA 3REQB 3BG5A 1L6WA 3GFYA 2IPFA 4K2SA 4LC8A 3TOPA 4JHZA 1BQCA 4ZSTA 3VD4A 5E09A 3AIQA 4BQ5A 2R1MA 3WQPA 4XZHA 3PUGA 3CBWA 4UWMA 2GDVA 2ZZ5A 2DQXA 2QV5A 3GTIA 3WQDA 1L8PA 1P7TB 2ZZ6A 1ZQ5A 1E9ZB 2GJXB 3H54A 2WSKA 3PZQA 4UOQA 4C60A 5CJ5A 3O16A 3ZWTA 4A29A 4DIAA 4EWJA 5IHRA 2QR6A 4EPKA 1R3YA 4L4LA 3AIWA 3SN1A 3HJEA 1VFHA 1THFD 1CGUA 1TCDA 1WXZA 4H9YA 2I1OA 1KBKA 3W38A 1KCXA 3AYTA 5CKSA 2V5LA 1N8IA 2BGSA 4AWEA 1KLYA 3NDYA 4M24A 2A5HA 1HJWA 2NXIA 4CQ8A 3CUHA 3PZTA 4HPXA 2QJHA 5AYIA 3FW6A 2Z26A 4QE4A 4M3PA 4ZQPA 3HTWA 2JE8A 3C3UA 3M5YA 2WZTA 1FH7A 3BAIA 1GKRA 5DEZA 4E8GA 3WDIA 3IRDA 1AODA 3QHMA 1UKPA 4NYUA 1TMQA 3PFMA 2P0OA 4L4PA 4LBSA 1EO5A 4BWLA 1YNYA 1SSDA 1IXQA 3EOUA 4UMAA 5FJIA 4XD5A 3T0DA 4MB5A 1RK6A 2WK2A 5HOSA 4P5UA 4PB4A 2B7PA 4JIHA 4S39A 1J96A 5D9MA 4OKDA 1KBBA 2RUSA 5AC5A 4HMEA 4NRRA 3VIOA 4H9TA 4MSSA 4DJFC 2EG7A 5F7UA 3LGGA 1KR1A 1CB2A 4DM1A 1JPMA 2FPYA 2DV0A 4WHBA 2YL8A 4C1NB 5DMMA 1R2TA 5C9XA 3FX4A 1VBGA 3UY7A 1JCLA 4ZE5A 4DF2A 4JTQA 1S2WA 4YJ5A 5CQ1A 4LU0A 4TX6A 4O16A 3P0XA 2DGAA 5C55A 4BJHA 3N34A 2IKIA 4LY4A 3STGA 4JL2A 1A3HA 3A3XA 1VYRA 4UFHA 1JZ8A 3DFNA 3CJPA 1RH9A 5E93A 1TVLA 2ZUMA 4H04A 4J3TA 3WEMA 4MG4A 1CGVA 4XV0A 5AHIA 2QW5A 2X0SA 1IIHA 4NNCA 4BI5A 4Y8EA 1XG4A 3R0UA 2Q09A 4LNCA 4S3GA 1YADA 4IQLA 2PWGA 3R0DA 3EWUA 3EXSA 3G1HA 2TRSA 4PUNA 2A6LA 3PHAA 3RPMA 5I7GA 1HKMA 3WNPA 2C18A 1W2VA 5D05A 3G8RA 5GJNA 3TOYA 1T6MA 4XBKA 3TN3A 1S2CA 2FFCA 1SZNA 1C8VA 3N15A 3DBPA 1W91A 2YA1A 4WVXA 2PP0A 3ABXA 3CAWA 3VKBA 5K3VA 1VCVA 2WVVB 2OSXA 3ITGA 1MQRA 2Z29A 2VOMA 1RLCL 4XO6A 1RBAA 1UD4A 2XIOA 2VZVA 1QTWA 5I24A 5KSWA 1UP3A 2ZZ2A 1W3NA 5LIKX 1EXBA 3IIXA 3BV4A 3LLXA 3KVJA 5DMNA 4Y8FA 5AYBA 2ZRUA 3BSGA 1QNOA 4WX2A 1XIBA 4QQUA 3VOGA 4RDVA 5RUBA 2VEKA 4HPHA 3ABRA 8TIMA 3VDGA 3E0VA 3RX2A 4LBUA 1UWTA 3MUIA 3TJLA 4UTUA 3ZIZA 1DQXA 4F0RA 1RCQA 4DXVA 3DHUA 2XFWA 4F40A 3AISA 4C7FA 2DIJA 2X42A 1F3TA 2YCKX 2PPGA 4AWUA 1OD8A 1TJ0A 2V0TA 1QATA 1GJPA 4DNMA 2Y8KA 4B9YA 3BJFA 1HL2A 4MADA 3VU2A 3A64A 3MC5A 1E51A 3K46A 1I1WA 2ISDA 1W8GA 3S1WA 4HNVA 1UD8A 1W2PA 1KCKA 3SCTA 2YA2A 5BROA 4ATWA 1Q4NX 1QPOA 1GVQA 2GK1B 3DFQA 4F0MA 3L9CA 2H9AA 3I65A 3ID7A 4GNVA 4UTWC 4O1CA 3BICA 4CD8A 3COTA 3O06A 2UY2A 5CZTA 2GQ9A 4IMAA 1TV8A 3NVDA 5C2CA 2QF7A 4C6PA 3DHDA 2J47A 4D8LA 1NJJA 1TQJA 2D22A 3BMVA 2CYGA 3UJFA 4U5KA 2UZ9A 2WNNA 1ISYA 5A8QA 5EU9A 4XG1A 1XD0A 3C2RA 1YDYA 1XL9A 3AMCA 4GA8A 3WSUA 1P0EA 1Z32X 4RW5A 4OZOA 3LTYA 4MMWA 1BTMA 1TELA 4LXFA 3G1AA 3T7VA 1FWBC 4KWUA 1JDDA 2DP3A 5F2GA 1H7RA 1T99A 1LQAA 3Q94A 2FHBA 4GJ1A 3M0ZA 1M7JA 2WHLA 2PDUA 3N25A 2PRMA 1DWGM 4AFYA 1H7PA 1LUCA 2BB0A 2P88A 3VCRA 2YCJA 1JYXA 1FWGC 4EPDC 2O55A 2E6DA 4A2SA 2CZFA 4DAFA 3UG8A 3V1PA 3ARYA 1DORA 2X0YA 2GQ3A 1O66A 3GHTA 3XINA 1DKWA 1TPVA 4PMZA 4QX4A 3YPIA 1TSIA 1KV8A 3TEVA 1OG0A 3GDTA 2VZOA 1I0DA 1UUQA 1GCYA 4CEXC 5LKYA 4ATLA 4ZB2A 2EPLX 2CBIA 4D2JA 3CT2A 5XINA 3SCRA 4LVFA 4J9JA 4NVTA 1T0OA 3W7CA 1DP0A 3RILA 3TTQA 4IJCA 2WZIA 1YDNA 1O60A 1TPB1 4TUFA 3N12A 3ALFA 4S3JA 3A9IA 4A3UA 4PTNA 3GXFA 2Y5EA 3E6EA 4C6FA 1GVYA 1W1TA 2F6XA 1TJRA 4HZ8A 1UZDA 3LI0A 3P82A 2E5CA 1DPMA 3JS3A 3R13A 3TWBA 1AMYA 1ZBWA 2PDIA 2GJXA 3DIPA 1OYBA 4KGLA 3C2EA 1CZ1A 1OINA 4UTLA 4XKMA 4MPKA 2BTMA 3PK7A 4JDBA 1PTGA 2Z1VA 3MMUA 3CUFA 1LDCA 3OLDA 4FP1A 3OBEA 3OBKA 3ITTA 4JQAA 4R34A 1VCGA 5A3HA 1BSLA 3BZGA 1GZGA 3NYDA 3IK4A 3M07A 4K38A 3H2NA 3S1XA 4MJ4A 3W85A 2X1IA 2QCGA 3FY1A 1MQPA 1R86A 2CFFA 1JCJA 3GG0A 1HZYA 1OHLA 2XPKA 5FEPA 2D69A 4PRTA 4UFIA 3S42A 1CB7B 4GI8A 1B5TA 4D6GA 1AVAA 3A4JA 3PBWA 3TE9A 1GKQA 1V7YA 3GY1A 1QJWA 2E77A 5BNKA 5JQ9A 3AMGA 4RCXA 7A3HA 2DT1A 1UPMB 5I0DA 4QAWA 3QZ6A 3W00A 2WOQA 3U7VA 3NUKA 2YBUA 2OQYA 2BGNE 2GPTA 4GBDA 1DJZA 1QHPA 3OZOA 3M0KA 1YKWA 3V5OA 3GK0A 1M7XA 4R9XA 4K39A 1A47A 8RUCA 1A0DA 4HD5A 3FK4A 2P3ZA 4ZO7A 3O3RA 1FKWA 1Q6RA 1ZAJA 3F7JA 4WDXA 1GHRA 5MKGB 2NLYA 2AGKA 3AYVA 1F8MA 4F0SA 4GINA 1PZ0A 4C1NA 4D72A 2I57A 4IGHA 3ZR6A 4UCGA 1JZ2A 2WSQA 2GUYA 3C8NA 3AS3A 4FS9A 3ATZA 3FDKA 3PWGA 4L65A 5H91A 2VKZG 4AHPA 4G9PA 1IEIA 1U22A 3P5ZA 1KV5A 4GOAA 4DZHA 4BEQA 4ZXOA 1CECA 1Q65A 5HBFA 4Z17A 3H2FA 4PCPA 2BY0A 1RY0A 3HB9A 2D1ZA 1LP6A 3AIEA 4FPSA 3QZEA 4O11A 4IFRA 5F1UA 4L6DA 3HBLA 3GH5A 2EKCA 1XDLA 2R1LA 3LSCA 4CQ9A 3BLKA 3BPWA 1EGMA 4HOZA 3VKDA 3AALA 5HJXA 2Y4SA 5BXRA 1XRFA 3HIJA 2ACRA 3MSYA 3G2GA 4PE8A 2GDUA 3UP8A 3E38A 3WK1A 4ZA0A 2FDMA 1GKPA 4Q8WA 3PSWA 5DLCA 1UOKA 5EMMA 7XIMA 1ICSA 2WVVA 3GNOA 1EQPA 1X97A 3O1NA 4AZIA 3F03K 1K6AA 2CETA 3HGOA 5DBUA 4MVAA 1K8XA 3FJ6A 4YVVA 4ECLA 2WQDA 1UUOA 4G8TA 1Z3NA 4QDPA 2GGIA 2CWNA 4NJIA 3WK2A 3N4FA 5AVNA 1TX0A 1GEHA 1ZP3A 4XUYA 4LUJA 2OYMA 2XVNA 4FR6A 3QLLA 4JQ3A 4US6A 1AQ0A 1UCWA 4W7WA 3MKVA 1AQHA 5PTDA 2ADAA 5DT7A 4DBSA 1M7PA 3NL5A 2YOCA 2ODOA 1MUCA 4PTXA 1ZJBA 1H1YA 2WVSA 1WKDA 4ICNA 2Y7EA 3O7UA 4DWDA 3H7RA 4GI9A 1MXGA 2UWFA 1BG4A 2LLEA 3L2MA 1W17A 3WK0A 3KX6A 3O0KA 4FF5A 4B91A 2QUMA 1OFQA 3UT0A 1VD6A 4Y96A 1S39A 1WNOA 1IZKA 1A4LA 5AC4A 1UH4A 2J24A 1RVGA 4U3CA 4UQBA 4DXXA 5T91A 4Z2KA 1H7XA 3WQCA 4YWSA 1XS2A 4MHBA 4NX5A 2BOFX 2WHJA 4R7JA 3RX4A 1TJ1A 3SURA 2GK1A 1I2OA 3HQOA 3WLPA 3TA6A 4E6MA 3TLQA 4YVXA 2BY3A 2PDNA 1RP9A 1XLGA 1XSKA 4XKYB 4A3QA 2HISA 1IEQA 3KOXA 2BODX 1U1UA 1K4HA 5HK4A 1XI3A 3B0XA 1ZBCA 3GNRA 3P61A 3QEZA 5F1VA 4JAWA 1EIXA 1PHQA 4I5UA 1HKJA 1S1PA 1G4EA 3KRSA 1S1RA 3LTSA 3CB3A 1AL8A 3LU2A 2Y62A 3L0GA 4LFYA 3UPMA 2AKMA 3N2TA 1Y8BA 3IJ9A 1XBVA 4FNPA 3WDRA 2PDXA 4NZJA 3O15A 1OFEA 3TR9A 2Z1BA 3CO8A 4IFKB 4HNUA 3TLLA 1QWGA 3ALGA 5LNVA 3PZUA 3GXNA 1XYLA 3RN6A 3S47A 4QQ3A 3NSXA 3ARZA 2W27A 3GDKA 1WDPA 3P3BA 2BASA 4PSPA 4YIWA 3L7RA 5E5CA 5JU6A 1OF6A 4GCAA 1E0UA 3O6CA 2WM1A 3TAKA 2RGMA 4L9ZA 5BU9A 2WHMA 3W7NA 4WKHA 2GGHA 2DUAA 3LLDA 1KFWA 3AUOA 1E70M 2OX1A 4WDTA 2C71A 4ZR8A 1TJ2A 2J66A 4L64A 2ZFAA 1K77A 2BVYA 2ZTKA 4JKLA 1M01A 1UC4A 3GHUA 1PZ2A 2X1SA 3LM7A 2VRQA 2JF7A 1C8QA 4QCFA 1E9IA 1V4YA 1PJ9A 2ZUVA 2BHZA 2FGZA 2VDGA 1DHKA 1XYCA 4WY0F 1HP5A 1R30A 5BRPA 3KL3A 5FOOA 2ALDA 1ZENA 4HSNA 3PF3A 4JY8A 3V35A 1V8EA 2WB5A 5A6BA 3APGA 3VNMA 4OOZA 3O9NA 1FHUA 4AIEA 1XYBA 3CZJA 4Q7BA 3GNNA 1J01A 5IXEA 2PTYA 3H4GA 1IZCA 4UZSA 3SW6A 3QSRA 3TKFA 2WC3A 2CLKA 1J6OA 3GUWA 1OGBA 2F9RA 5LGZA 2EG8A 1FDZA 1W1PA 1ITQA 2W61A 3QH2A 5CBJA 3F4WA 4MY8A 4AUBA 3CUIA 5LNWA 3KBWA 2NX1A 3SGZA 3AWNA 5E70A 2VC9A 3S46A 2CERA 4HJFA 4BF5A 1OCQA 4FSAA 3W1MA 2EQDA 4PH6A 2XM2A 3WX7A 1XP3A 4AD4A 1KXHA 1G4SA 4MAZA 3C3NA 3LCHA 1FWCC 3QHNA 4Q4RA 1V3LA 3VZYA 5KITA 4IX0A 3C0SA 3W70A 5I5RA 3TJIA 5AZ1A 4B90A 2JEPA 1R5YA 3W88A 2RJGA 2JBMA 3VNIA 4W5UA 3CMJA 5ABGA 1GQIA 4D6CA 1D9EA 5REQB 4I7UA 5MKGA 4ZQOA 3UXLA 1JCNA 4B2DD 4CD6A 1JRCA 2PZNA 1YLVA 3M46A 1DE6A 2WO5A 1KKOA 4H6KA 3VZZA 3VIFA 2J8GA 2CC0A 1RPKA 3L2LA 3LD5A 3SCQA 1AG1O 4WOZA 4AIBA 1M5WA 5I3GA 1OADA 1L6FA 3SUUA 2GYIA 1G67A 1BVZA 4D1IA 4N9DA 1US3A 3T09A 1FOBA 3U2EA 3EOOA 3G1SA 3W7OA 3ZLHA 3WDJA 1KTBA 3EEGA 3PN8A 1HQTA 1OX6A 3EA1A 3O6AA 3KVLA 3O8AA 4BI6A 1AW1A 3WUBA 2VFEA 4GHRA 2EAWA 4KBXA 3U5UA 1LWHA 1P0NA 4PUWA 5LNRA 3GB6A 3GW3A 2AAMA 5AYXA 2NLIA 2GJPA 3HFTA 4CEUC 5LIYX 1PXGA 1U83A 1SSGA 4HHLA 4A22A 1WKYA 1GOIA 4GX9A 2XH4A 4ZFCA 2YKKA 3BTNA 2XH2A 1JQVA 2YLAA 4XZ9A 3BQ6A 3V5FA 1A80A 2ZTJA 1A0CA 3L65A 4LT9A 2V69A 1X39A 5KEZA 4H83A 2B7NA 1XCWA 2Y7GA 1R87A 1UIOA 2VX6A 4GCXA 4IISA 4PUJA 1SFSA 4QITA 3L5AA 2YJQA 4ATDA 2OZ8A 2QAPA 3TNOA 3WFLA 3U6WA 2J6XA 4KEZA 3SIMA 5E0KA 5ABFB 3URAA 1MXSA 1PPIA 1Z44A 4XAPA 1MYRA 3CQ0A 3GDLA 1FDYA 1TFVA 2QVHA 5LNSA 1XFBA 2Y63A 4TVCA 5BCAA 3WD1A 2FH8A 3AUJA 4NIRA 2YW4A 4X22A 2FQIA 1NOUA 3P8JA 1SW7A 3LLFA 1V5XA 3SZ8A 2Z4GA 4XZBA 3UJSA 3AO0A 4LB3A 1ODUA 3SY8A 1QCWA 3SCNA 3RPTA 3V1HA 1NF0A 4CVUA 3IIZA 1G6CA 4HU4A 4L9YA 1LROA 1E4LA 4YTSA 5BZAA 4GG9A 5HMDA 3MV01 4KQNA 3RO8A 1S3TC 3GD6A 5HPOA 1C91A 1K3UA 2XIIA 1DIOA 1WO2A 4FNSA 5G4EA 3CH9A 2BNJA 2OO0A 1EJ7L 4YXGA 3W87A 1NOWA 4MYAA 4AVOA 1WZMA 3D5HA 3EWXA 5EL1A 1PE1A 3FJLA 4XB3A 3IJIA 4FALA 2CLMA 4Z0JA 3DFPA 1MEWA 4KT2A 1P5BA 4D9PA 3R10A 1LT7A 4WD0A 2YXXA 3KDNA 3A3WA 3DFOA 4N6FA 4Z2IA 1E43A 4GYFA 3VPLA 2VC5A 2V2CA 1KFJA 3GXPA 3WQOA 1QHOA 1E0VA 1GEQA 1WE5A 4WEVX 3MZ2A 3B9DA 4GQBA 1QBAA 2E9LA 4I9TA 1VPYA 4AZ6A 2WSRA 3UXKA 3P93A 3A9BA 3T2QA 3M0VA 5F4XA 1AJ0A 3FKRA 3DENA 1LQ0A 4GXWA 1TWWA 4JGDA 4L6HA 3R8GA 1EC7A 4Q4KA 2DVXA 3OZYA 1RY8A 3W2MA 1CYGA 4N02A 1AH3A 4FX6M 3WMLA 2V8ZA 4LAKA 1J5SA 2HXUA 4H8VA 3CIVA 3OOQA 3ZM8A 3WNMA 2WWCA 1R85A 5BXSA 3KP0A 4S23A 3EDEA 3EMQA 2EG6A 2P10A 3JZUA 3KLLA 3NSNA 2PC8A 2OEKA 5H8UA 2H8XA 2NV2A 3EEZA 2XWEA 3W74A 3DYOA 3ZT5A 5CXPA 3W7PA 3ES7A 1Q7QA 1H11A 3BAKA 1XIIA 2G4FA 5A6MA 2ZRYA 3CZGA 3PNZA 5KZDA 3L5LA 2GVJA 1SW3A 4CNPA 1W0MA 3M0LA 4QE5A 3TXZA 1JPIA 1OCBA 3WF4A 1GTHA 2Q3RA 2V38A 1J4EA 1GONA 1JZ4A 3WD0A 4U2ZA 4DYEA 1RALA 3ANVA 1DJQA 1QOPA 2G0WA 3BOFA 3TZFA 2REQB 4JS3A 2XIQA 4AD0A 1F4AA 4INFA 2PAJA 4H9XA 2DW7A 5CJNA 1J9YA 1K9EA 4RZ6A 5JVLA 1O5KA 1OC7A 3M0JA 4Q6JA 2EPKX 4AZ7A 2V68A 1DTNA 1QPKA 1FH8A 2WLYA 3LHWA 3M0MA 1B3OA 3VO0A 2PB1A 2C1GA 1HW6A 4Y9NA 1AZ2A 1JGIA 3WJWA 1OFOA 3KDOA 5L6UA 2J62A 4TR9A 3ZSSA 3SRDA 1M9HA 2X09A 1OX4A 3PB2A 1CWYA 5AKQA 3PUDA 2Y89A 2JKEA 1FCVA 2ISFA 3OYZA 4LW7A 3QQ1A 4FLSA 2IQTA 3TJ4A 3CQKA 5GPRA 4DUXA 5TAOA 1S2VA 1VYPX 3UXAA 4B3KA 3ZT7A 2J6VA 3QW4B 1ONXA 3NNTA 3TFXA 3VKAA 1PCKA 4CQDA 4C6IA 4JTCA 3SFKA 3RK8A 2R1NA 3TTOA 1HKVA 3S83A 3CC1A 3IV3A 2P53A 1V3IA 4BQ2A 3VGDA 1GYLA 3APYA 2CZ5A 4HA1A 4C6OA 2VX7A 4M19A 3S5OA 1E3XA 5BYWA 1YDOA 4J2MA 2A4AA 4BQ4A 4YHGA 4QGCA 5REQA 3G0SA 5IFTA 3TQKA 2PWVA 3SJ3A 2ZICA 3BCDA 4J2PA 2NQHA 3EOEA 4MJZA 3HPSA 3TMQA 1NWRA 3HG5A 1XBYA 1LORA 4U28A 4ZTXA 1DJNA 2PSNA 3LPPA 3RCNA 1CT5A 3T0BA 5IM51 7TIMA 2OT0A 4PEEA 4YYCA 3IK2A 1NFBA 4QEEA 2VMFA 3W26A 1XIDA 1OGGA 2Y5SA 2E1WA 4JTKA 2HE8A 5CPTA 1HKKA 2XU2A 4KRZA 3UJEA 2C13A 3QC3A 1UR2A 1TX2A 3B40A 3VX1A 1VP5A 3NYZA 4TOQA 3K13A 1EB3A 1EDQA 5LZLA 2IKHA 4PULA 1B3VA 1QI4A 1G9HA 4M29A 5D03A 5IFPA 2HROA 3I7QA 4GVIA 1F8IA 2VR4A 1XDJA 1YTKA 3UNDA 3L5MA 4DZAA 4L56A 5K9XA 1H3GA 1NQ6A 3KL0A 2NVDA 5A8NA 4IT1A 3GLCA 4JNZA 4S3DA 4DPPA 3KXQA 3GVVA 3VD3A 2C1HA 3UA3A 1PWLA 1A3XA 3B9EA 1CDGA 1MFVA 1KM1A 3CUJA 2XIMA 3BWWA 2XVPA 1K8ZA 1WKFA 4NQ1A 1JDAA 2V30A 2OWCA 1H49A 1SO3A 1UKOA 5ABFA 2Z2UA 3NZPA 3UF9A 1ZUAX 1QHZA 1UKQA 5I2UA 4AB4A 3POCA 1O7AA 3NZQA 3GNXA 5AY7A 3NQ7A 3KLKA 4GMEA 5HQMA 3GQYA 1KWGA 4XZIA 4H6RA 3E74A 3CM4A 3W1LA 4O18A 1XC4A 5DX7A 1Q63A 2W67A 3O0FA 3NZRA 3ENLA 4K36A 3VK5A 3T08A 1P1XA 3SM0A 1GPWA 1PTDA 1F4HA 4JXCA 2VWSA 4NHVA 3RR4A 2W6RA 4NZFA 4GNKB 1ITXA 3NQVA 3UPWA 4AQLA 3ARVA 1UWRA 1JCMP 2YGYA 3ATYA 1BF6A 1TMLA 2D2HA 3S9IA 2WCSA 1S38A 4K37A 3B97A 3KBSA 3DN5A 4CLMA 4NJHA 1BGGA 1HL9A 3A12A 4NU7A 4J7RA 4ERIA 3WDPP 3W7MA 2ZQ0A 2OQHA 3PBUA 4POCA 3IGHX 3V16A 2ABBA 3RYSA 1VC4A 4TMCA 4L5ZA 3L4VA 1ZBKA 4J3VA 5AC7A 2CCRA 4PUEA 3LMYA 1AD1A 3I6RA 3U4AA 4V1XA 4LVGA 3CTTA 3WLTA 4IMEA 1Q8AA 2ATSA 2VRJA 1R9ZA 2DZWA 2ZC8A 3MSGA 4G56A 4KIRA 4AZ5A 2A7PA 3TYZA 3VDCA 4HSHA 2J7GA 1UZ4A 3KHDA 2J8FA 5B80A 3VYLA 1XPGA 3L68A 1FH9A 4QSFA 1MO0A 2VGFA 1MI3A 1O1HA 3PANA 1LLZA 3EWWA 1AZ1A 4GC4A 1XGDA 2VYOA 4DQWA 1MXDA 4RL3A 3URBA 3AHTA 4WCJA 3C2YA 4NNAA 4IJBA 4U33A 1DWFM 3O63A 4JZ5A 2VELA 5IDZA 3W01A 3OIHA 4R7WA 7REQB 2FH6A 3PPHA 4NNBA 5D2TA 3MCOA 2V5CA 4DF0A 4JKKA 2ALRA 1ISVA 2Q3OA 1LOSA 2YFNA 5HUPA 3LXAA 3BSMA 2D3LA 2VUNA 5AB3A 2E9MA 1PAMA 5CZJA 3H2EA 4YYFA 4NASA 2PD5A 4M6UA 2YB4A 4JYEA 3HPXA 3N9RA 3PULA 1BTCA 4UBPC 3SCVA 1KTNA 3A22A 2E5DA 3UZ5A 3HG3A 5F2LA 1GOMA 4CNTA 2ZA3A 2UY3A 1NSJA 3AZTA 4O10A 1KQYA 3V4BA 1IXNA 1KXTA 1R9XA 1DV7A 2WMKA 3F4DA 5HULA 4QIUA 3LXBA 4I6VA 2ZUUA 3AHXA 4TMBA 3WD4A 4UOZA 3W6LA 5C0QA 1H0GA 4M6PA 1J8VA 3HG4A 1KCLA 5CJMA 4F8XA 2QMJA 3DI1A 4E0CA 5E1QA 3U2OA 4AW7A 4N2YA 1YMYA 4WY0B 4TVDA 1KFEA 1SFTA 1VBHA 4JN6A 4AXNA 3C4UA 2OWXA 3ARPA 2WW5A 4MB4A 3HPFA 1R2SA 4NSBA 4QBXA 1OEPA 3UVAA 4ZOCA 2J7HA 3MO7A 4KCUA 3D47A 4C6EA 4UXDA 4G7EA 4DJEA 3VIKA 3UA4A 3OVGA 2P3EA 1F9CA 2NXHA 1IT7A 4TIMA 5JMUA 1HJSA 2DEPA 1WAWA 2FZMA 4J3XA 3HMJG 1QVBA 1VS1A 1DWIM 5CPNA 1GQNA 4JN8A 1UD6A 4B5TA 1ONEA 1Q3NA 2I5QA 4IPNB 5I23A 1W9VA 1RAKA 5ECVA 4E8CA 5I00A 3DC8A 2J9YA 5EKYA 1DYSA 3W82A 2CXGA 3BSHA 4W8BA 1GHSA 2D2OA 2OKTA 1P48A 1QR7A 4JYDA 1VENA 3EX1A 3P7YA 1XH0A 2I14A 4GGHA 4WK9A 1SJAA 2WM0A 4Y9AA 1AFSA 1HVXA 2Y2WA 4LVAA 4DB7A 3TN4A 2P76A 3VGEA 4Q8UA 1V7AA 3VGHA 4GGBA 2PU0A 3VOIA 1AH0A 3H55A 3URQA 3AS1A 5T8GA 2P0IA 1O12A 2WJZA 3P6LA 2UV8G 5T9BG 1W1B1 4DNHA 5DT5A 1JDFA 3UWYA 3GXTA 2BP1A 2GOUA 3EX2A 4ZO9A 5T9CE 5AHNA 1HUVA 1EOMA 2BZNA 2XWDA 1SR9A 3J7HA 4RNIA 2C0HA 4B92A 2V5JA 4NY2A 5CZSA 4M5PA 1HIZA 3IAPA 1Q4WA 2VZUA 3B0YA 1U2YA 2J7BA 3C0LA 4BS0A 4Z2JA 3M9YA 5FF7A 4PODA 1JGMA 1US2A 1PEZA 4TQTA 5FESA 4U31A 4QS6A 1SM9A 1UZHA 1VHCA 4P8VA 5JBDA 2E0PA 4UTJA 4AF0B 2Z6IA 4CQCA 4EX4A 3UU0A 4LAMA 1BYCA 1H7OA 4QS5A 2OB3A 1E40A 2POTA 2D2GA 3HJZA 4KWOA 4W4QA 1DBTA 5K4ZA 5IBXC 1JXKA 4XVEA 3IJ7A 1AK5A 3ONBA 3ABSA 1SW0A 1D7KA 3FGCB 4M51A 5D8WA 3H53A 4KH2A 1RJQA 1XX1A 2PLCA 2GQ8A 1UP0A 2Z7GA 4Y9PA 3NCOA 2FPTA 5D8ZA 3PG8A 1JRBA 1O94A 1CCWB 1UR0A 4J1OA 3IS4A 3B03A 5MF5A 2G50A 3GHSA 2OJPA 1YQ2A 5J04A 1GJWA 1VQTA 4JTAA 3STFA 4H9UA 4FXRA 4RW3A 5FEWA 3VOFA 4ZGYA 3WQ5A 3KRZA 1KWKA 1JPHA 2GOKA 1XRSA 3DEQA 3VDHA 1EO7A 2QT3A 2R1PA 4OBTA 3JZEA 1S5WA 2WSYA 2R1KA 3WBYA 2QJIA 3G0XA 5EFDA 1VKFA 1ADSA 4Y2WA 4A35A 4RR4A 1GOKA 1G5AA 3SIZA 3ZO9A 3KHJA 3NWRA 2C8NA 2QYGA 4PR4A 1VLWA 1SJBA 3SECA 1BD0A 4HYVA 3W1RA 4Q8OA 3GDBA 1TZ9A 1FP9A 1VBJA 4ACZB 1QI3A 2PP1A 3W23A 4MKVA 4XSLA 1YPIA 4WUIA 3DZ1A 5LIUX 3BLFA 1SYTA 3TYEA 3ANYA 1KA9F 4MWAE 4YPJA 5BXTA 4Y9OA 2E28A 1XLMA 1K70A 3NZGA 4I7WA 3GS6A 3Q2DA 4HJWA 4UMBA 4A3HA 1QOXA 2H90A 3HGJA 3U7BA 2G8ZA 5KZ6A 1E73M 3FNDA 4FF7A 3VE7A 3EXRA 1KXVA 4EAMA 4JKMA 2BLEA 2Y70A 1NP2A 4TV6A 3PZOA 3WFZA 4HA0A 5D4YA 1AUSL 2CXEA 2V81A 3K2GA 1S2UA 3MCMA 2ZZ3A 3B06A 1CGYA 5F4SA 2J25A 4CNUA 2C15A 2F2KA 4V27A 3Q37A 4Z2LA 3BK0A 3BV7A 3NQFA 3ZVIA 2B7QA 4HOXA 3FN9A 3NQ6A 5HJYA 1X96A 3BXWA 4LVBA 3POHA 2OGJA 1OCJA 4DBUA 5CSUA 4C6KA 2RJHA 4GQ0A 3CHCA 1DQWA 1UMYA 3OGVA 3KAOA 4S3KA 4W8LA 2V5BA 1MW3A 1GORA 4CN6A 3RXZA 2GVYA 1O68A 3S5SA 3VI2A 1WA3A 4FXJA 1V0NA 3WFAA 2QCDB 2A3HA 3B0PA 2VFDA 3B8UA 3KEHA 2HPMA 2CLLA 7PTDA 3DYPA 5XIMA 7REQA 3LCLA 4QG6A 1VCFA 4OTKA 3NQMA 3NL6A 5JIPA 4S3BA 1XIFA 3OJGA 4R88A 1CLXA 4HTBA 4JFWA 4C6NA 1D7FA 3EGJA 3ORWA 1H1ZA 1J0KA 2G97A 3KTCA 4A8NA 1NFPA 4K8HA 2EGZA 1ZRQA 4ZCWA 4ERAA 1PZ1A 4B5XA 3L0KA 1Q7MA 3NPUA 2XFFA 3W81A 1XBZA 3A23A 4BR1A 1QW9A 5AHLA 2C0AA 1E9LA 1VGAA 5AHEA 4B9ZA 2Y7DA 2D73A 1RCOB 3BZJA 4RK8A 2QDHA 1CX9A 3GXDA 3GSMA 2NXGA 3W6MA 3AS0A 3P14A 3ZWSA 2J27A 5CSSA 1FHDA 1XLLA 3S6OA 2IPWA 2OWWA 1CNVA 3BO9A 3HM7A 1M1BA 1UWUA 5FJUA 2WAGA 1D3HA 3W76A 1TUFA 5EPDA 4C1KA 2V6AA 4MTVA 2IKGA 4UR7A 1JZ3A 3P67A 2F84A 4WY0A 3CH0A 4FIRA 1WCGA 2XSBA 1LF1A 1KBIA 3TW6A 1JAKA 2G3JA 3IACA 3BW4A 4PSRA 2IPGA 2DJXA 4OJYA 2DJLA 2G3MA 2PDMA 3DG6A 4LYKA 4HQVA 3DHPA 1Y0EA 2GL5A 4FO4A 3W22A 4LYQA 4HK5A 1FWHC 2J8TA 1VIZA 2ZKMX 3M0XA 4MWAB 4JNMA 2VCAA 1S3HA 4C6MA 4PMVA 3UWEA 1XGZA 4FA3A 4M81A 3LUTA 4Q8QA 1G1YA 3GIPA 3K8KA 4FNQA 1ITCA 1UWAA 1X7FA 4KRUA 1Q6FA 4OV4A 1M6JA 3BLLA 3GC2A 3LHYA 3TSMA 1PYMA 3W7DA 3TC3A 1QBBA 5C54A 2DPEA 3H8AA 4QJ4B 1Y65A 3UXIA 3HFYA 4LSBA 1A5SA 2CLFA 3ITXA 3HO8A 4W84A 2X0HA 4PUKA 1DVJA 3T4CA 2A85A 1C29A 1K7FA 1E1CA 5E6ZA 4OBSA 3BAWA 3EX4A 4XO7A 4JTHA 1MSSA 3LXCA 4CU7A 1IF2A 5EBUA 1LOLA 1FWSA 3SEPA 4AX6A 5IOBA 4E4FA 3DGBA 4GI4A 1Q6QA 3IWPA 4HA4A 1XHGA 2YCIX 3ITCA 3AIUA 3V5CA 3ZQ9A 4DBDA 4X2RA 2INFA 2IMRA 3W7KA 1HO4A 4HU3A 3LBMA 3INPA 4H2CA 3E0FA 1TA3B 4HN8A 2O7SA 1V3HA 1ODZA 1Q8JA 2V3FA 6ALDA 3SCWA 2ZXQA 3W1AA 4NILA 4HN4A 4NZ5A 5A1AA 3NVTA 5AYYA 3ANUA 5CGTA 5U7SA 1M04A 3QLDA 3TN6A 7ENLA 3WQWA 1HKIA 3CZKA 4QJ5B 5ENLA 2PDPA 5BOEA 2Q01A 1IYXA 3FV9A 1V93A 5M17A 2VGGA 1GOQA 1JAEA 1H62A 4MZYA 4KRTA 2XTKA 1RJPA 3ZR5A 3W29A 1KRBC 4CQBA 1K7EA 2PEVA 4UFKA 4AF0A 2ZWZA 8XIMA 3LCFA 1ZALA 1UR9A 2P8BA 4GZJA 1HJVA 4JHOA 4E4UA 2R94A 2YZ5A 4Y9MA 2HS8A 1EA9C 4KF1A 3LV5A 2XUCA 3H2OA 2IKJA 2KAUC 4XD4A 3FGCA 2WJDA 1W9PA 3GM8A 5EB8A 4A8LA 4EXQA 1PYFA 4YLWA 5FAJA 1VF8A 1ME8A 3ELFA 3TYDA 3GRIA 1WX0A 2HMCA 3L21A 5HDRA 2PP3A 4HOWA 4PCNA 3WH8A 4E2VA 3BGAA 3N2XA 5D2YA 1BYDA 1J2BA 1CLVA 1Y5WA 3FA5A 2HV5A 2V3GA 5CEWA 3S3GA 5G5IA 3PAOA 4O52A 2O7QA 5FCZA 4S3CA 4DWSC 4ZBCA 3IPWA 1L0PA 2YYUA 3WJYA 3HV9A 4EP8C 3IVUA 1XSJA 4KKXA 3FOKA 3VOHA 1B3XA 1ML1A 4Q4PA 2BDQA 1YEYA 3SADA 2OG9A 2RH9A 3WG6A 2R91A 3VCNA 4I9JA 3PBYA 2YCLB 1E1FA 4AU0A 2FMNA 4I8DA 1YPFA 3LSBA 2QIWA 4G2DA 3VKCA 5C8BB 1E6PA 2FVMA 3E12A 2EEXA 5EMJA 2FDSA 2VD9A 2VZTA 1TWSA 3MUZ1 1TB3A 4ACZA 3APTA 4OVXA 2VX5A 4FZIA 3C56A 4A8RA 5AECA 3GTFA 3G6MA 1LL6A 1W1A1 1XPYA 4NXKA 2BS9A 3OU8A 2E6AA 1XLKA 1XIGA 3P0WA 1V79A 2Z25A 1JNEA 4GQQA 3ITOA 1ZS2A 2CW6A 2QUUA 1AQMA 1BKHA 8XIAA 1E5JA 3F1QA 6REQB 4IPIA 3QY8A 4DAIA 4AZGA 1UR1A 3QR0A 4OFCA 5G2IA 2VM8A 3RX3A 2XH7A 2NZLA 5DXXA 2Z2BA 3PPFA 4O1BA 3RAOA 3ZLFA 1TKKA 3OGRA 4KCTA 3TQVA 2E3ZA 5CC3A 6ENLA 1OK4A 4JIEA 1P4CA 3W3OA 4UTFA 4Q7IA 1JDCA 2XGBA 4C6CA 1EJSC 4DI8A 4DYKA 1GG1A 1P6WA 4RZ4A 2I9EA 2WMHA 1ZNNA 1C8YA 4DWSB 4LPCA 3S4TA 1H7NA 3DFHA 1OZMA 4XBSA 2ZXAA 3QRHA 3BAXA 1EPXA 2VEIA 1EUNA 4XQ6A 1RBOB 3JW7A 3H4XA 5D9OA 2TAAA 2QCDA 2OYKA 2ICSA 1T8QA 6TAAA 1TG7A 4LALA 1D8WA 2NQ9A 3W02A 2PRLA 2CBVA 3QY6A 4J3WA 1FX6A 3L4UA 2CKSA 2PF0A 1XQKA 5DCBA 1C7SA 2JK2A 4HIBA 3KFTA 2OFJA 2UY4A 3E1F1 3UJRA 4CN4A 1IHIA 5I02A 4Y7EA 4OUEA 2NV1A 4XWUA 2R14A 3IUDA 3HF3A 1NARA 4WXZA 4RV3A 2XGIA 4F4RA 1AJ2A 1ZSXA 3VFLA 4RE3A 1A3WA 2ZX8A 3WK3A 1GQJA 4NJKA 1O5RA 4KWVA 4RNFA 3GWQA 5BRQA 3PJUA 2CEQA 1AW2A 4HSOA 2OR2A 3KVKA 2DIKA 1UC5A 3EKZA 3B8SA 4WSJA 4UB9A 2WJEA 3QQWA 4EVZA 1H0IA 4NI8A 3CEUA 3W4RA 3W07A 4LANA 1GOXA 1IT8A 1RUSA 4H6QA 4HNNA 5CZ0A 2CLIA 1MFUA 5A69A 1DJWA 3M6DA 4AHQA 3R94A 5D9NA 1L9WA 1UQZA 3VNKA 2VJXA 1KC7A 1E6RA 3GHRA 2O9TA 5E0CA 5HMEA 2FGLA 2A3LA 5H8PA 4MLRA 2O56A 2VCBA 3D0CA 4B15A 3W86A 4I8YA 1POJA 3HGSA 2VGIA 3I3BA 3W25A 2CBJA 4HHPA 2GUBA 4YMZA 4L1XA 4TTUA 2ZBTA 2EHHA 4MWAA 1ZP4A 5CGQA 2BG5A 1XLAA 2B31A 2C6QA 1NIUA 1UJPA 5JXQA 4X60A 4H3DA 3UFYA 3R43A 3WNOA 2W62A 3T8QA 3GBEA 4IXXA 2PDFA 1K1DA 5EGRA 4PL1A 2X2YA 1JZ7A 4EF9A 4PMRA 1GW1A 3R25A 1IE7C 4FOKA 1OGSA 1UYQA 3GXMA 3K4AA 4GVGA 4JEJA 4GC3A 1EDGA 5FEXA 4FMVA 1FQ0A 4WGXA 4DEFA 4DF1A 4JTGA 4B5NA 3KBVA 3AIVA 1SMDA 1SPQA 4PC8A 4D8ZA 5M2FX 4UIOA 2WSPA 3E49A 1GT8A 2EPHA 3VTRA 1RPXA 4NAEB 4X3ZA 3IGXA 5AVHA 3CAQA 1EX1A 4LUSB 3SI9A 1NU5A 1PKLA 3LK6A 1KGXA 5G4HC 3SO7A 4I90A 1Y5XA 3W73A 3W7JA 1CI1A 5DN1A 1I4NA 3PWIA 3AI0A 4Q8TA 2JALA 3LCWA 2C3ZA 3WL0A 2HBXA 1GVOA 2PWFA 3GAYA 4PCTA 3VKJA 4O19A 1XJBA 1JZ6A 3O6DA 1UKTA 1LL4A 3EKLA 3KTXA 3W75A 1JYWA 3M7WA 2J7EA 4DYJA 2AQWA 3LG3A 3QN3A 1YRRA 4YN5A 1H2JA 1XYZA 1H51A 2HXTA 4GKTA 5C5YA 2CBUA 4JQ4A 1SMAA 1PSCA 4O50A 4P7QA 3PTMA 5U4NA 1TIMA 2A3CA 3WQ4A 5AOUA 3VOCA 3PZNA 4B16A 1WUFA 4WSKA 2VVNA 4GH1A 3NG3A 1KNWA 3WEOA 4DO6A 1O95A 1UROA 4L4OA 1RV8A 4LAZA 1WYIA 1KM0A 3TAOA 2HVOA 1PX3A 4IICA 3CIWA 4CQAA 3WF0A 2ATMA 3JR2A 5I09A 3BCFA 5CPQA 4EIVA 5A6SA 4EOUA 3LZ3A 2C7FA 2GSEA 1BG9A 3VILA 1OFAA 1JR1A 1DWAM 1RCXB 3IARA 5HXMA 2YFOA 1HX0A 2A3EA 3GUGA 1QT1A 1FFRA 2DSKA 3GBDA 3T05A 3QW3A 3VFCA 4WIWA 3MA8A 1WAUA 3EOSA 2TODA 1P0DA 3BCJA 3H22A 3IUHA 2QCMA 5D32A 4K8EA 5AYZA 3NA8A 4KWWA 4JPGA 4A3RA 2BOGX 1XKYA 1ZAHA 4GQGA 4GIEA 1UWQA 1BRLB 1QI5A 2BV9A 3M4HA 3PAJA 1J0ZA 4PTVA 1QI0A 5G2HA 1DJXA 1HT6A 1ZGDA 2WJFA 5KTLA 4BF9A 4ZFMA 4DM2A 3AICA 3MANA 3UZXA 1IT0A 1QI2A 2PDKA 4JICA 1ONWA 4XAYA 3VIGA 3AZSA 1PKYA 4K7VA 4FOUA 5D33A 2AKZA 3HOJA 2PBGA 3U2CA 2FVKA 2QPXA 3HQNA 2E68A 3U8GA 4L9XA 3EWYA 3ISIX 1RQHA 4YVPA 1EEPA 4LV4A 3QF0A 2JFEX 4LRSA 5ABEA 6REQA 5M3WA 1JPKA 1VR6A 5JBFA 3I6TA 1F6PA 1VFTA 2PU1A 4AWTA 1S5NA 1UA7A 1JF6A 3T0CA 3F5KA 1K9FA 3FYOA 3SSJA 3S2JA 1H41A 5A2AA 1SO5A 2OOFA 5K7JA 3MUY1 3NOYA 1K9DA 4EXBA 2XVGA 2Q6ZA 1WDDA 2UBPC 3W7GA 4PMDA 3W2KA 1IR1A 1TWIA 5GNZA 1DQUA 4F79A 2WCGA 2Y5JA 3OA3A 4F48A 5GVJA 1W1YA 2D23A 3FAWA 4IMCA 3NL3A 4PRWA 3VA8A 2JGYA 6XIAA 3PS7A 4A8IA 2Z6JA 4GO8A 2KZHA 4HK6A 2CESA 1B4EA 1HG3A 4JIQA 4UMCA 2HJPA 2D2JA 4C6DA 4P7LA 3PUEA 4ICMA 4PB5A 3AYSA 5J5DA 2GWGA 5C9ZA 3NXLA 1RA5A 1PDZA 3WLOA 3AROA 4AHOA 3CQIA 3TWAA 5BWFA 9CGTA 1EJUC 4JY9A 1LG2A 3NQCA 1QXLA 4YWIA 4O53A 3L4XA 1FKXA 4B5VA 4WOQA 5D38A 4QNWA 2PRHA 4PTWA 3R5EA 5FJRA 3TVAA 3AU6A 4PMJA 1WZAA 1SU5A 1ZCCA 4JDYA 1I75A 3TROA 3GR4A 3PZIA 3PTQA 3EWBX 3MI2A 4KIEA 3MTWA 3A3HA 3CB8A 3I7RA 4UNLA 5LIXX 3ECQA 4JTRA 4J3UA 1OIMA 3T55A 3BANA 4H7ZA 3VINA 3SQSA 5H8MA 5TIMA 3KZSA 2VHLA 4L1WA 4MGGA 1UMLA 3SY1A 3BUVA 1CW2A 3HN3A 1BWVA 3SBFA 3SRKA 4A05A 4CCCA 3MYOA 3FHAA 2ZDRA 1A49A 3ITYA 3IIPA 3AHYA 2QAFA 3CU2A 9XIAA 4PYSA 3CUGA 1FCUA 2H3BA 1P1MA 2ZUNA 3DCPA 4M56A 4O0QA 3RM8A 4AISA 1EOKA 1EX5A 2PS2A 3REQA 4EPEC 1KGUA 3UWWA 4IP4A 5CCZA 2VEPA 2CU0A 2OKOA 1UH3A 4L7ZA 4C90A 3MKKA 3WF3A 4J3ZA 5A6KA 4WSHA 3KP1A 1R9YA 3TXVA 3M5XA 5HNUA 2VP8A 4K7YA 5A6BD 4B5UA 1P7TA 3KS5A 2XH0A 4HVXA 5AC8A 3CZEA 2W66A 1SJCA 1U5JA 2GGJA 1JULA 5IRPA 4JFUA 4JTEA 4UTTA 1S46A 1XC6A 1Z48A 2TYSA 2A21A 2FHCA 3R4IA 4QLKA 1YE6A 5HANA 4W87A 4IPPA 4QHRA 1FXQA 2QZRA 4TTGA 1TR1A 3XIMA 1EWEA 2PBOA 3LGEA 5B7YA 1E15A 2HZGA 2A3BA 2OELA 4GYPA 2EJAA 3WY1A 2FZDA 4DPQA 5A6JA 4FB7A 3QOKA 3W84A 5HMFA 1SO4A 4BFAA 2DQWA 3VVGA 4DJDA 3W7IA 3TX9A 3F4CA 4NAEA 4RJEA 4BK9A 4ES4A 4YHEA 3EPMA 4GLEA 4UFMA 1XRTA 5D09A 1IGWA 2VO5A 3CGTA 3THCA 1X8CA 2E8YA 5CC5A 3M16A 1FWTA 2J7FA 4UUIA 5HQLA 1G4PA 1GJUA 3CMGA 3FKKA 3ZFHA 1KR0A 1OFPA 1D8CA 4IL0A 5FJOA 5FF4A 5CBBA 2RDWA 1N55A 1MZHA 1BWLA 3LRKA 2O4QA 4ZO6A 4MNKA 3ZR4A 4YNGA 4LCQA 3HV8A 3VDBA 2C91A 3GFXA 2FTWA 1A5OC 1WOAA 4R27A 2J79A 3DFYA 3E2VA 6TIMA 4XK2A 3W1PA 1EFZA 1LRQA 1CGWA 2ZZ7A 3BLEA 3WH9A 3GC4A 1TTIA 4BWLC 4D6DA 3QMTA 4FHAA 2O9PA 1TZ7A 3GDRA 1J5TA 2OSWA 1G94A 2H8ZA 3PTKA 3NEVA 3OZPA 4ZOBA 3VM5A 1W3JA 3VUPA 4CD7A 3ITLA 3KWSA 4FLOA 2XN0A 1QO2A 3TYBA 1FBAA 3CPUA 4QROA 4GZIA 3F4VA 3SCSA 4LS0A 4LYRA 4G1KA 2XYLA 3GYEA 4PMQA 1A5MC 1U1JA 3MMDA 1PBGA 4Z2HA 3RRAA 1A50A 2VUYA 3TYAA 4Q33A 2QXWA 3IANA 3LZ5A 1UBPC 2QEZA 3OQ8A 5IHSA 1DJGA 3SDOA 2R82A 1EQCA 3C0QA 1W9BM 5HR7A 1XLIA 4OUIA 3RO6A 3SGGA 4F66A 2MUCA 1XH1A 2OT1A 4LAUA 1BRLA 4M1BA 1IV8A 2PI6A 4WDWA 4ONVA 3NQBA 2NQ5A 1Y5VA 3MWCA 4E2DA 4QE1A 4YTUA 1TQXA 5DXYA 1EBHA 4C6BA 1HGYA 1XLDA 2DSVA 4AY7A 3P81A 1Q6OA 3HG2A 1O6IA 2E6YA 4GXPA 3WYZA 4W89A 3SN4A 2PTXA 5JH2A 1FWIC 2OLHA 3CLWA 1WV2A 2E6FA 5A6TC 1YDVA 1I8JA 4WJXA 3RMJA 3AXIA 3VZXA 2RAGA 3EB4A 4DJFA 3S8HA 3LNMA 2YL6A 4R5EA 3DG3A 1YTEA 4PBEA 3IAQA 4XZLX 4GPNA 3P80A 4GIAA 4GY1A 4GYKA 1TRIA 3TK7A 4ZB5A 2BHYA 3RNDA 2R24A 3CL6A 3VNZA 1T5AA 2PD9A 4IP5A 3UJ2A 1RD6A 1TRDA 3LM3A 1Z8AA 4RE4A 4YTQA 1LWIA 1RP8A 3WUGA 2YLLA 1F3XA 4WGHA 3I3DA 3WMBA 1CLKA 4Z0SA 3H7VA 5E9AA 2XGZA 3R0KA 4ERGA 1EKOA 2ZWYA 3N9KA 2VOTA 1HP4A 4GUFA 2G3FA 1NM9A 1U30A 4FR1A 1PKMA 3O05A 4K1WA 2GUUA 4GUHA 4WQ6A 3N04A 3MSRA 4Q6XA 4NZ3A 3D3FA 1XDMA 4LS2A 1UP2A 2FGBA 2HK0A 1TVNA 3ZOAA 3LI1A 1ZAIA 4PBFA 3GDMA 4C5ZA 1JYVA 1VEPA 1QNQA 4LGXA 3C5QA 3WLQA 4H19A 5LSMA 4O1AA 1D3CA 2XHYA 1GOWA 4A3YA 4IGMA 4HZ7A 3GW0A 3AFBA 1VEOA 2G96A 1E71M 1TTQA 3N19B 4NJGA 1K02A 4MB3A 1J0IA 2AAAA 4MIMA 1BPLB 1UB3A 2X1RA 4O4WA 2OMAA 4JQ1A 3CAVA 4ZTYA 4ZOAA 2NV9A 1WQ5A 1BVWA 1UIPA 1B31A 3GC5A 3P5YA 4I5RA 4NAFB 1PCWA 1DXIA 4P7OA 4HGXA 4AG0A 3WKZA 1JZ5A 1V02E 1FCQA 3W71A 3RLUA 4JTLA 3BAJA 2HTMA 2WVUA 4HPJA 1PDYA 5A5WA 4E3TA 4D6FA 1FWFC 5A8OA 4I9MA 1NP0A 5JUVA 4HTYA 2CZVA 1PIFA 1QW8A 3DC0A 1ZJIA 4QFUA 1TPC1 3M43A 2PDJA 4QR6A 3NPVA 1ECQA 4ADSA 1FA2A 4PUMA 2Y8VA 1FCBA 4GFSA 3CUXA 4X61A 5CAKA 4A6GA 2TMDA 2VD8A 3S2LA 2BWGA 2EBNA 4LOCA 3TMLA 3UG4A 3NGJA 1HN1A 4M82A 3N3TA 1WKEA 3QM3A 3KBJA 4NUWA 2Z27A 4BI7A 1UPPA 4LYPA 3BLOA 1MDRA 1O4UA 3ZSTA 4UTWA 1V6TA 3LB0A 3UPBA 4OOUA 4XZNX 1OJXA 2VEFA 3MCNA 4P7RA 1TWZA 4PMUA 1CXLA 4MKNA 2ASHA 1CENA 2VENA 4Q32A 3Q4DA 4V2XA 1RJRA 3WDHA 3GTXA 4JQ2A 1KM5A 4UCFA 4HU0A 5CLTA 1XLBA 4ZENA 1ME9A 3ONCA 5CBIA 4JYFA 2WKJA 2WANA 3MSDA 2QCHA 2VDIA 3ZVHB 1AA1B 1CXFA 3HQPA 4W85A 2OGYA 1EBGA 1ISWA 2ZZ1A 3NURA 3N14A 1QW7A 2J74A 1EA0A 3GXIA 4LBRA 4JEQA 4M7TA 1EP3A 4E2BA 4US5A 3SJNA 1H60A 3GIQA 3P60A 2QV4A 4OU1A 2F6KA 1F76A 3W83A 2VEGA 4KWSA 1RLDA 4MOZA 1TPFA 3GZAA 2H3DA 2RDUA 2SFPA 1PIIA 1QWKA 3R12A 4Q3MA 4X0NA 3WO8A 3T07A 1O5QA 1R8LA 3K5XA 5C9WA 1S5TA 4A21A 5FSEC 4YU1A 1A5UA 1E72M 3P2VA 3W7LA 2CHOA 3AHVA