3TADC

Crystal structure of the liprin-alpha/liprin-beta complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
252
structure length
252
Chain Sequence
b'PFAKWTKEQVCSWLAEQGLGSYLSSGKHWIISGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNYGKLDFNWVTRWLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDENSITPSEVQQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Liprin-alpha-2
publication title Liprin-mediated large signaling complex organization revealed by the liprin-alpha/CASK and liprin-alpha/liprin-beta complex structures
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 84
structure length 252
sequence length 252
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00536 SAM_1 SAM domain (Sterile alpha motif)
C PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3tadC01
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3tadC03
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3tadC02
1SV0C 1COKA 1SXEA 2EAOA 1WWVA 2EAMA 2K60A 5J8YC 4RQNA 3SEIA 2D8CA 1V38A 2QARB 5JRTA 2QB0A 3BS5A 2LPEA 1SV4A 2K4PA 1Z1VA 3K1RB 2E8PA 1PK3A 2KSOA 1KW4A 2EANA 3KKAC 4RQMA 5JU5A 2Y9TA 5JTIA 1SGGA 1UCVA 4PZOA 2E8NA 5J8YA 4NL9C 2DKXA 1SXDA 2QKQA 1PK1B 2KMDA 3TACB 2QARA 2F8KA 1X9XA 1JI7A 2F3NA 2DKZA 1OXJA 3TADA 3H8MA 1B0XA 3BQ7A 2JV3A 3KKAA 2E8MA 1SV0A 1RG6A 1B4FA 1F0MA 3IDWA 2E8OA 2ESEA 1X40A 2DL0A 4NL9A 3BS7A 1DXSA 4IS7A 2ES6A 2LMRA 1UQVA 4PZNA 1PK1A 1V85A 3SENA 5L1MA 2KE7A 2KG5A 2QB0B 3BS5B 1OW5A 1LKYB 2FE9A 2EAPA 1X66A 1LKYA 4NJ8A 3HILA 4MHVA 2KIVA 2B6GA 1WWUA 2YTUA 2KSOB 2Y9UA 2F44A 2D3DA 2GLEA 2L5YA 3TADC 5F3XB 5KNIA 2QB1A
chains in the Genus database with same CATH superfamily
1COKA 2ZG6A 2EAOA 3C1YA 4DWIA 8ICGA 1WYGA 2Q0ZX 2EAMA 3ZDEA 1ZQYA 4EEKA 3PW5A 2KZZA 1ED1A 2PI4A 5CP2A 1ZQBA 4RQ3A 1JUDA 1SV4A 1FO4A 5KT6A 3N97B 4RNMA 4DFPA 4DFDA 3Q8RB 1TE2A 1IM4A 2DF4B 3HRDD 2XO7A 4RQMA 2KOBA 4PJ0U 3QXGA 3TFSA 1SGGA 4B9SA 1Z19A 2XICA 5DLFA 3ZD8A 2E8NA 3UMBA 3H8WA 1ZD4A 4EX6A 5KFHA 1RYUA 4KLHA 8ICHA 1NK4A 1AROP 2ASLA 4OJ5A 3AQEA 4U6PA 2C2RA 4PPXA 3K75D 2ZIWB 4DLGA 4J9PA 2VA8A 3KHLA 1T4GA 2ASDA 3RJJA 4YD2A 4DOBA 1RYSA 2VKQA 3WKDA 2PFQA 1XNSA 3BDPA 4NL9A 4YFKA 3WKBA 3ETRA 3MR2A 3PSFA 3QU5A 4QZDA 5BOLA 5J0OA 2NO4A 4AYBC 1S97A 4O0IA 3H4DA 1ZQKA 1LKYB 5DGBA 1ZQPA 3WU2U 4FO6A 3NTUA 4TURA 4KLLA 5BPCA 4I2BA 1RDFA 4R66A 2WF9A 1FIQA 3HP6A 2Q4TA 1JX4A 2HDOA 3MC1A 1BNOA 1V9PA 1L7NA 2D6FC 4BXOA 4K4IA 1ZXIA 4Y2VA 3RB4A 4F5QA 1LVHA 4QZCA 2E3TA 1L8LA 2JEIA 2DPJA 2OEHA 2Y1IA 3CW2C 1J97A 5DDYA 5AI0A 4YR3A 3ALRA 5JRTA 2H3QA 4B9VA 5L1LA 3QNMA 4XRHA 4NLZA 5KFPA 1DGJA 4ICAA 4HAIA 5KG7A 3PW0A 1ZOLA 4UASA 2W7OA 2W54A 2MAXA 2HBKA 2NRZA 2K4IA 2K4EA 9ICIA 4KLDA 9ICVA 2DQNB 4M9LA 3E2EA 4RU9A 5KG0A 4OJ6A 3B9JA 2GOLA 3F53A 3SAGA 1A77A 4CF4A 2V4RA 1L3UA 5KFUA 4TQSA 2RQ5A 2AQ0A 3KD3A 3KHRA 2P6UA 2ZUBA 1SV0A 4QW8A 3RRHA 1TFRA 4M9GA 2LKYA 3BQ1A 4HYKA 1KDHA 3IDWA 4I2CA 2I5HA 1X9WA 5KFLA 4O3OA 5CR0A 4F92B 3C2MA 4KN4A 4DSEA 4DFJA 1UQVA 3IN5A 3SQIA 2BCVA 3ISDA 1PVPA 4YMMA 4ED8A 5DLGA 5KT5A 4O5CA 3DEEA 1OW5A 2JRZA 4F2RA 1X66A 2E1EA 5E79U 2AU0A 4M6WA 4A8EA 4XUSA 1B22A 2OCEA 4C8MA 1KRPA 4JK1A 3A0BU 3TAPA 2HBJA 3RJIA 8ICIA 3GV8B 2DPIA 3AM9A 4ECWA 4U7CA 3EPGA 8ICNA 5J8YC 1QLNA 5IIJA 4I29A 1ZQGA 4Y2UA 1SWVA 3F5AA 4LZGA 1NK6A 4RQ5A 5AKKA 2WAQC 2ZJAA 5HR7A 1J2MA 4QZBA 2P6RA 1KFDA 3TANA 2GH1A 4M47A 1COOA 1RPLA 2LBOA 3GV5B 2MSNA 2EZXA 1PVQA 3Q8LA 2JZBB 5H2FU 1SXDA 2RLTA 1PK1B 3N4MB 4P2HA 4C8LA 3MR6A 2F77X 4C4TA 1JI7A 2H3ZA 1ZQCA 2ZUCA 4BX9C 3TADA 4DL4A 2ZTEA 1M6YA 2KJ8A 4MEYA 3JPNA 4GC7A 4B9MA 1D8BA 4GIBA 4XA5A 8ICVA 5AM1A 2M9NA 1C20A 5CB1A 1ZJNA 3N7SC 4JV2A 1HUZA 4TUSA 2ES6A 2ZXIA 5L1JA 4KLMA 2BR0A 3C23A 8ICJA 4NWIA 2R18A 4R63A 2BDUA 1N61A 5CRXA 4US8A 5BOMA 2FE9A 5AKYA 4KX3A 1WCNA 5AK6A 5HMMA 1QSSA 9ICTA 4DFMA 7ICRA 2WB1F 5K4LA 4DQSA 4IRCA 1MC8A 3QUQA 3MR5A 1WG8A 5ALMA 2J6UA 4IQWA 3ED5A 1SXEA 3V6KA 3V7LA 2XGQA 2XY5A 7ICSA 5DQGA 3OHBA 1V38A 1XC9A 4C80A 4IRKA 2I1QA 2KIWA 9ICPA 1QSLA 2K4PA 3EW9A 4J9MA 4FZLA 5ALRA 1FFVA 5KFTA 4JB3A 4K4GA 3H0LB 3OGUA 1TK5A 1TKDA 1Z00B 5IIIA 5J0XA 3WK5A 1KFTA 4O3QA 2Y0SC 2WTFA 2RP5A 3M9NB 4MFAA 4DF8A 1N48A 3TAQA 5KL8B 2J6TA 1XU4A 3FM9A 5AICA 2KZ3A 2YMQA 2W3RA 5DGAA 4I2DA 3V6JA 4ECVA 3G6XA 4J9RA 4Z6EA 3RB6A 2E1FA 4EENA 7ICKA 2MRLA 1SKSA 5J0YA 3NVVA 2H3VA 3JPOA 1B4FA 1HJPA 3JPPA 2HSZA 3I1YA 5HMLA 3SYZA 5FP0A 4BXOB 5KFSA 5KFGA 2LMRA 1NKBA 2FPLA 4RQ6A 3ZDAA 8ICEA 3D2SA 5AM5A 3KTQA 5AI5A 5KFOA 4DSLA 1IXRA 2KG5A 5J2KA 2KVSA 3Q8SB 4QZFA 4O5KA 3M9MB 3RB0A 3ETLA 5L9XA 8ICMA 8ICRA 3PW2A 5D49A 1X6JA 7ICPA 4RT3A 5F3XB 2KD1A 3CNHA 3SV4A 2QB1A 2HHVA 5IIKA 1L7MA 7ICNA 1F44A 2EZYA 3RH4A 1FFUA 1N5XA 2QB0A 3BS5A 3ZI4A 4IRDA 4X5VA 4QW9A 1ZRMA 3IM1A 4NY8A 1KW4A 2GO7A 3NS1A 1YZ7A 3OPXA 1AQ6A 2C28A 4YCXA 4NV0A 3QUTA 3HJEA 3WK6A 3WK9A 3C2LA 9ICUA 4OJPA 4RQ4A 2H5XA 4ED2A 3PX6A 4RQ2A 2A19A 7ICMA 3PW4A 4QWEA 4YMNA 4USAA 1BGXT 1DK3A 2C2EA 5AKHA 2BQ3A 1ZQJA 3MBYA 7ICFA 3H8MA 3QU4A 3SMVA 2JV3A 2LYHA 3ORYA 4ECUA 1KQQA 1S8OA 4B9LA 4QZEA 5DB6A 2KJ9A 4M6WB 2A1AA 3MFHA 3M9OB 4PL1A 1S9FA 1ZJMA 4RPYA 1GO3F 4M0AA 3B0XA 8ICWA 5J0QA 2ALZA 2YX8A 2LYBA 4C4SA 1SIJA 3MABA 1ZETA 3RB3A 3JPTA 5AI6A 4QIWC 2KFNA 3R9KA 2NRTA 8ICTA 1A6SA 1PVRA 5AKZA 1S5LU 3T3FA 3UXPA 3SAHA 4ED3A 2A1JA 4YXMA 4TQRA 2E5SA 3H0RB 4RQ1A 4PGXA 1S0VA 3PV8A 4F3OA 4UAYA 4UAZA 2L5YA 2BPFA 4IC9A 2KTQA 1L3SA 1PZNA 4UB3A 2FLLA 3PSIA 2BCQA 3H4BA 2D8CA 1NNLA 4KLFA 5ALFA 4YN4A 2YB1A 3C5FA 3M8SA 1Z1VA 1WCLA 3K1RB 4OJOA 4KLOA 4EELA 1S10A 2EANA 2ISPA 2LM1A 5JU5A 4RZRA 1XSNA 9ICBA 2PKEA 4Y2SA 2I6XA 1X9MA 4DL6A 5KT4A 2XIDA 4F71A 3T5HA 1N2XA 4MFFA 4QZIA 3EZ5A 2FPKA 2KHVA 4UAVA 3RR7A 1VJ5A 4OJLA 4O3MA 5ALXA 1NJZA 1ZD2P 3M6ZA 5AK5A 4YXJA 1BPDA 2AQ4A 2OYYA 5DKWA 3L5KA 8ICLA 4GFJA 4OD0A 4DS5A 1ZYQA 4Y2RA 2HOFA 1ZQZA 2G0AA 2H3IA 3RF9A 3FDSA 1U48A 4CF5A 5EE3A 4US9A 5DG8A 5B5EU 2JEJA 5KG1A 1N60A 4P4PA 4KLTA 3SI8A 2EAPA 4M9JA 3HILA 4CE6A 1ZQLA 1JALA 4JWNA 5EE9A 2KFZA 1RYRA 4CCHA 4GC6A 2AHOB 1L3TA 4RNNA 1XS9D 1XO0A 3ISBA 1FEZA 3PSPA 4YG2A 4DLEA 4MF8A 2G09A 4TUPA 4UAWA 1DGSA 5CA7A 5GTIU 2K60A 4GXKA 4ECTA 3WKCA 3RJEA 4J9SA 3OHAA 3V7KA 3L4PA 4O3PA 4CDGA 4DQQA 4G3IA 3PSTA 4YD1A 7ICEA 5ALYA 1OUQA 2O6KA 2J6SA 2KSOA 2W55A 4F5PA 3I28A 2MU2A 8ICUA 3HKZF 1XO1A 2JMGA 4Y2PA 4RPZA 3NASA 3THVA 3F2BA 2KVCA 1ZQWA 2G5IB 4PGYA 5KFJA 2I9GA 2FPMA 8ICOA 1XSPA 4B9TA 1JN3A 4JWMA 2BDPA 3OSPA 3BQ7A 3L3FX 5KG3A 1ZQXA 4AP9A 1X6IA 2R8JA 1ZQFA 3HWTA 5ALQA 4M9HA 4O3NA 2K8BB 3U26A 1IV8A 4Y2QA 1VLBA 1KN5A 3Q8MA 1QH9A 3TARA 1Q3VA 4IS7A 2HVIA 4XQ8A 3EWAA 4PZNA 2DBYA 4ACOA 8ICAA 2HW3A 4NM1A 4F4XA 4NM2A 2KKPA 2BKEA 5J2IA 1N62A 3UMCA 9ICLA 2VA2A 7ICJA 2ATLA 2QB0B 3BS5B 4E0DA 1CUKA 4BGDA 2HHWA 4Q45A 2JHDA 2IHMA 8ICSA 4G9BA 4QZ9A 4DS4A 1Z1BA 1D8LA 2YTUA 2OHFA 1TV9A 2Y9UA 4EZ9A 3MDAA 1QCKA 2AGOA 4QZAA 3M1YA 3NRWA 5AKJA 4ECRA 5TISU 4B6JA 3BJYA 4KTQA 3BZKA 1SV0C 3TI0A 1ZQSA 2Y1JA 4CRXA 4RQNA 2W8LA 2P66A 5C5JA 1JXLA 1T8EA 8ICXA 1NZBA 5IILA 4F5NA 5AM4A 3N7PD 5KTQA 4UAUA 9ICJA 1ZQQA 2HHTA 4EEYA 4UQGA 2CPRA 5JTIA 3FAHA 2ZIVA 3PVXA 7ICQA 3PMLA 3WK8A 5J8YA 3HPOA 3CRXA 2DKXA 3PMNA 4R8UA 3NVYA 4YQWA 4QWAA 1ZQDA 4RUAA 1A0PA 3H7IA 2KEYA 2F1HA 3ISCA 3SR6A 4Y2JA 5AI8A 8ICQA 5IIMA 3I76A 1S76D 4J9NA 2A1JB 4F4YA 2YMLA 5AKGA 4O3RA 1JRPA 4ECQA 4KITB 4UB5A 4FBTA 4YR0A 4UB4A 5ALVA 7ICTA 4P0PA 4QJFB 3D2NA 1TVAA 2ODGA 3FYHA 8ICBA 2K8AA 4R64A 3RFAA 4KMOB 1CRXA 5ALUA 4AYBF 2XGPA 3ZD9A 3TFRA 7ICOA 3KHHA 4DOAA 5KG6A 1ZD3A 2KZMA 4I2IA 9ICKA 2D3DA 3RBEA 2YN4A 3TADC 4NLNA 4P4OA 3C1ZA 7ICUA 1WWVA 2XVTA 7ICIA 4QWDA 4DCCA 3O0FA 4M04A 1L7OA 3EPIA 4PHEA 2OXOA 2IOFK 4KMUA 2EQYA 4DQRA 2NRVA 4Y2YA 1SB3C 1Z4OA 3MGVA 4NLGA 2ZIXA 3Q8QB 4J9OA 9ICSA 1SWWA 2R8KA 2BPCA 3PNCA 5EE0A 2PMZC 4O9MA 2W9MA 3GIJA 2CRXA 4PZOA 1Q3UA 3SZ2A 9ICXA 2QKQA 1RM6C 1BPXA 3OSNA 3QU7A 1Z4NA 2FMSA 4DQPA 3QUCA 1NK7A 3D6JA 3RTVA 5J2BA 7ICHA 2W43A 2KNJA 1SKRA 4I2AA 2FLPA 3N7RC 4GLXA 2G06A 1F0MA 3F2DA 1SL0A 3IV6A 7ICVA 3UM9A 4M2YA 8ICCA 2W9CA 2XY7A 4C0ZA 4JMUA 2DL0A 1U4BA 1BPEA 4I2FA 5IIOA 3AMZA 5D4BA 5DBCA 3WKAA 3GILA 4UB8U 5AK4A 4Q8FA 4DSIA 5DBAA 5J0UA 4KLQA 3B0YA 3HX0A 1Q8KA 4B9UA 2MA1A 3MGHA 2FI1A 8ICZA 2R8HA 4UBBA 1LKYA 3G6YA 2FMQA 9ICWA 1O03A 2RDIA 3UMGA 2KSOB 4ED1A 2JEGA 3DV9A 1RXWA 4M9NA 3OJSA 4O5EA 5KT2A 1L8OA 4MF2A 4JV1A 3GDXA 2WFAA 3C28A 3QZ8A 4MFCA 5KNIA 4I2HA 4NLKA 5KFVA 2JGAA 3F5EA 5ALLA 4QZ8A 4ZH4A 2W7PA 4EZ6A 3KZXA 1ZRNA 1DK2A 1UT8A 4DL2A 5AKLA 4IQTA 5DQHA 2BPGA 4BDPA 2FMPA 2WAQF 1UT5A 4J9KA 2HI0A 3KKAC 3SV3A 3WKEA 3AU6A 4ECZA 5DDMA 5T14A 1JIHA 4F2SA 2HHSA 3QYPA 2ASJA 2IMWP 1ZQTA 2WF6A 1UHUA 3KBBA 4RNOA 5ALSA 3LWMA 4IQUA 1BPZA 4KN7A 1K1SA 1ZQOA 3AUOA 1B0XA 2YB4A 4UBCA 3EYZA 3GZFA 2CXYA 1UPHA 1B43A 4EBCA 2HBMA 3NUQA 2E8OA 3GIKA 1PUZA 2W3SA 5EE1A 5AK3A 2C2DA 2IBKA 1A76A 4OO1J 2IOFA 4GXIA 3LWLA 3PY8A 3GIMA 5CWRA 3S6JA 1SL1A 1YT3A 1Y88A 5ALNA 3PW7A 5J0WA 4PGQA 3K1ZA 1UA0A 2BQRA 5AM3A 1S0NA 1VDVA 4F5RA 1KBUA 4YMOA 1U47A 2B6GA 5KFQA 5KFNA 5ALIA 2GLEA 2K8CB 4RT2A 2XC9A 5KG4A 4I27A 2ZIVB 2HOIA 1T3NA 1T7PA 1QSYA 2FJ6A 4KLIA 3RBDA 4UATA 1JMSA 9ICMA 3AN1A 1U9LA 4F72A 1MA7A 4KLJA 2LHTA 2BHNA 3IHQB 4ECXA 1DOQA 4F4ZA 5ALGA 4PL2A 3AEVA 2BCUA 1Z3EB 3IG5A 1RQLA 4J03A 3QEBZ 2NRXA 4R65A 2BGWA 8ICFA 2HBLA 2Y0SF 4EBEA 5DBBA 4PHAA 8ICKA 2QLTA 4ECYA 4P0PB 3V7JA 4Y2TA 5JUMA 2AGQA 2ZXHA 2GWSA 2QARA 9ICRA 3NVWA 3BQTA 1NK9A 2F2AB 2YMPA 1D9DA 3T5JA 4DF4A 5ALTA 4RQ8A 1TK8A 2VANA 3T5LA 3QU9A 2ZTCA 3SAFA 2PFNA 4DL5A 2PXIA 4J9QA 4K4HA 2W9BA 1C7YA 2V9WA 5IINA 1QQ5A 2WHEA 3BS7A 3QZ7A 5CHGA 5KFEA 4RUCA 4KLEA 4Q44A 2ZIUA 3PX0A 3M7DA 8ICPA 2K89A 5C0YA 5KFWA 5HHIA 5KG2A 5AIAA 5KFXA 3UPQA 2KN7A 2BCRA 3SD7A 4TUQA 3AU2A 3TKAA 5DB7A 3RR8A 2ZIXB 1ZQIA 4I28A 5J2FA 5AM2A 3FC4A 2IA6A 2HOQA 3RAXA 1N56A 3RJKA 2F8LA 5EWEA 1L6NA 4YP3A 1TAMA 8ICYA 1ZQUA 1S77D 4I2GA 4NLBA 3NVZA 2DFLA 2CN1A 1NJWA 3M6KA 4UB2A 4FZNA 2DUYA 4EYIB 3LVWA 4ZOHC 4IR1A 2KKVA 3NGDA 3GFKB 2M0NA 2PFOA 1Z00A 1ZQHA 5EWFA 3T79A 1RZTA 2YY6A 5ALEA 2W9CB 1TAUA 5DQIA 4I2EA 4EX7A 3LK9A 4FE3A 4NL9C 2F1JA 1LV5A 3C2KA 2R8IA 5KFRA 2F8KA 2LI6A 4J9LA 2BCSA 2FDRA 4ED6A 1EXNA 2ZTDA 2BQUA 1N63A 2E8MA 3C21A 1NKCA 2DGZA 5KFDA 4DL7A 3QU2A 4RPXA 2V4QA 3WK7A 3QUBA 1BVSA 5J2AA 3T5KA 5J2DA 5KL1B 1MQ2A 3G6VA 4F93B 3AL0B 2LM4A 3UXOA 2P35A 1J2NA 2KV2A 2KICA 1ZD5A 4QIWF 4CF3A 2FLNA 1L7PA 5ALOA 4LVSA 2W04A 2N1RA 4ECSA 4UARA 1UA1A 4F91B 1L3VA 2WB1C 3PO5A 4QNLA 4C7ZA 3DDHA 4UW9A 4PH5A 3LDAA 4C8KA 4DL3A 5KAFU 2WF5A 4QZHA 3VCBA 1URJA 4O3SA 1S0MA 1Q46A 5ALKA 2XI9A 3GQCA 2VA3A 1CEZA 9ICHA 4UB1A 5KFAA 5L1IA 4Z6DA 2E8PA 4DSKA 3CYMA 3M8RA 4FZMA 3GU3A 2LYAA 3KOOA 5AIBA 2HVHA 4BJQA 4CNQA 1RQNA 4C4RA 4GXJA 4YVZA 3MGIA 2KMDA 2IOHA 4QZGA 5ALPA 2MUTA 4BUGA 2DKZA 5B66U 1SZHA 4ELUA 4DO9A 2UVRA 3NRZA 7ICGA 3MR3A 1TK0A 1T94A 3OTQA 4P0QA 1ZQVA 5KFKA 2AXTU 3LYSA 5KFBA 1V85A 3UQ2A 3E58A 1U49A 3Q8PB 4Q8EA 4MEXA 2KE7A 1KLNA 4LJXA 3RJGA 1KKXA 5TZVA 5ALHA 5ALWA 1WUDA 1ECWA 2H3FA 1NK8A 5KT7A 4NJ8A 2OM6A 4MHVA 5A0LA 3ONNA 3CP8A 9ICCA 2G08A 1QQ6A 3QX7A 3PX4A 4KLSA 5KFMA 1NJYA 2RRDA 1X9SA 1U45A 5J29A 2VIXA 3SEIA 1ZQEA 2NV3A 1MSWD 1V97A 2QARB 3QE9Y 4B9NA 2DWQA 2LPEA 5HHHA 4Z6FA 5J0RA 4ELTA 4UB6U 4IQVA 1ZQ1C 4FBUA 5DB8A 4YR2A 4RQ7A 3MFIA 2XY6A 4Y2XA 4ELVA 9ICFA 4IR9A 4DSJA 5DG9A 2W9BB 4JUZA 5KG5A 3ICXA 5KFIA 1HUOA 3ZDBA 2ZJ5A 1KTQA 3A0HU 4ED7A 2HHQA 1JROA 2ZIUB 5J0TA 9ICAA 1NK5A 3AQFA 5J2EA 5AKXA 5J0PA 4F5OA 3GIIA 5GTHU 5ALZA 2VJ5A 4DFKA 1ZQRA 5EWGA 2JEFA 2PI5A 2AJQA 1BPBA 1RG6A 1QQ7A 4Q43A 4LZDA 4F8RA 4P4MA 5F9LA 3JPSA 3EUB2 2UVUA 2HMXA 3GV7B 3UXNA 4F4KA 4I2JA 2F76X 4DOCA 4C8OA 4PHPA 1QTMA 4ED0A 5J2GA 1LB2B 4NXZA 2ZIWA 3HT3A 2W11A 4DQIA 2B21A 1TAQA 4RQ0A 2F44A 3H40A 3JPQA 5KAIU 5DG7A 1NKEA 3V6HA 2F1IA 2W9AA 2RDJA 3RRGA 2HCFA 3MDCA 5EOZA 5AHXA 1P7DA 2IHNA 5F9NA 5J0SA 1SZPA 3K4GA 9ICGA 4F50A 4OCZA 5KT3A 1NZPA 5L1KA 2KHQA 1ZQMA 1RXVA 3WK4A 3PO4A 3BQ2A 1PK3A 2Z7JA 2JR5A 4Z6CA 1NI3A 5KFZA 1XWLA 1D9FA 4KX5A 4EYHB 3PZPA 2EH9A 3KZIU 2UVVA 2B0CA 5AI4A 4FFDA 3RAQA 1KFSA 2AGPA 2KP7A 3UQ0A 1UCVA 3J81j 3N28A 2UVWA 3F2CA 1X9XA 2F3NA 1YZ6A 1X42A 2NYVA 1F5SA 9ICNA 9ICOA 3VC8A 5CJ7A 1DRGA 5ALJA 3KKAA 1D8YA 1HIWA 1O08A 1SL2A 4NLCA 3HW8A 2JH1A 2HHUA 4QWCA 1L5UA 2ESEA 2G07A 5J2HA 5ALDA 4FS2A 1BPYA 2YMMA 1DXSA 1MN8A 2NRWA 5AM0A 3Q8KA 4DSFA 4C8NA 2AH5A 1MQ3A 4BWMA 1BNPA 5KFYA 2KIVA 1WWUA 3ZDDA 2BZFA 2WF7A 1KSPA 5HNKA 2R8GA 2NO5A 9ICQA 3H8SA 1KL9A 1H38A 3KFUF 1JXEA 2RHFA 2JH7A 5D46A 1IIPA 3RJFA 1XSLA 2PFPA 2KK0A 2MUTB 4PHDA 3C5GA 4IL6U 3H8JA 2WF8A 3HKZC 1K1QA 2EDUA 3C29A 4F4WA 5G5HA 2HHXA 3IP4B 4C7YA 2OH2A 2Y9TA 4P0QB 2K4HA 2VJ4A 5J2JA 3IG8A 2PMZF 2KJ5A 9ICEA 3ZDCA 5AI9A 4R8UB 5KFCA 1S0OA 1X2IA 2W8KA 3TACB 3KHGA 4KLGA 2XCPA 2ISOA 2ZJ8A 1ZQNA 3LVVA 3PR4A 1OXJA 4BWJA 2XCAA 4DEZA 4CGZA 2ZUDA 3TQ1A 4FS1A 1NOMA 4KLUA 3OJUA 3PR5B 1HEKA 2C22A 1NK0A 5HR6A 2W03A 1CI4A 1N5WA 1X40A 3BZCA 4JV0A 3E0FA 3IRUA 2JZBA 1K5OA 3JPRA 2YQEA 1SKWA 3RH5A 2A3VA 1PK1A 5CEHA 3SENA 5L1MA 5KFFA 5AKIA 3H0MB 5G5GA 5HP4A 5DB9A 1IG6A 3BQ0A 3RJHA 3RH6A 7ICLA 1ZQAA 4EBDA 1KEJA 2G5HB 2OWOA 5J2CA 2EZZA 3V72A 3D2QA 2JXJA 4QWBA 1NJXA 4WJ3B 5AKEA 3QEAZ 1T3QA
chains in the Genus database with same CATH topology
1SV0C 1COKA 1SXEA 2EAOA 1WWVA 2EAMA 2K60A 5J8YC 4RQNA 3SEIA 2D8CA 1V38A 2QARB 5JRTA 2QB0A 3BS5A 2LPEA 1SV4A 2K4PA 1Z1VA 3K1RB 2E8PA 1PK3A 2KSOA 1KW4A 2EANA 3KKAC 4RQMA 5JU5A 2Y9TA 5JTIA 1SGGA 1UCVA 4PZOA 2E8NA 5J8YA 4NL9C 2DKXA 1SXDA 2QKQA 1PK1B 2KMDA 3TACB 2QARA 2F8KA 1X9XA 1JI7A 2F3NA 2DKZA 1OXJA 3TADA 3H8MA 1B0XA 3BQ7A 2JV3A 3KKAA 2E8MA 1SV0A 1RG6A 1B4FA 1F0MA 3IDWA 2E8OA 2ESEA 1X40A 2DL0A 4NL9A 3BS7A 1DXSA 4IS7A 2ES6A 2LMRA 1UQVA 4PZNA 1PK1A 1V85A 3SENA 5L1MA 2KE7A 2KG5A 2QB0B 3BS5B 1OW5A 1LKYB 2FE9A 2EAPA 1X66A 1LKYA 4NJ8A 3HILA 4MHVA 2KIVA 2B6GA 1WWUA 2YTUA 2KSOB 2Y9UA 2F44A 2D3DA 2GLEA 2L5YA 3TADC 5F3XB 5KNIA 2QB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SV0 C;  1COK A;  1SXE A;  2EAO A;  1WWV A;  2EAM A;  2K60 A;  5J8Y C;  4RQN A;  3SEI A;  2D8C A;  1V38 A;  2QAR B;  5JRT A;  2QB0 A;  3BS5 A;  2LPE A;  1SV4 A;  2K4P A;  1Z1V A;  3K1R B;  2E8P A;  1PK3 A;  2KSO A;  1KW4 A;  2EAN A;  3KKA C;  4RQM A;  5JU5 A;  2Y9T A;  5JTI A;  1SGG A;  1UCV A;  4PZO A;  2E8N A;  5J8Y A;  4NL9 C;  2DKX A;  1SXD A;  2QKQ A;  1PK1 B;  2KMD A;  3TAC B;  2QAR A;  2F8K A;  1X9X A;  1JI7 A;  2F3N A;  2DKZ A;  1OXJ A;  3TAD A;  3H8M A;  1B0X A;  3BQ7 A;  2JV3 A;  3KKA A;  2E8M A;  1SV0 A;  1RG6 A;  1B4F A;  1F0M A;  3IDW A;  2E8O A;  2ESE A;  1X40 A;  2DL0 A;  4NL9 A;  3BS7 A;  1DXS A;  4IS7 A;  2ES6 A;  2LMR A;  1UQV A;  4PZN A;  1PK1 A;  1V85 A;  3SEN A;  5L1M A;  2KE7 A;  2KG5 A;  2QB0 B;  3BS5 B;  1OW5 A;  1LKY B;  2FE9 A;  2EAP A;  1X66 A;  1LKY A;  4NJ8 A;  3HIL A;  4MHV A;  2KIV A;  2B6G A;  1WWU A;  2YTU A;  2KSO B;  2Y9U A;  2F44 A;  2D3D A;  2GLE A;  2L5Y A;  3TAD C;  5F3X B;  5KNI A;  2QB1 A; 
#chains in the Genus database with same CATH topology
 1COK A;  2ZG6 A;  2EAO A;  3C1Y A;  4DWI A;  8ICG A;  1WYG A;  2Q0Z X;  2EAM A;  3ZDE A;  1ZQY A;  4EEK A;  3PW5 A;  2KZZ A;  1ED1 A;  2PI4 A;  5CP2 A;  1ZQB A;  4RQ3 A;  1JUD A;  1SV4 A;  1FO4 A;  5KT6 A;  3N97 B;  4RNM A;  4DFP A;  4DFD A;  3Q8R B;  1TE2 A;  1IM4 A;  2DF4 B;  3HRD D;  2XO7 A;  4RQM A;  2KOB A;  4PJ0 U;  3QXG A;  3TFS A;  1SGG A;  4B9S A;  1Z19 A;  2XIC A;  5DLF A;  3ZD8 A;  2E8N A;  3UMB A;  3H8W A;  1ZD4 A;  4EX6 A;  5KFH A;  1RYU A;  4KLH A;  8ICH A;  1NK4 A;  1ARO P;  2ASL A;  4OJ5 A;  3AQE A;  4U6P A;  2C2R A;  4PPX A;  3K75 D;  2ZIW B;  4DLG A;  4J9P A;  2VA8 A;  3KHL A;  1T4G A;  2ASD A;  3RJJ A;  4YD2 A;  4DOB A;  1RYS A;  2VKQ A;  3WKD A;  2PFQ A;  1XNS A;  3BDP A;  4NL9 A;  4YFK A;  3WKB A;  3ETR A;  3MR2 A;  3PSF A;  3QU5 A;  4QZD A;  5BOL A;  5J0O A;  2NO4 A;  4AYB C;  1S97 A;  4O0I A;  3H4D A;  1ZQK A;  1LKY B;  5DGB A;  1ZQP A;  3WU2 U;  4FO6 A;  3NTU A;  4TUR A;  4KLL A;  5BPC A;  4I2B A;  1RDF A;  4R66 A;  2WF9 A;  1FIQ A;  3HP6 A;  2Q4T A;  1JX4 A;  2HDO A;  3MC1 A;  1BNO A;  1V9P A;  1L7N A;  2D6F C;  4BXO A;  4K4I A;  1ZXI A;  4Y2V A;  3RB4 A;  4F5Q A;  1LVH A;  4QZC A;  2E3T A;  1L8L A;  2JEI A;  2DPJ A;  2OEH A;  2Y1I A;  3CW2 C;  1J97 A;  5DDY A;  5AI0 A;  4YR3 A;  3ALR A;  5JRT A;  2H3Q A;  4B9V A;  5L1L A;  3QNM A;  4XRH A;  4NLZ A;  5KFP A;  1DGJ A;  4ICA A;  4HAI A;  5KG7 A;  3PW0 A;  1ZOL A;  4UAS A;  2W7O A;  2W54 A;  2MAX A;  2HBK A;  2NRZ A;  2K4I A;  2K4E A;  9ICI A;  4KLD A;  9ICV A;  2DQN B;  4M9L A;  3E2E A;  4RU9 A;  5KG0 A;  4OJ6 A;  3B9J A;  2GOL A;  3F53 A;  3SAG A;  1A77 A;  4CF4 A;  2V4R A;  1L3U A;  5KFU A;  4TQS A;  2RQ5 A;  2AQ0 A;  3KD3 A;  3KHR A;  2P6U A;  2ZUB A;  1SV0 A;  4QW8 A;  3RRH A;  1TFR A;  4M9G A;  2LKY A;  3BQ1 A;  4HYK A;  1KDH A;  3IDW A;  4I2C A;  2I5H A;  1X9W A;  5KFL A;  4O3O A;  5CR0 A;  4F92 B;  3C2M A;  4KN4 A;  4DSE A;  4DFJ A;  1UQV A;  3IN5 A;  3SQI A;  2BCV A;  3ISD A;  1PVP A;  4YMM A;  4ED8 A;  5DLG A;  5KT5 A;  4O5C A;  3DEE A;  1OW5 A;  2JRZ A;  4F2R A;  1X66 A;  2E1E A;  5E79 U;  2AU0 A;  4M6W A;  4A8E A;  4XUS A;  1B22 A;  2OCE A;  4C8M A;  1KRP A;  4JK1 A;  3A0B U;  3TAP A;  2HBJ A;  3RJI A;  8ICI A;  3GV8 B;  2DPI A;  3AM9 A;  4ECW A;  4U7C A;  3EPG A;  8ICN A;  5J8Y C;  1QLN A;  5IIJ A;  4I29 A;  1ZQG A;  4Y2U A;  1SWV A;  3F5A A;  4LZG A;  1NK6 A;  4RQ5 A;  5AKK A;  2WAQ C;  2ZJA A;  5HR7 A;  1J2M A;  4QZB A;  2P6R A;  1KFD A;  3TAN A;  2GH1 A;  4M47 A;  1COO A;  1RPL A;  2LBO A;  3GV5 B;  2MSN A;  2EZX A;  1PVQ A;  3Q8L A;  2JZB B;  5H2F U;  1SXD A;  2RLT A;  1PK1 B;  3N4M B;  4P2H A;  4C8L A;  3MR6 A;  2F77 X;  4C4T A;  1JI7 A;  2H3Z A;  1ZQC A;  2ZUC A;  4BX9 C;  3TAD A;  4DL4 A;  2ZTE A;  1M6Y A;  2KJ8 A;  4MEY A;  3JPN A;  4GC7 A;  4B9M A;  1D8B A;  4GIB A;  4XA5 A;  8ICV A;  5AM1 A;  2M9N A;  1C20 A;  5CB1 A;  1ZJN A;  3N7S C;  4JV2 A;  1HUZ A;  4TUS A;  2ES6 A;  2ZXI A;  5L1J A;  4KLM A;  2BR0 A;  3C23 A;  8ICJ A;  4NWI A;  2R18 A;  4R63 A;  2BDU A;  1N61 A;  5CRX A;  4US8 A;  5BOM A;  2FE9 A;  5AKY A;  4KX3 A;  1WCN A;  5AK6 A;  5HMM A;  1QSS A;  9ICT A;  4DFM A;  7ICR A;  2WB1 F;  5K4L A;  4DQS A;  4IRC A;  1MC8 A;  3QUQ A;  3MR5 A;  1WG8 A;  5ALM A;  2J6U A;  4IQW A;  3ED5 A;  1SXE A;  3V6K A;  3V7L A;  2XGQ A;  2XY5 A;  7ICS A;  5DQG A;  3OHB A;  1V38 A;  1XC9 A;  4C80 A;  4IRK A;  2I1Q A;  2KIW A;  9ICP A;  1QSL A;  2K4P A;  3EW9 A;  4J9M A;  4FZL A;  5ALR A;  1FFV A;  5KFT A;  4JB3 A;  4K4G A;  3H0L B;  3OGU A;  1TK5 A;  1TKD A;  1Z00 B;  5III A;  5J0X A;  3WK5 A;  1KFT A;  4O3Q A;  2Y0S C;  2WTF A;  2RP5 A;  3M9N B;  4MFA A;  4DF8 A;  1N48 A;  3TAQ A;  5KL8 B;  2J6T A;  1XU4 A;  3FM9 A;  5AIC A;  2KZ3 A;  2YMQ A;  2W3R A;  5DGA A;  4I2D A;  3V6J A;  4ECV A;  3G6X A;  4J9R A;  4Z6E A;  3RB6 A;  2E1F A;  4EEN A;  7ICK A;  2MRL A;  1SKS A;  5J0Y A;  3NVV A;  2H3V A;  3JPO A;  1B4F A;  1HJP A;  3JPP A;  2HSZ A;  3I1Y A;  5HML A;  3SYZ A;  5FP0 A;  4BXO B;  5KFS A;  5KFG A;  2LMR A;  1NKB A;  2FPL A;  4RQ6 A;  3ZDA A;  8ICE A;  3D2S A;  5AM5 A;  3KTQ A;  5AI5 A;  5KFO A;  4DSL A;  1IXR A;  2KG5 A;  5J2K A;  2KVS A;  3Q8S B;  4QZF A;  4O5K A;  3M9M B;  3RB0 A;  3ETL A;  5L9X A;  8ICM A;  8ICR A;  3PW2 A;  5D49 A;  1X6J A;  7ICP A;  4RT3 A;  5F3X B;  2KD1 A;  3CNH A;  3SV4 A;  2QB1 A;  2HHV A;  5IIK A;  1L7M A;  7ICN A;  1F44 A;  2EZY A;  3RH4 A;  1FFU A;  1N5X A;  2QB0 A;  3BS5 A;  3ZI4 A;  4IRD A;  4X5V A;  4QW9 A;  1ZRM A;  3IM1 A;  4NY8 A;  1KW4 A;  2GO7 A;  3NS1 A;  1YZ7 A;  3OPX A;  1AQ6 A;  2C28 A;  4YCX A;  4NV0 A;  3QUT A;  3HJE A;  3WK6 A;  3WK9 A;  3C2L A;  9ICU A;  4OJP A;  4RQ4 A;  2H5X A;  4ED2 A;  3PX6 A;  4RQ2 A;  2A19 A;  7ICM A;  3PW4 A;  4QWE A;  4YMN A;  4USA A;  1BGX T;  1DK3 A;  2C2E A;  5AKH A;  2BQ3 A;  1ZQJ A;  3MBY A;  7ICF A;  3H8M A;  3QU4 A;  3SMV A;  2JV3 A;  2LYH A;  3ORY A;  4ECU A;  1KQQ A;  1S8O A;  4B9L A;  4QZE A;  5DB6 A;  2KJ9 A;  4M6W B;  2A1A A;  3MFH A;  3M9O B;  4PL1 A;  1S9F A;  1ZJM A;  4RPY A;  1GO3 F;  4M0A A;  3B0X A;  8ICW A;  5J0Q A;  2ALZ A;  2YX8 A;  2LYB A;  4C4S A;  1SIJ A;  3MAB A;  1ZET A;  3RB3 A;  3JPT A;  5AI6 A;  4QIW C;  2KFN A;  3R9K A;  2NRT A;  8ICT A;  1A6S A;  1PVR A;  5AKZ A;  1S5L U;  3T3F A;  3UXP A;  3SAH A;  4ED3 A;  2A1J A;  4YXM A;  4TQR A;  2E5S A;  3H0R B;  4RQ1 A;  4PGX A;  1S0V A;  3PV8 A;  4F3O A;  4UAY A;  4UAZ A;  2L5Y A;  2BPF A;  4IC9 A;  2KTQ A;  1L3S A;  1PZN A;  4UB3 A;  2FLL A;  3PSI A;  2BCQ A;  3H4B A;  2D8C A;  1NNL A;  4KLF A;  5ALF A;  4YN4 A;  2YB1 A;  3C5F A;  3M8S A;  1Z1V A;  1WCL A;  3K1R B;  4OJO A;  4KLO A;  4EEL A;  1S10 A;  2EAN A;  2ISP A;  2LM1 A;  5JU5 A;  4RZR A;  1XSN A;  9ICB A;  2PKE A;  4Y2S A;  2I6X A;  1X9M A;  4DL6 A;  5KT4 A;  2XID A;  4F71 A;  3T5H A;  1N2X A;  4MFF A;  4QZI A;  3EZ5 A;  2FPK A;  2KHV A;  4UAV A;  3RR7 A;  1VJ5 A;  4OJL A;  4O3M A;  5ALX A;  1NJZ A;  1ZD2 P;  3M6Z A;  5AK5 A;  4YXJ A;  1BPD A;  2AQ4 A;  2OYY A;  5DKW A;  3L5K A;  8ICL A;  4GFJ A;  4OD0 A;  4DS5 A;  1ZYQ A;  4Y2R A;  2HOF A;  1ZQZ A;  2G0A A;  2H3I A;  3RF9 A;  3FDS A;  1U48 A;  4CF5 A;  5EE3 A;  4US9 A;  5DG8 A;  5B5E U;  2JEJ A;  5KG1 A;  1N60 A;  4P4P A;  4KLT A;  3SI8 A;  2EAP A;  4M9J A;  3HIL A;  4CE6 A;  1ZQL A;  1JAL A;  4JWN A;  5EE9 A;  2KFZ A;  1RYR A;  4CCH A;  4GC6 A;  2AHO B;  1L3T A;  4RNN A;  1XS9 D;  1XO0 A;  3ISB A;  1FEZ A;  3PSP A;  4YG2 A;  4DLE A;  4MF8 A;  2G09 A;  4TUP A;  4UAW A;  1DGS A;  5CA7 A;  5GTI U;  2K60 A;  4GXK A;  4ECT A;  3WKC A;  3RJE A;  4J9S A;  3OHA A;  3V7K A;  3L4P A;  4O3P A;  4CDG A;  4DQQ A;  4G3I A;  3PST A;  4YD1 A;  7ICE A;  5ALY A;  1OUQ A;  2O6K A;  2J6S A;  2KSO A;  2W55 A;  4F5P A;  3I28 A;  2MU2 A;  8ICU A;  3HKZ F;  1XO1 A;  2JMG A;  4Y2P A;  4RPZ A;  3NAS A;  3THV A;  3F2B A;  2KVC A;  1ZQW A;  2G5I B;  4PGY A;  5KFJ A;  2I9G A;  2FPM A;  8ICO A;  1XSP A;  4B9T A;  1JN3 A;  4JWM A;  2BDP A;  3OSP A;  3BQ7 A;  3L3F X;  5KG3 A;  1ZQX A;  4AP9 A;  1X6I A;  2R8J A;  1ZQF A;  3HWT A;  5ALQ A;  4M9H A;  4O3N A;  2K8B B;  3U26 A;  1IV8 A;  4Y2Q A;  1VLB A;  1KN5 A;  3Q8M A;  1QH9 A;  3TAR A;  1Q3V A;  4IS7 A;  2HVI A;  4XQ8 A;  3EWA A;  4PZN A;  2DBY A;  4ACO A;  8ICA A;  2HW3 A;  4NM1 A;  4F4X A;  4NM2 A;  2KKP A;  2BKE A;  5J2I A;  1N62 A;  3UMC A;  9ICL A;  2VA2 A;  7ICJ A;  2ATL A;  2QB0 B;  3BS5 B;  4E0D A;  1CUK A;  4BGD A;  2HHW A;  4Q45 A;  2JHD A;  2IHM A;  8ICS A;  4G9B A;  4QZ9 A;  4DS4 A;  1Z1B A;  1D8L A;  2YTU A;  2OHF A;  1TV9 A;  2Y9U A;  4EZ9 A;  3MDA A;  1QCK A;  2AGO A;  4QZA A;  3M1Y A;  3NRW A;  5AKJ A;  4ECR A;  5TIS U;  4B6J A;  3BJY A;  4KTQ A;  3BZK A;  1SV0 C;  3TI0 A;  1ZQS A;  2Y1J A;  4CRX A;  4RQN A;  2W8L A;  2P66 A;  5C5J A;  1JXL A;  1T8E A;  8ICX A;  1NZB A;  5IIL A;  4F5N A;  5AM4 A;  3N7P D;  5KTQ A;  4UAU A;  9ICJ A;  1ZQQ A;  2HHT A;  4EEY A;  4UQG A;  2CPR A;  5JTI A;  3FAH A;  2ZIV A;  3PVX A;  7ICQ A;  3PML A;  3WK8 A;  5J8Y A;  3HPO A;  3CRX A;  2DKX A;  3PMN A;  4R8U A;  3NVY A;  4YQW A;  4QWA A;  1ZQD A;  4RUA A;  1A0P A;  3H7I A;  2KEY A;  2F1H A;  3ISC A;  3SR6 A;  4Y2J A;  5AI8 A;  8ICQ A;  5IIM A;  3I76 A;  1S76 D;  4J9N A;  2A1J B;  4F4Y A;  2YML A;  5AKG A;  4O3R A;  1JRP A;  4ECQ A;  4KIT B;  4UB5 A;  4FBT A;  4YR0 A;  4UB4 A;  5ALV A;  7ICT A;  4P0P A;  4QJF B;  3D2N A;  1TVA A;  2ODG A;  3FYH A;  8ICB A;  2K8A A;  4R64 A;  3RFA A;  4KMO B;  1CRX A;  5ALU A;  4AYB F;  2XGP A;  3ZD9 A;  3TFR A;  7ICO A;  3KHH A;  4DOA A;  5KG6 A;  1ZD3 A;  2KZM A;  4I2I A;  9ICK A;  2D3D A;  3RBE A;  2YN4 A;  3TAD C;  4NLN A;  4P4O A;  3C1Z A;  7ICU A;  1WWV A;  2XVT A;  7ICI A;  4QWD A;  4DCC A;  3O0F A;  4M04 A;  1L7O A;  3EPI A;  4PHE A;  2OXO A;  2IOF K;  4KMU A;  2EQY A;  4DQR A;  2NRV A;  4Y2Y A;  1SB3 C;  1Z4O A;  3MGV A;  4NLG A;  2ZIX A;  3Q8Q B;  4J9O A;  9ICS A;  1SWW A;  2R8K A;  2BPC A;  3PNC A;  5EE0 A;  2PMZ C;  4O9M A;  2W9M A;  3GIJ A;  2CRX A;  4PZO A;  1Q3U A;  3SZ2 A;  9ICX A;  2QKQ A;  1RM6 C;  1BPX A;  3OSN A;  3QU7 A;  1Z4N A;  2FMS A;  4DQP A;  3QUC A;  1NK7 A;  3D6J A;  3RTV A;  5J2B A;  7ICH A;  2W43 A;  2KNJ A;  1SKR A;  4I2A A;  2FLP A;  3N7R C;  4GLX A;  2G06 A;  1F0M A;  3F2D A;  1SL0 A;  3IV6 A;  7ICV A;  3UM9 A;  4M2Y A;  8ICC A;  2W9C A;  2XY7 A;  4C0Z A;  4JMU A;  2DL0 A;  1U4B A;  1BPE A;  4I2F A;  5IIO A;  3AMZ A;  5D4B A;  5DBC A;  3WKA A;  3GIL A;  4UB8 U;  5AK4 A;  4Q8F A;  4DSI A;  5DBA A;  5J0U A;  4KLQ A;  3B0Y A;  3HX0 A;  1Q8K A;  4B9U A;  2MA1 A;  3MGH A;  2FI1 A;  8ICZ A;  2R8H A;  4UBB A;  1LKY A;  3G6Y A;  2FMQ A;  9ICW A;  1O03 A;  2RDI A;  3UMG A;  2KSO B;  4ED1 A;  2JEG A;  3DV9 A;  1RXW A;  4M9N A;  3OJS A;  4O5E A;  5KT2 A;  1L8O A;  4MF2 A;  4JV1 A;  3GDX A;  2WFA A;  3C28 A;  3QZ8 A;  4MFC A;  5KNI A;  4I2H A;  4NLK A;  5KFV A;  2JGA A;  3F5E A;  5ALL A;  4QZ8 A;  4ZH4 A;  2W7P A;  4EZ6 A;  3KZX A;  1ZRN A;  1DK2 A;  1UT8 A;  4DL2 A;  5AKL A;  4IQT A;  5DQH A;  2BPG A;  4BDP A;  2FMP A;  2WAQ F;  1UT5 A;  4J9K A;  2HI0 A;  3KKA C;  3SV3 A;  3WKE A;  3AU6 A;  4ECZ A;  5DDM A;  5T14 A;  1JIH A;  4F2S A;  2HHS A;  3QYP A;  2ASJ A;  2IMW P;  1ZQT A;  2WF6 A;  1UHU A;  3KBB A;  4RNO A;  5ALS A;  3LWM A;  4IQU A;  1BPZ A;  4KN7 A;  1K1S A;  1ZQO A;  3AUO A;  1B0X A;  2YB4 A;  4UBC A;  3EYZ A;  3GZF A;  2CXY A;  1UPH A;  1B43 A;  4EBC A;  2HBM A;  3NUQ A;  2E8O A;  3GIK A;  1PUZ A;  2W3S A;  5EE1 A;  5AK3 A;  2C2D A;  2IBK A;  1A76 A;  4OO1 J;  2IOF A;  4GXI A;  3LWL A;  3PY8 A;  3GIM A;  5CWR A;  3S6J A;  1SL1 A;  1YT3 A;  1Y88 A;  5ALN A;  3PW7 A;  5J0W A;  4PGQ A;  3K1Z A;  1UA0 A;  2BQR A;  5AM3 A;  1S0N A;  1VDV A;  4F5R A;  1KBU A;  4YMO A;  1U47 A;  2B6G A;  5KFQ A;  5KFN A;  5ALI A;  2GLE A;  2K8C B;  4RT2 A;  2XC9 A;  5KG4 A;  4I27 A;  2ZIV B;  2HOI A;  1T3N A;  1T7P A;  1QSY A;  2FJ6 A;  4KLI A;  3RBD A;  4UAT A;  1JMS A;  9ICM A;  3AN1 A;  1U9L A;  4F72 A;  1MA7 A;  4KLJ A;  2LHT A;  2BHN A;  3IHQ B;  4ECX A;  1DOQ A;  4F4Z A;  5ALG A;  4PL2 A;  3AEV A;  2BCU A;  1Z3E B;  3IG5 A;  1RQL A;  4J03 A;  3QEB Z;  2NRX A;  4R65 A;  2BGW A;  8ICF A;  2HBL A;  2Y0S F;  4EBE A;  5DBB A;  4PHA A;  8ICK A;  2QLT A;  4ECY A;  4P0P B;  3V7J A;  4Y2T A;  5JUM A;  2AGQ A;  2ZXH A;  2GWS A;  2QAR A;  9ICR A;  3NVW A;  3BQT A;  1NK9 A;  2F2A B;  2YMP A;  1D9D A;  3T5J A;  4DF4 A;  5ALT A;  4RQ8 A;  1TK8 A;  2VAN A;  3T5L A;  3QU9 A;  2ZTC A;  3SAF A;  2PFN A;  4DL5 A;  2PXI A;  4J9Q A;  4K4H A;  2W9B A;  1C7Y A;  2V9W A;  5IIN A;  1QQ5 A;  2WHE A;  3BS7 A;  3QZ7 A;  5CHG A;  5KFE A;  4RUC A;  4KLE A;  4Q44 A;  2ZIU A;  3PX0 A;  3M7D A;  8ICP A;  2K89 A;  5C0Y A;  5KFW A;  5HHI A;  5KG2 A;  5AIA A;  5KFX A;  3UPQ A;  2KN7 A;  2BCR A;  3SD7 A;  4TUQ A;  3AU2 A;  3TKA A;  5DB7 A;  3RR8 A;  2ZIX B;  1ZQI A;  4I28 A;  5J2F A;  5AM2 A;  3FC4 A;  2IA6 A;  2HOQ A;  3RAX A;  1N56 A;  3RJK A;  2F8L A;  5EWE A;  1L6N A;  4YP3 A;  1TAM A;  8ICY A;  1ZQU A;  1S77 D;  4I2G A;  4NLB A;  3NVZ A;  2DFL A;  2CN1 A;  1NJW A;  3M6K A;  4UB2 A;  4FZN A;  2DUY A;  4EYI B;  3LVW A;  4ZOH C;  4IR1 A;  2KKV A;  3NGD A;  3GFK B;  2M0N A;  2PFO A;  1Z00 A;  1ZQH A;  5EWF A;  3T79 A;  1RZT A;  2YY6 A;  5ALE A;  2W9C B;  1TAU A;  5DQI A;  4I2E A;  4EX7 A;  3LK9 A;  4FE3 A;  4NL9 C;  2F1J A;  1LV5 A;  3C2K A;  2R8I A;  5KFR A;  2F8K A;  2LI6 A;  4J9L A;  2BCS A;  2FDR A;  4ED6 A;  1EXN A;  2ZTD A;  2BQU A;  1N63 A;  2E8M A;  3C21 A;  1NKC A;  2DGZ A;  5KFD A;  4DL7 A;  3QU2 A;  4RPX A;  2V4Q A;  3WK7 A;  3QUB A;  1BVS A;  5J2A A;  3T5K A;  5J2D A;  5KL1 B;  1MQ2 A;  3G6V A;  4F93 B;  3AL0 B;  2LM4 A;  3UXO A;  2P35 A;  1J2N A;  2KV2 A;  2KIC A;  1ZD5 A;  4QIW F;  4CF3 A;  2FLN A;  1L7P A;  5ALO A;  4LVS A;  2W04 A;  2N1R A;  4ECS A;  4UAR A;  1UA1 A;  4F91 B;  1L3V A;  2WB1 C;  3PO5 A;  4QNL A;  4C7Z A;  3DDH A;  4UW9 A;  4PH5 A;  3LDA A;  4C8K A;  4DL3 A;  5KAF U;  2WF5 A;  4QZH A;  3VCB A;  1URJ A;  4O3S A;  1S0M A;  1Q46 A;  5ALK A;  2XI9 A;  3GQC A;  2VA3 A;  1CEZ A;  9ICH A;  4UB1 A;  5KFA A;  5L1I A;  4Z6D A;  2E8P A;  4DSK A;  3CYM A;  3M8R A;  4FZM A;  3GU3 A;  2LYA A;  3KOO A;  5AIB A;  2HVH A;  4BJQ A;  4CNQ A;  1RQN A;  4C4R A;  4GXJ A;  4YVZ A;  3MGI A;  2KMD A;  2IOH A;  4QZG A;  5ALP A;  2MUT A;  4BUG A;  2DKZ A;  5B66 U;  1SZH A;  4ELU A;  4DO9 A;  2UVR A;  3NRZ A;  7ICG A;  3MR3 A;  1TK0 A;  1T94 A;  3OTQ A;  4P0Q A;  1ZQV A;  5KFK A;  2AXT U;  3LYS A;  5KFB A;  1V85 A;  3UQ2 A;  3E58 A;  1U49 A;  3Q8P B;  4Q8E A;  4MEX A;  2KE7 A;  1KLN A;  4LJX A;  3RJG A;  1KKX A;  5TZV A;  5ALH A;  5ALW A;  1WUD A;  1ECW A;  2H3F A;  1NK8 A;  5KT7 A;  4NJ8 A;  2OM6 A;  4MHV A;  5A0L A;  3ONN A;  3CP8 A;  9ICC A;  2G08 A;  1QQ6 A;  3QX7 A;  3PX4 A;  4KLS A;  5KFM A;  1NJY A;  2RRD A;  1X9S A;  1U45 A;  5J29 A;  2VIX A;  3SEI A;  1ZQE A;  2NV3 A;  1MSW D;  1V97 A;  2QAR B;  3QE9 Y;  4B9N A;  2DWQ A;  2LPE A;  5HHH A;  4Z6F A;  5J0R A;  4ELT A;  4UB6 U;  4IQV A;  1ZQ1 C;  4FBU A;  5DB8 A;  4YR2 A;  4RQ7 A;  3MFI A;  2XY6 A;  4Y2X A;  4ELV A;  9ICF A;  4IR9 A;  4DSJ A;  5DG9 A;  2W9B B;  4JUZ A;  5KG5 A;  3ICX A;  5KFI A;  1HUO A;  3ZDB A;  2ZJ5 A;  1KTQ A;  3A0H U;  4ED7 A;  2HHQ A;  1JRO A;  2ZIU B;  5J0T A;  9ICA A;  1NK5 A;  3AQF A;  5J2E A;  5AKX A;  5J0P A;  4F5O A;  3GII A;  5GTH U;  5ALZ A;  2VJ5 A;  4DFK A;  1ZQR A;  5EWG A;  2JEF A;  2PI5 A;  2AJQ A;  1BPB A;  1RG6 A;  1QQ7 A;  4Q43 A;  4LZD A;  4F8R A;  4P4M A;  5F9L A;  3JPS A;  3EUB 2;  2UVU A;  2HMX A;  3GV7 B;  3UXN A;  4F4K A;  4I2J A;  2F76 X;  4DOC A;  4C8O A;  4PHP A;  1QTM A;  4ED0 A;  5J2G A;  1LB2 B;  4NXZ A;  2ZIW A;  3HT3 A;  2W11 A;  4DQI A;  2B21 A;  1TAQ A;  4RQ0 A;  2F44 A;  3H40 A;  3JPQ A;  5KAI U;  5DG7 A;  1NKE A;  3V6H A;  2F1I A;  2W9A A;  2RDJ A;  3RRG A;  2HCF A;  3MDC A;  5EOZ A;  5AHX A;  1P7D A;  2IHN A;  5F9N A;  5J0S A;  1SZP A;  3K4G A;  9ICG A;  4F50 A;  4OCZ A;  5KT3 A;  1NZP A;  5L1K A;  2KHQ A;  1ZQM A;  1RXV A;  3WK4 A;  3PO4 A;  3BQ2 A;  1PK3 A;  2Z7J A;  2JR5 A;  4Z6C A;  1NI3 A;  5KFZ A;  1XWL A;  1D9F A;  4KX5 A;  4EYH B;  3PZP A;  2EH9 A;  3KZI U;  2UVV A;  2B0C A;  5AI4 A;  4FFD A;  3RAQ A;  1KFS A;  2AGP A;  2KP7 A;  3UQ0 A;  1UCV A;  3J81 j;  3N28 A;  2UVW A;  3F2C A;  1X9X A;  2F3N A;  1YZ6 A;  1X42 A;  2NYV A;  1F5S A;  9ICN A;  9ICO A;  3VC8 A;  5CJ7 A;  1DRG A;  5ALJ A;  3KKA A;  1D8Y A;  1HIW A;  1O08 A;  1SL2 A;  4NLC A;  3HW8 A;  2JH1 A;  2HHU A;  4QWC A;  1L5U A;  2ESE A;  2G07 A;  5J2H A;  5ALD A;  4FS2 A;  1BPY A;  2YMM A;  1DXS A;  1MN8 A;  2NRW A;  5AM0 A;  3Q8K A;  4DSF A;  4C8N A;  2AH5 A;  1MQ3 A;  4BWM A;  1BNP A;  5KFY A;  2KIV A;  1WWU A;  3ZDD A;  2BZF A;  2WF7 A;  1KSP A;  5HNK A;  2R8G A;  2NO5 A;  9ICQ A;  3H8S A;  1KL9 A;  1H38 A;  3KFU F;  1JXE A;  2RHF A;  2JH7 A;  5D46 A;  1IIP A;  3RJF A;  1XSL A;  2PFP A;  2KK0 A;  2MUT B;  4PHD A;  3C5G A;  4IL6 U;  3H8J A;  2WF8 A;  3HKZ C;  1K1Q A;  2EDU A;  3C29 A;  4F4W A;  5G5H A;  2HHX A;  3IP4 B;  4C7Y A;  2OH2 A;  2Y9T A;  4P0Q B;  2K4H A;  2VJ4 A;  5J2J A;  3IG8 A;  2PMZ F;  2KJ5 A;  9ICE A;  3ZDC A;  5AI9 A;  4R8U B;  5KFC A;  1S0O A;  1X2I A;  2W8K A;  3TAC B;  3KHG A;  4KLG A;  2XCP A;  2ISO A;  2ZJ8 A;  1ZQN A;  3LVV A;  3PR4 A;  1OXJ A;  4BWJ A;  2XCA A;  4DEZ A;  4CGZ A;  2ZUD A;  3TQ1 A;  4FS1 A;  1NOM A;  4KLU A;  3OJU A;  3PR5 B;  1HEK A;  2C22 A;  1NK0 A;  5HR6 A;  2W03 A;  1CI4 A;  1N5W A;  1X40 A;  3BZC A;  4JV0 A;  3E0F A;  3IRU A;  2JZB A;  1K5O A;  3JPR A;  2YQE A;  1SKW A;  3RH5 A;  2A3V A;  1PK1 A;  5CEH A;  3SEN A;  5L1M A;  5KFF A;  5AKI A;  3H0M B;  5G5G A;  5HP4 A;  5DB9 A;  1IG6 A;  3BQ0 A;  3RJH A;  3RH6 A;  7ICL A;  1ZQA A;  4EBD A;  1KEJ A;  2G5H B;  2OWO A;  5J2C A;  2EZZ A;  3V72 A;  3D2Q A;  2JXJ A;  4QWB A;  1NJX A;  4WJ3 B;  5AKE A;  3QEA Z;  1T3Q A; 
#chains in the Genus database with same CATH homology
 1SV0 C;  1COK A;  1SXE A;  2EAO A;  1WWV A;  2EAM A;  2K60 A;  5J8Y C;  4RQN A;  3SEI A;  2D8C A;  1V38 A;  2QAR B;  5JRT A;  2QB0 A;  3BS5 A;  2LPE A;  1SV4 A;  2K4P A;  1Z1V A;  3K1R B;  2E8P A;  1PK3 A;  2KSO A;  1KW4 A;  2EAN A;  3KKA C;  4RQM A;  5JU5 A;  2Y9T A;  5JTI A;  1SGG A;  1UCV A;  4PZO A;  2E8N A;  5J8Y A;  4NL9 C;  2DKX A;  1SXD A;  2QKQ A;  1PK1 B;  2KMD A;  3TAC B;  2QAR A;  2F8K A;  1X9X A;  1JI7 A;  2F3N A;  2DKZ A;  1OXJ A;  3TAD A;  3H8M A;  1B0X A;  3BQ7 A;  2JV3 A;  3KKA A;  2E8M A;  1SV0 A;  1RG6 A;  1B4F A;  1F0M A;  3IDW A;  2E8O A;  2ESE A;  1X40 A;  2DL0 A;  4NL9 A;  3BS7 A;  1DXS A;  4IS7 A;  2ES6 A;  2LMR A;  1UQV A;  4PZN A;  1PK1 A;  1V85 A;  3SEN A;  5L1M A;  2KE7 A;  2KG5 A;  2QB0 B;  3BS5 B;  1OW5 A;  1LKY B;  2FE9 A;  2EAP A;  1X66 A;  1LKY A;  4NJ8 A;  3HIL A;  4MHV A;  2KIV A;  2B6G A;  1WWU A;  2YTU A;  2KSO B;  2Y9U A;  2F44 A;  2D3D A;  2GLE A;  2L5Y A;  3TAD C;  5F3X B;  5KNI A;  2QB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...