3TA8A

Crystal structure hp-nap from strain ys39 iron loaded (cocrystallization 5mm)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
144
structure length
144
Chain Sequence
MKTFEILKHLQADAIVLFMKVHNFHWNVKGTDFFNVHKATEEIYEGFADMFDDLAERIAQLGHHPLVTLSEALKLTRVKEETKTSFHSKDIFKEILEDYKHLEKEFKELSNTAEKEGDKVTVTYADDQLAKLQKSIWMLQAHLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil-activating protein
publication title A new crystal lattice structure of Helicobacter pylori neutrophil-activating protein (HP-NAP)
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Metal transport
total genus 63
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2011-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3ta8A00
1RCGA 5FEJA 2BK6A 3Q4RA 3QHCA 3PW8C 1BFRA 5JACA 5LG8A 4M32A 4MKUA 3UOIA 4RC5B 3FI6A 4AM2A 1TJOA 2V2OA 3OJ5A 3UNOA 2JD60 3R2OA 5IX6A 2Y3QA 3KA6A 1F30A 4LYUA 1LKOA 4ZL6A 5JKMG 2V2SA 3H7GA 4CMYV 4E6KA 2BKCA 2XJMA 5D8SA 4RC7A 4MN9A 1Z6OA 2ZA6A 3WNWA 4R42A 2BW1A 2WTLA 2WLAA 3E1PA 4PGIA 5J9VA 1LKPA 3E6SA 4TOFA 4YKHA 4KVSA 5J93A 3AK9A 1VELA 1DVBA 1QGHA 4TW3A 3QVDA 3PWQA 3R2KA 2FKZA 1SOFA 1JGCA 3T9JA 3VNXA 1KRQA 2V2PA 1BG7A 3A9QA 2ZA7A 1AEWA 3BVFA 4DYYA 3ISEA 4IWKA 4TOGA 4PG1A 2GS4A 3E1QA 5D8OA 3HIUA 2ZG9X 4DYUA 4ZLWA 5I4JA 4TOBA 4QUWA 4IWJA 1TK6A 1RYTA 1RCIA 4RC6A 3E6RA 5K53A 5C6FA 4ERUA 2YJJA 2CN7A 1HRSA 2V15A 1JKVA 3Q4NA 5LBHA 3F38A 5LS9A 5D8XA 4CVTA 2FZFA 3FVBA 5GN8A 2C2UA 5HJHA 5JKLG 2ZURX 4M34A 2GYQA 2IU2A 2Z6MA 2FL0A 2VZBA 1J30A 4EVDA 2CHIA 4XKUA 4DE6A 1RCDA 5GU3X 2C2JA 2CLUA 4LYXA 1F33A 2X170 4M33A 1VJXA 1FHAA 3SE1A 2G4HA 4LQNA 3R2LA 5GU1X 1S2ZA 3A68A 5GU2X 1NF6A 4KVQA 2Z5RA 4ISMA 2XGWA 1EUMA 3GE4A 3PZAA 4P18A 3O7RA 4LQVA 2JD70 1BCFA 4RC5A 4DZ0A 3KA8A 1S30A 4CVSA 3Q4QA 4LPMA 4ZJKA 4U3GA 2XKQA 3E1MA 4CY9A 2C41A 3KA4A 3KX9A 2FG4A 3GHQA 3RE7A 4ZTTA 3BVIA 1IESA 1OTKA 4II4B 1UMNA 1QYBA 1LB3A 2IY4A 1VLGA 4TO9A 2VXIA 3OGHA 4ZKHA 3AF8X 3E1LA 2C6RA 3NP0X 4EVBA 4ML5A 4IXKA 3NOZX 3E1OA 1NFVA 4CYBA 5HJFA 3QB9A 1JYBA 5CMQA 1YUXA 3PVYB 4ITWA 3EZ0A 4CVPA 2JD80 3RBCA 5FFBA 1DPSA 4REUA 3E1NA 2GYDA 1O9IA 2QF9A 1NNQA 3U90A 3F34A 3EZUA 3RAVA 1UVHA 4OYNA 3BKNA 3R2SA 4ZL5A 1B71A 1RCCA 4TOEA 1JI5A 3F35A 4AM5A 1H96A 1RCEA 4DI0A 3PVRA 3AJQA 1Z6OM 4CMYA 4EVEA 3PW1A 5ERJA 2WLUA 2XJNA 3KA9A 3SHXA 1LKMA 3F33A 2ZG7X 3PWQC 4ZMCA 2CIHA 3AF7X 2YW6A 1S3QA 3MPSA 3KWOA 3NP2X 1NF4A 5D8YA 2YJKA 4XKSA 1ZUJA 1JIGA 2XJOA 1XZ1A 3ERZA 4XGSA 2YW7A 3PVTB 5FFEA 5JKMA 3UOFA 2F7NA 1ZS3A 3O7SA 1JI4A 3ES3A 3QZ3A 2IB0A 4M35A 3RD0A 4Z3BA 5J8WA 1VEQA 3AJPA 5D8PA 4CYAA 1YV1A 1N1QA 2CHPA 2W0OA 3F37A 3WVVA 2V2IA 3IS7A 4ETRA 4TODA 3GVYA 2HR5A 1TKOA 2CLBA 2D5KA 4MY7A 1GWGA 3BT5A 1JTSA 5E2DA 4TOCA 2UX1A 5AXSA 2VXXA 4II4A 3F39A 3Q4OA 3R2RA 3BVKA 3IS8A 1JREA 3HL1A 2V2MA 1L8HA 4KVRA 3F36A 5D8QA 3KXUA 5D8RA 4CVRA 1SQ3A 3SH6A 4AM4A 4ZKWA 5FFDA 3R2HA 2Z5PA 3R2MA 4MUDA 3PVYA 2FHAA 4EVCA 4MJYA 3PWFA 4RC7B 3WVUA 1JKUA 5CMRA 2C2FA 3E1JA 2ZA8A 1DATA 3F32A 5FFCA 4TOHA 1R03A 2BJYA 1MFRA 5JKLA 3KA3A 4RC8A 4ISPA 4DASA 4A25A 2OH3A 3BVEA 1IERA 1Z4AA 4PGKA 4TOAA 5HQOA 1YUZA 4ZKXA 4LPJA 2V2LA 4Y08A 3AF9X 2Z5QA 4XKTA 3IQ1A 3E2CA 5K52A 3EGMA 2QQYA 3QHBA 3ISFA 4LQHA 4LQJA 4Z5SA 5LG2A 2RBDA 2CN6A 2V2JA 2V2RA 4RC6B 1L8IA 3PW8A 4LPNA 4DYXA 5GOUA 5ERKA 5CZUA 2FG8A 2PYBA 1MOJA 4PG0A 2Z90A 5FFAA 2ITBA 5J8SA 3PVTA 1TKPA 3PVRB 5GN8B 3PW1B 2FJCA 5E1UA 4ITTA 2OC5A 3AK8A 5GU0X 2FFXJ 3WVWA 1VEIA 3QD8A 3SIDA 3RGDA 2CF7A 2V2NA 4DYZA 3FSEA 3AJOA 2ZG8X 3BVLA 1O9RA 3TA8A 1XZ3A 2CEIA 2HTNA
chains in the Genus database with same CATH superfamily
1RCGA 5FEJA 2BK6A 3Q4RA 3QHCA 3PW8C 1BFRA 5JACA 5LG8A 4M32A 4MKUA 3UOIA 4RC5B 3FI6A 4MXPA 4AM2A 3FRRA 1TJOA 2V2OA 3OJ5A 3UNOA 2JD60 3R2OA 5IX6A 2Y3QA 3KA6A 1F30A 4LYUA 1LKOA 4ZL6A 5JKMG 2V2SA 3H7GA 4CMYV 4E6KA 2BKCA 2Y44A 2XJMA 5D8SA 4RC7A 4MN9A 1Z6OA 2ZA6A 3WNWA 4R42A 2BW1A 2WTLA 2WLAA 3E1PA 4PGIA 5J9VA 1LKPA 3E6SA 4TOFA 4YKHA 4KVSA 5J93A 3AK9A 1VELA 1DVBA 1QGHA 2V8TA 4TW3A 3QVDA 3PWQA 3R2KA 2FKZA 1SOFA 1JGCA 3T9JA 3VNXA 1KRQA 2V2PA 3KHKA 1BG7A 3A9QA 2ZA7A 1AEWA 3BVFA 4DYYA 3ISEA 4W4LB 4IWKA 4TOGA 4PG1A 2GS4A 3E1QA 5D8OA 3HIUA 2ZG9X 3DBYA 4DYUA 4ZLWA 5I4JA 4TOBA 4QUWA 4IWJA 1TK6A 1RYTA 3JZ9A 1RCIA 4RC6A 3E6RA 5K53A 5C6FA 4ERUA 4X0JA 2YJJA 2CN7A 1HRSA 2V15A 4W4KB 1JKVA 3Q4NA 5LBHA 3F38A 5LS9A 5D8XA 3N6OA 2V8UA 4CVTA 2FZFA 3FVBA 5GN8A 2C2UA 3L0MA 5HJHA 5JKLG 2ZURX 4M34A 2GYQA 2IU2A 2Z6MA 2FL0A 2VZBA 1J30A 4EVDA 5JDOB 2CHIA 4XKUA 4DE6A 1RCDA 5GU3X 2C2JA 2CLUA 4LYXA 1F33A 2X170 4M33A 1VJXA 1FHAA 3SE1A 2G4HA 4LQNA 3R2LA 5GU1X 3KDQA 1S2ZA 3A68A 5GU2X 1NF6A 4KVQA 2Z5RA 4ISMA 2XGWA 1EUMA 3GE4A 3GGYA 3PZAA 4P18A 3O7RA 4LQVA 2JD70 1BCFA 4RC5A 4DZ0A 3KA8A 1S30A 4CVSA 3Q4QA 4LPMA 4ZJKA 4U3GA 2XKQA 3E1MA 2G38B 4CY9A 2C41A 2MGYA 3KA4A 3KX9A 3M6JA 2FG4A 4YVZA 3GHQA 3RE7A 4ZTTA 3BVIA 1IESA 1OTKA 4II4B 1UMNA 1QYBA 1LB3A 2IY4A 2CEIA 1VLGA 4TO9A 2VXIA 3C1YA 3OGHA 3W54A 4ZKHA 3AF8X 3E1LA 2C6RA 3NP0X 4EVBA 4ML5A 4IXKA 3NOZX 3E1OA 1NFVA 4CYBA 5HJFA 3QB9A 1JYBA 5CMQA 5HU6D 1YUXA 3PVYB 4ITWA 4KXRB 3UFBA 3C21A 3EZ0A 4CVPA 2JD80 3RBCA 5FFBA 1DPSA 4REUA 3E1NA 2GYDA 1O9IA 2QF9A 1NNQA 3U90A 3F34A 3EZUA 3RAVA 1UVHA 4OYNA 3BKNA 3FRSA 3R2SA 4ZL5A 1B71A 1RCCA 4TOEA 1JI5A 2WWXB 3F35A 4AM5A 3C1ZA 1H96A 1RCEA 4DI0A 3PVRA 2CWLA 3AJQA 1Z6OM 4CMYA 4EVEA 3PW1A 5ERJA 5JDOA 2WLUA 2XJNA 3KA9A 3SHXA 1LKMA 3F33A 2ZG7X 3PWQC 4ZMCA 2CIHA 3AF7X 2YW6A 1S3QA 3MPSA 3KWOA 3NP2X 1NF4A 5D8YA 2YJKA 4XKSA 3JZAB 1ZUJA 1JIGA 2XJOA 1XZ1A 3ERZA 4XGSA 2YW7A 4YXMA 3PVTB 5FFEA 5JKMA 4WJG4 3UOFA 2F7NA 1ZS3A 3O7SA 1JI4A 3ES3A 3QZ3A 2IB0A 4M35A 3RD0A 4Z3BA 5J8WA 1VEQA 3AJPA 5D8PA 4CYAA 1YV1A 1N1QA 2CHPA 2W0OA 3F37A 3WVVA 2V2IA 3IS7A 4ETRA 4TODA 3GVYA 2HR5A 1TKOA 2CLBA 3V3KB 3GGZA 3VV9A 2D5KA 4MY7A 1GWGA 3BT5A 1JTSA 5E2DA 4TOCA 2UX1A 5AXSA 2VXXA 4II4A 3F39A 3Q4OA 3R2RA 3BVKA 3IS8A 1JREA 3HL1A 2V2MA 1L8HA 4KVRA 3C23A 3F36A 5D8QA 3KXUA 5D8RA 4CVRA 1SQ3A 3SH6A 4AM4A 4ZKWA 5FFDA 3R2HA 2Z5PA 3R2MA 4MUDA 3PVYA 2FHAA 4EVCA 4MJYA 3PWFA 4RC7B 3WVUA 2AR0A 1JKUA 5CMRA 2C2FA 3E1JA 2ZA8A 1DATA 3F32A 5FFCA 4TOHA 1R03A 2BJYA 1MFRA 5JKLA 2N02A 3KA3A 4RC8A 4ISPA 4DASA 4A25A 2OH3A 3BVEA 1IERA 1Z4AA 4PGKA 4TOAA 5HQOA 1YUZA 4ZKXA 4LPJA 2V2LA 4Y08A 3AF9X 2Z5QA 4XKTA 3IQ1A 3E2CA 5K52A 3EGMA 2QQYA 3QHBA 3ISFA 4LQHA 4LQJA 4Z5SA 5LG2A 2RBDA 2CN6A 2V2JA 2V2RA 4RC6B 1L8IA 3PW8A 4LPNA 4DYXA 5GOUA 5ERKA 3VVAA 5CZUA 2OKCA 4E40A 2FG8A 2PYBA 1MOJA 4PG0A 2Z90A 5FFAA 2ITBA 5J8SA 3PVTA 1TKPA 3PVRB 5GN8B 3PW1B 2FJCA 5E1UA 4ITTA 2OC5A 3AK8A 5GU0X 2FFXJ 3WVWA 1VEIA 3QD8A 3SIDA 3RGDA 2CF7A 2V2NA 4DYZA 3FSEA 3AJOA 2ZG8X 3BVLA 1O9RA 3TA8A 4YXJA 1XZ3A 3D19A 3LKDA 2HTNA
chains in the Genus database with same CATH topology
1RCGA 5FEJA 2BK6A 3Q4RA 3QHCA 3PW8C 1BFRA 5JACA 5LG8A 4M32A 4MKUA 3UOIA 4RC5B 3FI6A 4MXPA 4AM2A 3FRRA 1TJOA 2V2OA 3OJ5A 3UNOA 2JD60 3R2OA 5IX6A 2Y3QA 3KA6A 1F30A 4LYUA 1LKOA 4ZL6A 5JKMG 2V2SA 3H7GA 4CMYV 4E6KA 2BKCA 2Y44A 2XJMA 5D8SA 4RC7A 4MN9A 1Z6OA 2ZA6A 3WNWA 4R42A 2BW1A 2WTLA 2WLAA 3E1PA 4PGIA 5J9VA 1LKPA 3E6SA 4TOFA 4YKHA 4KVSA 5J93A 3AK9A 1VELA 1DVBA 1QGHA 2V8TA 4TW3A 3QVDA 3PWQA 3R2KA 2FKZA 1SOFA 1JGCA 3T9JA 3VNXA 1KRQA 2V2PA 3KHKA 1BG7A 3A9QA 2ZA7A 1AEWA 3BVFA 4DYYA 3ISEA 4W4LB 4IWKA 4TOGA 4PG1A 2GS4A 3E1QA 5D8OA 3HIUA 2ZG9X 3DBYA 4DYUA 4ZLWA 5I4JA 4TOBA 4QUWA 4IWJA 1TK6A 1RYTA 3JZ9A 1RCIA 4RC6A 3E6RA 5K53A 5C6FA 4ERUA 4X0JA 2YJJA 2CN7A 1HRSA 2V15A 4W4KB 1JKVA 3Q4NA 5LBHA 3F38A 5LS9A 5D8XA 3N6OA 2V8UA 4CVTA 2FZFA 3FVBA 5GN8A 2C2UA 3L0MA 5HJHA 5JKLG 2ZURX 4M34A 2GYQA 2IU2A 2Z6MA 2FL0A 2VZBA 1J30A 4EVDA 5JDOB 2CHIA 4XKUA 4DE6A 1RCDA 5GU3X 2C2JA 2CLUA 4LYXA 1F33A 2X170 4M33A 1VJXA 1FHAA 3SE1A 2G4HA 4LQNA 3R2LA 5GU1X 3KDQA 1S2ZA 3A68A 5GU2X 1NF6A 4KVQA 2Z5RA 4ISMA 2XGWA 1EUMA 3GE4A 3GGYA 3PZAA 4P18A 3O7RA 4LQVA 2JD70 1BCFA 4RC5A 4DZ0A 3KA8A 1S30A 4CVSA 3Q4QA 4LPMA 4ZJKA 4U3GA 2XKQA 3E1MA 2G38B 4CY9A 2C41A 2MGYA 3KA4A 3KX9A 3M6JA 2FG4A 4YVZA 3GHQA 3RE7A 4ZTTA 3BVIA 1IESA 1OTKA 4II4B 1UMNA 1QYBA 1LB3A 2IY4A 2CEIA 1VLGA 4TO9A 2VXIA 3C1YA 3OGHA 3W54A 4ZKHA 3AF8X 3E1LA 2C6RA 3NP0X 4EVBA 4ML5A 4IXKA 3NOZX 3E1OA 1NFVA 4CYBA 5HJFA 3QB9A 1JYBA 5CMQA 5HU6D 1YUXA 3PVYB 4ITWA 4KXRB 3UFBA 3C21A 3EZ0A 4CVPA 2JD80 3RBCA 5FFBA 1DPSA 4REUA 3E1NA 2GYDA 1O9IA 2QF9A 1NNQA 3U90A 3F34A 3EZUA 3RAVA 1UVHA 4OYNA 3BKNA 3FRSA 3R2SA 4ZL5A 1B71A 1RCCA 4TOEA 1JI5A 2WWXB 3F35A 4AM5A 3C1ZA 1H96A 1RCEA 4DI0A 3PVRA 2CWLA 3AJQA 1Z6OM 4CMYA 4EVEA 3PW1A 5ERJA 5JDOA 2WLUA 2XJNA 3KA9A 3SHXA 1LKMA 3F33A 2ZG7X 3PWQC 4ZMCA 2CIHA 3AF7X 2YW6A 1S3QA 3MPSA 3KWOA 3NP2X 1NF4A 5D8YA 2YJKA 4XKSA 3JZAB 1ZUJA 1JIGA 2XJOA 1XZ1A 3ERZA 4XGSA 2YW7A 4YXMA 3PVTB 5FFEA 5JKMA 4WJG4 3UOFA 2F7NA 1ZS3A 3O7SA 1JI4A 3ES3A 3QZ3A 2IB0A 4M35A 3RD0A 4Z3BA 5J8WA 1VEQA 3AJPA 5D8PA 4CYAA 1YV1A 1N1QA 2CHPA 2W0OA 3F37A 3WVVA 2V2IA 3IS7A 4ETRA 4TODA 3GVYA 2HR5A 1TKOA 2CLBA 3V3KB 3GGZA 3VV9A 2D5KA 4MY7A 1GWGA 3BT5A 1JTSA 5E2DA 4TOCA 2UX1A 5AXSA 2VXXA 4II4A 3F39A 3Q4OA 3R2RA 3BVKA 3IS8A 1JREA 3HL1A 2V2MA 1L8HA 4KVRA 3C23A 3F36A 5D8QA 3KXUA 5D8RA 4CVRA 1SQ3A 3SH6A 4AM4A 4ZKWA 5FFDA 3R2HA 2Z5PA 3R2MA 4MUDA 3PVYA 2FHAA 4EVCA 4MJYA 3PWFA 4RC7B 3WVUA 2AR0A 1JKUA 5CMRA 2C2FA 3E1JA 2ZA8A 1DATA 3F32A 5FFCA 4TOHA 1R03A 2BJYA 1MFRA 5JKLA 2N02A 3KA3A 4RC8A 4ISPA 4DASA 4A25A 2OH3A 3BVEA 1IERA 1Z4AA 4PGKA 4TOAA 5HQOA 1YUZA 4ZKXA 4LPJA 2V2LA 4Y08A 3AF9X 2Z5QA 4XKTA 3IQ1A 3E2CA 5K52A 3EGMA 2QQYA 3QHBA 3ISFA 4LQHA 4LQJA 4Z5SA 5LG2A 2RBDA 2CN6A 2V2JA 2V2RA 4RC6B 1L8IA 3PW8A 4LPNA 4DYXA 5GOUA 5ERKA 3VVAA 5CZUA 2OKCA 4E40A 2FG8A 2PYBA 1MOJA 4PG0A 2Z90A 5FFAA 2ITBA 5J8SA 3PVTA 1TKPA 3PVRB 5GN8B 3PW1B 2FJCA 5E1UA 4ITTA 2OC5A 3AK8A 5GU0X 2FFXJ 3WVWA 1VEIA 3QD8A 3SIDA 3RGDA 2CF7A 2V2NA 4DYZA 3FSEA 3AJOA 2ZG8X 3BVLA 1O9RA 3TA8A 4YXJA 1XZ3A 3D19A 3LKDA 2HTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RCG A;  5FEJ A;  2BK6 A;  3Q4R A;  3QHC A;  3PW8 C;  1BFR A;  5JAC A;  5LG8 A;  4M32 A;  4MKU A;  3UOI A;  4RC5 B;  3FI6 A;  4AM2 A;  1TJO A;  2V2O A;  3OJ5 A;  3UNO A;  2JD6 0;  3R2O A;  5IX6 A;  2Y3Q A;  3KA6 A;  1F30 A;  4LYU A;  1LKO A;  4ZL6 A;  5JKM G;  2V2S A;  3H7G A;  4CMY V;  4E6K A;  2BKC A;  2XJM A;  5D8S A;  4RC7 A;  4MN9 A;  1Z6O A;  2ZA6 A;  3WNW A;  4R42 A;  2BW1 A;  2WTL A;  2WLA A;  3E1P A;  4PGI A;  5J9V A;  1LKP A;  3E6S A;  4TOF A;  4YKH A;  4KVS A;  5J93 A;  3AK9 A;  1VEL A;  1DVB A;  1QGH A;  4TW3 A;  3QVD A;  3PWQ A;  3R2K A;  2FKZ A;  1SOF A;  1JGC A;  3T9J A;  3VNX A;  1KRQ A;  2V2P A;  1BG7 A;  3A9Q A;  2ZA7 A;  1AEW A;  3BVF A;  4DYY A;  3ISE A;  4IWK A;  4TOG A;  4PG1 A;  2GS4 A;  3E1Q A;  5D8O A;  3HIU A;  2ZG9 X;  4DYU A;  4ZLW A;  5I4J A;  4TOB A;  4QUW A;  4IWJ A;  1TK6 A;  1RYT A;  1RCI A;  4RC6 A;  3E6R A;  5K53 A;  5C6F A;  4ERU A;  2YJJ A;  2CN7 A;  1HRS A;  2V15 A;  1JKV A;  3Q4N A;  5LBH A;  3F38 A;  5LS9 A;  5D8X A;  4CVT A;  2FZF A;  3FVB A;  5GN8 A;  2C2U A;  5HJH A;  5JKL G;  2ZUR X;  4M34 A;  2GYQ A;  2IU2 A;  2Z6M A;  2FL0 A;  2VZB A;  1J30 A;  4EVD A;  2CHI A;  4XKU A;  4DE6 A;  1RCD A;  5GU3 X;  2C2J A;  2CLU A;  4LYX A;  1F33 A;  2X17 0;  4M33 A;  1VJX A;  1FHA A;  3SE1 A;  2G4H A;  4LQN A;  3R2L A;  5GU1 X;  1S2Z A;  3A68 A;  5GU2 X;  1NF6 A;  4KVQ A;  2Z5R A;  4ISM A;  2XGW A;  1EUM A;  3GE4 A;  3PZA A;  4P18 A;  3O7R A;  4LQV A;  2JD7 0;  1BCF A;  4RC5 A;  4DZ0 A;  3KA8 A;  1S30 A;  4CVS A;  3Q4Q A;  4LPM A;  4ZJK A;  4U3G A;  2XKQ A;  3E1M A;  4CY9 A;  2C41 A;  3KA4 A;  3KX9 A;  2FG4 A;  3GHQ A;  3RE7 A;  4ZTT A;  3BVI A;  1IES A;  1OTK A;  4II4 B;  1UMN A;  1QYB A;  1LB3 A;  2IY4 A;  1VLG A;  4TO9 A;  2VXI A;  3OGH A;  4ZKH A;  3AF8 X;  3E1L A;  2C6R A;  3NP0 X;  4EVB A;  4ML5 A;  4IXK A;  3NOZ X;  3E1O A;  1NFV A;  4CYB A;  5HJF A;  3QB9 A;  1JYB A;  5CMQ A;  1YUX A;  3PVY B;  4ITW A;  3EZ0 A;  4CVP A;  2JD8 0;  3RBC A;  5FFB A;  1DPS A;  4REU A;  3E1N A;  2GYD A;  1O9I A;  2QF9 A;  1NNQ A;  3U90 A;  3F34 A;  3EZU A;  3RAV A;  1UVH A;  4OYN A;  3BKN A;  3R2S A;  4ZL5 A;  1B71 A;  1RCC A;  4TOE A;  1JI5 A;  3F35 A;  4AM5 A;  1H96 A;  1RCE A;  4DI0 A;  3PVR A;  3AJQ A;  1Z6O M;  4CMY A;  4EVE A;  3PW1 A;  5ERJ A;  2WLU A;  2XJN A;  3KA9 A;  3SHX A;  1LKM A;  3F33 A;  2ZG7 X;  3PWQ C;  4ZMC A;  2CIH A;  3AF7 X;  2YW6 A;  1S3Q A;  3MPS A;  3KWO A;  3NP2 X;  1NF4 A;  5D8Y A;  2YJK A;  4XKS A;  1ZUJ A;  1JIG A;  2XJO A;  1XZ1 A;  3ERZ A;  4XGS A;  2YW7 A;  3PVT B;  5FFE A;  5JKM A;  3UOF A;  2F7N A;  1ZS3 A;  3O7S A;  1JI4 A;  3ES3 A;  3QZ3 A;  2IB0 A;  4M35 A;  3RD0 A;  4Z3B A;  5J8W A;  1VEQ A;  3AJP A;  5D8P A;  4CYA A;  1YV1 A;  1N1Q A;  2CHP A;  2W0O A;  3F37 A;  3WVV A;  2V2I A;  3IS7 A;  4ETR A;  4TOD A;  3GVY A;  2HR5 A;  1TKO A;  2CLB A;  2D5K A;  4MY7 A;  1GWG A;  3BT5 A;  1JTS A;  5E2D A;  4TOC A;  2UX1 A;  5AXS A;  2VXX A;  4II4 A;  3F39 A;  3Q4O A;  3R2R A;  3BVK A;  3IS8 A;  1JRE A;  3HL1 A;  2V2M A;  1L8H A;  4KVR A;  3F36 A;  5D8Q A;  3KXU A;  5D8R A;  4CVR A;  1SQ3 A;  3SH6 A;  4AM4 A;  4ZKW A;  5FFD A;  3R2H A;  2Z5P A;  3R2M A;  4MUD A;  3PVY A;  2FHA A;  4EVC A;  4MJY A;  3PWF A;  4RC7 B;  3WVU A;  1JKU A;  5CMR A;  2C2F A;  3E1J A;  2ZA8 A;  1DAT A;  3F32 A;  5FFC A;  4TOH A;  1R03 A;  2BJY A;  1MFR A;  5JKL A;  3KA3 A;  4RC8 A;  4ISP A;  4DAS A;  4A25 A;  2OH3 A;  3BVE A;  1IER A;  1Z4A A;  4PGK A;  4TOA A;  5HQO A;  1YUZ A;  4ZKX A;  4LPJ A;  2V2L A;  4Y08 A;  3AF9 X;  2Z5Q A;  4XKT A;  3IQ1 A;  3E2C A;  5K52 A;  3EGM A;  2QQY A;  3QHB A;  3ISF A;  4LQH A;  4LQJ A;  4Z5S A;  5LG2 A;  2RBD A;  2CN6 A;  2V2J A;  2V2R A;  4RC6 B;  1L8I A;  3PW8 A;  4LPN A;  4DYX A;  5GOU A;  5ERK A;  5CZU A;  2FG8 A;  2PYB A;  1MOJ A;  4PG0 A;  2Z90 A;  5FFA A;  2ITB A;  5J8S A;  3PVT A;  1TKP A;  3PVR B;  5GN8 B;  3PW1 B;  2FJC A;  5E1U A;  4ITT A;  2OC5 A;  3AK8 A;  5GU0 X;  2FFX J;  3WVW A;  1VEI A;  3QD8 A;  3SID A;  3RGD A;  2CF7 A;  2V2N A;  4DYZ A;  3FSE A;  3AJO A;  2ZG8 X;  3BVL A;  1O9R A;  3TA8 A;  1XZ3 A;  2CEI A;  2HTN A; 
#chains in the Genus database with same CATH topology
 1RCG A;  5FEJ A;  2BK6 A;  3Q4R A;  3QHC A;  3PW8 C;  1BFR A;  5JAC A;  5LG8 A;  4M32 A;  4MKU A;  3UOI A;  4RC5 B;  3FI6 A;  4MXP A;  4AM2 A;  3FRR A;  1TJO A;  2V2O A;  3OJ5 A;  3UNO A;  2JD6 0;  3R2O A;  5IX6 A;  2Y3Q A;  3KA6 A;  1F30 A;  4LYU A;  1LKO A;  4ZL6 A;  5JKM G;  2V2S A;  3H7G A;  4CMY V;  4E6K A;  2BKC A;  2Y44 A;  2XJM A;  5D8S A;  4RC7 A;  4MN9 A;  1Z6O A;  2ZA6 A;  3WNW A;  4R42 A;  2BW1 A;  2WTL A;  2WLA A;  3E1P A;  4PGI A;  5J9V A;  1LKP A;  3E6S A;  4TOF A;  4YKH A;  4KVS A;  5J93 A;  3AK9 A;  1VEL A;  1DVB A;  1QGH A;  2V8T A;  4TW3 A;  3QVD A;  3PWQ A;  3R2K A;  2FKZ A;  1SOF A;  1JGC A;  3T9J A;  3VNX A;  1KRQ A;  2V2P A;  3KHK A;  1BG7 A;  3A9Q A;  2ZA7 A;  1AEW A;  3BVF A;  4DYY A;  3ISE A;  4W4L B;  4IWK A;  4TOG A;  4PG1 A;  2GS4 A;  3E1Q A;  5D8O A;  3HIU A;  2ZG9 X;  3DBY A;  4DYU A;  4ZLW A;  5I4J A;  4TOB A;  4QUW A;  4IWJ A;  1TK6 A;  1RYT A;  3JZ9 A;  1RCI A;  4RC6 A;  3E6R A;  5K53 A;  5C6F A;  4ERU A;  4X0J A;  2YJJ A;  2CN7 A;  1HRS A;  2V15 A;  4W4K B;  1JKV A;  3Q4N A;  5LBH A;  3F38 A;  5LS9 A;  5D8X A;  3N6O A;  2V8U A;  4CVT A;  2FZF A;  3FVB A;  5GN8 A;  2C2U A;  3L0M A;  5HJH A;  5JKL G;  2ZUR X;  4M34 A;  2GYQ A;  2IU2 A;  2Z6M A;  2FL0 A;  2VZB A;  1J30 A;  4EVD A;  5JDO B;  2CHI A;  4XKU A;  4DE6 A;  1RCD A;  5GU3 X;  2C2J A;  2CLU A;  4LYX A;  1F33 A;  2X17 0;  4M33 A;  1VJX A;  1FHA A;  3SE1 A;  2G4H A;  4LQN A;  3R2L A;  5GU1 X;  3KDQ A;  1S2Z A;  3A68 A;  5GU2 X;  1NF6 A;  4KVQ A;  2Z5R A;  4ISM A;  2XGW A;  1EUM A;  3GE4 A;  3GGY A;  3PZA A;  4P18 A;  3O7R A;  4LQV A;  2JD7 0;  1BCF A;  4RC5 A;  4DZ0 A;  3KA8 A;  1S30 A;  4CVS A;  3Q4Q A;  4LPM A;  4ZJK A;  4U3G A;  2XKQ A;  3E1M A;  2G38 B;  4CY9 A;  2C41 A;  2MGY A;  3KA4 A;  3KX9 A;  3M6J A;  2FG4 A;  4YVZ A;  3GHQ A;  3RE7 A;  4ZTT A;  3BVI A;  1IES A;  1OTK A;  4II4 B;  1UMN A;  1QYB A;  1LB3 A;  2IY4 A;  2CEI A;  1VLG A;  4TO9 A;  2VXI A;  3C1Y A;  3OGH A;  3W54 A;  4ZKH A;  3AF8 X;  3E1L A;  2C6R A;  3NP0 X;  4EVB A;  4ML5 A;  4IXK A;  3NOZ X;  3E1O A;  1NFV A;  4CYB A;  5HJF A;  3QB9 A;  1JYB A;  5CMQ A;  5HU6 D;  1YUX A;  3PVY B;  4ITW A;  4KXR B;  3UFB A;  3C21 A;  3EZ0 A;  4CVP A;  2JD8 0;  3RBC A;  5FFB A;  1DPS A;  4REU A;  3E1N A;  2GYD A;  1O9I A;  2QF9 A;  1NNQ A;  3U90 A;  3F34 A;  3EZU A;  3RAV A;  1UVH A;  4OYN A;  3BKN A;  3FRS A;  3R2S A;  4ZL5 A;  1B71 A;  1RCC A;  4TOE A;  1JI5 A;  2WWX B;  3F35 A;  4AM5 A;  3C1Z A;  1H96 A;  1RCE A;  4DI0 A;  3PVR A;  2CWL A;  3AJQ A;  1Z6O M;  4CMY A;  4EVE A;  3PW1 A;  5ERJ A;  5JDO A;  2WLU A;  2XJN A;  3KA9 A;  3SHX A;  1LKM A;  3F33 A;  2ZG7 X;  3PWQ C;  4ZMC A;  2CIH A;  3AF7 X;  2YW6 A;  1S3Q A;  3MPS A;  3KWO A;  3NP2 X;  1NF4 A;  5D8Y A;  2YJK A;  4XKS A;  3JZA B;  1ZUJ A;  1JIG A;  2XJO A;  1XZ1 A;  3ERZ A;  4XGS A;  2YW7 A;  4YXM A;  3PVT B;  5FFE A;  5JKM A;  4WJG 4;  3UOF A;  2F7N A;  1ZS3 A;  3O7S A;  1JI4 A;  3ES3 A;  3QZ3 A;  2IB0 A;  4M35 A;  3RD0 A;  4Z3B A;  5J8W A;  1VEQ A;  3AJP A;  5D8P A;  4CYA A;  1YV1 A;  1N1Q A;  2CHP A;  2W0O A;  3F37 A;  3WVV A;  2V2I A;  3IS7 A;  4ETR A;  4TOD A;  3GVY A;  2HR5 A;  1TKO A;  2CLB A;  3V3K B;  3GGZ A;  3VV9 A;  2D5K A;  4MY7 A;  1GWG A;  3BT5 A;  1JTS A;  5E2D A;  4TOC A;  2UX1 A;  5AXS A;  2VXX A;  4II4 A;  3F39 A;  3Q4O A;  3R2R A;  3BVK A;  3IS8 A;  1JRE A;  3HL1 A;  2V2M A;  1L8H A;  4KVR A;  3C23 A;  3F36 A;  5D8Q A;  3KXU A;  5D8R A;  4CVR A;  1SQ3 A;  3SH6 A;  4AM4 A;  4ZKW A;  5FFD A;  3R2H A;  2Z5P A;  3R2M A;  4MUD A;  3PVY A;  2FHA A;  4EVC A;  4MJY A;  3PWF A;  4RC7 B;  3WVU A;  2AR0 A;  1JKU A;  5CMR A;  2C2F A;  3E1J A;  2ZA8 A;  1DAT A;  3F32 A;  5FFC A;  4TOH A;  1R03 A;  2BJY A;  1MFR A;  5JKL A;  2N02 A;  3KA3 A;  4RC8 A;  4ISP A;  4DAS A;  4A25 A;  2OH3 A;  3BVE A;  1IER A;  1Z4A A;  4PGK A;  4TOA A;  5HQO A;  1YUZ A;  4ZKX A;  4LPJ A;  2V2L A;  4Y08 A;  3AF9 X;  2Z5Q A;  4XKT A;  3IQ1 A;  3E2C A;  5K52 A;  3EGM A;  2QQY A;  3QHB A;  3ISF A;  4LQH A;  4LQJ A;  4Z5S A;  5LG2 A;  2RBD A;  2CN6 A;  2V2J A;  2V2R A;  4RC6 B;  1L8I A;  3PW8 A;  4LPN A;  4DYX A;  5GOU A;  5ERK A;  3VVA A;  5CZU A;  2OKC A;  4E40 A;  2FG8 A;  2PYB A;  1MOJ A;  4PG0 A;  2Z90 A;  5FFA A;  2ITB A;  5J8S A;  3PVT A;  1TKP A;  3PVR B;  5GN8 B;  3PW1 B;  2FJC A;  5E1U A;  4ITT A;  2OC5 A;  3AK8 A;  5GU0 X;  2FFX J;  3WVW A;  1VEI A;  3QD8 A;  3SID A;  3RGD A;  2CF7 A;  2V2N A;  4DYZ A;  3FSE A;  3AJO A;  2ZG8 X;  3BVL A;  1O9R A;  3TA8 A;  4YXJ A;  1XZ3 A;  3D19 A;  3LKD A;  2HTN A; 
#chains in the Genus database with same CATH homology
 1RCG A;  5FEJ A;  2BK6 A;  3Q4R A;  3QHC A;  3PW8 C;  1BFR A;  5JAC A;  5LG8 A;  4M32 A;  4MKU A;  3UOI A;  4RC5 B;  3FI6 A;  4MXP A;  4AM2 A;  3FRR A;  1TJO A;  2V2O A;  3OJ5 A;  3UNO A;  2JD6 0;  3R2O A;  5IX6 A;  2Y3Q A;  3KA6 A;  1F30 A;  4LYU A;  1LKO A;  4ZL6 A;  5JKM G;  2V2S A;  3H7G A;  4CMY V;  4E6K A;  2BKC A;  2Y44 A;  2XJM A;  5D8S A;  4RC7 A;  4MN9 A;  1Z6O A;  2ZA6 A;  3WNW A;  4R42 A;  2BW1 A;  2WTL A;  2WLA A;  3E1P A;  4PGI A;  5J9V A;  1LKP A;  3E6S A;  4TOF A;  4YKH A;  4KVS A;  5J93 A;  3AK9 A;  1VEL A;  1DVB A;  1QGH A;  2V8T A;  4TW3 A;  3QVD A;  3PWQ A;  3R2K A;  2FKZ A;  1SOF A;  1JGC A;  3T9J A;  3VNX A;  1KRQ A;  2V2P A;  3KHK A;  1BG7 A;  3A9Q A;  2ZA7 A;  1AEW A;  3BVF A;  4DYY A;  3ISE A;  4W4L B;  4IWK A;  4TOG A;  4PG1 A;  2GS4 A;  3E1Q A;  5D8O A;  3HIU A;  2ZG9 X;  3DBY A;  4DYU A;  4ZLW A;  5I4J A;  4TOB A;  4QUW A;  4IWJ A;  1TK6 A;  1RYT A;  3JZ9 A;  1RCI A;  4RC6 A;  3E6R A;  5K53 A;  5C6F A;  4ERU A;  4X0J A;  2YJJ A;  2CN7 A;  1HRS A;  2V15 A;  4W4K B;  1JKV A;  3Q4N A;  5LBH A;  3F38 A;  5LS9 A;  5D8X A;  3N6O A;  2V8U A;  4CVT A;  2FZF A;  3FVB A;  5GN8 A;  2C2U A;  3L0M A;  5HJH A;  5JKL G;  2ZUR X;  4M34 A;  2GYQ A;  2IU2 A;  2Z6M A;  2FL0 A;  2VZB A;  1J30 A;  4EVD A;  5JDO B;  2CHI A;  4XKU A;  4DE6 A;  1RCD A;  5GU3 X;  2C2J A;  2CLU A;  4LYX A;  1F33 A;  2X17 0;  4M33 A;  1VJX A;  1FHA A;  3SE1 A;  2G4H A;  4LQN A;  3R2L A;  5GU1 X;  3KDQ A;  1S2Z A;  3A68 A;  5GU2 X;  1NF6 A;  4KVQ A;  2Z5R A;  4ISM A;  2XGW A;  1EUM A;  3GE4 A;  3GGY A;  3PZA A;  4P18 A;  3O7R A;  4LQV A;  2JD7 0;  1BCF A;  4RC5 A;  4DZ0 A;  3KA8 A;  1S30 A;  4CVS A;  3Q4Q A;  4LPM A;  4ZJK A;  4U3G A;  2XKQ A;  3E1M A;  2G38 B;  4CY9 A;  2C41 A;  2MGY A;  3KA4 A;  3KX9 A;  3M6J A;  2FG4 A;  4YVZ A;  3GHQ A;  3RE7 A;  4ZTT A;  3BVI A;  1IES A;  1OTK A;  4II4 B;  1UMN A;  1QYB A;  1LB3 A;  2IY4 A;  2CEI A;  1VLG A;  4TO9 A;  2VXI A;  3C1Y A;  3OGH A;  3W54 A;  4ZKH A;  3AF8 X;  3E1L A;  2C6R A;  3NP0 X;  4EVB A;  4ML5 A;  4IXK A;  3NOZ X;  3E1O A;  1NFV A;  4CYB A;  5HJF A;  3QB9 A;  1JYB A;  5CMQ A;  5HU6 D;  1YUX A;  3PVY B;  4ITW A;  4KXR B;  3UFB A;  3C21 A;  3EZ0 A;  4CVP A;  2JD8 0;  3RBC A;  5FFB A;  1DPS A;  4REU A;  3E1N A;  2GYD A;  1O9I A;  2QF9 A;  1NNQ A;  3U90 A;  3F34 A;  3EZU A;  3RAV A;  1UVH A;  4OYN A;  3BKN A;  3FRS A;  3R2S A;  4ZL5 A;  1B71 A;  1RCC A;  4TOE A;  1JI5 A;  2WWX B;  3F35 A;  4AM5 A;  3C1Z A;  1H96 A;  1RCE A;  4DI0 A;  3PVR A;  2CWL A;  3AJQ A;  1Z6O M;  4CMY A;  4EVE A;  3PW1 A;  5ERJ A;  5JDO A;  2WLU A;  2XJN A;  3KA9 A;  3SHX A;  1LKM A;  3F33 A;  2ZG7 X;  3PWQ C;  4ZMC A;  2CIH A;  3AF7 X;  2YW6 A;  1S3Q A;  3MPS A;  3KWO A;  3NP2 X;  1NF4 A;  5D8Y A;  2YJK A;  4XKS A;  3JZA B;  1ZUJ A;  1JIG A;  2XJO A;  1XZ1 A;  3ERZ A;  4XGS A;  2YW7 A;  4YXM A;  3PVT B;  5FFE A;  5JKM A;  4WJG 4;  3UOF A;  2F7N A;  1ZS3 A;  3O7S A;  1JI4 A;  3ES3 A;  3QZ3 A;  2IB0 A;  4M35 A;  3RD0 A;  4Z3B A;  5J8W A;  1VEQ A;  3AJP A;  5D8P A;  4CYA A;  1YV1 A;  1N1Q A;  2CHP A;  2W0O A;  3F37 A;  3WVV A;  2V2I A;  3IS7 A;  4ETR A;  4TOD A;  3GVY A;  2HR5 A;  1TKO A;  2CLB A;  3V3K B;  3GGZ A;  3VV9 A;  2D5K A;  4MY7 A;  1GWG A;  3BT5 A;  1JTS A;  5E2D A;  4TOC A;  2UX1 A;  5AXS A;  2VXX A;  4II4 A;  3F39 A;  3Q4O A;  3R2R A;  3BVK A;  3IS8 A;  1JRE A;  3HL1 A;  2V2M A;  1L8H A;  4KVR A;  3C23 A;  3F36 A;  5D8Q A;  3KXU A;  5D8R A;  4CVR A;  1SQ3 A;  3SH6 A;  4AM4 A;  4ZKW A;  5FFD A;  3R2H A;  2Z5P A;  3R2M A;  4MUD A;  3PVY A;  2FHA A;  4EVC A;  4MJY A;  3PWF A;  4RC7 B;  3WVU A;  2AR0 A;  1JKU A;  5CMR A;  2C2F A;  3E1J A;  2ZA8 A;  1DAT A;  3F32 A;  5FFC A;  4TOH A;  1R03 A;  2BJY A;  1MFR A;  5JKL A;  2N02 A;  3KA3 A;  4RC8 A;  4ISP A;  4DAS A;  4A25 A;  2OH3 A;  3BVE A;  1IER A;  1Z4A A;  4PGK A;  4TOA A;  5HQO A;  1YUZ A;  4ZKX A;  4LPJ A;  2V2L A;  4Y08 A;  3AF9 X;  2Z5Q A;  4XKT A;  3IQ1 A;  3E2C A;  5K52 A;  3EGM A;  2QQY A;  3QHB A;  3ISF A;  4LQH A;  4LQJ A;  4Z5S A;  5LG2 A;  2RBD A;  2CN6 A;  2V2J A;  2V2R A;  4RC6 B;  1L8I A;  3PW8 A;  4LPN A;  4DYX A;  5GOU A;  5ERK A;  3VVA A;  5CZU A;  2OKC A;  4E40 A;  2FG8 A;  2PYB A;  1MOJ A;  4PG0 A;  2Z90 A;  5FFA A;  2ITB A;  5J8S A;  3PVT A;  1TKP A;  3PVR B;  5GN8 B;  3PW1 B;  2FJC A;  5E1U A;  4ITT A;  2OC5 A;  3AK8 A;  5GU0 X;  2FFX J;  3WVW A;  1VEI A;  3QD8 A;  3SID A;  3RGD A;  2CF7 A;  2V2N A;  4DYZ A;  3FSE A;  3AJO A;  2ZG8 X;  3BVL A;  1O9R A;  3TA8 A;  4YXJ A;  1XZ3 A;  3D19 A;  3LKD A;  2HTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...