3TA6A

Structure of mycobacterium tuberculosis triosephosphate isomerase
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
255
structure length
255
Chain Sequence
RKPLIAGNWKMNLNHYEAIALVQKIAFSLPDKYYDRVDVAVIPPFTDLRSVQTLVDGDKLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAATALKHGLTPIVCIGEHLDVREAGNHVAHNIEQLRGSLAGLLAEQIGSVVIAYEPVWAIGTGRVASAADAQEVCAAIRKELASLASPRIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGGASLDGEHFATLAAIAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of Mycobacterium tuberculosis triosephosphate isomerase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 94
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ta6A00
3HGJA 3BLFA 1DKWA 1NF7A 2QF7A 3LRKA 4UMCA 5D2YA 1UUMA 1UBSA 3IEBA 4JGDA 4EF9A 2E6YA 1JULA 4LS0A 4FNUA 2CZEA 2ZRWA 3N19B 2FJKA 1RQEA 2ZQ0A 3L65A 5C54A 2FLIA 3M7WA 3HIJA 1LOQA 5T26A 1ME9A 5C2XA 3NDOA 2ISVA 4AHQA 2CWNA 3IVSA 3P62A 1LP6A 3DGRA 4NU7A 3UXAA 4N9DA 3PR2A 4P2VA 1IIGA 1GVOA 1NEYA 1W0MA 2WV8A 1MEWA 2QCCA 3N14A 5HUOA 4U28A 3TXVA 3TE9A 3QSRA 5DLCA 3DFQA 3W86A 3STGA 3TFCA 3CB8A 4LV4A 2E5BA 2RDWA 4PA8A 2F7FA 2H3DA 3PS7A 2FPTA 3TJXA 1SFLA 2WSYA 5BNKA 1BKSA 3FOKA 4Y96A 4NNBA 4DBDA 3HMJG 2QAFA 2NX1A 1RVGA 1X1OA 1VCGA 1GT8A 3P8IA 8TIMA 2ZZ1A 3CIXA 4K7YA 1ZENA 3HGSA 3EXSA 3TA6A 1N55A 2A7PA 3N2XA 3NPUA 2VEIA 3WJYA 4AHOA 1EA0A 3WK0A 4GUIA 4BWLC 2ZZ2A 3B4UA 1I2RA 3SZ8A 3L21A 2DJLA 3W88A 5CSSA 3P5ZA 5G4EA 1ALDA 5KZEA 1T8XA 2ZRYA 5CPOA 2TPSA 2YFNA 2ZA1A 2DZVA 2VENA 1EEPA 3MMTA 5DXXA 5E93A 1VQTA 1G67A 3LLDA 3W7KA 4S2CA 3W2UA 5U7SA 1LCOA 2NLIA 4UTTC 1TREA 2DZSA 3I65A 2BWGA 3T40A 2X1UA 3IV3A 2FB3A 1QPNA 3TSBA 2GQ9A 3IGXA 3QRHA 1YPIA 1J5TA 1VLWA 5DXYA 1V7YA 3TUUA 5LNSA 5I3IA 3EX4A 3MYOA 3JRKA 1FCUA 1E51A 4DF0A 1ME7A 4R7JA 3S5YA 1YTEA 4A2SA 1UASA 3DFOA 4I7WA 1YXYA 2QCEA 2G97A 2OZ0A 1OFOA 3FEMA 1R46A 2TRSA 3ZR4A 3PULA 4M7SA 4HHPA 3GNDA 5AOUA 3EWXA 1FY6A 2A85A 2NZLA 3GB6A 3FYOA 3G8EA 4LRSA 1RQHA 1QMLA 1FQ0A 1ZAHA 3B0UX 1XCFA 2WO5A 1IF2A 3GK0A 3NQ6A 4IOTA 4EVZA 4EOUA 2Q8LA 1YDOA 2GVLA 2FTPA 3PG8A 4R33A 4POCA 1WXJA 1TPFA 1MEIA 2DZTA 5D09A 4PTNA 2G95A 3BLIA 5D2WA 5CPNA 2YCEA 3SGZA 5FEZA 1GVQA 3Q58A 3O8AA 1DBTA 4XKYA 3OIXA 3UWZA 4UTMA 3IIOA 1Y0EA 3M5VA 1SO5A 4O12A 1I8JA 1ZALA 3LHZA 1OF8A 3CT7A 3NQCA 3GZ3A 2E6FA 3CLMA 3QYQA 3TR2A 1WYIA 3PB2A 3L68A 1XUUA 2X2GA 3N34A 1VH7A 2DZPA 4IJBA 3BGJA 3EX6A 2FQIA 3L5LA 1PCWA 3DZ1A 1QO5A 4NNCA 3B03A 1LZOA 4N6FA 2BSLA 3GDRA 2VKZG 3BW3A 1YLVA 1WBHA 4M6PA 3H55A 3LV5A 1OX6A 1DV7A 1KM2A 2V5LA 2Z6JA 3TCEA 5F4XA 1W5QA 1H7RA 4QISA 5AHEA 1EWDA 3K30A 4OQVA 4RXFA 4O0KA 3G1YA 1LBLA 3A5FA 4O1AA 4KFOA 1JCLA 3TIMA 3N73A 1OFAA 3S1XA 4JTFA 3L0GA 4NXKA 3ATZA 3DFSA 4LVDA 4ZVJA 3N3MA 2QEZA 1RZMA 4JYEA 3TK7A 2P0OA 2V81A 4K6AA 2WSQA 3RMJA 2HSAA 3O6YX 1OX4A 2FIQA 2D73A 1W37A 4UUIA 2C13A 3W2NA 4JICA 4IXHA 1QPRA 3C6CA 4JTGA 3W3OA 4BI6A 1TPEA 2I1OA 4NXSA 4UR7A 3Q37A 4MY9A 5FF0A 3BLEA 5FESA 4QM1A 3O6CA 4TO8A 4RR4A 5IM51 3PBWA 5D30A 3LCLA 4P61A 3UPBA 4JN6A 1W5OA 2Z0IA 2ZBTA 3OVQA 4Z1BA 1WOBA 3BGGA 2GOUA 4WD0A 4QNWA 4O14A 1QPOA 4FNRA 5LSMA 3SSJA 1YYAA 3OVPA 2XN1A 3FKRA 2GJLA 4XZ9A 3DXIA 1B4KA 5CKSA 4K8EA 4QITA 2A1YA 1LRTA 1H5YA 1G7UA 5DCDA 2GVJA 3D0CA 3W85A 6TIMA 1F7BA 3NR0A 3NYZA 3R13A 2CLIA 3B06A 1FCBA 2Y88A 4J9JA 4CCDA 1M7PA 3NL6A 5K9XA 1H63A 4FO4A 4XBSA 5EMUA 3LTYA 1XBVA 4OT7A 3ELFA 5I3JA 3L66A 3EKZA 1JCXA 4CNNA 3QEZA 3P67A 3AO0A 5F4SA 4JDBA 1BTMA 4CCEA 4AXKA 5C6MA 2YW4A 1TRIA 3GDLA 4GFSA 4PL1A 4YXGA 4UTUA 4HT3A 4N9CA 2V30A 1VC4A 2NXIA 3QFEA 4DPPA 2FPVA 2ZCGA 5DBUA 3G0SA 4IUOA 3QPYA 1FXQA 3C2OA 2QJIA 1RQBA 3TMQA 1TSIA 3M1ZA 2IQTA 3S9YA 4JX5A 1TPUA 4MZYA 2V5BA 1L6YA 3RNDA 1L9WA 1FCQA 3PC0A 3CWNA 1TTQA 1YXCA 1P1XA 3T7VA 1PE1A 4GUHA 3MUXA 3W1RA 5KMYA 3QH2A 1UJPA 2EAWA 4O54A 1KFBA 3EKLA 2QCGA 3GXTA 1OYAA 3FS2A 3B8DA 3BG5A 3RLUA 3GXPA 1P0NA 3W84A 4MZ1A 1TV5A 2NXHA 4MIMA 2DORA 2C15A 4WY0A 3UWYA 1TTPA 2TMDA 2FB2A 1LYXA 1OHLA 1JCJA 1KM4A 3P60A 3U6WA 5CZSA 4MLJA 1OF6A 2ZZ4A 2R94A 3C0JA 4UMAA 1AL8A 1N8FA 3A23A 5DY2A 3U2OA 1GWJA 2DP3A 1LM1A 4ONVA 1D9EA 1DHPA 1JVNA 1JR1A 1TYGA 3QW4B 4KFPA 4O4WA 4M5PA 1D3HA 5CZ0A 4A29A 1Q45A 1JJKA 5LGXA 4NUWA 3IVUA 4ZL1A 1FWRA 1GVRA 5FF7A 1RD5A 1G4EA 5BRBA 5TBOA 2QDHA 1SQ7A 2GVGA 4KFNA 3R12A 2P10A 5HULA 1H60A 4O1BA 1I2QA 3WK1A 5CGQA 1FDJA 3L9CA 3VKJA 3W07A 1EUNA 2ZZ5A 1LROA 3LI1A 3W70A 5FF4A 1L6WA 4QJ1A 1JCYA 1TQJA 2JGYA 5KSWA 4LC6A 2PRHA 3HGRA 4LTSA 4H3DA 2E6DA 2HS6A 3QZEA 4O19A 2YYUA 4JIQA 4O18A 1PV8A 1TPC1 1KW1A 1EPXA 1OVDA 3S1UA 1H7OA 3JR2A 1WV2A 1SR9A 2I14A 3A9IA 1QFEA 3NQAA 1GG1A 2CLLA 5BMXA 3W75A 3O05A 3B05A 1PHQA 5EKYA 2B7QA 3RLVA 1QDSA 3B04A 5HWNA 1PS9A 2A6LA 1XUZA 4NVTA 5CZTA 5E1QA 1W1ZA 2HMCA 1KFKA 1DVJA 3DBPA 3W7IA 2A5HA 3BPWA 4UR8A 1KV8A 5A5WA 2DZWA 2A0NA 3UWWA 1WBJA 1DJQA 4CLMA 4ZZ9A 5AHLA 5EA9A 3R2GA 4YL2A 1D3GA 3NQ8A 3W1TA 5J5RA 2Y6ZA 5EY5A 2NV2A 3P5YA 1G4TA 3TAKA 1W5MA 2VOMA 4TU1A 1OK6A 4LOCA 3LHVA 5LHEA 3E02A 2RDUA 3TDFA 1TV8A 1K8XA 4Y9AA 2V9DA 1WOAA 3NO5A 2V8ZA 3NM1A 4WZHA 3A21A 2NUXA 4A22A 4K37A 3G1XA 4GUFA 4RV8A 2QUUA 3PG9A 4LU0A 4NX5A 1UB3A 1M6JA 5LNWA 4N02A 3G22A 3HB9A 2NX3A 3MWAA 1WA3A 1H7WA 4IPJA 4TX9A 2A2IA 1KFEA 2A6NA 2NWRA 5F1VA 3W1QA 1P5BA 5K4ZA 4LS2A 1GYNA 1GZGA 1QWGA 1ML1A 1VJIA 4K38A 3W23A 4GWEA 3M41A 4GBUA 3CQ0A 3Q2DA 3E9AA 2Y7EA 4NNAA 4DO6A 3NPVA 1KTCA 3C2FA 3AJXA 1KM3A 3W7LA 2YXGA 3GX9A 3M0ZA 1G6CA 2CLHA 2VFIA 3CHVA 5CZJA 2E5DA 4RZ6A 1FWSA 1W8SA 3DFPA 1QOPA 3HPXA 2C0AA 5FF3A 5BOOA 3FJ6A 3W7OA 3GKAA 4OE7A 1JUEA 1GJPA 1O4UA 4FNQA 3W87A 4AHPA 1SW3A 5D02A 3LB0A 4BI7A 2X1RA 2NX9A 5AFDA 2DU2A 3NQ2A 3MHGA 1H7NA 3TQ0A 1C29A 4LW7A 3CWOX 2G5WA 3LGEA 2C16A 4LNYA 1F6KA 3TC7A 4LC8A 2QUVA 3KFTA 1SSDA 3EWUA 5AHMA 5DY3A 4FF7A 2X16A 5D37A 2J88A 2CLFA 4IXXA 2Y61A 3E0IA 3W1XA 4MY1A 1GOXA 5KITA 1TTIA 3TXZA 1FUYA 2V2CA 4LVAA 3GAYA 4NT0A 3T44A 4IMCA 4AWUA 4ZQNA 1X8FA 2FFCA 1TIMA 3HG3A 4DEFA 3C52A 4IGHA 1U5JA 3PB0A 1G4PA 1OFEA 4OHQA 2CU0A 1FCVA 3LCGA 4FB7A 4R34A 1B3OA 1CI1A 4Z0JA 5K7JA 5F2GA 3LXBA 2DJXA 3SECA 4JY8A 5HNRA 1F05A 4PFMA 4UFKA 2OMAA 4C1LA 1DOSA 1SZFA 1XXXA 3G18A 4JTSA 3OVRA 3LRLA 4N2YA 1S5WA 2Y7GA 3EWZA 3FLUA 4FHAA 1VS1A 3R89A 3ZS4A 2C19A 4O57A 4ADSA 1W5PA 3ABSA 3I68A 3KX6A 2J9ZA 2V2HA 4I7UA 4K36A 1SO3A 3W2MA 1W3TA 1H1YA 1S5TA 3N9SA 4BFAA 2EKCA 5MHBA 4MYXA 3PY2A 3DHDA 5U4NA 4N9BA 3KVKA 3TQKA 4HN4A 5G2WA 3IIPA 1ICPA 4O13A 4GXMA 5EYWA 3EWBX 5I3KA 1TV7A 1G69A 3R8RA 3MJYA 1THFD 2OT0A 2X1SA 3QJAA 3NQVA 4UTKA 3WJZA 1OK4A 1K7FA 1SO6A 2YFOA 4DXVA 4NJHA 5C5YA 4LVGA 1XL9A 2ISWA 3GDTA 2F84A 3G1FA 2ZFAA 2ZRXA 3SIZA 3UWUA 3NZ1A 3EEGA 1XM3A 3NL3A 4DELA 4A3UA 3M44A 5AC6A 1ICSA 1QCWA 5HWJA 4X3ZA 4GUJA 1IXNA 5F2MA 1X1ZA 5DCEA 1WDWA 2O7QA 3RF9A 3IRDA 1ZAIA 4EWND 3QMTA 3R5EA 3KXQA 5K2ZA 4AB4A 5ABTA 2J6XA 2H8XA 1UCWA 5DCBA 4H4IA 4XTIA 3CC1A 2Y89A 2WSRA 3IGUA 5CPLA 2Y62A 3IIXA 3LCHA 4E0CA 1GQNA 3TAOA 3SY5A 3NM3A 1LBFA 1WAUA 1Q3NA 1XBZA 2YYTA 1KLYA 2OT1A 3OA3A 3CIWA 2EF9A 1LOLA 1MZHA 4E2BA 3NEVA 2JK2A 3LCFA 1K02A 4XQ6A 1LORA 5K9CA 1TPWA 1YPFA 4AMAA 2VFDA 4FNPA 1YADA 5HWMA 1VYRA 3NQMA 1R47A 1HG3A 4K7VA 3LI0A 3STCA 4AVFA 4UIOA 4FXRA 3MYPA 4M7TA 3M5YA 4FX8A 2PE4A 4NQ1A 4RJEA 5D32A 2AGKA 4Q4KA 4UCGA 2CLMA 4HSNA 1KFCA 3TFXA 1PL9A 3BO9A 5AYXA 4XTDA 3TKFA 3NL5A 1LLWA 4FXSA 5CPMA 1F6PA 2Y85A 3BG9A 2PURA 3O06A 2J27A 3I7QA 1LOSA 3LHYA 1O95A 3C2EA 2A7RA 1ONRA 2NV1A 3HPZA 3C61A 3MW7A 4O53A 2PRLA 4CNPA 1OFPA 4TMBA 1HUVA 1NFBA 3ATYA 1VR6A 3KRZA 3GIYA 3QPZA 4JY9A 1KM6A 4ZQCA 3S5OA 1VZWA 3VCRA 3LCIA 2VEPA 3QQ0A 3S6DA 1XKYA 5G1TA 1M7OA 1NF0A 2W79A 1ZCOA 1SU5A 1SZNA 2VELA 1H62A 1K8ZA 4LUIA 3V1PA 3W1LA 5LHFA 5F2IA 3NXFA 2ZZ7A 3ANYA 3NG3A 4RCXA 1ZNNA 3E96A 1WX0A 1W56A 3C56A 1O94A 4HIBA 4ORIA 3GXNA 1F73A 1KM0A 1FDZA 3P74A 1XC4A 5D05A 3CTLA 3O1NA 3HGOA 3GVGA 1GVSA 1X7FA 1TJPA 3FIGA 3CPRA 5D2TA 1G7VA 4IPIA 2QJGA 1KFJA 3MI2A 2NUYA 1OFQA 3BW4A 4OV9A 1I2OA 1UUOA 1LBMA 2JKPA 2Y70A 3M43A 5EBUA 4Q33A 4ZQRA 3W2LA 4M6QA 2Z1BA 1X6UA 5I3HA 1TPDA 3UYCA 3ZWTA 3LCXA 3DH7A 4N9EA 2EPHA 2CLEA 3CU2A 2B7OA 4U4MA 4DF1A 3SW6A 5TQLA 1LDCA 3KRUA 3V75A 4JTUA 3SFKA 4UTTA 4UTWC 1CX9A 1S3HA 1F76A 3I7SA 4ADTA 3RFAA 5I3FA 3SJ3A 4MLRA 4O10A 5K3VA 4LV9A 2QJHA 1J2WA 1TPB1 3RU6A 3PSWA 1KM1A 1W54A 2JGQA 1JCNA 5HJLA 4DO5A 3M5ZA 4NJJA 3UZJA 2RH9A 3LERA 4KWVA 3GNNA 1OABA 5G5IA 2V2DA 4TMCA 3NL2A 5HUPA 3VNDA 3W73A 4R53A 2H8ZA 4H6KA 1TQXA 1DQWA 3NQGA 4LWWA 3W7NA 3KVMA 3WK3A 3I7RA 4NJGA 4DF2A 1I2NA 2H6RA 3ABRA 4FIRA 2YGYA 4JR5A 5AN7A 1OFDA 3P84A 3P7YA 4YWIA 4WOZA 2VXNA 2OJPA 4UFHA 2QCMA 2WJZA 1KA9F 4OBTA 5LKYA 2G96A 4MFEA 1F2JA 1MSSA 1K3UA 1OYCA 3W7HA 4NJIA 3NQ7A 4MJZA 3T4CA 1JRCA 1B9BA 1QAPA 4MYAA 3FYPA 2YSWA 1SSGA 3DU0A 4QIUA 2WOQA 4BWLA 3EB2A 5IBXA 1T0OA 2QCHA 2VEKA 4RZ4A 3LHTA 3G3DA 1IXQA 1PCKA 5DBTA 5D2VA 3G1SA 4K8HA 4O1CA 5G2HA 1ZY9A 4IQLA 4MPQA 5AC8A 1A50A 4IMGA 4A21A 3ABQA 4DBEA 2JKEA 3DKJA 2ZRZA 1F5ZA 3P80A 2X1TA 2WNZA 3G0XA 4E2DA 3CEPA 3UNDA 3S5ZA 4LVFA 1K03A 6ALDA 4LRTA 4MVAA 1C8VA 4XBKA 2BX7A 2V0TA 4O1DA 2A21A 1AW1A 3JS3A 2RKXA 7TIMA 3VFLA 4G1KA 1XBXA 1VHCA 4JEQA 4UNKA 5KZMA 5FF2A 3W9ZA 4JIPA 3E49A 4I9AA 3W7RA 1SW7A 3W6YA 2VFEA 4IX0A 3QMRA 4JTKA 1AG1O 3KHJA 3M47A 3NQEA 3IVTA 2ZDRA 1SUXA 4IMFA 4LY8A 1TRDA 3DAQA 4EF8A 3BW2A 3LV6A 2Y7FA 1ICQA 2C18A 2Z6IA 4DQWA 3NQDA 1SFJA 1FXPA 1IIHA 1W5NA 4PEKA 3B0PA 4ZQPA 1MXSA 5G2IA 5LZLA 2H3BA 1W31A 4NZFA 3UD6A 2YZRA 4UFIA 2Z2UA 1S5VA 4CNOA 4A2RA 3SGUA 3PUDA 1T99A 4UTJA 2DZXA 5AHFA 3W7EA 3W7GA 1R30A 1Q6RA 3HG2A 3TNOA 3GAKA 3LBCA 2TYSA 1K7EA 2QAPA 1OJXA 1R2RA 2YR1A 2V82A 5AYYA 2YDAA 1EB3A 3NVTA 4WX2A 1T96A 2J9XA 2YPIA 3L2IA 5H2ZA 2UV8G 3FJLA 4AEOA 4RLIA 3MI6A 1JQVA 3W1UA 4YCPA 4BR1A 4AH7A 3TQVA 5AC7A 2R91A 3NAVA 3W72A 2BXVA 1O5XA 1B57A 4HKPA 1OX5A 3GR8A 4UTWA 1XFBA 3USBA 1H61A 2J24A 4WXZA 5KZDA 3DFNA 4IX2A 3THAA 4O52A 2FPYA 4MUZA 4PC8A 3OHIA 3C3NA 2QUTA 2ZA3A 1EIXA 4CQ9A 3CM4A 3NNTA 2XFWA 1SO4A 3G0UA 3QF0A 3W1PA 3W1MA 3O6DA 4WOQA 3TW7A 1VHNA 2CW6A 3EXRA 1XI3A 1YTDA 3W7MA 3O16A 2ABBA 2CFFA 5K4XA 1OG0A 4LT9A 4IWWA 4M19A 4XKYB 3LHUA 1CW2A 4O17A 2ZZ6A 4PH6A 1TO3A 1TPH1 2GPTA 2B4GA 3C2VA 3QC3A 1PHWA 3LTSA 3LXCA 3L5MA 5G4WA 1KFLA 2OX1A 3HO8A 1YXDA 4UTIA 2Y63A 1TMHA 2ZTJA 4BI5A 1JCMP 5I3GA 3W2JA 3MP3A 5A8GA 4HPXA 1A5SA 2LLEA 3F4NA 2NWSA 3WJXA 4JYFA 4BK9A 4Z0SA 1M5WA 5FI8A 2WNQA 4AF0B 4UNLA 3STEA 3P81A 4OV4A 1QO2A 4PL2A 4BF9A 5D2XA 1HL2A 4MOZA 4JX4A 4WY0F 2PC4A 3T78A 1JUKA 2J9YA 1NVMA 4FNSA 4ZQOA 2QR6A 2CZ5A 2CZFA 1WQ5A 3FA5A 1O5KA 3C2RA 4O15A 2FDSA 4HPJA 4PODA 3T55A 2ZZ3A 3FFSA 3BV4A 2ATMA 1RR2A 3GLCA 3UY7A 4GC4A 2GQAA 3G1DA 4JTJA 4XUGA 4QSHA 2QCFA 1DJNA 4GE8A 3DI1A 2CLKA 5HINA 1ADOA 2W0UA 2E1DA 4UFJA 4RX0A 3C8FA 4Y8FA 5L9FA 3L0NA 3MBDA 2E5CA 3LTPA 4FIQA 2XN0A 1DORA 3B0VC 4UTHA 4TIMA 3GYEA 4N4QA 4JTLA 2PRMA 3OBKA 4FX7A 3TSMA 4RZ5A 1NSJA 4UC5A 5DN1A 2ATSA 4WXYA 3MP5A 1LRQA 3TMLA 4QAIA 3P8JA 2EHHA 2GUUA 3DHFA 3WK2A 4B5NA 4KKXA 1VYSX 1KLZA 3W7QA 3M5XA 4NZJA 5IBXC 5AYZA 4UTLA 4YLWA 5J5DA 3MI3A 4N4PA 2E68A 2QDGA 3A24A 4ZQMA 5FEWA 2AQWA 1ME8A 2JBMA 1FWTA 4DO4A 3HPSA 1A5CA 4O28A 1IXPA 1QNVA 1TTJA 1VCVA 3TW6A 2WNNA 3O63A 3RK8A 1YTKA 2WKJA 5HR7A 3QMSA 3W7JA 3S42A 2PCQA 4MFDA 1C9DA 5K9DA 3DFTA 2AAMA 1Z42A 4EIVA 4HNNA 3PBUA 3UXDA 2GJNA 1J4EA 1KBJA 1L2UA 4Z1DA 3WJWA 2P1FA 4AF0A 1A53A 1EUAA 2WPBA 3LDVA 3M6YA 3OEXA 4WQ6A 5CG7A 1AL7A 3MP4A 5FEXA 1H1ZA 4UFMA 4CQAA 4PCFA 1Z44A 3EWWA 3KVLA 4JXCA 5D33A 3U8GA 4GRSA 5CSRA 1FBAA 2ZRUA 5GVJA 3QSTA 2E09A 4WJEA 3L0KA 1KM5A 3TSDA 1MEHA 4JTEA 1BWLA 3G1AA 1KTNA 4X2RA 1L6SA 2NUWA 2NXGA 1W3NA 1TPVA 3UZ5A 1ZFJA 1G4SA 1SW0A 4OGZA 1QR7A 1K7XA 1I4NA 1RV8A 1KV5A 3CEUA 3H54A 3HG4A 2EGZA 2JKAA 2QCDA 3BG3A 5BMWA 1AW5A 3HF3A 1R2SA 3VE9A 4Q32A 4O50A 4GUGA 3W2KA 1HTIA 3QQ1A 3HQ1A 1EX5A 4D2JA 3W74A 1OX4B 1RPXA 2A4AA 3LX9A 2VFGA 4X22A 1SZEA 2RHGA 3INPA 3G8RA 3I6RA 3LM7A 3PWAA 2B7PA 1SZGA 4L4LA 4C1KA 2Q8ZA 3THQA 4CQ8A 3F1QA 3TJLA 3P61A 2B0MA 2OCZA 1Q6LA 3KVJA 4Z1AA 3TX9A 5FEPA 1GTHA 1HO1A 1MO0A 3IIVA 5G1YA 5LNVA 3A5VA 4N6EA 2VFFA 2QCLA 3GDMA 1LTDA 2B7NA 3LXAA 1PIIA 1V5XA 1XBYA 1FX6A 5LNUA 4JS3A 2ZYFA 4CCCA 3GKFA 4RKAA 3F4WA 3PSVA 3O07A 4MZ8A 3ZFHA 5AHNA 1VGAA 2WQPA 1FWWA 2R14A 3W76A 5HQEA 4W9TA 3TV8A 4NX0A 3LBMA 4XWUA 3PBYA 4AWTA 4YCOA 1GTEA 3KRSA 3PF3A 4UXDA 1P4CA 3LCWA 1A5BA 3IGSA 4AAJA 3SR7A 4E38A 4JNMA 3BVJA 1GVFA 5EPDA 3OG3A 3NPWA 1VYPX 2RDTA 5EL1A 4QQ3A 3DENA 1R2TA 3FKKA 4LS1A 3W7CA 2VC6A 3TC6A 5H91A 1H7PA 2C1HA 4QNEA 2ALDA 3W1AA 1LLZA 3STFA 4JYDA 3TROA 4JDYA 3S0CA 1YDVA 3HG5A 1XDMA 3LOTA 5AHIA 5D04C 3S5NA 1BWKA 3W83A 2VFHA 1EP1A 1GYLA 1AW2A 3EXTA 4ALDA 5AB3A 1HFBA 2QCNA 4WY0B 2X30A 3KOFA 1XDLA 3P82A 1OYBA 2QCDB 3L5AA 1PVNA 5D03A 1AMKA 1FDYA 1VPXA 1AK5A 3UQNA 1H50A 3UY8A 1QOQA 3W71A 4JTIA 4HSOA 4TR9A 4YMZA 1EP3A 5HR6A 4LUJA 2BZNA 5DELA 4X9SA 2HS8A 5HMSA 1GEQA 3VE7A 3BK0A 3UPWA 1Z41A 3PUEA 3F03K 4ORMA 3O15A 2XN2A 3G3MA 2BLEA 3ZWSA 4GNJA 1ZAJA 4S2BA 2Y7DA 2ZTKA 4UMBA 1EWEA 4AWSA 3QW3A 1IXOA 3NA8A 1JQXA 1ZHAA 2O7SA 4MKNA 5LGZA 3WFAA 1JRBA 3A22A 1H51A 3PBVA 1W3IA 3PUOA 2W6RA 1KTBA 4K39A 1OFBA 3TU9A 2A7NA 4Z1CA 4ML9A 3NOEA 1Z48A 1O60A 4IMDA 4O4VA 2HTMA 3NQFA 2R8WA 3DKLA 3PVFA 2E6AA 4O16A 4HNUA 2Q3OA 3N2MA 1P0KA 1A5AA 1YDNA 4ADUA 1TJRA 2QKFA 3GDKA 3W7DA 3KAOA 4O8RA 4ZMGA 2ZRVA 3EX3A 4Y6GA 1HO4A 4HNTA 5SWUA 3E12A 5E0KA 3GR7A 4RXGA 3HJZA 5C55A 1TB3A 1OFRA 3G1VA 1BEUA 3C4UA 4IMEA 2YW3A 3DI0A 3EWYA 3BARA 1B4EA 3PAJA 4M6VA 2RFGA 4O0ZA 3NZRA 5KINA 1GG0A 3QM3A 3UWQA 1DL3A 4MJMA 1U83A 2GQ8A 5LNRA 3M9YA 2DZUA 2C6QA 3MBFA 1Q6QA 3YPIA 1VCFA 3H53A 3MO7A 2BTMA 2ISSA 5D38A 4Z08A 3UWVA 2ABAA 4WUIA 3G1HA 3EX1A 3W7PA 3S8HA 1FWNA 3G24A 1ZJIA 2VEMA 1VRDA 5TIMA 4HNVA 4LVBA 4O11A 3NGJA 1QPQA 4NJKA 4Y90A 1Q6OA 3WJSA 4RK8A 3LLFA 1I2PA 2KZHA 4JTHA 1TCDA 1K8YA 2CZDA 2ZA2A 1SPQA 4DPQA 3HBLA 1EP2A 1DQXA 4FX6M 3S1WA 3PM6A 4L4MA 4S1FA 2Q3RA 2E77A 4KWWA 1NAL1 3W22A 3Q94A 4OU1A 3W1NA 4FEZA 1F74A 3L67A 4JTTA 3LRMA 4OWGA 5F2LA 3M16A 5BW6A 5L6UA 5F1UA 2CLOA 4JD4A 3SI9A 5F4WA 1N7KA 1VLIA 2C3ZA 1I45A 4MY8A 3MHFA 3VI2A 3EX2A 3HOJA 1KBIA 2YX0A 1IGSA 3IIZA 4JX6A 2H90A 1H7XA 3MHUA 5KTLA 3TH6A 3N9RA 3S1VA 1GPWA 4FNTA 3NPXA 3ABOA 2TSYA 3LHWA 4I7VA 4UFLA 1JUBA 1LRNA 2C14A 4ICNA 4GJ1A 2I9EA
chains in the Genus database with same CATH superfamily
3TA9A 3UZZA 2QF7A 2CKSA 4JZ5A 3I4EA 1JULA 4LS0A 3M0KA 2CZEA 2XISA 3P14A 4EXQA 2FJKA 3L65A 3HIJA 1QU4A 1R0MA 3NDOA 5FJPA 4AHQA 1AQFA 2CPUA 2CWNA 4NU7A 1JZ4A 2VCAA 4N9DA 4C6NA 3DBNA 4XO7A 4LUTB 5E09A 1MDLA 1GVOA 2HCVA 1DIEA 1YE4A 4XAGA 1W0MA 4NYYA 4AD0A 5HUOA 2ZVIA 3QSRA 3DFQA 3STGA 4CVWA 1IZKA 1BYCA 3BOXA 4PA8A 1UMLA 4ZCWA 1VJZA 3O3RA 3TJXA 3AALA 4Z2LA 4Q22A 4GXWA 1WAWA 4Y96A 2QAFA 5JQ9A 2PBOA 4NRRA 3A4AA 1PX3A 4LX4A 1J12A 2OYKA 4AZCA 1ZENA 3V5OA 4XZHA 2VEIA 3PTDA 2YL8A 2FKPA 1WXZA 1ONXA 3B4UA 2V63A 3SQMA 1I2RA 3SZ8A 5CSSA 3PBGA 3ITLA 1ONWA 3P5ZA 1GJWA 4BEUA 5KZEA 4OOUA 3GIQA 5H8UA 4IJCA 3GNRA 1KC7A 2C1IA 1S39A 3G6MA 1IT0A 5DXXA 4A8NA 3PWGA 3LLDA 2QIIA 4QP0A 3B8UA 4D6CA 1V3IA 1LCOA 2NLIA 3UT0A 3LU2A 5GJPA 3W37A 2DZSA 3I65A 2XIMA 3BURA 2BWGA 4XD5A 2X1UA 1QASA 5HBFA 1CGWA 5LA2A 4U31A 2WMJA 2HISA 4NKCA 1GOMA 3TUUA 2QDDA 5CAKA 2RGMA 3KW3A 2VHLA 5ENLA 3EX4A 1WPCA 4Q6XA 1S2AA 4D8AA 2BOEX 4DF0A 3L4XA 3S5YA 5DQPA 1UASA 1F3XA 1ISVA 2QPSA 2ZX5A 4MB5A 4OVXA 4ATLA 2TRSA 4XVEA 3PULA 3ZYZA 1E3XA 1CGTA 1SJDA 4HCLA 5AOUA 3LG3A 5DMMA 4HHMA 1FY6A 4HK6A 2NZLA 2XFYA 3GB6A 3W6LA 5ABHA 4LRSA 3B0UX 1F9CA 1XCFA 2WO5A 3NQ6A 2Q8LA 1XLJA 3AOFA 1H41A 1MEIA 3OZYA 2G95A 2PU1A 5CPNA 4DWSB 2YCEA 1QI0A 2V5DA 2WMIB 4GYFA 3K13A 2VQTA 3MV11 1XGDA 3OIXA 5C70A 4UTMA 3KTCA 3RX2A 5FAJA 3M5VA 2QXWA 5A8OA 3KDOA 1I8JA 3LHZA 2E28A 3CT7A 3NQCA 7TAAA 2E6FA 1UWAA 1R3RA 3LQGA 5I5RA 3PB2A 3R4IA 4IJBA 1YPXA 3L5LA 3DZ1A 3K8LA 1OBAA 4YTTA 4FAMA 4DJFC 1JYXA 3BW3A 2QV5A 1WBHA 4I3GA 5CSYA 1R7OA 2BVYA 3V18A 2ZX9A 3EEZA 1KM2A 3F2DA 3NSNA 1EO5A 2Z6JA 2EJAA 4WLCA 5F4XA 1W5QA 4AQLA 3NSXA 4OQVA 1OCQA 3CS2A 3GXDA 4O0KA 1VFTA 4EAYA 1W32A 4AD3A 1ZGDA 1JCLA 3TIMA 3EBVA 2HBXA 4Y2WA 4C6MA 3L0GA 3WCZA 3DFSA 3SCSA 2QEZA 4JYEA 2GK1B 1PWMA 2P0OA 1U1JA 1TJ0A 1QW7A 2O4QA 7PTDA 1DIDA 2D73A 4YJ5A 3TTOA 4UUIA 4IXHA 2E25A 4I9JA 1TPEA 2XFRA 5CC6A 1DE5A 3BTNA 3E0FA 1CXLA 4ROQA 2JF6A 1MFUA 5FESA 1W1IE 3O6CA 2Q6ZA 2FZBA 4RR4A 5IM51 3PBWA 5A6SA 3WQCA 4JN6A 2ZBTA 2MANA 1QPOA 1RY0A 3CO8A 4I5XA 3FKRA 1UR4A 1SJBA 2FMOA 3TYBA 3SURA 2X41A 1H5YA 3D0CA 6TIMA 1F7BA 3RITA 1V6YA 4H9ZA 2UY2A 1FCBA 4BQ2A 3NXLA 1M7JA 2J7HA 5A94A 3FYYA 3EKZA 2NQLA 1JCXA 2PGFA 4CNNA 1J01A 3AO0A 3VMOA 4GYKA 1QW9A 4XIMA 1PZ3A 3KL0A 4F9JA 2YW4A 1OQFA 4C65A 1H49A 1GOWA 4DPPA 3QPEA 4IUOA 1FXQA 5TD4A 2QJIA 3UR5A 3TMQA 1TSIA 1DJGA 4W4QA 2WJEA 2V5BA 1YXCA 1PE1A 2GSEA 4P7LA 4B5XA 4DZ5A 3VUPA 3EOEA 3UJFA 1KFBA 3EKLA 3RJYA 4FLOA 1W9DM 4LYPA 1FWHC 3FS2A 1X8CA 1P6CA 4D6JA 3AHTA 4PRTA 2OG9A 3MQTA 1XIMA 1ZJBA 2F2HA 3GXPA 2YLAA 1TV5A 3SCOA 4J35A 1TTPA 1FA2A 3H24A 1LYXA 4D6FA 2VX5A 1JG9A 3U6WA 3W02A 1OF6A 3LPFA 3A23A 1UWSA 5DY2A 2I56A 1FWBC 1HXJA 1DHPA 4NYUA 2G37A 2IS7A 3QW4B 1FH7A 3WLNA 2POTA 3MSGA 1Q45A 1JJKA 3SM0A 4L61A 3IVUA 1FWRA 4YYCA 1E3ZA 1ONEA 2JQXA 2IQDA 4CD5A 3MSRA 3T4WA 4IJRA 4DXXA 2VCBA 4H6QA 4GVGA 1IE7C 2P10A 1PTDA 1LQAA 4O1BA 3WK1A 1FDJA 2PTZA 2ZZ5A 1LROA 3WLMA 4HOXA 3DUGA 3A3XA 4QJ1A 4UNIA 2VX7A 3ARQA 5CQ1A 3DESA 2ZKMX 2BV9A 1BVNP 4QE5A 4AD2A 4L1GA 4IIHA 2AAAA 3UW6A 5LIKX 2E6DA 2HS6A 1DXFA 3VC5A 4BF5A 2YYUA 1OVDA 4P7RA 2BXZA 1FKXA 1SR9A 4QS6A 2VJXA 1JD7A 2OQHA 4N42A 1XUZA 5CC3A 1B1YA 2FH8A 4NZ5A 1XW8A 2I16A 1DVJA 3DBPA 1TG7A 3BPWA 4UR8A 1MNSA 5AHLA 1XX1A 1ECEA 5J04A 5J5RA 4JIEA 5EY5A 2NV2A 2RJHA 3P5YA 5FD0A 3WD3A 1TV3A 3GE7A 4GGBA 2P8BA 5LHEA 4US5D 5HMFA 1TV8A 3T2OA 1W2PA 3S1GA 1WOAA 2DQWA 3NZGA 4GY0A 4JHOA 4YTSA 4Z42C 4A22A 2BOFX 1IT7A 4KETA 1KBBA 5EFDA 3CGTA 3WDIA 1UB3A 1J8VA 5LNWA 4N02A 4Z2HA 3CAKA 4PUDA 4PTVA 3KM8A 3MWAA 5IXEA 1H7WA 4IPJA 2DUAA 3D3AA 1KFEA 5F1VA 1P5BA 5K4ZA 3DN5A 5ABGA 4DHGA 1GZGA 1QWGA 3THDA 2XZ9A 4KWSA 3CQ0A 3Q2DA 3UZYA 3E9AA 3BJTA 4J3VA 4C6OA 1GK8A 1R6WA 3AS1A 3C2FA 4IICA 4B90A 3AJXA 1XQKA 3TLQA 1XLEA 1KM3A 3P2VA 1V6WA 2YXGA 4GXPA 2VP8A 3B3DA 5C9XA 5CZJA 3N25A 4W7UA 3WDRA 1JCTA 3N2CA 2AL1A 3PFMA 2UY3A 4OOZA 1QOPA 3M0JA 5FJOA 2C71A 2Y0FA 3SIMA 1E5JA 3NO3A 2GDQA 3VKCA 2ISDA 1SW3A 4BI7A 2CXGA 3MMWA 1QOXA 2DU2A 5AFDA 3IJLA 1QUMA 4LW7A 2G5WA 1UR9A 5DO8A 3SQSA 4FALA 1P7TB 4TVCA 4WSHA 5D37A 2CLFA 2HK1A 3QOKA 2Y61A 4C6LA 1ISZA 1P43A 3TYEA 4J1OA 1GEHA 1I0DA 3OZOA 1FUYA 3VGEA 1NM9A 4AD4A 1JIBA 4DLMA 4AWUA 4U10A 4ZQNA 3CNYA 3N18A 2FFCA 1TIMA 3HG3A 4IGHA 3CZLA 5E0FA 2AKMA 2FVLA 3CZGA 3KS6A 4MB4A 2J13A 4QGCA 3QGKC 4FB7A 1C90A 3ES7A 4NL1A 1C8XA 1GVEA 2DJXA 3LXBA 3PNUA 3IK2A 4Z2JA 3WBXA 1F05A 2GUBA 2OMAA 1VEOA 1CDGA 1PDZA 1G9HA 1XXXA 2EJ1A 2ZADA 1US3A 4HYRA 3PZOA 2Y7GA 1PUDA 1SJAA 4FHAA 5H8MA 2OGJA 3HMCA 4AZBA 3ZS4A 4KCVA 3BAYA 1PIGA 1PYMA 4O57A 4HU8A 4BY3A 3I68A 2CERA 2EG6A 4IHCA 2V2HA 4I7UA 1OIFA 4CD6A 4MDOA 1Y5WA 1S5TA 3N9SA 1VBHA 1XLLA 4AC7C 2EKCA 4F9DA 9XIMA 1UZDA 3DHDA 3KVKA 3IIPA 4GXMA 1UR0A 3ABXA 3D47A 2X1SA 2WAGA 4UTKA 2YFOA 2ZIDA 4L1XA 4GYJA 5A3HA 1XL9A 4TX6A 1DWAM 3E1F1 3W24A 2VGBA 3EEGA 3NL3A 5AC6A 5F2MA 1ECQA 2Q71A 3F7JA 5DCEA 1WDWA 2O7QA 3RF9A 4S3DA 4Q4OA 2VYOA 3P93A 3BANA 5K2ZA 3UR2A 2J7BA 1UCWA 4MNJA 3CC1A 2ZUWA 1TCMA 3IGUA 5CPLA 2Y62A 4QLKA 1IZJA 3IWPA 3TAOA 2YYTA 3R0UA 4PUNA 1B31A 4ZODA 4UB9A 1QATA 9XIAA 3NDYA 1XIBA 4XQ6A 1UD2A 1YPFA 4JKLA 4AMAA 4X61A 3TP4A 5HWMA 1IYXA 1HG3A 4AZ7A 2HJPA 4K7VA 2CEQA 4UIOA 1IHIA 4FXRA 1HKWA 1JXKA 4FX8A 2BHZA 2AGKA 1PZ0A 5I77A 1SJCA 3K5XA 4JFVA 2XVGA 1OG6A 1PL9A 2IMRA 3BO9A 3MDWA 4AEEA 3KBNA 2OOGA 4W5UA 1Q6GA 2YDRA 2ACUA 3NL5A 4HCHA 3O06A 2J27A 3CYJA 1O95A 1ONRA 4CNPA 1DWGM 4GI4A 2YIHA 1NFBA 3ATYA 1VR6A 3ABZA 3GIYA 3QPZA 1AJ2A 4CEXC 4E2OA 1XJBA 2EPMX 1EQCA 1IT8A 1FWAC 3VIGA 2Y1HA 1RCXB 2PDHA 2D3LA 3CUJA 2VEPA 2VC9A 1O66A 4H7ZA 3S6DA 1NF0A 1SZNA 3GHSA 1H62A 2PP3A 5F2IA 3NXFA 3W01A 5XINA 1VBRA 2BVTA 2XIQA 2J7DA 1KR1A 1O94A 3GXNA 4LANA 1F73A 3ITOA 2CWXA 3MCOA 5CPQA 1V77A 1V6XA 3EOLA 5D05A 3HGOA 1TVNA 4J27A 5CC5A 3E0LA 3FIGA 4UTFA 5D2TA 2BVDA 5FSEC 2QJGA 3JU2A 4X60A 1KFJA 3CK5A 1RSCA 2WW5A 3E38A 3TN4A 1DTNA 3OW1A 1PXGA 1UUOA 2JKPA 2TAAA 5EBUA 4KT2A 3A3HA 2Z1BA 5I3HA 1XIIA 3UYCA 3LCXA 3ARSA 1J10A 5AYBA 2X2YA 4DF1A 3ZXWA 2ACRA 4JTUA 2I7GA 3UXIA 1IEQA 1JAEA 4OFCA 1FVPA 3RFAA 1BF6A 2FZ8A 4J4KA 4MB1A 3SRHA 1TPB1 1W1YA 4D8ZA 3VIIA 1YE6A 2JGQA 1JCNA 5HJLA 1RP9A 4DO5A 4GC3A 3LERA 3WBEA 3MC5A 2V2DA 4TMCA 3NGFA 1M3UA 1TQXA 2ALRA 3SUUA 3WK3A 2L5HA 3I7RA 2NQHA 3ID7A 3LYEA 3HV9A 3VD7A 4S3JA 4ZR8A 1PKLA 2OLAA 5TNVA 3P7YA 4WOZA 3SFWA 4UFHA 4L7ZA 1XLFA 4OBTA 4NZ3A 1F2JA 4UOZA 1UIPA 3NQ7A 5PTDA 1MMFA 2PDNA 4MJ2A 1UOKA 4UWMA 3K2GA 3EB2A 1T0OA 2QCHA 1AUSL 3EKGA 2HPMA 3W26A 5FACA 5G2HA 4MPQA 1GQIA 3STPA 4IMGA 4A21A 3WMCA 4DBEA 1V3MA 2JKEA 5AZ1A 2ZRZA 1J2BA 3P80A 1JDCA 2X1TA 2WNZA 5JIWA 4H19A 2ADAA 3S5ZA 1S2TA 2NT1A 4MAVA 4Q8MA 4XBKA 1AW1A 3JS3A 3VFLA 3WLTA 4EKJA 3H2EA 1VHCA 2F61A 3PK7A 1JXJA 3RU8X 4LALA 3IJ8A 3PTQA 1HP5A 4IMAA 2HXUA 3W7RA 1SW7A 3W6YA 3VKBA 4IX0A 3QMRA 2QJNA 4IP4A 1OCBA 1PO9A 2Z2AA 1GKQA 4V2XA 4H7CA 3NQEA 1OCJA 3CTTA 3F2CA 2ASHA 4C90A 1XLCA 3AUOA 5LZLA 4CD7A 2PDGA 3PWIA 2YKKA 4AZ5A 3UD6A 3D46A 4UFIA 3SUWA 2XIOA 2E1WA 4WF7A 4KBXA 3EMCA 1CGUA 4UTJA 4IIEA 4NI3A 5AHFA 4KW2A 1A5KC 3TNOA 3WO8A 3WMBA 2UWFA 2FZDA 2AOSA 1R2RA 1POJA 1QI5A 5AYYA 2YPIA 2VDGA 3R6IA 4LB3A 2UV8G 3FJLA 4AEOA 4RLIA 4QCFA 2IPWA 5IFPA 2DPEA 5AC7A 2R91A 2E40A 4GCAA 3QKEA 1XD0A 4NIRA 1H61A 4DBSA 1REQB 3THAA 3DFNA 5E9AA 1CBGA 3UESA 4J3ZA 1RAKA 2GSHA 2QUTA 3GBEA 1EIXA 3CM4A 1B30A 3NNTA 2XFWA 1TUFA 3G0UA 4GY1A 2GVYA 3PPGA 3TJ4A 3A4JA 4DRSA 1VHNA 4FLRA 4K1WA 5D9PA 3A64A 3W7MA 4BHYA 3V0TA 3H2FA 3O16A 4BQ3A 1V3LA 2ABBA 2GWNA 2CBVA 4LT9A 2DT0A 5C71A 1ZB5A 3LHUA 5D9MA 1XINA 4UQEA 6REQA 4EACA 2ZUUA 2PU0A 1KCXA 4I8DA 3QC3A 4Y9MA 3L5MA 1TWDA 2OZ3A 3VNLA 2OX1A 3ENLA 3RM8A 2Q01A 4UTIA 5I3GA 3AIBA 1A5SA 2NWSA 1YEYA 3SSZA 3NJ3A 5FI8A 1Q13A 5ABFB 2WLZA 4ML4A 3STEA 3RGTA 1KRAC 1DJWA 1HL2A 4MOZA 1E6XM 4WY0F 2PC4A 3SEPA 1NVMA 3QVQA 4ZQOA 1I9CB 2CZ5A 1LL6A 4IUGA 2YA2A 2OQLA 3EOUA 2YLLA 3SY1A 2HROA 3LZ5A 1S3TC 4HPJA 4PODA 4ZXLA 3FFSA 3BV4A 3GIPA 4RW5A 3GLCA 4GC4A 1L0PA 2ZOXA 3I4KA 1E40A 4EPDC 2GQAA 3G1DA 4XUGA 5EB8A 3WQDA 1EIBA 2HQAA 1DJNA 4GE8A 3DI1A 4C60A 5HINA 4O1EA 2W0UA 1J9YA 5HATA 4LJ3A 4ZBCA 4MPKA 1W3LA 2E5CA 3LTPA 3VABA 2P88A 3L4VA 3B0VC 3GYEA 2PRMA 3LGGA 1YMYA 1ELSA 1LRQA 4AY1A 1QK2A 4FF5A 3VDHA 4KKXA 1IV8A 1KLZA 1M68A 3TQPA 1QXLA 1EBHA 1K4GA 4X9YA 2XU2A 5D9OA 1NWRA 3T42A 1S5NA 3A24A 3B8TA 4W8AA 2OB3A 2JBMA 3VNZA 3WMSA 1A5CA 3VXGA 1TTJA 3TW6A 1RK6A 3VM7A 5HR7A 3QMSA 4FPSA 3W7JA 2PCQA 3K8KA 1C9DA 4F0MA 1R38A 1HNYA 1Z42A 2EPKX 1YBQA 1W3HA 3LPPA 4AF0A 3F2BA 1EUAA 3LDVA 3M6YA 3VDAA 2YB4A 2Z1VA 2GK1A 5A6AA 3N4AA 2FGLA 3EWWA 3C0SA 5D33A 4P5UA 1FBAA 5GVJA 4Q8UA 3KUMA 1KM5A 3F5KA 1MEHA 1BWLA 4S3AA 3GS6A 1FWJC 1V08A 4IFRA 1W3NA 5I07A 1TPVA 1Y5VA 4PBFA 4RNJA 4PMXA 4HOWA 3JUGA 3CXOA 2BHUA 3PZGA 4REQB 5BMWA 4B9ZA 1ZRQA 5A2BA 1E73M 1LWHA 3L23A 2R82A 4GUGA 1HTIA 1EC8A 3QLDA 4RDYA 4KEUA 3VIOA 1A5MC 4X22A 3INPA 3LY0A 3I6RA 3LM7A 5GNZA 3AIQA 2G41A 4L4LA 1AVAA 3UVIA 1JGIA 3EDDA 3BCJA 3LSBA 1KFWA 2OCZA 2A3AA 1Q6LA 5FEPA 1UPMB 1O68A 1MO0A 3IIVA 1FWDC 2OFJA 1XG3A 3WN6A 2V3FA 3U7VA 1EDTA 4M29A 1XBYA 3QZ6A 4LCRA 2XVPA 2ZYFA 5JVLA 1W1VA 1KXVA 4M6UA 4RKAA 2CHNA 3PSVA 2VZVA 1H0GA 1BRLB 2DSUA 4W9TA 4GZ7A 3EYPA 3LBMA 3PZUA 4XWUA 3C0LA 3VOFA 4UXDA 5C2CA 4ATDA 3QV8A 5C7VA 4JNMA 1GVFA 4PMNA 4DM1A 1TR9A 3UA3A 3GNPA 3ES8A 1R2TA 4LS1A 3W7CA 3NOYA 4QNEA 2GGEA 3W1AA 4TTUA 4JYDA 1JZ3A 3S0CA 1XDMA 2AQVA 3LOTA 5AHIA 1BWKA 1VIWA 5LIXX 1EP1A 1GYLA 4GG9A 4ALDA 1HFBA 4WY0B 4PB4A 3UG4A 2QCDB 2PZNA 1PVNA 1VPXA 4F2TA 1ISYA 1FH8A 1FP9A 3AIVA 4FK9A 4H9YA 3G2GA 1FWGC 4HSOA 4LUJA 4Q8OA 4EAMA 4X9SA 3VE7A 3UPWA 3O15A 4GA8A 5REQB 3WUGA 2XN2A 4U2ZA 1Q6EA 1Q4NX 2Y7DA 1EWEA 3ICJA 2YCJA 1IXOA 4G56A 1XP3A 2O7SA 1YRRA 1OSEA 3BZJA 3PBVA 1H51A 3UU0A 3VGGA 2W6RA 5HPOA 1OFBA 2A7NA 4JFWA 1UR8A 3H26A 1XLIA 1O60A 2FFIA 4O4VA 2PWDA 1A80A 1V4YA 2BMBA 2F6XA 3PVFA 2E6AA 5I6SA 4C1NB 3WL1A 3MUAA 3KAOA 4GQGA 4V15A 4Y6GA 1BYAA 4HNTA 1YNPA 2G3IA 1OFRA 4MJ4A 4X0NA 1V6UA 4IMEA 2YW3A 2A3EA 1NARA 1L6GA 3PAJA 1I0BA 4E4PA 2RFGA 1GG0A 3UWQA 4HYWA 4PCNA 4UQCA 4MJMA 1U83A 1KNWA 3VD3A 3WBYA 5M03A 4GI9A 2Z24A 2DZUA 2C6QA 5BXTA 3MO7A 2PDPA 2BTMA 2ABAA 3U5UA 1ZJIA 2VEMA 4WKFA 2XH0A 1Q2SA 1UPPA 4O11A 2YB1A 1QPQA 4NJKA 4NG3A 4QAWA 1TMLA 4RK8A 1F8MA 3KCJA 7ENLA 1TCDA 4GI8A 1VPQA 2YZ5A 1J6PA 1SPQA 4DPQA 5FJJA 1EOKA 3LMZA 4FX6M 1M01A 5DT7A 3VIPA 1TR1A 4L4MA 2C1GA 4EP8C 2X8RA 1XPGA 2DUZA 3W22A 4AVOA 4F0SA 4FEZA 4CEUC 4JTTA 3ARWA 5I06A 3LRMA 4OWGA 4ZOBA 1ZBKA 4JBRA 5BW6A 4IL2A 5F1UA 1DIOA 1N7KA 2C3ZA 1PIFA 5HDRA 4D1JA 3S3GA 4PMOA 4GGHA 5BOEA 5KTLA 3BCFA 2DSKA 1EZ2A 3N9RA 1AFSA 1EXBA 2NT0A 1GPWA 3ARPA 2GYIA 3HU7A 4F40A 4B91A 4Q8WA 1I6NA 4MKSA 4ICNA 2BASA 2I9EA 3LBOA 4US6A 3LRKA 4UMCA 3NQBA 1UUMA 4F0HA 6A3HA 1HJXA 2PDJA 3PUGA 4TXEA 1CECA 1PX4A 2WK2A 1XRSA 3VGBA 5CBJA 2ZQ0A 1V0NA 3M7WA 3RAOA 1LOQA 5T26A 2DT3A 2ISVA 4P8WA 5A8NA 1LP6A 1V93A 3PJTA 3KTXA 4I5UA 4PSRA 4IIGA 1FWFC 2WV8A 2QCCA 1A0CA 3TXVA 3AIWA 3OGVA 2JIWA 4ACZB 3MTWA 3TFCA 4AXNA 3CB8A 3G5EA 2GJXB 2FPTA 1TKKA 1XSIA 3L4TA 1SFLA 5BNKA 3FXGA 1BKSA 4HTYA 2C8NA 1Q66A 5LIYX 1RVGA 1X1OA 1NDYA 1PB0A 3P8IA 8TIMA 3URQA 3BLPX 3ONCA 2D1ZA 4KRTA 4K7YA 3HGSA 3EXSA 3N2XA 1WDRA 3OLIA 3LNMA 2YBVA 5B7YA 3TYCA 1O7AA 4AHOA 1WKFA 2ZZ2A 1BXCA 3XISA 3OG2A 3U3HA 5A2AA 3L21A 2DSVA 5G4EA 4OKDA 1S5MA 3QHMA 4G7EA 2DVUA 4XAFA 3UJSA 2YFNA 2ZA1A 1TZ9A 3GXFA 3ZJ8A 5B80A 1VQTA 3W0KA 1G67A 1QK0A 3PTMA 4AYSA 1B3WA 4S2CA 1JFXA 1AZ1A 4W86A 3UG5A 3MO4A 5HQLA 5U7SA 1KKRA 4UTTC 2F6UA 1QPNA 2GQ9A 3LA4A 1G01A 3AU6A 1WZLA 1HJWA 1YPIA 1VLWA 1V7YA 5LNSA 2Y24A 3R10A 4ERIA 2F8QA 1E51A 4MHBA 3GC5A 5I23A 2JE8A 3M0XA 4R7JA 1J6OA 4GNKB 4I7WA 2G97A 1OFOA 3GTNA 1EGMA 1NP2A 2EG7A 3QV9A 5AYIA 2PD9A 1KRMA 3P0WA 3DG3A 3VUSA 3EWXA 3V16A 3OA5A 2A85A 2YA1A 3G8EA 3M0VA 1ZAHA 3K4AA 1IF2A 3UF9A 3WLHA 3TN6A 1Z9AA 5D2WA 2G3NA 2I57A 3KWXA 5EMYA 4NZCA 3Q58A 4JNZA 3UWZA 4A3HA 3APGA 3IIOA 3GH4A 4F66A 1Y0EA 4GH3A 4E8DA 3BWWA 1ZALA 2D3NA 3GZ3A 4ASTA 3GNXA 1G5AA 2X2GA 3MMDA 3N34A 2VRJA 5G4HC 2PI6A 1BGAA 4L1WA 1PCWA 1I60A 3L4WA 1D8WA 3TCSA 1LZOA 2O92A 3NWRA 4N6FA 4A05A 1DJYA 4YHEA 3ZT5A 4M6PA 4FOUA 1AD4A 1DV7A 4AW7A 1H4PA 2BB0A 4M0XA 3TCEA 6XIMA 4R5EA 4W84A 4GQQA 1HGWA 4UQBA 4RXFA 4MWAE 1MUCA 3A5FA 4KFOA 1CT5A 3UFYA 3CUHA 2X0YA 1B3VA 4I9TA 4ZVJA 4DJFA 1RZMA 2BGQA 2V81A 1A0DA 3RMJA 1AQMA 3KOXA 2YCLB 1DWJM 5FA5A 2PF8A 5GPRA 3W2NA 1QPRA 4BI6A 3SB0A 1VFUA 4MY9A 1C93A 5FF0A 3DEQA 1EOMA 4GZIA 2WJFA 4NAEA 4LCSA 2VI0A 3KL3A 4D8LA 2YXXA 1W5OA 2Z0IA 3CAWA 4QE4A 2GOUA 2E67A 5LSMA 2XN1A 2R1MA 4M51A 1B4KA 5CKSA 1NOFA 4K8EA 3HTWA 3FVDA 3N6JA 3SQLA 3R13A 4ZEPA 2PMQA 2Y88A 3WEZA 2VDHA 4CCDA 5K9XA 3NL6A 5I7GA 4CQCA 3SUTA 3M46A 1UKQA 4FO4A 4XBSA 2PFHA 5EMUA 3LTYA 4OT7A 5A6JA 1MRQA 3ISIX 1P0EA 4JNYA 4DBUA 1BTMA 4CCEA 1VIZA 3WD1A 1TRIA 3VMPA 3QV7A 2JIEA 4PL1A 2Q8XA 3IS4A 4UTUA 3BLDA 5I24A 2V30A 2DT2A 3QFEA 2FPVA 3D5HA 4D71A 1XYCA 2ZX6A 3QTGA 3C2OA 2C91A 2IQTA 4DM2A 1OD0A 2PTDA 4JX5A 1L6YA 4KCUA 1L9WA 1ODUA 3AWNA 1P1XA 4D6GA 2ZC1A 1EJTC 3WMLA 2HVNA 1IGWA 5I0DA 5KMYA 4QDPA 2QCGA 1OYAA 1R85A 3QHNA 5CJNA 3GSMA 1UG6A 1GQLA 3RLUA 4AUBA 4P7QA 3EA1A 3W84A 4MZ1A 4MIMA 4MNKA 3UWYA 3OTRA 4DNMA 3DERA 2FB2A 1OHLA 1KM4A 3P60A 3KOYA 2ZZ4A 3C0JA 1WO2A 4BZYA 3E5PA 1P6BA 2EPOA 3ZM8A 5KETA 2WMGA 1GWJA 1CZ1A 2DP3A 2WB5A 4CVUA 4C6JA 1JR1A 1TYGA 1RBAA 4KFPA 4O4WA 4M5PA 4V27A 1TWZA 4NUWA 4ZL1A 3WEMA 1RD5A 1BQGA 2IPFA 3HQOA 5TBOA 3ITTA 2QDHA 4E3TA 4HP5A 1I2QA 3KBJA 5CGQA 3L9CA 1OT2A 1XYZA 4JHMA 3VKJA 3W07A 3UBPC 3LI1A 3L2LA 1SR0A 2IKJA 6ENLA 1TQJA 2JGYA 1KXTA 3GHUA 2VD9A 4DZAA 2PDFA 3BC9A 3AIRA 1MUWA 4HJFA 1TZZA 1E55A 5A6KA 3H8AA 1LF1A 3MUY1 1M7XA 1H7OA 3EDKA 2I14A 3A9IA 5D8WA 1QFEA 4MNLA 4DJDD 3O05A 3B05A 3S5SA 2IW0A 3B0YA 3EDFA 3B8VA 2XWDA 2XTKA 4TQTA 2YBTA 1X7IA 1DWIM 1W1ZA 4H2HA 3MWCA 2VGGA 5BXRA 1EDGA 5CG0A 3AFBA 1KFKA 3H2MA 2A3BA 3W7IA 1KV8A 2DZWA 2J7GA 2Z1WA 1PPIA 4CLMA 4ZZ9A 1NWUA 1AA1B 4XAPA 5EA9A 1GCYA 4GJJA 1OADA 1UH4A 4YL2A 3NQ8A 3WQ4A 1VB9A 2VZOA 4DWSC 2PA6A 5E5CA 3VKKA 3QBUA 4WDXA 4LOCA 3LHVA 4GVFA 2XVLA 2Y2WA 2NVCA 2HBVA 1T5AA 4KEZA 1QNOA 2ACQA 2WM0A 2NUXA 4K37A 4KIRA 5IRPA 2E9MA 3URBA 4J3SA 3PG9A 4LU0A 1E71M 3OHMB 2PWVA 5EMJA 4DYKA 3G22A 2HZGA 3HB9A 4QCEA 4ZE5A 2PDYA 1K8CA 2I17A 3W1QA 2C79A 3KOZA 5FJIA 1EFZA 4ACZA 1OD8A 4GWEA 1XIHA 3M41A 3WUBA 3EB3A 4ECLA 4L6DA 3RRXA 2Y7EA 3WF4A 3NPVA 4LAZA 3GFYA 4A8IA 3LN3A 1EPVA 4PTXA 4XZLX 1LG1A 2BY2A 2J62A 4P8VA 1XFCA 1O1HA 5TF0A 5AECA 3GX9A 3VZYA 3M0ZA 1RLCL 1T40A 2VFIA 3CHVA 3HN3A 2E5DA 4RZ6A 1FWSA 1TA3B 1W8SA 1A4LA 2BGNE 4QR6A 3DFPA 2VR4A 2C0AA 3MMUA 4F0LA 5BOOA 3FJ6A 3FA3A 3VIJA 3FDGA 1Q4WA 2QHAA 1HKKA 3GG1A 2D69A 3JVAA 4OE7A 1O4UA 4FNQA 2BG5A 3W87A 3AHVA 1VF8A 3HV8A 4W89A 1H7NA 4RPPA 3PJXA 1W3JA 4LC8A 1K4HA 4PMJA 1SSDA 1UR3M 5AHMA 5DY3A 2X16A 4FF7A 3AIEA 3E0IA 3AYTA 1HL9A 1GOXA 4MY1A 2WWDA 4IIDA 1AMYA 2VGFA 4LVAA 3UA4A 4NT0A 3T44A 2INFA 4IMCA 3WQ6A 3RCMA 2DW7A 3KBWA 3QGVA 3PB0A 4C6QA 1G4PA 1OFEA 2QZRA 4OHQA 4S3BA 1SFSA 3LCGA 5TAOA 4R34A 1B3OA 4HQVA 3WYZA 1CI1A 3VTRA 5K7JA 2UY4A 3QHOA 1UD4A 3SECA 1UJQA 4HZMA 4PFMA 3WF3A 4M1RA 4AD5A 3IARA 3S2MA 3N13A 1DOSA 1UA7A 3G18A 4HZ6A 1S5WA 4HMCA 1VS1A 3TOPA 2GGGA 3GFZA 1MUMA 3F5LA 2EKGA 4PUJA 4US5A 2X09A 4PBGA 3KX6A 4BCEA 3Q65A 4B5TA 3THCA 1W3TA 4BFAA 5ECUA 1NOWA 5MHBA 4MYXA 3PY2A 3TQKA 3T2PA 2J74A 5G2WA 5T9BG 1LWJA 1TV7A 4QSFA 1ISXA 3ZJ7A 1ZQ5A 3NQVA 1TJ1A 3B8SA 4PEEA 1GYMA 1X1NA 1PZ1A 3M4HA 3GTFA 3ZLGA 2OEJA 3O0KA 3B97A 3LM3A 4QG6A 3G1FA 4PSPA 1BPLB 1YKWA 2ZRXA 3SIZA 5HK4A 1KD0A 1RUSA 3VILA 2PS2A 3GZAA 1ICSA 1QCWA 2BGSA 4NHVA 3ARVA 4GUJA 3ALGA 2IQ0A 3WNMA 1UBPC 4H2CA 4EWND 3R5EA 3KXQA 3UGVA 5ABTA 5JIPA 4XTIA 2Y89A 2WSRA 4KQNA 1W91A 3C8NA 3IIXA 3OGRA 3KRBA 2HPIA 5FJUA 1HN1A 3FNDA 2XIBA 1LBFA 3LLXA 2VD8A 1KLYA 4AX7A 3CIWA 1KXHA 4UBPC 4E2BA 3NEVA 4JPGA 4JN8A 2JK2A 4M82A 3GU9A 3LCFA 1LORA 2XGIA 5EMMA 2CHOA 3WY1A 1VYRA 1A3WA 4AVFA 4AX6A 3MYPA 2WZEA 2QMJA 3M5YA 4IPNB 2REQB 4NQ1A 2PE4A 1E4IA 3HM7A 5BRPA 1KFCA 1V79A 3FJ4A 3TKFA 3VGFA 5CPMA 2JALA 1F6PA 2PURA 1LOSA 3PPCA 2PDLA 2NV1A 1RCOB 4O53A 2JEPA 1EZWA 1OFPA 4ZQCA 3DC0A 3NDZA 3SCPA 3E3HA 4PMVA 5G1TA 1JPIA 1M7OA 1DEDA 3AHYA 3GH7A 2VELA 2YL6A 1LL4A 5HJYA 3S47A 4DZHA 1LG2A 3K4DA 4LY4A 2ZZ7A 3NG3A 4RCXA 1ZNNA 1ZPTA 1US0A 4RZBA 4ORIA 3BICA 3MKCA 3TN5A 1FDZA 2PBGA 1GHSA 2XJ7A 2HE8A 3GVGA 4ZO8A 4OTKA 1GVSA 1JGMA 3OPSA 4L56A 3MUCA 1TJPA 3FV9A 4IPIA 2V6AA 4DJEC 2J8TA 3RO6A 2J75A 1OFQA 2NUYA 3ZSSA 1WDPA 4OV9A 1LBMA 3UG3A 1MDRA 4I90A 4KS0A 3WEOA 3I3EA 2WZIA 2CLEA 3OZPA 1K1DA 3WH6A 3SW6A 2Z1SA 5TQLA 1LDCA 1D7KA 4PMZA 4UTTA 1CX9A 1TX2A 1S3HA 3OODA 3I7SA 3ONBA 1W1A1 4HZ8A 4LV9A 3IAPA 2W27A 1D2KA 2WCGA 3PSWA 4IQJA 3ARXA 3GO2A 3SUVA 2V5JA 4DJFD 3M5ZA 4HPHA 4NJJA 1V02E 3N9KA 3UZJA 2XYLA 3GNNA 2J78A 4WKAA 2WLYA 4AD1A 1Q5MA 3NL2A 1VFFA 5IHSA 2H8ZA 1TVPA 4HK5A 2DEPA 3FW6A 4NJGA 3WLQA 3R58A 1I2NA 3ABRA 2YGYA 4JR5A 1TELA 3P84A 2PLKA 2VXNA 2D0GA 5T9CE 4UR9A 3O7UA 1E70M 1PZ2A 2G96A 4MFEA 1MSSA 1K3UA 3W7HA 2Z7KA 4H9MA 1XPYA 4NJIA 3C0QA 4LBRA 1UD3A 4MJZA 1EJ7L 3ITGA 1B9BA 3LMYA 4MYAA 2VGIA 2OYLA 4AEFA 2WOQA 4GO8A 5IBXA 3LHTA 3G3DA 2X0SA 2WCAA 5C7HA 4MAZA 1WNOA 1RPKA 1ZY9A 4IQLA 1G1YA 3UXLA 5A6MA 2ZUNA 1IR1A 3SGGA 1F5ZA 1JZ6A 1BG4A 6ALDA 2VZUA 2PDUA 1WKYA 4LRTA 1YW1A 4B5WA 2V0TA 4O1DA 4U33A 6REQB 2D2JA 4AZHA 2RKXA 7TIMA 4G1KA 3J7HA 4UNKA 5C9UA 3CUFA 1K6AA 3V0SA 4GKTA 4KMQA 1L6FA 4JIPA 5CSUA 1XYFA 4I9AA 3WG6A 1UMYA 2CKRA 2XG9A 3M47A 1QPKA 2ZDRA 4LY8A 5FAGA 3DAQA 2GDUA 4EF8A 3BW2A 2Y7FA 1ICQA 1F4AA 2Z6IA 3KBSA 3EWDA 3AROA 3CH0A 1F6YA 1W5NA 3RLGA 4JL1A 4AZGA 4NZFA 3HZ3A 3AUJA 4CNOA 2Z1KA 4A2RA 5A2CA 3IRSA 3PBMA 3VIFA 2P3ZA 1MQPA 1OC6A 4WGXA 1XLHA 3W7EA 2OKTA 2ZUSA 3CHDA 3HG2A 1OJXA 1FWEC 2GZXA 2YR1A 8CGTA 3PAOA 2V82A 1XD1A 1T7LA 3H4XA 3LPOA 3NVTA 4I6KA 1OY0A 1CXFA 5H2ZA 1DYSA 2BVWA 5BRQA 4QJ4B 4L4PA 3N2TA 4BR1A 4AH7A 3TQVA 4AISA 3NAVA 1B57A 4R27A 4Q4MA 1IWBA 3GR8A 1BYDA 1XFBA 3QOMA 2AMXA 1EDQA 5CJMA 3DFYA 3P3BA 2FMNA 1FFRA 1VBUA 4MUZA 1JPKA 1O1ZA 2DUXA 4HMDA 3TZFA 3CWHA 2CHRA 3JZUA 2WMFA 1GZJA 3H2CA 2CW6A 1RJPA 3CT2A 3QY6A 4LFYA 1RJQA 4REQA 7ODCA 1XGZA 2VR2A 4IWWA 1GOKA 3DHPA 3SCUA 3ZT6A 4JFSA 1GOQA 1YIXA 3REQA 1CW2A 4O17A 2ZZ6A 1F8IA 2IXVA 4PTWA 3DG6A 2HE5A 2GPTA 2B4GA 1PHWA 3M0LA 2ZX7A 4PUMA 1OC5A 2OX4A 2W62A 5J8LA 3W2JA 2XH2A 3MP3A 3F4NA 3WJXA 1MVYA 3R25A 4G1NA 4WK9A 3WQVA 4AF0B 4UNLA 1A5NC 1QO2A 2BY1A 4PL2A 4FLQA 4BF9A 5M1TA 1IQ8A 3V7PA 4J7RA 2G4FA 3FX4A 3U4FA 1MYRA 1Q7MA 1XDJA 1HP4A 2A79A 3WDQA 2FDSA 1TJ2A 2X42A 1RR2A 3FEQA 3UY7A 4QSHA 3EWCA 3VU2A 1ADOA 2HK0A 3LD5A 4YS1A 3C8FA 3DOPA 3WNPA 1BGGA 2XZ7A 4WKHA 4JHZA 3BJFA 3PPFA 4JQAA 2YXOA 2DQXA 4UTHA 4JTLA 3OBKA 4FR6A 3BSHA 1KRBC 4FX7A 3S9ZA 1NSJA 1KQYA 4UC5A 5CGTA 2EHHA 4U5IA 1Y8BA 1W9UA 4PN2A 4B5NA 2WC3A 3M5XA 4NZJA 1HT6A 4UTLA 4YLWA 3WUEA 2OWCA 4UZSA 5J5DA 2QDGA 5FEWA 3V0UA 1DPMA 1TFVA 1X98A 2FGZA 4O28A 1IXPA 1QNVA 2WNNA 3RK8A 3ZSTA 3VINA 3TWBA 4MFDA 1E0WA 4GX9A 5K9DA 9CGTA 4A8LA 4YVPA 1QNSA 3BMXA 4HNNA 1R3WA 1XLDA 1J4EA 2P1FA 3OJGA 2XINA 5CG7A 4M24A 2FDMA 4FXJA 4RE2A 3SADA 4W8BA 4UFMA 4GZEA 3RN6A 1KWGA 3O0FA 2ZRUA 5CSRA 5MKGB 2FHBA 1V51A 4UCFA 3U9IA 2NUWA 3PZVA 4IFKA 4Q8QA 2QNEA 3ZR5A 3VOHA 1SW0A 1K9EA 2DIKA 1QR7A 3BQ6A 1R5YA 1JZ7A 1I4NA 3XIMA 1KRCC 3CEUA 3H54A 2EGZA 2ZICA 2JKAA 1EF3A 2QCDA 1E6RA 1X38A 1O12A 3U5YA 4Q32A 2EEXA 1E9LA 3W2KA 4DLFA 1RY8A 3T0BA 3GBDA 2WSPA 4F48A 1Q8JA 4ICCX 5LA0A 3HQ1A 4XBJA 1CYGA 1KKOA 2VFGA 1C9WA 3SY8A 4XK2A 2VCCA 2B7PA 1SZGA 4C1KA 2Q8ZA 4AZCB 1QHPA 3P61A 2B0MA 3KVJA 2G3MA 4W7VA 3TX9A 1J11A 2GJRA 3GG8A 3A5VA 3EA2A 2FVKA 2BDQA 3QR3A 2WVVB 2VFFA 4JAWA 3EOOA 1EC7A 1KBLA 4HU0A 1XV8A 1FX6A 1FWCC 5LNUA 4GIAA 4JS3A 4OZOA 3AYSA 4JTDA 3VGHA 1YNQA 1TUXA 3F4WA 4MZ8A 3O07A 3ZFHA 5AHNA 2R14A 1NFGA 1ITXA 4NX0A 1MFVA 3T81A 4GMEA 1S1PA 3KRSA 2WVSA 3MZ2A 4KGJA 1BF2A 1M53A 4C6EA 1EL3A 4AZ6A 3A9BA 3WZ0E 2OOFA 1ZUAX 1VYPX 1SYTA 3FKKA 4HMNA 5DX7A 2OWWA 3TC6A 1H7PA 3CZJA 3BXWA 3RR1A 1MI3A 1DJZA 5HJXA 5GJNA 1N2VA 3TROA 1UZ4A 1YDVA 4LAKA 2WKGA 3S5NA 4F8XA 3EXTA 2OO6A 2WVUA 5AB3A 1CXKA 1JI1A 1E6SM 2X30A 3KOFA 1XDLA 2RUSA 4H8UA 3HQNA 1OWQA 3ERPA 3WQ8A 4ACYA 1AK5A 2VUNA 4JIIX 3UQNA 4TX8A 3UY8A 1XG4A 2BZNA 4H41A 5CC7A 3COTA 2CYGA 1HQTA 3PUEA 3F03K 1VFLA 5I09A 4GNJA 1ZAJA 2J7CA 4DI8A 1JQXA 5JBFA 4MKNA 3EDJA 1MW3A 2WCSA 3R8HA 3A22A 1KTBA 1VD6A 3GG7A 3ZZ1A 1VP5A 4EE9A 2CC0A 3SN4A 1X97A 2HTMA 2Q3OA 1PKYA 3N2MA 3UERA 1H3GA 2GOKA 4ADUA 3W7DA 4O8RA 1S2UA 3PZMA 2GWGA 3E12A 3RX4A 3GR7A 3IJ7A 1XLBA 1TB3A 3V5FA 4C6KA 2EG8A 3C4UA 4QQUA 4P8UA 4IFOA 3BARA 3TJIA 4E2VA 1XLMA 1HVQA 4M6VA 2CBJA 3QM3A 4ZTYA 1DL3A 4G7EB 1J79A 2F6KA 2ZXQA 4H9TA 3ZLHA 1E9YB 5IFTA 4DVOA 5LNRA 2WWCA 3M0YA 2CBIA 3H53A 1EHAA 3B9AA 1XSKA 5D38A 4Z08A 2ZXAA 3KOWA 3W7PA 3EX1A 3G24A 1QHZA 5TIMA 4AYGA 2PDKA 3GM8A 3NGJA 3S9IA 5BROA 3EMZA 4Y90A 1TWSA 4DZIA 3LLFA 1I2PA 4JTHA 2UZ9A 1VPYA 2ZA2A 7A3HA 3CPUA 3RPDA 5FIPA 1DQXA 3A3WA 1QI2A 2WQDA 3RHGA 4MB3A 3OLGA 4Q8PA 4ICMA 4B2DD 3WLKX 4HNLA 3W1NA 5EGRA 4DXKA 4JD4A 1C92A 1Z3NA 1VLIA 1P0BA 2AQOA 3VI2A 1QTWA 3MHUA 3TH6A 2V3EA 2OODA 2GGJA 5HNTA 3NPXA 3ABOA 4RV3A 4DB7A 2TSYA 3RUBL 1YDYA 1PTAA 1GVIA 4HHLA 1JL8A 1JUBA 2PAJA 5CPOA 4GJ1A 1DKWA 1NF7A 2XH4A 1XS2A 2WC7A 1VFHA 4JTQA 1UUQA 3IEBA 4EF9A 3AXKA 2E6YA 4PULA 3FHAA 4Z1YA 4FNUA 3AWOA 2ZRWA 1ADSA 1XH2A 3XINA 2Z00A 3N19B 4DUVA 2R24A 5AVHA 1IR2A 2FLIA 3LZ3A 4I6VA 1HKJA 1ME9A 5C2XA 2QW5A 3P62A 3DGRA 3UXAA 3PR2A 2PDMA 1IIGA 1I75A 1DTUA 2ANUA 3B8WA 3N14A 2YBUA 4PUEA 5DLCA 2PDBA 1I1XA 3VIMA 3W86A 4LV4A 3CYVA 4Z2KA 2F7FA 3CHFA 3G77A 3PS7A 2P53A 2WHKA 2O0TA 1XKJA 1EEXA 2H9AA 4X2PA 1GT8A 1N8WA 1H0IA 1P1MA 2ZZ1A 3CIXA 4W88A 3KHDA 3TA6A 2A7PA 3SBFA 3NPUA 3LSCA 3WH7A 3WJYA 2EXOA 1S38A 1C8YA 4GUIA 4BWLC 4DJDA 1QHOA 4CU8A 3S83A 2OWXA 4HOZA 3N2BA 3WELA 5F7UA 3W88A 4EWJA 2GJPA 3V3WA 2ZRYA 3K46A 4O8AA 4V1YA 2TPSA 3QQWA 4QE1A 3LNPA 5ECVA 1E1CA 1PKMA 3S4TA 4IGMA 4KWOA 2VENA 1YNYA 1EEPA 3MMTA 4URIA 5E93A 3LUTA 1VKFA 3W7KA 4HMEA 3W2UA 3PNZA 4Z17A 2E8YA 4IGSA 1TREA 4PTMA 4JN7A 3ZVHB 3IV3A 1E4NA 4L6HA 4MSSA 1J5SA 3TSBA 1MXDA 4HNCA 4PTDA 3QRHA 2QUNA 3KCOA 1J5TA 2GDVA 4MWAB 4FOKA 1ZSXA 1JDFA 4BQ5A 3TEVA 3MYOA 3JRKA 2YOCA 1FCUA 2F2KA 1UP0A 4L9YA 1J0YA 1ME7A 4A2SA 1DIKA 3DFOA 2YCLA 4XV0A 1A49A 3I6TA 3FEMA 4GQ0A 1TIWA 4E8GA 2V5KA 1R46A 3ZR4A 1P48A 4HHPA 2QGYA 3GNDA 1YX1A 1K9TA 4JCMA 1EO7A 3MPGA 1C7TA 3NVDA 4YTQA 3LQLA 1XF0A 2ZXBA 3GK0A 4IOTA 4EVZA 1YDOA 2GVLA 3PG8A 4R33A 3GG0A 1WXJA 3U2ZA 2DZTA 5D09A 3LENA 5LIWX 4PTNA 3SO7A 4L65A 4AZIA 4S3FA 3CH9A 3OBAA 1U1HA 5FEZA 1GVQA 4XD6A 1XC6A 1DBTA 1LQ0A 5A8PA 3TNBA 4JFTA 4ERGA 3CHCA 4MWAC 3RR4A 4QEHA 4O12A 3TONA 1OF8A 5KEZA 4IG2A 5JXQA 1UD6A 3CLMA 3QYQA 1WYIA 2SFPA 3L68A 4DJDC 1XUUA 2HEJA 1VH7A 2PWHA 2DZPA 2FTYA 1QO5A 2PWGA 4V28A 3G1RA 3B03A 3WNNA 1RP8A 3VA8A 4O0QA 4EX4A 2BSLA 1FH9A 3GDRA 3MVTA 3VNYA 2VKZG 4QBXA 3LV5A 2PF0A 3ANUA 1W1B1 3SCRA 4GACA 4B15A 1EWDA 1E1CB 3K30A 4NAFB 1X6LA 1A5UA 2GQ3A 3G1YA 2G3JA 4PZVA 1AQ0A 3CUZA 3CJPA 4FI4A 4WDWA 1OFAA 3T8LA 1EH9A 3S1XA 4JTFA 4NXKA 2W9MA 3N3MA 4GABA 4R9OA 5T8GA 3TK7A 4Q4SA 2RDXA 3U57A 1OX4A 2FIQA 3FCPA 3IJQA 2C13A 3ITYA 4J3TA 4Q4QA 3C6CA 4JTGA 3W3OA 5E6ZA 1MXGA 2OELA 3L4UA 3Q37A 9RUBA 3BLEA 4QM1A 1FRBA 1GHRA 2PP1A 5D30A 4P61A 4PUWA 3BV7A 3UPBA 3KCLA 4HA3A 1NH6A 2PP0A 1BHGA 3BGGA 4WD0A 2ICSA 4FNRA 3RIKA 3DXIA 1CXHA 1TX0A 4OIFA 1LRTA 3K4WA 5CGMA 2VURA 3CUGA 4XAYA 3W85A 4P7NA 3NYZA 2CLIA 3W00A 1TWIA 3KDNA 4D9PA 3OBEA 1CB2A 4XO6A 3BLLA 3VX1A 3OZMA 3BQ5A 3ELFA 5I3JA 1S2VA 1PKNA 3K1GA 3SJNA 1KR0A 3QEZA 3P67A 5F4SA 4JDBA 4AXKA 2XVKA 1REQA 5C6MA 4GFSA 4QLJA 4R88A 4IT1A 5C9WA 4D6HA 4PUKA 2NXIA 5E6YA 1GPFA 1QBAA 2NSXA 5C9RA 1EKOA 1HJSA 1S2CA 3QPYA 1G0CA 1RQBA 4YYFA 1JF5A 1RD6A 3M1ZA 3BMWA 2NSOA 3S9YA 4DO7A 4PBEA 3M0IA 4MZYA 2FJUB 1E15A 1C3FA 4ZB0A 1TTQA 4IP5A 4LF1A 1GW9A 2WVVA 3T7VA 3QR0A 3MUXA 4LUYA 3W1RA 1O5QA 2A3HA 3QH2A 2EAWA 2ZWYA 1XR2A 2QYGA 1L2QA 4B3ZA 4C6CA 2NXHA 1ADDA 4M80A 3W28A 2C15A 4M1BA 3WQOA 2TMDA 4OUIA 1JCJA 1ZU8A 3ZOAA 3KE0A 5CZSA 4UMAA 1AL8A 1GJUA 3T0TA 4KRUA 1O5RA 1EX1A 4JQ4A 3T9PA 4P8XA 3C86A 3QXBA 1UWQA 3WDPP 1DJXA 1WZMA 3E2VA 1D3HA 2EBNA 1N82A 4XISA 4A29A 5LGXA 4XSMA 3BL3A 3WNLA 2D24A 2DVXA 1NQKA 4LUSB 1HVXA 4QTGA 1SQ7A 4LSBA 4XAZA 4GFIA 2I5IA 1NDZA 3S2NA 3T0AA 1EUNA 3AXXA 3VDGA 1ZBWA 1L6WA 3CAQA 1XISA 2WHLA 4LEQA 5KSWA 4LC6A 1Y5XA 4PYSA 1EYEA 4LTSA 1OCNA 3MA8A 3VOCA 3QY8A 4O19A 1IEVA 4JIQA 1Q6CA 4O18A 1PV8A 3S6TA 1CGXA 3S1UA 3JR2A 1WV2A 1CXEA 3NQAA 3W25A 4RDVA 3W75A 5BMXA 4OJYA 5JBDA 1PHQA 5EKYA 4GX8A 3RLVA 1QDSA 3AHZA 3VGDA 1PS9A 2A6LA 4I8YA 4NVTA 3V35A 3CHEA 3F4DA 4ZO9A 4K68A 5CZTA 4L6OA 4BKNA 2HMCA 4KCWA 1HF6A 4B3KA 3BJSA 4HVXA 1V8EA 4IQEA 3GYCA 3MSYA 4E4UA 1PBGA 3ANVA 2A0NA 3UWWA 5CH9A 1WBJA 1DJQA 1D3GA 3W1TA 2Y6ZA 4JKKA 5HXMA 5HNNA 1VAHA 3TAKA 1W5MA 2VOMA 3AS3A 4BJHA 4FR1A 3N6QA 3TDFA 4CNTA 1M65A 2PTWA 4Y9AA 2OQYA 4B4FA 5JUVA 4WZHA 4WDUA 1BRLA 1V03A 3A21A 1UYQA 3A4WA 4LPCA 4BQ4A 3GTXA 2WANA 3OVGA 3R7MA 1E0UA 2QUUA 4NX5A 1M6JA 3OIHA 3CV6A 3UJRA 5IDZA 4AC1X 1R3YA 2RGLA 4Z2GA 4E6MA 2NX3A 1WA3A 2A2IA 4BS0A 4UZUA 2A6NA 1R3QA 3R79A 2E0PA 1ZCCA 1NQ6A 1AQHA 1ML1A 5DT5A 1VJIA 4K38A 3E6EA 3W23A 5I00A 4DO6A 4NNAA 3HPFA 2VC7A 4GVHA 3VOGA 1W9BM 3UCCA 1GORA 1G6CA 1UKSA 3U0HA 4C6PA 3OQ8A 2WHJA 3QZAA 1E6NA 1XHGA 2B31A 4DJED 3W38A 3HPXA 3PFRA 4TTGA 4MTVA 2Y8UA 4M56A 4ZA0A 3E0VA 3GKAA 4EXAA 3WLJA 5A6LA 1Q7QA 4NP7A 1GJPA 3EMQA 4PMYA 1LLOA 1BKHA 3POHA 3C3UA 1EHNA 1S1RA 3NQ2A 3CWOX 2G4JA 2V68A 2BS9A 3TC7A 2QUVA 4H8VA 2W91A 1UQYA 3EWUA 2J88A 1TE1A 2IPJA 4IXXA 1ZP4A 2C0HA 5FCZA 7XIMA 3IV8A 4J3UA 2V2CA 2QV4A 2JF7A 4C7FA 1J0KA 1XICA 5CBIA 4J2MA 1X8FA 6XIAA 3H2NA 4Q4PA 4DEFA 4EANA 3FAWA 3QLLA 1ZBCA 3GH5A 2CU0A 4ZB2A 1XRFA 1M1BA 4Z0JA 2VQUA 2XFFA 3URAA 5F2GA 3CUIA 4JY8A 3TC3A 5AC4A 4UFKA 3BAWA 3GU1A 1EXPA 1VEMA 3OVRA 4N2YA 3U4AA 2B81A 3EWZA 3FLUA 3AC0A 3VX0A 3ZVIA 3R89A 3CQIA 1XRTA 4D6DA 3AXIA 4ADSA 4MM1A 3MS8A 4C91A 2YL5A 2J9ZA 1ZJAA 4K36A 1SO3A 3HPAA 3W2MA 4YNGA 3UG8A 2P5NA 1JPMA 2D0HA 5I3DA 3O9NA 1XLGA 3TN3A 3H4GA 4IM4A 1ICPA 4IZGA 4O13A 1L8NA 3EWBX 1CIUA 3ITXA 2QULA 3MJYA 3QJAA 3TW9A 1OK4A 5IDIA 1K7FA 1SO6A 4DXVA 2W67A 3M0MA 5C5YA 3GUWA 2ISWA 3GDTA 5FJRA 3WH8A 3PANA 2ZFAA 3UWUA 2NW0A 3W82A 5CJ5A 1XM3A 3PZIA 4DELA 3TVAA 2HNHA 2J8GA 1IXNA 4PCTA 1X1ZA 5A6BD 4ENLA 1ZTVA 3GUGA 4E4FA 1ZAIA 3OP2A 3QMTA 3E2RA 4AB4A 5DCBA 3OB8A 1QT1A 4NAFA 4E0CA 2XSXA 4H9XA 1WAUA 1Q3NA 1XBZA 1Q8AA 1QVBA 4K8GA 2POZA 3DC8A 1JI2A 3N4EA 3SCWA 1MZHA 3ZR6A 1JZ2A 1K02A 2PDXA 1TPWA 2O9OA 2VFDA 4FNPA 3WNKA 2X7VA 2HVMA 3LI0A 3STCA 1BXBA 4UCGA 3QY7A 2CLMA 4HSNA 2O9RA 1V0MA 4Y9NA 5AYXA 4XTDA 2DZBA 1EC9A 2IKGA 1OIMA 4U3AA 4FXSA 2G3FA 3TR9A 2Y85A 4NILA 4CUCA 3BG9A 3MT1A 3IJIA 1IWAA 3LHYA 3I10A 3MW7A 3EA3A 2I9UA 3KRZA 4G8TA 1QW8A 1KM6A 3S5OA 3MU7A 3BCDA 3H6OA 5IHRA 3LCIA 1MZRA 1LJYA 1XKYA 2OSWA