3TADC

Crystal structure of the liprin-alpha/liprin-beta complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
252
structure length
252
Chain Sequence
PFAKWTKEQVCSWLAEQGLGSYLSSGKHWIISGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNYGKLDFNWVTRWLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDENSITPSEVQQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Liprin-mediated large signaling complex organization revealed by the liprin-alpha/CASK and liprin-alpha/liprin-beta complex structures
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Liprin-alpha-2
total genus 84
structure length 252
sequence length 252
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00536 SAM_1 SAM domain (Sterile alpha motif)
C PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3tadC01
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3tadC03
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3tadC02
2QB0B 1SXDA 2Y9TA 1COKA 2DKZA 5F3XB 3BS7A 1UQVA 2D8CA 4PZOA 2QB0A 2K4PA 3HILA 1PK3A 2QKQA 5JRTA 3TACB 2QARA 2KSOB 2KIVA 1X40A 3IDWA 5JU5A 1WWVA 1SGGA 2E8NA 1X9XA 3BQ7A 1LKYB 3H8MA 1B4FA 1SV0C 2FE9A 4PZNA 1PK1A 3KKAC 2LPEA 2KG5A 2YTUA 2ESEA 2EANA 1KW4A 2KSOA 1RG6A 1X66A 3K1RB 1PK1B 2E8MA 5J8YC 2K60A 4NJ8A 2EAOA 2B6GA 2E8PA 1LKYA 2JV3A 2GLEA 1OXJA 2DKXA 2Y9UA 3SEIA 2F44A 4NL9C 1DXSA 2DL0A 3TADC 2L5YA 5JTIA 2F8KA 1OW5A 3KKAA 2KMDA 1V85A 5J8YA 1Z1VA 1UCVA 2F3NA 1SV0A 1B0XA 4NL9A 2D3DA 1F0MA 2EAMA 1JI7A 4MHVA 2EAPA 2E8OA 2QARB 1WWUA 1SV4A 1SXEA 1V38A 3BS5A 2QB1A 3BS5B 5KNIA 4RQNA 2KE7A 5L1MA 3SENA 4RQMA 3TADA 2LMRA 4IS7A 2ES6A
chains in the Genus database with same CATH superfamily
2BKEA 3C2KA 3CYMA 5EE1A 2A1JB 3C1ZA 1VDVA 1Y88A 2LKYA 2HMXA 1PK3A 2M0NA 1RXVA 4UASA 4ICAA 1Z3EB 5DGBA 2XICA 3UMCA 3EUB2 4J9RA 4KLQA 4DEZA 1PUZA 4CE6A 4DSJA 5AI0A 3PX0A 4KMUA 2BHNA 2PXIA 3OHAA 4ED1A 3C1YA 2XI9A 7ICRA 4DSFA 1YZ6A 4IL6U 4PZNA 2MA1A 2RLTA 5DQHA 1L7MA 3H0LB 4Y2SA 3JPSA 4KLGA 1X66A 4YD1A 4ECSA 9ICAA 5ALNA 3Q8LA 2KZMA 1ZQQA 5E79U 8ICKA 5KTQA 2W9CB 5AK6A 4XQ8A 2F1HA 5KFFA 4M9LA 3PV8A 9ICLA 5J2IA 5EWGA 2YMPA 2A1AA 3ZI4A 4IQWA 2BPGA 4KLEA 5TISU 4QWCA 4UAWA 5TZVA 4PGQA 2CN1A 4QWBA 5DBBA 1ZQOA 4P4PA 3BQTA 4QZDA 3RRGA 4UB5A 2IOFA 4AYBF 1DGSA 3WKBA 5KFPA 2ZJ8A 4K4HA 2KIWA 3EZ5A 1WWUA 3PSFA 5KG7A 2UVUA 2KOBA 3BS5A 3A0HU 2IMWP 5KNIA 1ZD3A 2AH5A 3FC4A 2W9MA 1Z4OA 2XGPA 4ED2A 4ECZA 2FLNA 3PSTA 3M6KA 2E1EA 1ZRMA 2QB0B 4QZGA 2OXOA 4EENA 5KL1B 2KP7A 1ZQWA 5KT5A 3SZ2A 3I76A 3RH6A 4FO6A 1Q3UA 3IG5A 2WF9A 1URJA 5AM1A 3NTUA 2VA2A 2GH1A 4K4GA 1SGGA 3H8SA 5ALIA 5F9LA 2KVSA 5EE9A 4QZAA 4UB6U 3QYPA 2DPJA 4UAUA 4RPXA 5J2CA 2JEGA 3CW2C 4YFKA 5ALJA 9ICRA 4ECRA 1ZOLA 2KKPA 1ZQMA 4DL4A 4DL7A 1NKBA 2ZJ5A 3JPQA 4ZH4A 3HT3A 5CHGA 4F72A 3F2CA 2B6GA 9ICFA 3UQ2A 3Q8KA 3BZCA 2R8JA 2NRTA 5AKIA 5KFXA 4I28A 1ZQXA 2JEJA 1L3TA 2E3TA 2ZIWA 3H0RB 4RQ3A 4ED7A 4M9JA 3OHBA 3SV3A 4J9NA 2ZIXB 4PL2A 5DGAA 4FZNA 2ZIVA 2W11A 4YVZA 3KOOA 3AN1A 3Q8PB 1NK8A 1Z1VA 4F93B 4OJ6A 2M9NA 2YB1A 1JROA 2KVCA 5AHXA 1SKWA 5KFIA 5AM3A 5J0OA 4NM1A 5KFMA 3VC8A 1XU4A 4C8LA 4I2IA 8ICXA 4Q44A 5DG7A 4RQNA 5L1MA 2XY5A 2JH1A 1RZTA 1FEZA 2PMZC 4DSLA 2AHOB 4CGZA 4ELVA 1O03A 3SMVA 1RYRA 1DGJA 3H8JA 5IIJA 5L1KA 1ZJNA 2QB0A 4GFJA 2QKQA 4DQQA 2EQYA 1TK0A 2MRLA 4FBUA 2G0AA 5EE3A 2FMSA 1WWVA 8ICUA 4ED0A 4EELA 5AM5A 4M9HA 3ONNA 1S8OA 3MR5A 4I2FA 4NLNA 5D4BA 1SKRA 4LVSA 3ORYA 1KBUA 5K4LA 2VKQA 5KG6A 1QSLA 2W8KA 1RG6A 3SD7A 4GXKA 2IA6A 1SZPA 2ZIUB 5AKJA 5J0UA 2BQRA 1AROP 4DLGA 4KLOA 4AYBC 4Y2JA 3T5HA 5ALFA 2OYYA 3L4PA 4TUQA 2WFAA 2G08A 4NXZA 5J2EA 4EBDA 4IR1A 3GIJA 2K8AA 4B9VA 1ZQSA 4PPXA 1JN3A 3PX4A 1XNSA 3RR8A 3ISCA 1D8YA 1QLNA 3CP8A 4QNLA 3NVVA 3KZIU 1NK7A 1ZJMA 9ICNA 3DV9A 1CUKA 5KFOA 5ALGA 8ICZA 2MUTA 8ICHA 3HP6A 2JGAA 2HCFA 3ALRA 3KD3A 4NLCA 4EYHB 2HW3A 3TADA 1KQQA 7ICUA 4O0IA 3F5AA 4UB3A 1ZQ1C 2R8GA 4XA5A 3EW9A 4TQRA 3HKZC 3HILA 5AIAA 3C5GA 2LYAA 4JWNA 3AU2A 3ZDEA 1HUOA 3UMGA 7ICJA 2K4HA 3BQ7A 1NJXA 1IG6A 2XY7A 3RR7A 4BJQA 4C4TA 5J2DA 2ZIUA 3UXPA 4O3MA 9ICQA 3SV4A 4CRXA 2JEIA 1B22A 2ESEA 1S77D 2BCQA 4B9UA 2H3FA 3GV7B 5GTIU 2DBYA 1ZQGA 5ALPA 4IR9A 4YD2A 5DB9A 1L7OA 2PKEA 1ZQUA 5KG5A 4UAYA 5L1IA 5G5GA 2ZUCA 3GILA 2JV3A 1L8OA 4FE3A 1QTMA 3GU3A 4Z6CA 4F2SA 5IINA 1SL1A 3WKCA 8ICCA 4Y2VA 9ICWA 5AK3A 5DLFA 1XO1A 7ICOA 3IRUA 3QU4A 2HHQA 5KAFU 1OUQA 2JEFA 4HAIA 4DFDA 1KLNA 3GIKA 5KFTA 3C23A 3IG8A 1B0XA 1RQNA 5KFWA 2DQNB 1F5SA 3WK9A 1T94A 4EEKA 1N62A 4RQ2A 2EAPA 1SZHA 2A3VA 1SV4A 2WF8A 2XC9A 2AGOA 5KFNA 2GOLA 1F44A 2UVWA 3AUOA 4RPZA 3D2SA 1BPZA 4OD0A 3RJGA 5CP2A 3Q8RB 2LYBA 2D8CA 1S10A 3SAFA 4F92B 4EX6A 3M8RA 3VCBA 4RQ8A 1TKDA 1KEJA 2BDUA 4K4IA 1N61A 2XGQA 4PHDA 3PMLA 4X5VA 2YMQA 5KFVA 2BGWA 4P2HA 4C8OA 9ICVA 4FFDA 1YZ7A 5ALYA 1FFUA 1IM4A 3QU2A 1Q3VA 4UW9A 7ICVA 1RYSA 4RUCA 2IHNA 2UVRA 3GZFA 4LZGA 3N7SC 7ICEA 1PVRA 3MR3A 4RT2A 4Q8FA 9ICUA 4F5RA 3FM9A 3FYHA 1Z00B 2HHXA 2HHWA 2JZBB 4NJ8A 2LI6A 2EAOA 3RB6A 1Z00A 5J2GA 4EZ6A 4P0QB 5ALUA 9ICXA 1SWWA 3TFSA 2FDRA 2G5HB 2KJ5A 4OO1J 4QZCA 1KTQA 2KEYA 1NKCA 2GLEA 3MGVA 1T3QA 3GV5B 7ICHA 1JRPA 4YXJA 2KKVA 3A0BU 1TK5A 4QWAA 2ZUBA 4P0PB 2VANA 1LVHA 5J2JA 4Y2YA 1WCLA 4PJ0U 4YR2A 3RB3A 3T79A 4CDGA 2RHFA 1ZQJA 3T5JA 4US8A 2I1QA 4O9MA 4KLLA 2KZZA 4U7CA 1UPHA 1NZPA 5IIOA 1XSNA 7ICPA 2KFNA 1TAUA 1B43A 4RQ1A 3TI0A 3NVZA 4O3PA 1KL9A 5ALQA 4PHAA 4UB2A 4EBEA 2AGPA 4NLKA 5ALOA 1FIQA 3ZDCA 2RP5A 5J2BA 2N1RA 1U4BA 4O5EA 2ZJAA 5DBCA 1NNLA 4O5KA 9ICGA 1KDHA 2P6UA 4UATA 4BWJA 1KFTA 1KKXA 4YMNA 1X2IA 4DS4A 4US9A 8ICLA 4C4RA 3PO5A 5KL8B 2FMQA 5DB7A 3MR2A 3RRHA 1X9XA 3PSIA 4DL6A 4DSIA 4Q43A 3PVXA 4G3IA 1B4FA 7ICQA 1T8EA 4YR0A 5KFRA 1BNOA 2FE9A 4O3NA 3EPGA 3KKAC 4ECVA 1IIPA 2FI1A 3IV6A 3WK6A 3U26A 1RYUA 5T14A 2XVTA 2NYVA 3KBBA 4F2RA 4QW8A 1ZQLA 2E8PA 1ZQDA 4ELUA 3RAQA 1TAQA 1X9WA 5DQIA 4TUSA 3C21A 5BOMA 2MAXA 4Z6FA 4QIWF 2F8KA 2G06A 4NLZA 3H8WA 1QQ7A 5J8YA 4KMOB 2I5HA 5B5EU 3Q8QB 2ZIVB 2F3NA 8ICAA 3KHRA 3GV8B 3KZXA 2ASJA 1F0MA 2PI5A 2CXYA 3F53A 4JV0A 1MN8A 4I2GA 1KN5A 5J2FA 3ED5A 4R63A 4DFPA 2Y1JA 2ASDA 3R9KA 4DFKA 3NRWA 4KLJA 4C0ZA 3NGDA 1XSPA 1X9SA 3ZDAA 4DQIA 4RPYA 2BZFA 1L5UA 5KT2A 4RNMA 4UAVA 4F5PA 3PX6A 3UM9A 2NRWA 1V97A 1KRPA 1X40A 4MFAA 8ICFA 1UT5A 2ATLA 4R65A 1O08A 3K1ZA 5KFZA 2HBKA 4TQSA 3GDXA 4QW9A 2KICA 3OTQA 4ECTA 2KG5A 2QLTA 3C2LA 4KX3A 3THVA 3V7KA 7ICFA 4RQ7A 2HHUA 1JX4A 8ICQA 1P7DA 2YY6A 2CPRA 2C22A 4UARA 1ZQNA 3JPRA 2EZYA 5C5JA 2FPMA 3V7LA 5KFDA 1BVSA 2FPLA 1L3VA 8ICJA 4I29A 5KFCA 3DDHA 2WF5A 4MF2A 2PFQA 1S0NA 2K8CB 9ICCA 3RJFA 5AIBA 4RUAA 2Y1IA 1UCVA 1V9PA 1HEKA 1MQ3A 2R8KA 4C8MA 2BPFA 4GC7A 2OEHA 1WYGA 3MDCA 2J6TA 2MU2A 4CF3A 5KT4A 5AKEA 3F2BA 3JPOA 3MGIA 4B9TA 4IQTA 1S9FA 5CEHA 3LDAA 5KFHA 4GXJA 2HOFA 3QE9Y 5CRXA 5DDYA 5DDMA 3RB0A 5KFEA 2EZZA 3BDPA 1UQVA 3ISDA 4JK1A 5KFUA 3B0YA 2A1JA 2WB1C 2DPIA 3NVYA 4F91B 5AI8A 8ICNA 5ALXA 4O5CA 1S97A 2GWSA 2E8NA 3H7IA 2PFNA 5IIMA 1IV8A 3EWAA 3WK5A 4UQGA 2W9BA 4ED3A 3UXOA 1QSYA 4ECYA 1COOA 1SV0C 4P4MA 2LPEA 4NLBA 1S5LU 3GIIA 2CRXA 2PFOA 4J9QA 4RNOA 3N7PD 4IC9A 1BPYA 2FMPA 4CNQA 4ED8A 4DOCA 3NVWA 1WUDA 1BPEA 2HI0A 2WAQC 1L3SA 1L3UA 2W8LA 1H38A 2IOFK 3M9NB 4OJOA 1C7YA 3WK8A 3PW7A 1Z1BA 3TFRA 5JTIA 1V85A 1BPDA 3C2MA 1NZBA 3ETRA 2BQ3A 5BPCA 5IIIA 4JV2A 3NASA 4DL2A 5CR0A 2AJQA 1L7PA 1DRGA 1RXWA 4MHVA 5AK5A 3T5LA 5AM4A 5D46A 3F2DA 4ELTA 2KTQA 3BS5B 3IN5A 2XY6A 2YMMA 1ZQYA 2ODGA 5KT7A 5IIKA 2W7OA 7ICKA 3H40A 1C20A 3BS7A 5HR6A 5EE0A 5J2AA 2QARA 3N97B 2BR0A 3TQ1A 2H5XA 4I2JA 4J03A 4R8UB 3M8SA 2F8LA 4F5NA 1MQ2A 4PL1A 3KHLA 2WAQF 2WHEA 2P35A 3M6ZA 4M9GA 2BPCA 3AQFA 4Y2RA 1SB3C 1DK2A 3HJEA 2C2DA 2IHMA 4I2CA 3SQIA 2KK0A 2RDIA 3AEVA 8ICYA 1T4GA 5DQGA 4DOAA 4B9MA 3L3FX 4FS2A 4PHEA 9ICOA 2F1JA 2BQUA 5AKXA 1M6YA 1BPXA 2AU0A 2F44A 2ZIWB 4Y2TA 5AM2A 2YQEA 3TARA 5ALZA 2V4QA 1MC8A 2OCEA 1ZQFA 1PZNA 3G6XA 3M7DA 2W9AA 2EH9A 3JPPA 4RT3A 1NI3A 4YN4A 2JRZA 4KITB 7ICSA 2G09A 2I9GA 2KNJA 2JHDA 3PNCA 8ICWA 1N5XA 4B9SA 4I2BA 4P4OA 3IM1A 3C5FA 4A8EA 8ICPA 4GIBA 5ALRA 5AKGA 1ECWA 4PH5A 3PW0A 2I6XA 7ICNA 2BDPA 4RQ4A 5KT6A 4ECWA 1ZYQA 1QSSA 2LMRA 4I2HA 3WK7A 2C28A 4QZFA 4NY8A 2R8HA 2DKZA 1RPLA 8ICIA 5KFLA 5EOZA 4J9MA 5ALHA 3DEEA 4UBBA 1T7PA 3J81j 1YT3A 1UT8A 4BXOA 3QU7A 3WK4A 2HBMA 4RNNA 1RM6C 2FLPA 4IQVA 5B66U 4IRCA 4FS1A 1N60A 3LWMA 2OHFA 3S6JA 5KG1A 3SI8A 1ZRNA 2H3VA 3QUTA 4QZ8A 3G6YA 2YTUA 1KW4A 1HIWA 2F76X 2WTFA 2Z7JA 9ICKA 1NJZA 3RJEA 3O0FA 3HPOA 4M47A 3OJUA 2PFPA 3D6JA 3AQEA 5EWEA 3V6HA 1ZQRA 5KG2A 4TURA 5DB8A 1U49A 4QZHA 1QH9A 1RDFA 3SEIA 4KTQA 1K1QA 2YB4A 1L7NA 1X9MA 3FDSA 3OPXA 5KG3A 3RJKA 2W55A 3C29A 5AKZA 4BDPA 4UB4A 1ZQKA 2YMLA 5HHIA 4YXMA 1UA0A 2JH7A 1ZQTA 1QQ6A 1TAMA 2HBLA 1ZQZA 3UXNA 1JI7A 1NK4A 2E1FA 3PW5A 2E8OA 1CEZA 4M6WA 4J9OA 5GTHU 1S0OA 4M9NA 5KFSA 4USAA 1XC9A 2C2RA 4OJLA 4IRDA 3I1YA 3AMZA 1KFSA 2K8BB 1COKA 2E5SA 4KLUA 5L9XA 2K4PA 2W3RA 3T3FA 5AI6A 1N48A 2PMZF 1IXRA 1SL0A 2R8IA 1EXNA 3SAHA 1NK5A 4U6PA 1J2NA 1VLBA 3MDAA 3G6VA 2KD1A 4Q45A 1NKEA 5FP0A 3ISBA 1BGXT 4B9LA 4DF4A 1D8LA 5A0LA 3NS1A 5CWRA 3GQCA 2EANA 4I2AA 3MABA 2KFZA 1U45A 4QJFB 3FAHA 4QZBA 3MBYA 2EZXA 3EPIA 1L6NA 1GO3F 4Y2UA 3PR5B 2FPKA 1RQLA 3SR6A 1T3NA 4TUPA 2KZ3A 4NWIA 4GC6A 1NK9A 3UPQA 3PSPA 3PMNA 5J0RA 4NM2A 9ICJA 3OSNA 5AM0A 1OXJA 4DWIA 4NL9C 3JPNA 3QUQA 2AXTU 3RH4A 1U9LA 4J9LA 2DL0A 2KJ8A 3GIMA 2PI4A 2HDOA 2WF6A 4DQPA 4M6WB 1SKSA 1ZD5A 3LK9A 4DL3A 4YMMA 1FFVA 5KFKA 4GXIA 1MSWD 2Y0SC 4R66A 4MEYA 2VA8A 3TAQA 4RQ6A 5F9NA 4EZ9A 3V6KA 1SXEA 3LVVA 5L1LA 3KTQA 1PVPA 1ZQPA 2QB1A 2ZUDA 4DQSA 1A6SA 3QU9A 2HHSA 4F4ZA 4O3SA 2DWQA 1X42A 1ZQAA 2ES6A 2ALZA 1D8BA 4KLMA 5C0YA 3E0FA 5ALLA 1SWVA 3PW2A 3QEAZ 2RQ5A 3LVWA 4DQRA 2H3IA 2KIVA 2FLLA 7ICGA 4C8NA 4DL5A 5DB6A 4LJXA 2O6KA 5KAIU 3NRZA 1N2XA 2HOIA 2D6FC 2W3SA 2F2AB 2Y0SF 4KLSA 1NJYA 3ZDDA 4RQ5A 5CB1A 3BQ2A 2B21A 2DGZA 5J0PA 4KLFA 1AQ6A 3AM9A 3AL0B 1WCNA 3OSPA 5BOLA 3TKAA 2OWOA 2E8MA 2NRXA 3GFKB 2ISOA 4QZEA 4PGXA 3CRXA 2GO7A 4DO9A 5ALEA 5HNKA 3N4MB 1Z19A 2AGQA 4EBCA 2HBJA 3L5KA 2DKXA 2HOQA 2G07A 4ED6A 1DXSA 5J0QA 5AI4A 4QZ9A 1NJWA 4KLHA 3KFUF 4EEYA 1XS9D 3KKAA 2VJ4A 2K4EA 2A19A 4FBTA 2WF7A 4C8KA 5J0YA 3MC1A 1ZETA 3ZDBA 3RH5A 3LWLA 1HUZA 5HR7A 3QU5A 4Y2QA 4EX7A 3UMBA 2W04A 1ZQVA 5KFGA 9ICHA 2G5IB 2LYHA 3M9MB 1S0VA 5KT3A 2JXJA 3M1YA 5AK4A 1JMSA 2LHTA 4J9SA 1ZQEA 4FZMA 1TVAA 5AKYA 2K89A 4B9NA 5KFYA 2P66A 4NV0A 4F50A 2RDJA 1XSLA 1DK3A 3OGUA 3QUBA 3SYZA 1U47A 2KJ9A 1VJ5A 5J2KA 4UBCA 4DF8A 5JU5A 1D9DA 5AKHA 2IBKA 5H2FU 3RF9A 4WJ3B 3T5KA 5CA7A 8ICRA 3AU6A 2EDUA 3WKEA 1QCKA 7ICTA 4M2YA 3TANA 4YP3A 1JXLA 3K75D 3E2EA 4LZDA 4YG2A 3C28A 4R8UA 2HVIA 5J0XA 9ICBA 2H3QA 1QQ5A 3SAGA 4OJPA 3MFHA 5AKLA 3PO4A 3HW8A 2ZTEA 3IHQB 4ZOHC 2NO5A 7ICIA 2Y9UA 4ECQA 3QXGA 2ZG6A 2MUTB 1JUDA 1Q8KA 2L5YA 2BCSA 1OW5A 1N5WA 2KMDA 3HRDD 4Z6EA 3RJIA 5ALKA 4PGYA 4E0DA 2W54A 3D2NA 5DBAA 2ZXHA 1ZQBA 1A77A 8ICSA 3F5EA 1SV0A 3MR6A 2DF4B 2LBOA 1S0MA 4F5QA 3ZD9A 2KN7A 3NUQA 1J97A 4RQ0A 4Y2PA 1ZQHA 1SIJA 2W43A 4DSEA 1BNPA 4OJ5A 4MFCA 2KE7A 5AKKA 4DLEA 3SENA 5ALSA 3WU2U 1FO4A 4JUZA 1HJPA 3QZ8A 3PR4A 2K4IA 3HKZF 2Y9TA 3M9OB 3QEBZ 4BX9C 3RJJA 5J29A 2NRZA 4ECUA 2MSNA 4UB1A 9ICEA 3JPTA 3MFIA 3IDWA 4I2EA 9ICMA 3KHHA 5ALMA 2W9BB 5J0TA 1UHUA 4C7YA 4KN4A 3H8MA 4KLTA 5KG0A 1PVQA 1JXEA 5EWFA 3HX0A 1CRXA 2NV3A 1U48A 1MA7A 4JV1A 4M04A 4PHPA 2W03A 1TFRA 3H4DA 3N28A 2K60A 4DCCA 2C2EA 4G9BA 3MGHA 5L1JA 4O3OA 4JWMA 4QIWC 4BGDA 2VJ5A 1ED1A 2W9CA 8ICMA 3UQ0A 3N7RC 3RBEA 2H3ZA 4UAZA 5ALTA 2XCPA 2R18A 5KG4A 7ICMA 3EYZA 4DOBA 1TE2A 2KV2A 1L8LA 1KFDA 1XO0A 1TV9A 2Q0ZX 2XO7A 2V9WA 2NO4A 3BQ1A 4CF5A 4YMOA 4MEXA 5J0SA 2HSZA 3BJYA 5DKWA 5IILA 3LYSA 4NL9A 4UB8U 1KSPA 2AQ4A 2OH2A 2YN4A 4MF8A 2QARB 1ZXIA 1NK0A 1V38A 7ICLA 2F77X 2LM4A 3V6JA 4YCXA 5DLGA 3Q8MA 2FJ6A 4IS7A 3ICXA 4Z6DA 2W7PA 3QX7A 2HVHA 3PY8A 1SXDA 1A0PA 5F3XB 5ALVA 4PZOA 3RBDA 3QNMA 5HP4A 3ETLA 3PZPA 1JIHA 5KFBA 2B0CA 4F8RA 3TACB 1N63A 5KFQA 4M0AA 1TK8A 5AICA 2IOHA 1UA1A 9ICIA 4DSKA 4YR3A 8ICOA 3HWTA 4XUSA 2VA3A 4KLDA 4OCZA 5G5HA 1ZQCA 4BXOB 2BCVA 4KN7A 1X6JA 2XCAA 3K1RB 2Q4TA 5J8YC 4F71A 3V72A 5J2HA 1J2MA 4DFJA 1ZD4A 3RAXA 4KX5A 4HYKA 4O3QA 3RTVA 3H4BA 5HMLA 4ACOA 5D49A 3CNHA 2NRVA 3WKDA 4DFMA 5HHHA 4JB3A 4BUGA 5DG8A 1N56A 1DOQA 1WG8A 2WB1F 3TADC 2P6RA 4JMUA 2JMGA 2JZBA 2ZTCA 4O3RA 3PW4A 1XWLA 1LV5A 3I28A 4QWEA 4R64A 2HHTA 2ZTDA 2DUYA 2D3DA 1Z4NA 1K1SA 2EAMA 5AI5A 8ICBA 9ICPA 1S76D 2V4RA 2RRDA 4P0PA 1CI4A 3IP4B 2HHVA 5KFJA 2ISPA 9ICTA 4EYIB 3QUCA 8ICVA 3WKAA 4F4KA 5KFAA 3V7JA 4KLIA 3B0XA 1NOMA 5ALDA 2LM1A 4GLXA 4IRKA 4MFFA 4I27A 4Q8EA 4J9KA 5JRTA 1Q46A 4FZLA 2UVVA 2KSOB 2VIXA 4F4XA 3BQ0A 4J9PA 3K4GA 3RJHA 4F3OA 1LKYB 4AP9A 5JUMA 4QZIA 4CCHA 3KHGA 1D9FA 1SL2A 2AQ0A 2BCUA 1JALA 4NLGA 3E58A 2KHQA 1NK6A 3RB4A 1PK1A 1A76A 4C80A 5CJ7A 1X6IA 2KSOA 2KHVA 4I2DA 8ICGA 1PK1B 4BWMA 2F1IA 8ICTA 4IQUA 9ICSA 1LB2B 4B6JA 3TAPA 1LKYA 2OM6A 1ZQIA 4ECXA 4DS5A 1BPBA 3ZD8A 4C4SA 4F4YA 4RU9A 2ZXIA 4F4WA 1ZD2P 4C7ZA 3QZ7A 4P0QA 4XRHA 5HMMA 4YQWA 8ICEA 3OJSA 1K5OA 3BZKA 2ZIXA 2YX8A 4RZRA 5J0WA 2DFLA 5DG9A 4Y2XA 3D2QA 4QWDA 5ALWA 2J6SA 5AI9A 3RFAA 3B9JA 3Q8SB 4F5OA 4CF4A 2JR5A 2XIDA 4RQMA 2ASLA 2J6UA 3H0MB 2BCRA
chains in the Genus database with same CATH topology
2QB0B 1SXDA 2Y9TA 1COKA 2DKZA 5F3XB 3BS7A 1UQVA 2D8CA 4PZOA 2QB0A 2K4PA 3HILA 1PK3A 2QKQA 5JRTA 3TACB 2QARA 2KSOB 2KIVA 1X40A 3IDWA 5JU5A 1WWVA 1SGGA 2E8NA 1X9XA 3BQ7A 1LKYB 3H8MA 1B4FA 1SV0C 2FE9A 4PZNA 1PK1A 3KKAC 2LPEA 2KG5A 2YTUA 2ESEA 2EANA 1KW4A 2KSOA 1RG6A 1X66A 3K1RB 1PK1B 2E8MA 5J8YC 2K60A 4NJ8A 2EAOA 2B6GA 2E8PA 1LKYA 2JV3A 2GLEA 1OXJA 2DKXA 2Y9UA 3SEIA 2F44A 4NL9C 1DXSA 2DL0A 3TADC 2L5YA 5JTIA 2F8KA 1OW5A 3KKAA 2KMDA 1V85A 5J8YA 1Z1VA 1UCVA 2F3NA 1SV0A 1B0XA 4NL9A 2D3DA 1F0MA 2EAMA 1JI7A 4MHVA 2EAPA 2E8OA 2QARB 1WWUA 1SV4A 1SXEA 1V38A 3BS5A 2QB1A 3BS5B 5KNIA 4RQNA 2KE7A 5L1MA 3SENA 4RQMA 3TADA 2LMRA 4IS7A 2ES6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QB0 B;  1SXD A;  2Y9T A;  1COK A;  2DKZ A;  5F3X B;  3BS7 A;  1UQV A;  2D8C A;  4PZO A;  2QB0 A;  2K4P A;  3HIL A;  1PK3 A;  2QKQ A;  5JRT A;  3TAC B;  2QAR A;  2KSO B;  2KIV A;  1X40 A;  3IDW A;  5JU5 A;  1WWV A;  1SGG A;  2E8N A;  1X9X A;  3BQ7 A;  1LKY B;  3H8M A;  1B4F A;  1SV0 C;  2FE9 A;  4PZN A;  1PK1 A;  3KKA C;  2LPE A;  2KG5 A;  2YTU A;  2ESE A;  2EAN A;  1KW4 A;  2KSO A;  1RG6 A;  1X66 A;  3K1R B;  1PK1 B;  2E8M A;  5J8Y C;  2K60 A;  4NJ8 A;  2EAO A;  2B6G A;  2E8P A;  1LKY A;  2JV3 A;  2GLE A;  1OXJ A;  2DKX A;  2Y9U A;  3SEI A;  2F44 A;  4NL9 C;  1DXS A;  2DL0 A;  3TAD C;  2L5Y A;  5JTI A;  2F8K A;  1OW5 A;  3KKA A;  2KMD A;  1V85 A;  5J8Y A;  1Z1V A;  1UCV A;  2F3N A;  1SV0 A;  1B0X A;  4NL9 A;  2D3D A;  1F0M A;  2EAM A;  1JI7 A;  4MHV A;  2EAP A;  2E8O A;  2QAR B;  1WWU A;  1SV4 A;  1SXE A;  1V38 A;  3BS5 A;  2QB1 A;  3BS5 B;  5KNI A;  4RQN A;  2KE7 A;  5L1M A;  3SEN A;  4RQM A;  3TAD A;  2LMR A;  4IS7 A;  2ES6 A; 
#chains in the Genus database with same CATH topology
 2BKE A;  3C2K A;  3CYM A;  5EE1 A;  2A1J B;  3C1Z A;  1VDV A;  1Y88 A;  2LKY A;  2HMX A;  1PK3 A;  2M0N A;  1RXV A;  4UAS A;  4ICA A;  1Z3E B;  5DGB A;  2XIC A;  3UMC A;  3EUB 2;  4J9R A;  4KLQ A;  4DEZ A;  1PUZ A;  4CE6 A;  4DSJ A;  5AI0 A;  3PX0 A;  4KMU A;  2BHN A;  2PXI A;  3OHA A;  4ED1 A;  3C1Y A;  2XI9 A;  7ICR A;  4DSF A;  1YZ6 A;  4IL6 U;  4PZN A;  2MA1 A;  2RLT A;  5DQH A;  1L7M A;  3H0L B;  4Y2S A;  3JPS A;  4KLG A;  1X66 A;  4YD1 A;  4ECS A;  9ICA A;  5ALN A;  3Q8L A;  2KZM A;  1ZQQ A;  5E79 U;  8ICK A;  5KTQ A;  2W9C B;  5AK6 A;  4XQ8 A;  2F1H A;  5KFF A;  4M9L A;  3PV8 A;  9ICL A;  5J2I A;  5EWG A;  2YMP A;  2A1A A;  3ZI4 A;  4IQW A;  2BPG A;  4KLE A;  5TIS U;  4QWC A;  4UAW A;  5TZV A;  4PGQ A;  2CN1 A;  4QWB A;  5DBB A;  1ZQO A;  4P4P A;  3BQT A;  4QZD A;  3RRG A;  4UB5 A;  2IOF A;  4AYB F;  1DGS A;  3WKB A;  5KFP A;  2ZJ8 A;  4K4H A;  2KIW A;  3EZ5 A;  1WWU A;  3PSF A;  5KG7 A;  2UVU A;  2KOB A;  3BS5 A;  3A0H U;  2IMW P;  5KNI A;  1ZD3 A;  2AH5 A;  3FC4 A;  2W9M A;  1Z4O A;  2XGP A;  4ED2 A;  4ECZ A;  2FLN A;  3PST A;  3M6K A;  2E1E A;  1ZRM A;  2QB0 B;  4QZG A;  2OXO A;  4EEN A;  5KL1 B;  2KP7 A;  1ZQW A;  5KT5 A;  3SZ2 A;  3I76 A;  3RH6 A;  4FO6 A;  1Q3U A;  3IG5 A;  2WF9 A;  1URJ A;  5AM1 A;  3NTU A;  2VA2 A;  2GH1 A;  4K4G A;  1SGG A;  3H8S A;  5ALI A;  5F9L A;  2KVS A;  5EE9 A;  4QZA A;  4UB6 U;  3QYP A;  2DPJ A;  4UAU A;  4RPX A;  5J2C A;  2JEG A;  3CW2 C;  4YFK A;  5ALJ A;  9ICR A;  4ECR A;  1ZOL A;  2KKP A;  1ZQM A;  4DL4 A;  4DL7 A;  1NKB A;  2ZJ5 A;  3JPQ A;  4ZH4 A;  3HT3 A;  5CHG A;  4F72 A;  3F2C A;  2B6G A;  9ICF A;  3UQ2 A;  3Q8K A;  3BZC A;  2R8J A;  2NRT A;  5AKI A;  5KFX A;  4I28 A;  1ZQX A;  2JEJ A;  1L3T A;  2E3T A;  2ZIW A;  3H0R B;  4RQ3 A;  4ED7 A;  4M9J A;  3OHB A;  3SV3 A;  4J9N A;  2ZIX B;  4PL2 A;  5DGA A;  4FZN A;  2ZIV A;  2W11 A;  4YVZ A;  3KOO A;  3AN1 A;  3Q8P B;  1NK8 A;  1Z1V A;  4F93 B;  4OJ6 A;  2M9N A;  2YB1 A;  1JRO A;  2KVC A;  5AHX A;  1SKW A;  5KFI A;  5AM3 A;  5J0O A;  4NM1 A;  5KFM A;  3VC8 A;  1XU4 A;  4C8L A;  4I2I A;  8ICX A;  4Q44 A;  5DG7 A;  4RQN A;  5L1M A;  2XY5 A;  2JH1 A;  1RZT A;  1FEZ A;  2PMZ C;  4DSL A;  2AHO B;  4CGZ A;  4ELV A;  1O03 A;  3SMV A;  1RYR A;  1DGJ A;  3H8J A;  5IIJ A;  5L1K A;  1ZJN A;  2QB0 A;  4GFJ A;  2QKQ A;  4DQQ A;  2EQY A;  1TK0 A;  2MRL A;  4FBU A;  2G0A A;  5EE3 A;  2FMS A;  1WWV A;  8ICU A;  4ED0 A;  4EEL A;  5AM5 A;  4M9H A;  3ONN A;  1S8O A;  3MR5 A;  4I2F A;  4NLN A;  5D4B A;  1SKR A;  4LVS A;  3ORY A;  1KBU A;  5K4L A;  2VKQ A;  5KG6 A;  1QSL A;  2W8K A;  1RG6 A;  3SD7 A;  4GXK A;  2IA6 A;  1SZP A;  2ZIU B;  5AKJ A;  5J0U A;  2BQR A;  1ARO P;  4DLG A;  4KLO A;  4AYB C;  4Y2J A;  3T5H A;  5ALF A;  2OYY A;  3L4P A;  4TUQ A;  2WFA A;  2G08 A;  4NXZ A;  5J2E A;  4EBD A;  4IR1 A;  3GIJ A;  2K8A A;  4B9V A;  1ZQS A;  4PPX A;  1JN3 A;  3PX4 A;  1XNS A;  3RR8 A;  3ISC A;  1D8Y A;  1QLN A;  3CP8 A;  4QNL A;  3NVV A;  3KZI U;  1NK7 A;  1ZJM A;  9ICN A;  3DV9 A;  1CUK A;  5KFO A;  5ALG A;  8ICZ A;  2MUT A;  8ICH A;  3HP6 A;  2JGA A;  2HCF A;  3ALR A;  3KD3 A;  4NLC A;  4EYH B;  2HW3 A;  3TAD A;  1KQQ A;  7ICU A;  4O0I A;  3F5A A;  4UB3 A;  1ZQ1 C;  2R8G A;  4XA5 A;  3EW9 A;  4TQR A;  3HKZ C;  3HIL A;  5AIA A;  3C5G A;  2LYA A;  4JWN A;  3AU2 A;  3ZDE A;  1HUO A;  3UMG A;  7ICJ A;  2K4H A;  3BQ7 A;  1NJX A;  1IG6 A;  2XY7 A;  3RR7 A;  4BJQ A;  4C4T A;  5J2D A;  2ZIU A;  3UXP A;  4O3M A;  9ICQ A;  3SV4 A;  4CRX A;  2JEI A;  1B22 A;  2ESE A;  1S77 D;  2BCQ A;  4B9U A;  2H3F A;  3GV7 B;  5GTI U;  2DBY A;  1ZQG A;  5ALP A;  4IR9 A;  4YD2 A;  5DB9 A;  1L7O A;  2PKE A;  1ZQU A;  5KG5 A;  4UAY A;  5L1I A;  5G5G A;  2ZUC A;  3GIL A;  2JV3 A;  1L8O A;  4FE3 A;  1QTM A;  3GU3 A;  4Z6C A;  4F2S A;  5IIN A;  1SL1 A;  3WKC A;  8ICC A;  4Y2V A;  9ICW A;  5AK3 A;  5DLF A;  1XO1 A;  7ICO A;  3IRU A;  3QU4 A;  2HHQ A;  5KAF U;  1OUQ A;  2JEF A;  4HAI A;  4DFD A;  1KLN A;  3GIK A;  5KFT A;  3C23 A;  3IG8 A;  1B0X A;  1RQN A;  5KFW A;  2DQN B;  1F5S A;  3WK9 A;  1T94 A;  4EEK A;  1N62 A;  4RQ2 A;  2EAP A;  1SZH A;  2A3V A;  1SV4 A;  2WF8 A;  2XC9 A;  2AGO A;  5KFN A;  2GOL A;  1F44 A;  2UVW A;  3AUO A;  4RPZ A;  3D2S A;  1BPZ A;  4OD0 A;  3RJG A;  5CP2 A;  3Q8R B;  2LYB A;  2D8C A;  1S10 A;  3SAF A;  4F92 B;  4EX6 A;  3M8R A;  3VCB A;  4RQ8 A;  1TKD A;  1KEJ A;  2BDU A;  4K4I A;  1N61 A;  2XGQ A;  4PHD A;  3PML A;  4X5V A;  2YMQ A;  5KFV A;  2BGW A;  4P2H A;  4C8O A;  9ICV A;  4FFD A;  1YZ7 A;  5ALY A;  1FFU A;  1IM4 A;  3QU2 A;  1Q3V A;  4UW9 A;  7ICV A;  1RYS A;  4RUC A;  2IHN A;  2UVR A;  3GZF A;  4LZG A;  3N7S C;  7ICE A;  1PVR A;  3MR3 A;  4RT2 A;  4Q8F A;  9ICU A;  4F5R A;  3FM9 A;  3FYH A;  1Z00 B;  2HHX A;  2HHW A;  2JZB B;  4NJ8 A;  2LI6 A;  2EAO A;  3RB6 A;  1Z00 A;  5J2G A;  4EZ6 A;  4P0Q B;  5ALU A;  9ICX A;  1SWW A;  3TFS A;  2FDR A;  2G5H B;  2KJ5 A;  4OO1 J;  4QZC A;  1KTQ A;  2KEY A;  1NKC A;  2GLE A;  3MGV A;  1T3Q A;  3GV5 B;  7ICH A;  1JRP A;  4YXJ A;  2KKV A;  3A0B U;  1TK5 A;  4QWA A;  2ZUB A;  4P0P B;  2VAN A;  1LVH A;  5J2J A;  4Y2Y A;  1WCL A;  4PJ0 U;  4YR2 A;  3RB3 A;  3T79 A;  4CDG A;  2RHF A;  1ZQJ A;  3T5J A;  4US8 A;  2I1Q A;  4O9M A;  4KLL A;  2KZZ A;  4U7C A;  1UPH A;  1NZP A;  5IIO A;  1XSN A;  7ICP A;  2KFN A;  1TAU A;  1B43 A;  4RQ1 A;  3TI0 A;  3NVZ A;  4O3P A;  1KL9 A;  5ALQ A;  4PHA A;  4UB2 A;  4EBE A;  2AGP A;  4NLK A;  5ALO A;  1FIQ A;  3ZDC A;  2RP5 A;  5J2B A;  2N1R A;  1U4B A;  4O5E A;  2ZJA A;  5DBC A;  1NNL A;  4O5K A;  9ICG A;  1KDH A;  2P6U A;  4UAT A;  4BWJ A;  1KFT A;  1KKX A;  4YMN A;  1X2I A;  4DS4 A;  4US9 A;  8ICL A;  4C4R A;  3PO5 A;  5KL8 B;  2FMQ A;  5DB7 A;  3MR2 A;  3RRH A;  1X9X A;  3PSI A;  4DL6 A;  4DSI A;  4Q43 A;  3PVX A;  4G3I A;  1B4F A;  7ICQ A;  1T8E A;  4YR0 A;  5KFR A;  1BNO A;  2FE9 A;  4O3N A;  3EPG A;  3KKA C;  4ECV A;  1IIP A;  2FI1 A;  3IV6 A;  3WK6 A;  3U26 A;  1RYU A;  5T14 A;  2XVT A;  2NYV A;  3KBB A;  4F2R A;  4QW8 A;  1ZQL A;  2E8P A;  1ZQD A;  4ELU A;  3RAQ A;  1TAQ A;  1X9W A;  5DQI A;  4TUS A;  3C21 A;  5BOM A;  2MAX A;  4Z6F A;  4QIW F;  2F8K A;  2G06 A;  4NLZ A;  3H8W A;  1QQ7 A;  5J8Y A;  4KMO B;  2I5H A;  5B5E U;  3Q8Q B;  2ZIV B;  2F3N A;  8ICA A;  3KHR A;  3GV8 B;  3KZX A;  2ASJ A;  1F0M A;  2PI5 A;  2CXY A;  3F53 A;  4JV0 A;  1MN8 A;  4I2G A;  1KN5 A;  5J2F A;  3ED5 A;  4R63 A;  4DFP A;  2Y1J A;  2ASD A;  3R9K A;  4DFK A;  3NRW A;  4KLJ A;  4C0Z A;  3NGD A;  1XSP A;  1X9S A;  3ZDA A;  4DQI A;  4RPY A;  2BZF A;  1L5U A;  5KT2 A;  4RNM A;  4UAV A;  4F5P A;  3PX6 A;  3UM9 A;  2NRW A;  1V97 A;  1KRP A;  1X40 A;  4MFA A;  8ICF A;  1UT5 A;  2ATL A;  4R65 A;  1O08 A;  3K1Z A;  5KFZ A;  2HBK A;  4TQS A;  3GDX A;  4QW9 A;  2KIC A;  3OTQ A;  4ECT A;  2KG5 A;  2QLT A;  3C2L A;  4KX3 A;  3THV A;  3V7K A;  7ICF A;  4RQ7 A;  2HHU A;  1JX4 A;  8ICQ A;  1P7D A;  2YY6 A;  2CPR A;  2C22 A;  4UAR A;  1ZQN A;  3JPR A;  2EZY A;  5C5J A;  2FPM A;  3V7L A;  5KFD A;  1BVS A;  2FPL A;  1L3V A;  8ICJ A;  4I29 A;  5KFC A;  3DDH A;  2WF5 A;  4MF2 A;  2PFQ A;  1S0N A;  2K8C B;  9ICC A;  3RJF A;  5AIB A;  4RUA A;  2Y1I A;  1UCV A;  1V9P A;  1HEK A;  1MQ3 A;  2R8K A;  4C8M A;  2BPF A;  4GC7 A;  2OEH A;  1WYG A;  3MDC A;  2J6T A;  2MU2 A;  4CF3 A;  5KT4 A;  5AKE A;  3F2B A;  3JPO A;  3MGI A;  4B9T A;  4IQT A;  1S9F A;  5CEH A;  3LDA A;  5KFH A;  4GXJ A;  2HOF A;  3QE9 Y;  5CRX A;  5DDY A;  5DDM A;  3RB0 A;  5KFE A;  2EZZ A;  3BDP A;  1UQV A;  3ISD A;  4JK1 A;  5KFU A;  3B0Y A;  2A1J A;  2WB1 C;  2DPI A;  3NVY A;  4F91 B;  5AI8 A;  8ICN A;  5ALX A;  4O5C A;  1S97 A;  2GWS A;  2E8N A;  3H7I A;  2PFN A;  5IIM A;  1IV8 A;  3EWA A;  3WK5 A;  4UQG A;  2W9B A;  4ED3 A;  3UXO A;  1QSY A;  4ECY A;  1COO A;  1SV0 C;  4P4M A;  2LPE A;  4NLB A;  1S5L U;  3GII A;  2CRX A;  2PFO A;  4J9Q A;  4RNO A;  3N7P D;  4IC9 A;  1BPY A;  2FMP A;  4CNQ A;  4ED8 A;  4DOC A;  3NVW A;  1WUD A;  1BPE A;  2HI0 A;  2WAQ C;  1L3S A;  1L3U A;  2W8L A;  1H38 A;  2IOF K;  3M9N B;  4OJO A;  1C7Y A;  3WK8 A;  3PW7 A;  1Z1B A;  3TFR A;  5JTI A;  1V85 A;  1BPD A;  3C2M A;  1NZB A;  3ETR A;  2BQ3 A;  5BPC A;  5III A;  4JV2 A;  3NAS A;  4DL2 A;  5CR0 A;  2AJQ A;  1L7P A;  1DRG A;  1RXW A;  4MHV A;  5AK5 A;  3T5L A;  5AM4 A;  5D46 A;  3F2D A;  4ELT A;  2KTQ A;  3BS5 B;  3IN5 A;  2XY6 A;  2YMM A;  1ZQY A;  2ODG A;  5KT7 A;  5IIK A;  2W7O A;  7ICK A;  3H40 A;  1C20 A;  3BS7 A;  5HR6 A;  5EE0 A;  5J2A A;  2QAR A;  3N97 B;  2BR0 A;  3TQ1 A;  2H5X A;  4I2J A;  4J03 A;  4R8U B;  3M8S A;  2F8L A;  4F5N A;  1MQ2 A;  4PL1 A;  3KHL A;  2WAQ F;  2WHE A;  2P35 A;  3M6Z A;  4M9G A;  2BPC A;  3AQF A;  4Y2R A;  1SB3 C;  1DK2 A;  3HJE A;  2C2D A;  2IHM A;  4I2C A;  3SQI A;  2KK0 A;  2RDI A;  3AEV A;  8ICY A;  1T4G A;  5DQG A;  4DOA A;  4B9M A;  3L3F X;  4FS2 A;  4PHE A;  9ICO A;  2F1J A;  2BQU A;  5AKX A;  1M6Y A;  1BPX A;  2AU0 A;  2F44 A;  2ZIW B;  4Y2T A;  5AM2 A;  2YQE A;  3TAR A;  5ALZ A;  2V4Q A;  1MC8 A;  2OCE A;  1ZQF A;  1PZN A;  3G6X A;  3M7D A;  2W9A A;  2EH9 A;  3JPP A;  4RT3 A;  1NI3 A;  4YN4 A;  2JRZ A;  4KIT B;  7ICS A;  2G09 A;  2I9G A;  2KNJ A;  2JHD A;  3PNC A;  8ICW A;  1N5X A;  4B9S A;  4I2B A;  4P4O A;  3IM1 A;  3C5F A;  4A8E A;  8ICP A;  4GIB A;  5ALR A;  5AKG A;  1ECW A;  4PH5 A;  3PW0 A;  2I6X A;  7ICN A;  2BDP A;  4RQ4 A;  5KT6 A;  4ECW A;  1ZYQ A;  1QSS A;  2LMR A;  4I2H A;  3WK7 A;  2C28 A;  4QZF A;  4NY8 A;  2R8H A;  2DKZ A;  1RPL A;  8ICI A;  5KFL A;  5EOZ A;  4J9M A;  5ALH A;  3DEE A;  4UBB A;  1T7P A;  3J81 j;  1YT3 A;  1UT8 A;  4BXO A;  3QU7 A;  3WK4 A;  2HBM A;  4RNN A;  1RM6 C;  2FLP A;  4IQV A;  5B66 U;  4IRC A;  4FS1 A;  1N60 A;  3LWM A;  2OHF A;  3S6J A;  5KG1 A;  3SI8 A;  1ZRN A;  2H3V A;  3QUT A;  4QZ8 A;  3G6Y A;  2YTU A;  1KW4 A;  1HIW A;  2F76 X;  2WTF A;  2Z7J A;  9ICK A;  1NJZ A;  3RJE A;  3O0F A;  3HPO A;  4M47 A;  3OJU A;  2PFP A;  3D6J A;  3AQE A;  5EWE A;  3V6H A;  1ZQR A;  5KG2 A;  4TUR A;  5DB8 A;  1U49 A;  4QZH A;  1QH9 A;  1RDF A;  3SEI A;  4KTQ A;  1K1Q A;  2YB4 A;  1L7N A;  1X9M A;  3FDS A;  3OPX A;  5KG3 A;  3RJK A;  2W55 A;  3C29 A;  5AKZ A;  4BDP A;  4UB4 A;  1ZQK A;  2YML A;  5HHI A;  4YXM A;  1UA0 A;  2JH7 A;  1ZQT A;  1QQ6 A;  1TAM A;  2HBL A;  1ZQZ A;  3UXN A;  1JI7 A;  1NK4 A;  2E1F A;  3PW5 A;  2E8O A;  1CEZ A;  4M6W A;  4J9O A;  5GTH U;  1S0O A;  4M9N A;  5KFS A;  4USA A;  1XC9 A;  2C2R A;  4OJL A;  4IRD A;  3I1Y A;  3AMZ A;  1KFS A;  2K8B B;  1COK A;  2E5S A;  4KLU A;  5L9X A;  2K4P A;  2W3R A;  3T3F A;  5AI6 A;  1N48 A;  2PMZ F;  1IXR A;  1SL0 A;  2R8I A;  1EXN A;  3SAH A;  1NK5 A;  4U6P A;  1J2N A;  1VLB A;  3MDA A;  3G6V A;  2KD1 A;  4Q45 A;  1NKE A;  5FP0 A;  3ISB A;  1BGX T;  4B9L A;  4DF4 A;  1D8L A;  5A0L A;  3NS1 A;  5CWR A;  3GQC A;  2EAN A;  4I2A A;  3MAB A;  2KFZ A;  1U45 A;  4QJF B;  3FAH A;  4QZB A;  3MBY A;  2EZX A;  3EPI A;  1L6N A;  1GO3 F;  4Y2U A;  3PR5 B;  2FPK A;  1RQL A;  3SR6 A;  1T3N A;  4TUP A;  2KZ3 A;  4NWI A;  4GC6 A;  1NK9 A;  3UPQ A;  3PSP A;  3PMN A;  5J0R A;  4NM2 A;  9ICJ A;  3OSN A;  5AM0 A;  1OXJ A;  4DWI A;  4NL9 C;  3JPN A;  3QUQ A;  2AXT U;  3RH4 A;  1U9L A;  4J9L A;  2DL0 A;  2KJ8 A;  3GIM A;  2PI4 A;  2HDO A;  2WF6 A;  4DQP A;  4M6W B;  1SKS A;  1ZD5 A;  3LK9 A;  4DL3 A;  4YMM A;  1FFV A;  5KFK A;  4GXI A;  1MSW D;  2Y0S C;  4R66 A;  4MEY A;  2VA8 A;  3TAQ A;  4RQ6 A;  5F9N A;  4EZ9 A;  3V6K A;  1SXE A;  3LVV A;  5L1L A;  3KTQ A;  1PVP A;  1ZQP A;  2QB1 A;  2ZUD A;  4DQS A;  1A6S A;  3QU9 A;  2HHS A;  4F4Z A;  4O3S A;  2DWQ A;  1X42 A;  1ZQA A;  2ES6 A;  2ALZ A;  1D8B A;  4KLM A;  5C0Y A;  3E0F A;  5ALL A;  1SWV A;  3PW2 A;  3QEA Z;  2RQ5 A;  3LVW A;  4DQR A;  2H3I A;  2KIV A;  2FLL A;  7ICG A;  4C8N A;  4DL5 A;  5DB6 A;  4LJX A;  2O6K A;  5KAI U;  3NRZ A;  1N2X A;  2HOI A;  2D6F C;  2W3S A;  2F2A B;  2Y0S F;  4KLS A;  1NJY A;  3ZDD A;  4RQ5 A;  5CB1 A;  3BQ2 A;  2B21 A;  2DGZ A;  5J0P A;  4KLF A;  1AQ6 A;  3AM9 A;  3AL0 B;  1WCN A;  3OSP A;  5BOL A;  3TKA A;  2OWO A;  2E8M A;  2NRX A;  3GFK B;  2ISO A;  4QZE A;  4PGX A;  3CRX A;  2GO7 A;  4DO9 A;  5ALE A;  5HNK A;  3N4M B;  1Z19 A;  2AGQ A;  4EBC A;  2HBJ A;  3L5K A;  2DKX A;  2HOQ A;  2G07 A;  4ED6 A;  1DXS A;  5J0Q A;  5AI4 A;  4QZ9 A;  1NJW A;  4KLH A;  3KFU F;  4EEY A;  1XS9 D;  3KKA A;  2VJ4 A;  2K4E A;  2A19 A;  4FBT A;  2WF7 A;  4C8K A;  5J0Y A;  3MC1 A;  1ZET A;  3ZDB A;  3RH5 A;  3LWL A;  1HUZ A;  5HR7 A;  3QU5 A;  4Y2Q A;  4EX7 A;  3UMB A;  2W04 A;  1ZQV A;  5KFG A;  9ICH A;  2G5I B;  2LYH A;  3M9M B;  1S0V A;  5KT3 A;  2JXJ A;  3M1Y A;  5AK4 A;  1JMS A;  2LHT A;  4J9S A;  1ZQE A;  4FZM A;  1TVA A;  5AKY A;  2K89 A;  4B9N A;  5KFY A;  2P66 A;  4NV0 A;  4F50 A;  2RDJ A;  1XSL A;  1DK3 A;  3OGU A;  3QUB A;  3SYZ A;  1U47 A;  2KJ9 A;  1VJ5 A;  5J2K A;  4UBC A;  4DF8 A;  5JU5 A;  1D9D A;  5AKH A;  2IBK A;  5H2F U;  3RF9 A;  4WJ3 B;  3T5K A;  5CA7 A;  8ICR A;  3AU6 A;  2EDU A;  3WKE A;  1QCK A;  7ICT A;  4M2Y A;  3TAN A;  4YP3 A;  1JXL A;  3K75 D;  3E2E A;  4LZD A;  4YG2 A;  3C28 A;  4R8U A;  2HVI A;  5J0X A;  9ICB A;  2H3Q A;  1QQ5 A;  3SAG A;  4OJP A;  3MFH A;  5AKL A;  3PO4 A;  3HW8 A;  2ZTE A;  3IHQ B;  4ZOH C;  2NO5 A;  7ICI A;  2Y9U A;  4ECQ A;  3QXG A;  2ZG6 A;  2MUT B;  1JUD A;  1Q8K A;  2L5Y A;  2BCS A;  1OW5 A;  1N5W A;  2KMD A;  3HRD D;  4Z6E A;  3RJI A;  5ALK A;  4PGY A;  4E0D A;  2W54 A;  3D2N A;  5DBA A;  2ZXH A;  1ZQB A;  1A77 A;  8ICS A;  3F5E A;  1SV0 A;  3MR6 A;  2DF4 B;  2LBO A;  1S0M A;  4F5Q A;  3ZD9 A;  2KN7 A;  3NUQ A;  1J97 A;  4RQ0 A;  4Y2P A;  1ZQH A;  1SIJ A;  2W43 A;  4DSE A;  1BNP A;  4OJ5 A;  4MFC A;  2KE7 A;  5AKK A;  4DLE A;  3SEN A;  5ALS A;  3WU2 U;  1FO4 A;  4JUZ A;  1HJP A;  3QZ8 A;  3PR4 A;  2K4I A;  3HKZ F;  2Y9T A;  3M9O B;  3QEB Z;  4BX9 C;  3RJJ A;  5J29 A;  2NRZ A;  4ECU A;  2MSN A;  4UB1 A;  9ICE A;  3JPT A;  3MFI A;  3IDW A;  4I2E A;  9ICM A;  3KHH A;  5ALM A;  2W9B B;  5J0T A;  1UHU A;  4C7Y A;  4KN4 A;  3H8M A;  4KLT A;  5KG0 A;  1PVQ A;  1JXE A;  5EWF A;  3HX0 A;  1CRX A;  2NV3 A;  1U48 A;  1MA7 A;  4JV1 A;  4M04 A;  4PHP A;  2W03 A;  1TFR A;  3H4D A;  3N28 A;  2K60 A;  4DCC A;  2C2E A;  4G9B A;  3MGH A;  5L1J A;  4O3O A;  4JWM A;  4QIW C;  4BGD A;  2VJ5 A;  1ED1 A;  2W9C A;  8ICM A;  3UQ0 A;  3N7R C;  3RBE A;  2H3Z A;  4UAZ A;  5ALT A;  2XCP A;  2R18 A;  5KG4 A;  7ICM A;  3EYZ A;  4DOB A;  1TE2 A;  2KV2 A;  1L8L A;  1KFD A;  1XO0 A;  1TV9 A;  2Q0Z X;  2XO7 A;  2V9W A;  2NO4 A;  3BQ1 A;  4CF5 A;  4YMO A;  4MEX A;  5J0S A;  2HSZ A;  3BJY A;  5DKW A;  5IIL A;  3LYS A;  4NL9 A;  4UB8 U;  1KSP A;  2AQ4 A;  2OH2 A;  2YN4 A;  4MF8 A;  2QAR B;  1ZXI A;  1NK0 A;  1V38 A;  7ICL A;  2F77 X;  2LM4 A;  3V6J A;  4YCX A;  5DLG A;  3Q8M A;  2FJ6 A;  4IS7 A;  3ICX A;  4Z6D A;  2W7P A;  3QX7 A;  2HVH A;  3PY8 A;  1SXD A;  1A0P A;  5F3X B;  5ALV A;  4PZO A;  3RBD A;  3QNM A;  5HP4 A;  3ETL A;  3PZP A;  1JIH A;  5KFB A;  2B0C A;  4F8R A;  3TAC B;  1N63 A;  5KFQ A;  4M0A A;  1TK8 A;  5AIC A;  2IOH A;  1UA1 A;  9ICI A;  4DSK A;  4YR3 A;  8ICO A;  3HWT A;  4XUS A;  2VA3 A;  4KLD A;  4OCZ A;  5G5H A;  1ZQC A;  4BXO B;  2BCV A;  4KN7 A;  1X6J A;  2XCA A;  3K1R B;  2Q4T A;  5J8Y C;  4F71 A;  3V72 A;  5J2H A;  1J2M A;  4DFJ A;  1ZD4 A;  3RAX A;  4KX5 A;  4HYK A;  4O3Q A;  3RTV A;  3H4B A;  5HML A;  4ACO A;  5D49 A;  3CNH A;  2NRV A;  3WKD A;  4DFM A;  5HHH A;  4JB3 A;  4BUG A;  5DG8 A;  1N56 A;  1DOQ A;  1WG8 A;  2WB1 F;  3TAD C;  2P6R A;  4JMU A;  2JMG A;  2JZB A;  2ZTC A;  4O3R A;  3PW4 A;  1XWL A;  1LV5 A;  3I28 A;  4QWE A;  4R64 A;  2HHT A;  2ZTD A;  2DUY A;  2D3D A;  1Z4N A;  1K1S A;  2EAM A;  5AI5 A;  8ICB A;  9ICP A;  1S76 D;  2V4R A;  2RRD A;  4P0P A;  1CI4 A;  3IP4 B;  2HHV A;  5KFJ A;  2ISP A;  9ICT A;  4EYI B;  3QUC A;  8ICV A;  3WKA A;  4F4K A;  5KFA A;  3V7J A;  4KLI A;  3B0X A;  1NOM A;  5ALD A;  2LM1 A;  4GLX A;  4IRK A;  4MFF A;  4I27 A;  4Q8E A;  4J9K A;  5JRT A;  1Q46 A;  4FZL A;  2UVV A;  2KSO B;  2VIX A;  4F4X A;  3BQ0 A;  4J9P A;  3K4G A;  3RJH A;  4F3O A;  1LKY B;  4AP9 A;  5JUM A;  4QZI A;  4CCH A;  3KHG A;  1D9F A;  1SL2 A;  2AQ0 A;  2BCU A;  1JAL A;  4NLG A;  3E58 A;  2KHQ A;  1NK6 A;  3RB4 A;  1PK1 A;  1A76 A;  4C80 A;  5CJ7 A;  1X6I A;  2KSO A;  2KHV A;  4I2D A;  8ICG A;  1PK1 B;  4BWM A;  2F1I A;  8ICT A;  4IQU A;  9ICS A;  1LB2 B;  4B6J A;  3TAP A;  1LKY A;  2OM6 A;  1ZQI A;  4ECX A;  4DS5 A;  1BPB A;  3ZD8 A;  4C4S A;  4F4Y A;  4RU9 A;  2ZXI A;  4F4W A;  1ZD2 P;  4C7Z A;  3QZ7 A;  4P0Q A;  4XRH A;  5HMM A;  4YQW A;  8ICE A;  3OJS A;  1K5O A;  3BZK A;  2ZIX A;  2YX8 A;  4RZR A;  5J0W A;  2DFL A;  5DG9 A;  4Y2X A;  3D2Q A;  4QWD A;  5ALW A;  2J6S A;  5AI9 A;  3RFA A;  3B9J A;  3Q8S B;  4F5O A;  4CF4 A;  2JR5 A;  2XID A;  4RQM A;  2ASL A;  2J6U A;  3H0M B;  2BCR A; 
#chains in the Genus database with same CATH homology
 2QB0 B;  1SXD A;  2Y9T A;  1COK A;  2DKZ A;  5F3X B;  3BS7 A;  1UQV A;  2D8C A;  4PZO A;  2QB0 A;  2K4P A;  3HIL A;  1PK3 A;  2QKQ A;  5JRT A;  3TAC B;  2QAR A;  2KSO B;  2KIV A;  1X40 A;  3IDW A;  5JU5 A;  1WWV A;  1SGG A;  2E8N A;  1X9X A;  3BQ7 A;  1LKY B;  3H8M A;  1B4F A;  1SV0 C;  2FE9 A;  4PZN A;  1PK1 A;  3KKA C;  2LPE A;  2KG5 A;  2YTU A;  2ESE A;  2EAN A;  1KW4 A;  2KSO A;  1RG6 A;  1X66 A;  3K1R B;  1PK1 B;  2E8M A;  5J8Y C;  2K60 A;  4NJ8 A;  2EAO A;  2B6G A;  2E8P A;  1LKY A;  2JV3 A;  2GLE A;  1OXJ A;  2DKX A;  2Y9U A;  3SEI A;  2F44 A;  4NL9 C;  1DXS A;  2DL0 A;  3TAD C;  2L5Y A;  5JTI A;  2F8K A;  1OW5 A;  3KKA A;  2KMD A;  1V85 A;  5J8Y A;  1Z1V A;  1UCV A;  2F3N A;  1SV0 A;  1B0X A;  4NL9 A;  2D3D A;  1F0M A;  2EAM A;  1JI7 A;  4MHV A;  2EAP A;  2E8O A;  2QAR B;  1WWU A;  1SV4 A;  1SXE A;  1V38 A;  3BS5 A;  2QB1 A;  3BS5 B;  5KNI A;  4RQN A;  2KE7 A;  5L1M A;  3SEN A;  4RQM A;  3TAD A;  2LMR A;  4IS7 A;  2ES6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...