3TADC

Crystal structure of the liprin-alpha/liprin-beta complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
252
structure length
252
Chain Sequence
PFAKWTKEQVCSWLAEQGLGSYLSSGKHWIISGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNYGKLDFNWVTRWLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDENSITPSEVQQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Liprin-mediated large signaling complex organization revealed by the liprin-alpha/CASK and liprin-alpha/liprin-beta complex structures
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Liprin-alpha-2
total genus 84
structure length 252
sequence length 252
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00536 SAM_1 SAM domain (Sterile alpha motif)
C PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3tadC01
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3tadC03
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3tadC02
2EAOA 4IS7A 2L5YA 1COKA 3TACB 1X40A 1B0XA 1KW4A 1WWVA 2ES6A 2KE7A 3H8MA 4MHVA 5JRTA 3BS5B 1F0MA 1X66A 3BS5A 2QB0B 3IDWA 2D8CA 2DKZA 3KKAA 2JV3A 2QARB 1OW5A 1WWUA 2KIVA 1SV4A 2EAPA 1PK3A 5J8YA 2Y9TA 5L1MA 2F44A 4NJ8A 2F3NA 2KMDA 1UQVA 1RG6A 2LMRA 2FE9A 2KG5A 2E8MA 3SENA 5KNIA 2QB0A 1V38A 4PZOA 2QARA 1JI7A 1V85A 2DKXA 4NL9A 3SEIA 3TADC 1SGGA 3HILA 2DL0A 2ESEA 2QKQA 3TADA 2LPEA 2EANA 3BQ7A 2QB1A 1LKYA 4RQNA 3KKAC 1SV0A 2Y9UA 2KSOB 1X9XA 2KSOA 2GLEA 1B4FA 1Z1VA 5JU5A 1DXSA 1SXEA 4NL9C 2D3DA 2B6GA 5J8YC 2E8PA 3K1RB 1PK1A 1LKYB 2K60A 1PK1B 5JTIA 1UCVA 2EAMA 1OXJA 5F3XB 1SXDA 2F8KA 1SV0C 2K4PA 3BS7A 4PZNA 2E8NA 4RQMA 2YTUA 2E8OA
chains in the Genus database with same CATH superfamily
4OJPA 5ALOA 4JV1A 3TACB 1VJ5A 1X40A 5KFWA 5KFJA 2G07A 2JZBA 5JRTA 2FPKA 2D8CA 1IIPA 4ECUA 2IBKA 3NVYA 7ICMA 1ED1A 1SV4A 1LV5A 5CB1A 3OGUA 3MBYA 4IR1A 2Q0ZX 3UMCA 5DB6A 1Q8KA 7ICVA 5ALUA 4QZFA 4ECZA 1JUDA 2AQ0A 3MC1A 3GDXA 3PX4A 4HAIA 5DB8A 1ZQSA 4CF3A 3WKDA 1U47A 1S76D 5AKXA 8ICUA 5KFGA 5J2KA 4EZ9A 3DDHA 5J0TA 2ESEA 3SV4A 1SWWA 3QUBA 3HW8A 4ECSA 3F2DA 1L8LA 5F9NA 1FO4A 4BUGA 2H3FA 2YQEA 3KKAC 5JUMA 3N97B 2H3IA 4ECXA 2PI4A 2HSZA 4BXOA 1ZOLA 5KG6A 4RQ4A 4TUPA 5L1LA 1Y88A 3PW7A 9ICUA 2OCEA 2UVRA 1U49A 2XCAA 4J9QA 2KKPA 2D3DA 4O5CA 3ISBA 3SAFA 3SV3A 9ICPA 5ALIA 1KFDA 2EZYA 3HRDD 2BCSA 2EZZA 1ZQPA 2K4PA 4QZGA 2WB1F 4DCCA 3EW9A 4PL2A 4RQMA 1URJA 2IOFA 3BDPA 4UB3A 1NI3A 3N4MB 5BOLA 1UT8A 2W43A 4UAVA 1VLBA 2EAOA 2OXOA 5KFAA 4F91B 1TK0A 3IG8A 3GQCA 8ICXA 3B0XA 4MHVA 5ALHA 4PHPA 8ICOA 2PMZF 4F2SA 3TAQA 1NZBA 1OW5A 1N62A 5IIMA 8ICEA 4RQ7A 5DDYA 3LDAA 3ONNA 1X9WA 3MABA 5CRXA 4KLJA 2NRWA 3LWMA 3E2EA 2QB0A 2W9CB 3WKEA 8ICNA 1Z00A 2HMXA 2LYAA 2G5HB 3HILA 8ICQA 4KLOA 3B9JA 1B22A 5KFBA 1SL1A 2KZMA 1FEZA 4PL1A 4UARA 3RF9A 4YN4A 4TQSA 4ED7A 1ZQBA 1K5OA 4RNNA 3JPTA 3QE9Y 4FZNA 5ALXA 1KBUA 4UASA 2HW3A 3V6KA 1M6YA 1QH9A 1QLNA 1PZNA 3PZPA 1XSPA 2EH9A 3C23A 1DOQA 2KN7A 2HI0A 3PW5A 5J8YC 4U6PA 1N5WA 1PVQA 4IRCA 3QU5A 4G3IA 1LKYB 1RXWA 4FBTA 3NVZA 5EWEA 4RQ5A 3NUQA 2IHNA 1NK5A 3QUTA 2ZIXA 2K89A 2YMLA 2R8KA 5J0SA 4UB6U 1X2IA 5DGBA 2E8OA 4GIBA 1TKDA 3TAPA 4KMUA 1S0NA 2JGAA 1ZD2P 3GU3A 2JZBB 5KG2A 5KAIU 2K4HA 5ALZA 3SMVA 3KKAA 1L3VA 4I2DA 3HJEA 4QZCA 2LYHA 5T14A 4Q45A 3PSTA 3H8JA 2KP7A 4YMNA 4IRKA 4WJ3B 4P4PA 4UBCA 1ZQQA 4JB3A 1OUQA 2W54A 3FAHA 1KTQA 4A8EA 3GV7B 3KHHA 5AKKA 2E8MA 2JRZA 4CF4A 5KFCA 4DSKA 2RDJA 2J6SA 1V38A 4BWJA 4PZOA 1ECWA 1N5XA 2DKXA 2JH1A 5KG0A 4BDPA 1BPYA 8ICLA 5EE3A 3KBBA 3LK9A 1AROP 2CN1A 5KFOA 2LI6A 4RQ3A 3Q8MA 1ZQKA 2F2AB 2XY7A 3C2LA 4JWNA 5KAFU 1MQ2A 7ICQA 4YQWA 3TANA 4C8OA 1MA7A 1TAQA 3PO4A 5J2HA 2HHSA 4NL9C 4IQWA 4O3QA 2GO7A 2FMSA 1KQQA 4ZOHC 3G6YA 2AGPA 3K1RB 1SL0A 1NK8A 4Y2JA 1CRXA 3KFUF 2KZ3A 1A6SA 1CI4A 4O5EA 2K8BB 4QW9A 1K1QA 5AM4A 5AK5A 4LZGA 1T4GA 3PR4A 3V7KA 2ZXIA 5KFVA 1BPZA 2HOIA 1KFTA 2BPCA 4HYKA 5AK6A 7ICUA 1S0MA 1RYSA 4IS7A 1COKA 3Q8PB 2O6KA 8ICGA 2KE7A 2GH1A 3AEVA 4F5OA 5KFKA 1JN3A 4M9LA 4NWIA 3GIIA 2ZJ8A 4QZ9A 2QLTA 2AH5A 5DB9A 2XIDA 2HOQA 4J9MA 3R9KA 1ZQCA 2C22A 4YR3A 3L4PA 3GILA 2C2RA 3HKZF 1RG6A 3I28A 5B66U 1MN8A 4B9SA 4XUSA 4RU9A 5KFLA 2HVHA 2YB4A 5KFUA 2C2DA 3M9NB 4ED6A 1U9LA 7ICPA 3GV5B 1K1SA 1Z00B 4QNLA 3CYMA 4C7ZA 1CUKA 1DGSA 4F4YA 4Y2UA 4ECVA 1NJXA 3NRZA 4CE6A 1RDFA 2LPEA 2HHVA 4ECYA 2ZIVB 5KFSA 2KVCA 4FBUA 4I2CA 1HJPA 3TFSA 3Q8LA 4C8KA 3OPXA 3RB0A 5DQIA 4ICAA 2WF8A 4ED0A 5JU5A 5AI5A 5AK3A 4DL7A 1SIJA 3LWLA 1LB2B 2F8LA 5KG1A 3IV6A 5F3XB 2PMZC 2DQNB 2ZIXB 4IQVA 4KLHA 5AI6A 3LVVA 3SYZA 1HUZA 4Q43A 4DSJA 5D4BA 5AM0A 5AI8A 2H5XA 2DBYA 5E79U 1KW4A 4Z6FA 5EE0A 2HHXA 5ALGA 2MRLA 3IG5A 3BS5B 4Q8FA 2FLNA 2W9AA 1XNSA 7ICOA 2XGPA 4C4TA 3F53A 2BZFA 2W8LA 5KFRA 4I2IA 1V9PA 4C8NA 3RRGA 3JPPA 2ZXHA 2AJQA 9ICVA 5AI9A 4QZBA 2PFNA 9ICFA 4OCZA 1ZQNA 5ALPA 1XC9A 2KG5A 3UQ2A 5KNIA 3HP6A 5J2FA 3ZDDA 2G0AA 4OJ5A 3TADC 4ECQA 2ZIWB 2M9NA 3HT3A 4C4RA 2DL0A 3F2BA 2NRTA 3PSPA 3QZ8A 5EWGA 2HBJA 4IRDA 4M0AA 3PW0A 3FM9A 2A3VA 5IIKA 4Y2SA 3NS1A 3V72A 3WKAA 1X9XA 3QU9A 4J9NA 4DLGA 3QZ7A 1UHUA 4RT2A 2OEHA 3EUB2 4OJ6A 4I27A 2MAXA 2PFPA 2VIXA 5KFFA 3RB4A 2ZUDA 3BQ2A 2IA6A 4QWCA 1DRGA 4J9PA 2R8IA 3UPQA 2BCUA 5ALYA 4M9JA 1Z4OA 2K4IA 4YXMA 2ASDA 1ZD4A 5HNKA 2XCPA 1KSPA 1JXEA 2F1IA 5IINA 1QSLA 3AQFA 5B5EU 3ALRA 4F5RA 4CDGA 2E1EA 4KN4A 4DFPA 1N48A 2BQRA 4KLFA 4EELA 5J2BA 2XY6A 4KLGA 3C1ZA 4PHDA 2DGZA 3QNMA 4M6WB 2DWQA 3H8MA 2PXIA 5KTQA 2PFOA 2A1JB 4GXIA 1S77D 3JPSA 1ZQAA 5KFDA 2F77X 2BPFA 4AYBF 2Y9TA 2ZIWA 5KFPA 5L9XA 3RR7A 4DSEA 1L7MA 3D2SA 4I2FA 4I2GA 2KNJA 3WK9A 3MDCA 2R18A 4QIWF 4PJ0U 2W9CA 5BPCA 3ZDBA 3H0MB 2QARA 3THVA 5D49A 2AU0A 1NJZA 2Y1JA 5AIBA 2W55A 1H38A 5AI4A 1GO3F 4KLMA 3JPQA 4KN7A 9ICQA 4XQ8A 2ATLA 2DF4B 2W9BB 4C4SA 2AGQA 2Y0SF 4B9NA 4DWIA 3L5KA 5ALVA 9ICJA 3H8WA 3G6VA 1KRPA 4JV0A 4MFFA 8ICKA 5HMMA 4QWDA 1ZETA 3T3FA 8ICIA 1DXSA 3MR3A 1X42A 1N2XA 2KICA 4B6JA 7ICHA 5KFIA 2MU2A 4MFAA 4BWMA 1KLNA 4DL4A 1OXJA 5KT2A 1RZTA 3JPNA 4M9GA 4UB5A 4I2EA 2CXYA 4JK1A 4QJFB 2E8NA 3M7DA 3N7RC 1NKEA 8ICTA 3C21A 1F5SA 4DQRA 3M8SA 3MGIA 2KHVA 1B0XA 1KEJA 3RJGA 5AKJA 4P2HA 5AKEA 1X66A 1D9DA 1ZQVA 2W11A 3K4GA 4PH5A 1WYGA 3ZI4A 2F1HA 4F3OA 5TISU 5KT6A 5L1IA 5J0RA 3EWAA 3AU6A 4P0PB 2KD1A 4RZRA 2KJ9A 2FMQA 5ALJA 2BCQA 2N1RA 1ZQWA 1EXNA 2D6FC 7ICKA 4I29A 1J2MA 5HMLA 4JMUA 4NL9A 3RRHA 3AQEA 3JPRA 4CNQA 4DQSA 2XO7A 2ALZA 2QKQA 2JEFA 4O5KA 4PGXA 2HCFA 5DDMA 1MQ3A 3WU2U 2YMMA 2JHDA 3H40A 1FFUA 4F5NA 4OJOA 5J2DA 1TFRA 5A0LA 3Q8RB 2G5IB 5KFZA 2KOBA 4PHEA 4J9KA 2OHFA 1YZ7A 9ICLA 1UCVA 2EAMA 2ZUBA 4Y2PA 2FDRA 3FDSA 3F5AA 1S9FA 4DFDA 3WK6A 5DLGA 4ECTA 5KT5A 4KX3A 3BS7A 4R63A 1SL2A 4EBCA 3H4DA 3T5HA 3EPGA 2ASLA 2DPJA 4C0ZA 5ALTA 4ED1A 5J0YA 1BPDA 5AM1A 4KLSA 4AYBC 2KK0A 1UA1A 4FS1A 1KFSA 4O3SA 4F4XA 3PX6A 2ODGA 3UMGA 2E5SA 4RQ0A 1B43A 1T3QA 4DS4A 4YD2A 1O08A 2C2EA 1X9SA 3EPIA 1VDVA 5J0OA 5IIOA 3QXGA 4DL6A 3KD3A 5AKLA 5AKHA 3ZD9A 7ICTA 2DFLA 4KLLA 3F5EA 4DFKA 2ISPA 4C8MA 5DG9A 2KZZA 4YXJA 1HEKA 2VA3A 1L8OA 3VCBA 4LZDA 4DQPA 5D46A 4IQUA 3RJFA 1QQ7A 9ICIA 3FC4A 1S10A 3C28A 3K75D 5ALMA 2BGWA 1DK3A 3TADA 1Z1BA 2G08A 4DO9A 1A77A 1NZPA 5DKWA 4RNMA 3MGVA 1BPXA 3WK4A 4KTQA 1S97A 2PI5A 3C5FA 3PV8A 1YT3A 2BDUA 3RH5A 9ICRA 1SZHA 1Z1VA 1Z3EB 1PUZA 3Q8KA 4GFJA 2XY5A 3F2CA 4UB8U 1C7YA 4JUZA 2CRXA 4F72A 2OWOA 2HDOA 1SKRA 4Z6CA 5AM5A 5DQHA 3PR5B 3MR6A 4RQ6A 5HP4A 2B21A 4UBBA 4FS2A 9ICHA 4PGQA 1N61A 1KN5A 2HBKA 3A0BU 1S0OA 3UXOA 4K4GA 2JR5A 1NK6A 1D8BA 5J2CA 2BKEA 2Q4TA 2HBMA 4JV2A 1QTMA 4M2YA 3N28A 3S6JA 4CCHA 1WUDA 1SWVA 5ALSA 2KVSA 2KIVA 4UATA 7ICNA 2EAPA 5J8YA 1JMSA 1Q3VA 5L1MA 2VJ4A 4J9SA 5KG3A 2KMDA 3TQ1A 3IN5A 1JRPA 8ICPA 4M47A 3T5KA 2BPGA 4KLDA 1QSYA 2W9MA 1MSWD 3GFKB 2BQUA 1X9MA 5DBBA 2AGOA 1JXLA 3V7JA 1FFVA 5K4LA 1V85A 3RJJA 4NLZA 5ALQA 5J2EA 1SGGA 1JROA 2KHQA 3QYPA 7ICLA 4UQGA 2JEJA 1N60A 4R64A 3CNHA 4DEZA 2JH7A 5IIIA 9ICXA 4RPYA 2W3RA 2Y9UA 1U48A 3CRXA 3CP8A 4YG2A 1LVHA 2UVUA 4O0IA 3RB6A 2IOHA 3NASA 1PVRA 2PFQA 2W7PA 2ASJA 3GIKA 2WAQC 1XO1A 2ZJ5A 3QUQA 3EYZA 8ICVA 4KLIA 2FI1A 5KFEA 2UVWA 2KFZA 2RQ5A 2LM4A 5ALFA 1ZQFA 2LYBA 3WK8A 4F50A 2MUTA 5JTIA 9ICTA 1NNLA 1XU4A 1T94A 4GXKA 2R8JA 4EBEA 4C80A 4R65A 3T5LA 3UMBA 4X5VA 1L6NA 4O3MA 3KOOA 3MFIA 4QZ8A 1SKWA 4I2HA 5KFTA 2RP5A 4QZDA 2PKEA 5KG4A 5DQGA 2OM6A 2GWSA 3SZ2A 4YMMA 4C7YA 1TE2A 5G5GA 2A1JA 3SQIA 5GTHU 8ICHA 4ELVA 3RJEA 1BNPA 3PX0A 4KLTA 5C5JA 2JMGA 1UA0A 2ISOA 4NJ8A 2YN4A 3D2NA 4KLUA 8ICFA 4EX6A 4EBDA 1WCLA 4NLCA 4M9NA 4O9MA 5EE9A 1RYRA 3NRWA 5AI0A 4QW8A 1TAUA 3RH6A 2G06A 3WK5A 5CWRA 1FIQA 1U45A 2KV2A 2NO5A 5EWFA 4P0QA 2KJ5A 2AQ4A 2YY6A 4YR2A 1JX4A 3T79A 4IR9A 9ICBA 2FMPA 1XWLA 4ACOA 3PW4A 2W8KA 3K1ZA 2QB1A 2AXTU 1RPLA 4U7CA 1F44A 4UAUA 2HHWA 3ZD8A 1QQ6A 2BCRA 3D6JA 5KT4A 3M1YA 3RAQA 3H4BA 7ICRA 2ZIUA 2FJ6A 3KZIU 2W7OA 3GIMA 1BVSA 3ZDEA 2IHMA 2V4QA 3ZDCA 3ISDA 4NM2A 1X6JA 5DG8A 2G09A 1XSNA 1ZQGA 3Q8QB 3PNCA 3H0RB 4J03A 3O0FA 5KL8B 1RXVA 4EYHB 4F4ZA 9ICCA 3KTQA 9ICEA 3ETRA 4E0DA 4NLNA 1WWVA 3ISCA 1NK7A 3BS5A 3IDWA 2Z7JA 2J6UA 4O3PA 5ALNA 4NLGA 7ICSA 4P4OA 4EENA 4OJLA 4QWAA 4TUQA 1ZJNA 1UQVA 4RUAA 4UB1A 2YB1A 3UXNA 1BPBA 2LMRA 4Y2RA 4CF5A 3RTVA 5J2JA 1DGJA 1S8OA 2H3VA 1JI7A 1IV8A 2JEIA 1TAMA 3UQ0A 2WF5A 8ICRA 1ZQJA 4RPXA 3RBDA 8ICJA 4DLEA 1L3UA 3AMZA 4MEYA 4DQIA 5ALEA 4DL3A 5DG7A 8ICZA 1D8YA 3AL0B 1SV0A 3TI0A 4OO1J 2KSOB 5CEHA 4BXOB 4QWEA 5KG7A 2MA1A 2GLEA 2KEYA 1JALA 3NGDA 2EQYA 5DB7A 3RR8A 4DFMA 4K4HA 2W3SA 3C29A 4KMOB 5L1JA 5DLFA 3V6HA 2EZXA 2YMPA 2MUTB 4YFKA 1C20A 4Z6EA 1QSSA 1S0VA 3U26A 4ZH4A 2P6UA 2F8KA 1RQNA 3BQ0A 4MEXA 3GV8B 3KHRA 4UB2A 4YP3A 4O3NA 4YMOA 3NTUA 2KFNA 3EZ5A 4DF4A 4DSFA 2LBOA 1O03A 3J81j 4EYIB 4LJXA 5KT7A 1F0MA 5J0PA 5J0XA 3PSIA 5AKIA 2NV3A 3C5GA 1WWUA 1PK3A 1S5LU 1UT5A 1ZQMA 2WF6A 5EOZA 4MF8A 1ZYQA 4YVZA 2KJ8A 5HHHA 3H8SA 4F4KA 2FE9A 2VKQA 4JWMA 1ZQXA 3WKCA 5J2GA 4US8A 4BX9C 3OHBA 2I5HA 2WB1C 5CP2A 4XA5A 2XGQA 3PW2A 4DS5A 1ZRNA 3M6KA 1WG8A 2WFAA 1NKBA 3OHAA 5TZVA 5CR0A 4IQTA 4NV0A 5AICA 9ICGA 3MGHA 5AKGA 2FLPA 5HR6A 1L3SA 3ETLA 4YCXA 3DV9A 4B9LA 5KFXA 5J0UA 1SXEA 3I1YA 1ZQIA 1SZPA 2ZG6A 4QZAA 3NVWA 1P7DA 2DPIA 2P35A 1ZD5A 3SR6A 4B9MA 2NRVA 3UM9A 1PK1A 3AUOA 3Q8SB 1PK1B 2ZUCA 4QWBA 2ZTDA 4ELTA 4RPZA 4OD0A 4I2AA 4F92B 3GIJA 4M9HA 3N7PD 4US9A 2WF9A 4DOBA 2OH2A 1IG6A 3AN1A 1HUOA 4DFJA 4KX5A 5ALDA 1Z19A 3RB3A 1CEZA 3SI8A 3E0FA 2HHUA 7ICJA 3CW2C 5AHXA 3MFHA 2A1AA 9ICNA 3M9OB 2W03A 5ALKA 2QB0B 2JV3A 1U4BA 4MF2A 2BHNA 2A19A 1ZQUA 2QARB 5IILA 5FP0A 2EDUA 1RYUA 2E3TA 3IHQB 4RT3A 2RLTA 1NOMA 2HOFA 2DUYA 2F3NA 3DEEA 3H0LB 2VA2A 2VA8A 5AKZA 8ICBA 5KFNA 4TURA 1ZQHA 2R8GA 1RQLA 2HVIA 3QEAZ 1TV9A 4C8LA 3BJYA 2KIWA 5DBAA 8ICAA 1L5UA 2B0CA 4QZEA 5J29A 4IL6U 4CGZA 5AKYA 1V97A 4F4WA 2ZTCA 4PHAA 2EANA 3BQ7A 3TFRA 2F76X 2AHOB 4RQNA 1YZ6A 8ICWA 2KSOA 1J97A 4P4MA 4F93B 2YMQA 3IP4B 3UXPA 3T5JA 4Y2YA 5AK4A 4B9TA 3RJIA 1B4FA 4Y2TA 3QEBZ 4GC7A 1WCNA 1XO0A 1NK4A 1XS9D 4BJQA 2ZTEA 3AM9A 2RRDA 9ICWA 2E8PA 3VC8A 4FO6A 2HHQA 3BZCA 4RQ8A 4LVSA 1D8LA 3H7IA 4NLBA 4B9UA 5BOMA 2ZJAA 5AM3A 2XVTA 4UAYA 4ELUA 4RNOA 3ED5A 4ED3A 4KLQA 2WHEA 2ZIUB 2Y1IA 1A76A 4P0PA 3E58A 2GOLA 3QU7A 4F5QA 3RJHA 3V6JA 5IIJA 1KL9A 2W04A 4M6WA 4NLKA 1AQ6A 2P66A 1MC8A 1L7NA 2VJ5A 5KFQA 3TKAA 5F9LA 5ALWA 1ZQTA 4I28A 3QX7A 1X6IA 1KKXA 5CHGA 4YR0A 2F44A 4QZIA 3RAXA 2KTQA 2JEGA 3WK7A 4FZLA 1Q46A 5KL1B 4NM1A 2HHTA 1ZQOA 3QU4A 4O3OA 1ZXIA 3BZKA 3C2KA 8ICSA 4ED8A 4J9RA 8ICYA 3LVWA 2XICA 3PVXA 3SEIA 1T7PA 4DL5A 4KLEA 4CRXA 2BQ3A 4USAA 4XRHA 1TK8A 1ZQEA 1QQ5A 2K8CB 1TK5A 1NJWA 1A0PA 2F1JA 1N63A 3BQ1A 2LHTA 2JXJA 5AIAA 2FPLA 3KHGA 2ZIVA 4F5PA 1SKSA 3PO5A 7ICEA 4Y2VA 3IM1A 2YX8A 2C28A 5KT3A 2FLLA 5ALLA 3RFAA 3OSPA 5GTIU 4Q44A 3C1YA 4UW9A 2XC9A 4MFCA 3RJKA 9ICKA 3PY8A 2I9GA 2V4RA 1NKCA 4YD1A 3HKZC 1ZQ1C 5CA7A 1ZQLA 4DL2A 9ICSA 4RQ1A 3WKBA 3N7SC 3HX0A 1BPEA 5HR7A 1PVPA 9ICOA 1HIWA 2YTUA 4GC6A 4DSIA 2BCVA 2V9WA 2R8HA 1ZQYA 4FE3A 3PMLA 1UPHA 4R8UB 2DKZA 1IM4A 4FZMA 4Y2XA 5KG5A 2HBLA 1Z4NA 3KZXA 4EX7A 3MR2A 3PMNA 2IOFK 5EE1A 1NK9A 1BGXT 2BR0A 4F8RA 7ICGA 3I76A 1QCKA 4Q8EA 4UAZA 4J9LA 3MDAA 2IMWP 3SENA 5G5HA 1T8EA 3L3FX 9ICMA 2I6XA 5J0WA 4PGYA 3QU2A 1Q3UA 1RM6C 2E1FA 1ZQZA 1L7OA 2WTFA 1LKYA 3C2MA 2M0NA 5J2IA 3RH4A 1TVAA 1DK2A 5CJ7A 4DOAA 4RUCA 4DF8A 2NRZA 2H3QA 5KFYA 3GZFA 3B0YA 3HWTA 1NJYA 2NYVA 3KHLA 2UVVA 2J6TA 1T3NA 7ICIA 4DOCA 4F2RA 4ECWA 3M8RA 2B6GA 3QUCA 4Z6DA 4UB4A 4QZHA 1ZRMA 2K60A 2RDIA 3RBEA 1L3TA 4UAWA 4RQ2A 4QIWC 3D2QA 2VANA 1SV0C 4DSLA 4TUSA 4O3RA 1BNOA 3OJUA 2BDPA 4EZ6A 5J0QA 4EEKA 1NK0A 2L5YA 4PPXA 2NO4A 4I2BA 2LM1A 2ES6A 3BQTA 4B9VA 2CPRA 3IRUA 1J2NA 1L7PA 5ALRA 3SD7A 2Y0SC 1IXRA 1JIHA 4K4IA 2I1QA 1N56A 4NXZA 4FFDA 3OSNA 4G9BA 2XI9A 1SB3C 4I2JA 4M04A 3TARA 2MSNA 3ORYA 3PSFA 4AP9A 5AM2A 3SAGA 3M6ZA 4BGDA 2RHFA 8ICCA 4F71A 2OYYA 2H3ZA 3A0HU 4R8UA 1D9FA 5DGAA 3OJSA 4P0QB 3AU2A 4KITB 4DQQA 2KKVA 1ZJMA 5C0YA 3FYHA 4R66A 1ZD3A 4Y2QA 4EEYA 3ICXA 3LYSA 3JPOA 5H2FU 5DBCA 3MR5A 4IC9A 3OTQA 2W9BA 4GXJA 1KDHA 4J9OA 3ZDAA 2K8AA 1XSLA 4ED2A 2FPMA 2K4EA 7ICFA 2NRXA 4NY8A 5KFHA 4ECRA 2WF7A 3SAHA 3HPOA 3G6XA 1SXDA 5HHIA 2P6RA 5L1KA 1ZQRA 4PZNA 9ICAA 1COOA 3NVVA 8ICMA 2LKYA 5KFMA 3M9MB 5J2AA 4TQRA 1ZQDA 3V7LA 4GLXA 2WAQF
chains in the Genus database with same CATH topology
2EAOA 4IS7A 2L5YA 1COKA 3TACB 1X40A 1B0XA 1KW4A 1WWVA 2ES6A 2KE7A 3H8MA 4MHVA 5JRTA 3BS5B 1F0MA 1X66A 3BS5A 2QB0B 3IDWA 2D8CA 2DKZA 3KKAA 2JV3A 2QARB 1OW5A 1WWUA 2KIVA 1SV4A 2EAPA 1PK3A 5J8YA 2Y9TA 5L1MA 2F44A 4NJ8A 2F3NA 2KMDA 1UQVA 1RG6A 2LMRA 2FE9A 2KG5A 2E8MA 3SENA 5KNIA 2QB0A 1V38A 4PZOA 2QARA 1JI7A 1V85A 2DKXA 4NL9A 3SEIA 3TADC 1SGGA 3HILA 2DL0A 2ESEA 2QKQA 3TADA 2LPEA 2EANA 3BQ7A 2QB1A 1LKYA 4RQNA 3KKAC 1SV0A 2Y9UA 2KSOB 1X9XA 2KSOA 2GLEA 1B4FA 1Z1VA 5JU5A 1DXSA 1SXEA 4NL9C 2D3DA 2B6GA 5J8YC 2E8PA 3K1RB 1PK1A 1LKYB 2K60A 1PK1B 5JTIA 1UCVA 2EAMA 1OXJA 5F3XB 1SXDA 2F8KA 1SV0C 2K4PA 3BS7A 4PZNA 2E8NA 4RQMA 2YTUA 2E8OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAO A;  4IS7 A;  2L5Y A;  1COK A;  3TAC B;  1X40 A;  1B0X A;  1KW4 A;  1WWV A;  2ES6 A;  2KE7 A;  3H8M A;  4MHV A;  5JRT A;  3BS5 B;  1F0M A;  1X66 A;  3BS5 A;  2QB0 B;  3IDW A;  2D8C A;  2DKZ A;  3KKA A;  2JV3 A;  2QAR B;  1OW5 A;  1WWU A;  2KIV A;  1SV4 A;  2EAP A;  1PK3 A;  5J8Y A;  2Y9T A;  5L1M A;  2F44 A;  4NJ8 A;  2F3N A;  2KMD A;  1UQV A;  1RG6 A;  2LMR A;  2FE9 A;  2KG5 A;  2E8M A;  3SEN A;  5KNI A;  2QB0 A;  1V38 A;  4PZO A;  2QAR A;  1JI7 A;  1V85 A;  2DKX A;  4NL9 A;  3SEI A;  3TAD C;  1SGG A;  3HIL A;  2DL0 A;  2ESE A;  2QKQ A;  3TAD A;  2LPE A;  2EAN A;  3BQ7 A;  2QB1 A;  1LKY A;  4RQN A;  3KKA C;  1SV0 A;  2Y9U A;  2KSO B;  1X9X A;  2KSO A;  2GLE A;  1B4F A;  1Z1V A;  5JU5 A;  1DXS A;  1SXE A;  4NL9 C;  2D3D A;  2B6G A;  5J8Y C;  2E8P A;  3K1R B;  1PK1 A;  1LKY B;  2K60 A;  1PK1 B;  5JTI A;  1UCV A;  2EAM A;  1OXJ A;  5F3X B;  1SXD A;  2F8K A;  1SV0 C;  2K4P A;  3BS7 A;  4PZN A;  2E8N A;  4RQM A;  2YTU A;  2E8O A; 
#chains in the Genus database with same CATH topology
 4OJP A;  5ALO A;  4JV1 A;  3TAC B;  1VJ5 A;  1X40 A;  5KFW A;  5KFJ A;  2G07 A;  2JZB A;  5JRT A;  2FPK A;  2D8C A;  1IIP A;  4ECU A;  2IBK A;  3NVY A;  7ICM A;  1ED1 A;  1SV4 A;  1LV5 A;  5CB1 A;  3OGU A;  3MBY A;  4IR1 A;  2Q0Z X;  3UMC A;  5DB6 A;  1Q8K A;  7ICV A;  5ALU A;  4QZF A;  4ECZ A;  1JUD A;  2AQ0 A;  3MC1 A;  3GDX A;  3PX4 A;  4HAI A;  5DB8 A;  1ZQS A;  4CF3 A;  3WKD A;  1U47 A;  1S76 D;  5AKX A;  8ICU A;  5KFG A;  5J2K A;  4EZ9 A;  3DDH A;  5J0T A;  2ESE A;  3SV4 A;  1SWW A;  3QUB A;  3HW8 A;  4ECS A;  3F2D A;  1L8L A;  5F9N A;  1FO4 A;  4BUG A;  2H3F A;  2YQE A;  3KKA C;  5JUM A;  3N97 B;  2H3I A;  4ECX A;  2PI4 A;  2HSZ A;  4BXO A;  1ZOL A;  5KG6 A;  4RQ4 A;  4TUP A;  5L1L A;  1Y88 A;  3PW7 A;  9ICU A;  2OCE A;  2UVR A;  1U49 A;  2XCA A;  4J9Q A;  2KKP A;  2D3D A;  4O5C A;  3ISB A;  3SAF A;  3SV3 A;  9ICP A;  5ALI A;  1KFD A;  2EZY A;  3HRD D;  2BCS A;  2EZZ A;  1ZQP A;  2K4P A;  4QZG A;  2WB1 F;  4DCC A;  3EW9 A;  4PL2 A;  4RQM A;  1URJ A;  2IOF A;  3BDP A;  4UB3 A;  1NI3 A;  3N4M B;  5BOL A;  1UT8 A;  2W43 A;  4UAV A;  1VLB A;  2EAO A;  2OXO A;  5KFA A;  4F91 B;  1TK0 A;  3IG8 A;  3GQC A;  8ICX A;  3B0X A;  4MHV A;  5ALH A;  4PHP A;  8ICO A;  2PMZ F;  4F2S A;  3TAQ A;  1NZB A;  1OW5 A;  1N62 A;  5IIM A;  8ICE A;  4RQ7 A;  5DDY A;  3LDA A;  3ONN A;  1X9W A;  3MAB A;  5CRX A;  4KLJ A;  2NRW A;  3LWM A;  3E2E A;  2QB0 A;  2W9C B;  3WKE A;  8ICN A;  1Z00 A;  2HMX A;  2LYA A;  2G5H B;  3HIL A;  8ICQ A;  4KLO A;  3B9J A;  1B22 A;  5KFB A;  1SL1 A;  2KZM A;  1FEZ A;  4PL1 A;  4UAR A;  3RF9 A;  4YN4 A;  4TQS A;  4ED7 A;  1ZQB A;  1K5O A;  4RNN A;  3JPT A;  3QE9 Y;  4FZN A;  5ALX A;  1KBU A;  4UAS A;  2HW3 A;  3V6K A;  1M6Y A;  1QH9 A;  1QLN A;  1PZN A;  3PZP A;  1XSP A;  2EH9 A;  3C23 A;  1DOQ A;  2KN7 A;  2HI0 A;  3PW5 A;  5J8Y C;  4U6P A;  1N5W A;  1PVQ A;  4IRC A;  3QU5 A;  4G3I A;  1LKY B;  1RXW A;  4FBT A;  3NVZ A;  5EWE A;  4RQ5 A;  3NUQ A;  2IHN A;  1NK5 A;  3QUT A;  2ZIX A;  2K89 A;  2YML A;  2R8K A;  5J0S A;  4UB6 U;  1X2I A;  5DGB A;  2E8O A;  4GIB A;  1TKD A;  3TAP A;  4KMU A;  1S0N A;  2JGA A;  1ZD2 P;  3GU3 A;  2JZB B;  5KG2 A;  5KAI U;  2K4H A;  5ALZ A;  3SMV A;  3KKA A;  1L3V A;  4I2D A;  3HJE A;  4QZC A;  2LYH A;  5T14 A;  4Q45 A;  3PST A;  3H8J A;  2KP7 A;  4YMN A;  4IRK A;  4WJ3 B;  4P4P A;  4UBC A;  1ZQQ A;  4JB3 A;  1OUQ A;  2W54 A;  3FAH A;  1KTQ A;  4A8E A;  3GV7 B;  3KHH A;  5AKK A;  2E8M A;  2JRZ A;  4CF4 A;  5KFC A;  4DSK A;  2RDJ A;  2J6S A;  1V38 A;  4BWJ A;  4PZO A;  1ECW A;  1N5X A;  2DKX A;  2JH1 A;  5KG0 A;  4BDP A;  1BPY A;  8ICL A;  5EE3 A;  3KBB A;  3LK9 A;  1ARO P;  2CN1 A;  5KFO A;  2LI6 A;  4RQ3 A;  3Q8M A;  1ZQK A;  2F2A B;  2XY7 A;  3C2L A;  4JWN A;  5KAF U;  1MQ2 A;  7ICQ A;  4YQW A;  3TAN A;  4C8O A;  1MA7 A;  1TAQ A;  3PO4 A;  5J2H A;  2HHS A;  4NL9 C;  4IQW A;  4O3Q A;  2GO7 A;  2FMS A;  1KQQ A;  4ZOH C;  3G6Y A;  2AGP A;  3K1R B;  1SL0 A;  1NK8 A;  4Y2J A;  1CRX A;  3KFU F;  2KZ3 A;  1A6S A;  1CI4 A;  4O5E A;  2K8B B;  4QW9 A;  1K1Q A;  5AM4 A;  5AK5 A;  4LZG A;  1T4G A;  3PR4 A;  3V7K A;  2ZXI A;  5KFV A;  1BPZ A;  2HOI A;  1KFT A;  2BPC A;  4HYK A;  5AK6 A;  7ICU A;  1S0M A;  1RYS A;  4IS7 A;  1COK A;  3Q8P B;  2O6K A;  8ICG A;  2KE7 A;  2GH1 A;  3AEV A;  4F5O A;  5KFK A;  1JN3 A;  4M9L A;  4NWI A;  3GII A;  2ZJ8 A;  4QZ9 A;  2QLT A;  2AH5 A;  5DB9 A;  2XID A;  2HOQ A;  4J9M A;  3R9K A;  1ZQC A;  2C22 A;  4YR3 A;  3L4P A;  3GIL A;  2C2R A;  3HKZ F;  1RG6 A;  3I28 A;  5B66 U;  1MN8 A;  4B9S A;  4XUS A;  4RU9 A;  5KFL A;  2HVH A;  2YB4 A;  5KFU A;  2C2D A;  3M9N B;  4ED6 A;  1U9L A;  7ICP A;  3GV5 B;  1K1S A;  1Z00 B;  4QNL A;  3CYM A;  4C7Z A;  1CUK A;  1DGS A;  4F4Y A;  4Y2U A;  4ECV A;  1NJX A;  3NRZ A;  4CE6 A;  1RDF A;  2LPE A;  2HHV A;  4ECY A;  2ZIV B;  5KFS A;  2KVC A;  4FBU A;  4I2C A;  1HJP A;  3TFS A;  3Q8L A;  4C8K A;  3OPX A;  3RB0 A;  5DQI A;  4ICA A;  2WF8 A;  4ED0 A;  5JU5 A;  5AI5 A;  5AK3 A;  4DL7 A;  1SIJ A;  3LWL A;  1LB2 B;  2F8L A;  5KG1 A;  3IV6 A;  5F3X B;  2PMZ C;  2DQN B;  2ZIX B;  4IQV A;  4KLH A;  5AI6 A;  3LVV A;  3SYZ A;  1HUZ A;  4Q43 A;  4DSJ A;  5D4B A;  5AM0 A;  5AI8 A;  2H5X A;  2DBY A;  5E79 U;  1KW4 A;  4Z6F A;  5EE0 A;  2HHX A;  5ALG A;  2MRL A;  3IG5 A;  3BS5 B;  4Q8F A;  2FLN A;  2W9A A;  1XNS A;  7ICO A;  2XGP A;  4C4T A;  3F53 A;  2BZF A;  2W8L A;  5KFR A;  4I2I A;  1V9P A;  4C8N A;  3RRG A;  3JPP A;  2ZXH A;  2AJQ A;  9ICV A;  5AI9 A;  4QZB A;  2PFN A;  9ICF A;  4OCZ A;  1ZQN A;  5ALP A;  1XC9 A;  2KG5 A;  3UQ2 A;  5KNI A;  3HP6 A;  5J2F A;  3ZDD A;  2G0A A;  4OJ5 A;  3TAD C;  4ECQ A;  2ZIW B;  2M9N A;  3HT3 A;  4C4R A;  2DL0 A;  3F2B A;  2NRT A;  3PSP A;  3QZ8 A;  5EWG A;  2HBJ A;  4IRD A;  4M0A A;  3PW0 A;  3FM9 A;  2A3V A;  5IIK A;  4Y2S A;  3NS1 A;  3V72 A;  3WKA A;  1X9X A;  3QU9 A;  4J9N A;  4DLG A;  3QZ7 A;  1UHU A;  4RT2 A;  2OEH A;  3EUB 2;  4OJ6 A;  4I27 A;  2MAX A;  2PFP A;  2VIX A;  5KFF A;  3RB4 A;  2ZUD A;  3BQ2 A;  2IA6 A;  4QWC A;  1DRG A;  4J9P A;  2R8I A;  3UPQ A;  2BCU A;  5ALY A;  4M9J A;  1Z4O A;  2K4I A;  4YXM A;  2ASD A;  1ZD4 A;  5HNK A;  2XCP A;  1KSP A;  1JXE A;  2F1I A;  5IIN A;  1QSL A;  3AQF A;  5B5E U;  3ALR A;  4F5R A;  4CDG A;  2E1E A;  4KN4 A;  4DFP A;  1N48 A;  2BQR A;  4KLF A;  4EEL A;  5J2B A;  2XY6 A;  4KLG A;  3C1Z A;  4PHD A;  2DGZ A;  3QNM A;  4M6W B;  2DWQ A;  3H8M A;  2PXI A;  5KTQ A;  2PFO A;  2A1J B;  4GXI A;  1S77 D;  3JPS A;  1ZQA A;  5KFD A;  2F77 X;  2BPF A;  4AYB F;  2Y9T A;  2ZIW A;  5KFP A;  5L9X A;  3RR7 A;  4DSE A;  1L7M A;  3D2S A;  4I2F A;  4I2G A;  2KNJ A;  3WK9 A;  3MDC A;  2R18 A;  4QIW F;  4PJ0 U;  2W9C A;  5BPC A;  3ZDB A;  3H0M B;  2QAR A;  3THV A;  5D49 A;  2AU0 A;  1NJZ A;  2Y1J A;  5AIB A;  2W55 A;  1H38 A;  5AI4 A;  1GO3 F;  4KLM A;  3JPQ A;  4KN7 A;  9ICQ A;  4XQ8 A;  2ATL A;  2DF4 B;  2W9B B;  4C4S A;  2AGQ A;  2Y0S F;  4B9N A;  4DWI A;  3L5K A;  5ALV A;  9ICJ A;  3H8W A;  3G6V A;  1KRP A;  4JV0 A;  4MFF A;  8ICK A;  5HMM A;  4QWD A;  1ZET A;  3T3F A;  8ICI A;  1DXS A;  3MR3 A;  1X42 A;  1N2X A;  2KIC A;  4B6J A;  7ICH A;  5KFI A;  2MU2 A;  4MFA A;  4BWM A;  1KLN A;  4DL4 A;  1OXJ A;  5KT2 A;  1RZT A;  3JPN A;  4M9G A;  4UB5 A;  4I2E A;  2CXY A;  4JK1 A;  4QJF B;  2E8N A;  3M7D A;  3N7R C;  1NKE A;  8ICT A;  3C21 A;  1F5S A;  4DQR A;  3M8S A;  3MGI A;  2KHV A;  1B0X A;  1KEJ A;  3RJG A;  5AKJ A;  4P2H A;  5AKE A;  1X66 A;  1D9D A;  1ZQV A;  2W11 A;  3K4G A;  4PH5 A;  1WYG A;  3ZI4 A;  2F1H A;  4F3O A;  5TIS U;  5KT6 A;  5L1I A;  5J0R A;  3EWA A;  3AU6 A;  4P0P B;  2KD1 A;  4RZR A;  2KJ9 A;  2FMQ A;  5ALJ A;  2BCQ A;  2N1R A;  1ZQW A;  1EXN A;  2D6F C;  7ICK A;  4I29 A;  1J2M A;  5HML A;  4JMU A;  4NL9 A;  3RRH A;  3AQE A;  3JPR A;  4CNQ A;  4DQS A;  2XO7 A;  2ALZ A;  2QKQ A;  2JEF A;  4O5K A;  4PGX A;  2HCF A;  5DDM A;  1MQ3 A;  3WU2 U;  2YMM A;  2JHD A;  3H40 A;  1FFU A;  4F5N A;  4OJO A;  5J2D A;  1TFR A;  5A0L A;  3Q8R B;  2G5I B;  5KFZ A;  2KOB A;  4PHE A;  4J9K A;  2OHF A;  1YZ7 A;  9ICL A;  1UCV A;  2EAM A;  2ZUB A;  4Y2P A;  2FDR A;  3FDS A;  3F5A A;  1S9F A;  4DFD A;  3WK6 A;  5DLG A;  4ECT A;  5KT5 A;  4KX3 A;  3BS7 A;  4R63 A;  1SL2 A;  4EBC A;  3H4D A;  3T5H A;  3EPG A;  2ASL A;  2DPJ A;  4C0Z A;  5ALT A;  4ED1 A;  5J0Y A;  1BPD A;  5AM1 A;  4KLS A;  4AYB C;  2KK0 A;  1UA1 A;  4FS1 A;  1KFS A;  4O3S A;  4F4X A;  3PX6 A;  2ODG A;  3UMG A;  2E5S A;  4RQ0 A;  1B43 A;  1T3Q A;  4DS4 A;  4YD2 A;  1O08 A;  2C2E A;  1X9S A;  3EPI A;  1VDV A;  5J0O A;  5IIO A;  3QXG A;  4DL6 A;  3KD3 A;  5AKL A;  5AKH A;  3ZD9 A;  7ICT A;  2DFL A;  4KLL A;  3F5E A;  4DFK A;  2ISP A;  4C8M A;  5DG9 A;  2KZZ A;  4YXJ A;  1HEK A;  2VA3 A;  1L8O A;  3VCB A;  4LZD A;  4DQP A;  5D46 A;  4IQU A;  3RJF A;  1QQ7 A;  9ICI A;  3FC4 A;  1S10 A;  3C28 A;  3K75 D;  5ALM A;  2BGW A;  1DK3 A;  3TAD A;  1Z1B A;  2G08 A;  4DO9 A;  1A77 A;  1NZP A;  5DKW A;  4RNM A;  3MGV A;  1BPX A;  3WK4 A;  4KTQ A;  1S97 A;  2PI5 A;  3C5F A;  3PV8 A;  1YT3 A;  2BDU A;  3RH5 A;  9ICR A;  1SZH A;  1Z1V A;  1Z3E B;  1PUZ A;  3Q8K A;  4GFJ A;  2XY5 A;  3F2C A;  4UB8 U;  1C7Y A;  4JUZ A;  2CRX A;  4F72 A;  2OWO A;  2HDO A;  1SKR A;  4Z6C A;  5AM5 A;  5DQH A;  3PR5 B;  3MR6 A;  4RQ6 A;  5HP4 A;  2B21 A;  4UBB A;  4FS2 A;  9ICH A;  4PGQ A;  1N61 A;  1KN5 A;  2HBK A;  3A0B U;  1S0O A;  3UXO A;  4K4G A;  2JR5 A;  1NK6 A;  1D8B A;  5J2C A;  2BKE A;  2Q4T A;  2HBM A;  4JV2 A;  1QTM A;  4M2Y A;  3N28 A;  3S6J A;  4CCH A;  1WUD A;  1SWV A;  5ALS A;  2KVS A;  2KIV A;  4UAT A;  7ICN A;  2EAP A;  5J8Y A;  1JMS A;  1Q3V A;  5L1M A;  2VJ4 A;  4J9S A;  5KG3 A;  2KMD A;  3TQ1 A;  3IN5 A;  1JRP A;  8ICP A;  4M47 A;  3T5K A;  2BPG A;  4KLD A;  1QSY A;  2W9M A;  1MSW D;  3GFK B;  2BQU A;  1X9M A;  5DBB A;  2AGO A;  1JXL A;  3V7J A;  1FFV A;  5K4L A;  1V85 A;  3RJJ A;  4NLZ A;  5ALQ A;  5J2E A;  1SGG A;  1JRO A;  2KHQ A;  3QYP A;  7ICL A;  4UQG A;  2JEJ A;  1N60 A;  4R64 A;  3CNH A;  4DEZ A;  2JH7 A;  5III A;  9ICX A;  4RPY A;  2W3R A;  2Y9U A;  1U48 A;  3CRX A;  3CP8 A;  4YG2 A;  1LVH A;  2UVU A;  4O0I A;  3RB6 A;  2IOH A;  3NAS A;  1PVR A;  2PFQ A;  2W7P A;  2ASJ A;  3GIK A;  2WAQ C;  1XO1 A;  2ZJ5 A;  3QUQ A;  3EYZ A;  8ICV A;  4KLI A;  2FI1 A;  5KFE A;  2UVW A;  2KFZ A;  2RQ5 A;  2LM4 A;  5ALF A;  1ZQF A;  2LYB A;  3WK8 A;  4F50 A;  2MUT A;  5JTI A;  9ICT A;  1NNL A;  1XU4 A;  1T94 A;  4GXK A;  2R8J A;  4EBE A;  4C80 A;  4R65 A;  3T5L A;  3UMB A;  4X5V A;  1L6N A;  4O3M A;  3KOO A;  3MFI A;  4QZ8 A;  1SKW A;  4I2H A;  5KFT A;  2RP5 A;  4QZD A;  2PKE A;  5KG4 A;  5DQG A;  2OM6 A;  2GWS A;  3SZ2 A;  4YMM A;  4C7Y A;  1TE2 A;  5G5G A;  2A1J A;  3SQI A;  5GTH U;  8ICH A;  4ELV A;  3RJE A;  1BNP A;  3PX0 A;  4KLT A;  5C5J A;  2JMG A;  1UA0 A;  2ISO A;  4NJ8 A;  2YN4 A;  3D2N A;  4KLU A;  8ICF A;  4EX6 A;  4EBD A;  1WCL A;  4NLC A;  4M9N A;  4O9M A;  5EE9 A;  1RYR A;  3NRW A;  5AI0 A;  4QW8 A;  1TAU A;  3RH6 A;  2G06 A;  3WK5 A;  5CWR A;  1FIQ A;  1U45 A;  2KV2 A;  2NO5 A;  5EWF A;  4P0Q A;  2KJ5 A;  2AQ4 A;  2YY6 A;  4YR2 A;  1JX4 A;  3T79 A;  4IR9 A;  9ICB A;  2FMP A;  1XWL A;  4ACO A;  3PW4 A;  2W8K A;  3K1Z A;  2QB1 A;  2AXT U;  1RPL A;  4U7C A;  1F44 A;  4UAU A;  2HHW A;  3ZD8 A;  1QQ6 A;  2BCR A;  3D6J A;  5KT4 A;  3M1Y A;  3RAQ A;  3H4B A;  7ICR A;  2ZIU A;  2FJ6 A;  3KZI U;  2W7O A;  3GIM A;  1BVS A;  3ZDE A;  2IHM A;  2V4Q A;  3ZDC A;  3ISD A;  4NM2 A;  1X6J A;  5DG8 A;  2G09 A;  1XSN A;  1ZQG A;  3Q8Q B;  3PNC A;  3H0R B;  4J03 A;  3O0F A;  5KL8 B;  1RXV A;  4EYH B;  4F4Z A;  9ICC A;  3KTQ A;  9ICE A;  3ETR A;  4E0D A;  4NLN A;  1WWV A;  3ISC A;  1NK7 A;  3BS5 A;  3IDW A;  2Z7J A;  2J6U A;  4O3P A;  5ALN A;  4NLG A;  7ICS A;  4P4O A;  4EEN A;  4OJL A;  4QWA A;  4TUQ A;  1ZJN A;  1UQV A;  4RUA A;  4UB1 A;  2YB1 A;  3UXN A;  1BPB A;  2LMR A;  4Y2R A;  4CF5 A;  3RTV A;  5J2J A;  1DGJ A;  1S8O A;  2H3V A;  1JI7 A;  1IV8 A;  2JEI A;  1TAM A;  3UQ0 A;  2WF5 A;  8ICR A;  1ZQJ A;  4RPX A;  3RBD A;  8ICJ A;  4DLE A;  1L3U A;  3AMZ A;  4MEY A;  4DQI A;  5ALE A;  4DL3 A;  5DG7 A;  8ICZ A;  1D8Y A;  3AL0 B;  1SV0 A;  3TI0 A;  4OO1 J;  2KSO B;  5CEH A;  4BXO B;  4QWE A;  5KG7 A;  2MA1 A;  2GLE A;  2KEY A;  1JAL A;  3NGD A;  2EQY A;  5DB7 A;  3RR8 A;  4DFM A;  4K4H A;  2W3S A;  3C29 A;  4KMO B;  5L1J A;  5DLF A;  3V6H A;  2EZX A;  2YMP A;  2MUT B;  4YFK A;  1C20 A;  4Z6E A;  1QSS A;  1S0V A;  3U26 A;  4ZH4 A;  2P6U A;  2F8K A;  1RQN A;  3BQ0 A;  4MEX A;  3GV8 B;  3KHR A;  4UB2 A;  4YP3 A;  4O3N A;  4YMO A;  3NTU A;  2KFN A;  3EZ5 A;  4DF4 A;  4DSF A;  2LBO A;  1O03 A;  3J81 j;  4EYI B;  4LJX A;  5KT7 A;  1F0M A;  5J0P A;  5J0X A;  3PSI A;  5AKI A;  2NV3 A;  3C5G A;  1WWU A;  1PK3 A;  1S5L U;  1UT5 A;  1ZQM A;  2WF6 A;  5EOZ A;  4MF8 A;  1ZYQ A;  4YVZ A;  2KJ8 A;  5HHH A;  3H8S A;  4F4K A;  2FE9 A;  2VKQ A;  4JWM A;  1ZQX A;  3WKC A;  5J2G A;  4US8 A;  4BX9 C;  3OHB A;  2I5H A;  2WB1 C;  5CP2 A;  4XA5 A;  2XGQ A;  3PW2 A;  4DS5 A;  1ZRN A;  3M6K A;  1WG8 A;  2WFA A;  1NKB A;  3OHA A;  5TZV A;  5CR0 A;  4IQT A;  4NV0 A;  5AIC A;  9ICG A;  3MGH A;  5AKG A;  2FLP A;  5HR6 A;  1L3S A;  3ETL A;  4YCX A;  3DV9 A;  4B9L A;  5KFX A;  5J0U A;  1SXE A;  3I1Y A;  1ZQI A;  1SZP A;  2ZG6 A;  4QZA A;  3NVW A;  1P7D A;  2DPI A;  2P35 A;  1ZD5 A;  3SR6 A;  4B9M A;  2NRV A;  3UM9 A;  1PK1 A;  3AUO A;  3Q8S B;  1PK1 B;  2ZUC A;  4QWB A;  2ZTD A;  4ELT A;  4RPZ A;  4OD0 A;  4I2A A;  4F92 B;  3GIJ A;  4M9H A;  3N7P D;  4US9 A;  2WF9 A;  4DOB A;  2OH2 A;  1IG6 A;  3AN1 A;  1HUO A;  4DFJ A;  4KX5 A;  5ALD A;  1Z19 A;  3RB3 A;  1CEZ A;  3SI8 A;  3E0F A;  2HHU A;  7ICJ A;  3CW2 C;  5AHX A;  3MFH A;  2A1A A;  9ICN A;  3M9O B;  2W03 A;  5ALK A;  2QB0 B;  2JV3 A;  1U4B A;  4MF2 A;  2BHN A;  2A19 A;  1ZQU A;  2QAR B;  5IIL A;  5FP0 A;  2EDU A;  1RYU A;  2E3T A;  3IHQ B;  4RT3 A;  2RLT A;  1NOM A;  2HOF A;  2DUY A;  2F3N A;  3DEE A;  3H0L B;  2VA2 A;  2VA8 A;  5AKZ A;  8ICB A;  5KFN A;  4TUR A;  1ZQH A;  2R8G A;  1RQL A;  2HVI A;  3QEA Z;  1TV9 A;  4C8L A;  3BJY A;  2KIW A;  5DBA A;  8ICA A;  1L5U A;  2B0C A;  4QZE A;  5J29 A;  4IL6 U;  4CGZ A;  5AKY A;  1V97 A;  4F4W A;  2ZTC A;  4PHA A;  2EAN A;  3BQ7 A;  3TFR A;  2F76 X;  2AHO B;  4RQN A;  1YZ6 A;  8ICW A;  2KSO A;  1J97 A;  4P4M A;  4F93 B;  2YMQ A;  3IP4 B;  3UXP A;  3T5J A;  4Y2Y A;  5AK4 A;  4B9T A;  3RJI A;  1B4F A;  4Y2T A;  3QEB Z;  4GC7 A;  1WCN A;  1XO0 A;  1NK4 A;  1XS9 D;  4BJQ A;  2ZTE A;  3AM9 A;  2RRD A;  9ICW A;  2E8P A;  3VC8 A;  4FO6 A;  2HHQ A;  3BZC A;  4RQ8 A;  4LVS A;  1D8L A;  3H7I A;  4NLB A;  4B9U A;  5BOM A;  2ZJA A;  5AM3 A;  2XVT A;  4UAY A;  4ELU A;  4RNO A;  3ED5 A;  4ED3 A;  4KLQ A;  2WHE A;  2ZIU B;  2Y1I A;  1A76 A;  4P0P A;  3E58 A;  2GOL A;  3QU7 A;  4F5Q A;  3RJH A;  3V6J A;  5IIJ A;  1KL9 A;  2W04 A;  4M6W A;  4NLK A;  1AQ6 A;  2P66 A;  1MC8 A;  1L7N A;  2VJ5 A;  5KFQ A;  3TKA A;  5F9L A;  5ALW A;  1ZQT A;  4I28 A;  3QX7 A;  1X6I A;  1KKX A;  5CHG A;  4YR0 A;  2F44 A;  4QZI A;  3RAX A;  2KTQ A;  2JEG A;  3WK7 A;  4FZL A;  1Q46 A;  5KL1 B;  4NM1 A;  2HHT A;  1ZQO A;  3QU4 A;  4O3O A;  1ZXI A;  3BZK A;  3C2K A;  8ICS A;  4ED8 A;  4J9R A;  8ICY A;  3LVW A;  2XIC A;  3PVX A;  3SEI A;  1T7P A;  4DL5 A;  4KLE A;  4CRX A;  2BQ3 A;  4USA A;  4XRH A;  1TK8 A;  1ZQE A;  1QQ5 A;  2K8C B;  1TK5 A;  1NJW A;  1A0P A;  2F1J A;  1N63 A;  3BQ1 A;  2LHT A;  2JXJ A;  5AIA A;  2FPL A;  3KHG A;  2ZIV A;  4F5P A;  1SKS A;  3PO5 A;  7ICE A;  4Y2V A;  3IM1 A;  2YX8 A;  2C28 A;  5KT3 A;  2FLL A;  5ALL A;  3RFA A;  3OSP A;  5GTI U;  4Q44 A;  3C1Y A;  4UW9 A;  2XC9 A;  4MFC A;  3RJK A;  9ICK A;  3PY8 A;  2I9G A;  2V4R A;  1NKC A;  4YD1 A;  3HKZ C;  1ZQ1 C;  5CA7 A;  1ZQL A;  4DL2 A;  9ICS A;  4RQ1 A;  3WKB A;  3N7S C;  3HX0 A;  1BPE A;  5HR7 A;  1PVP A;  9ICO A;  1HIW A;  2YTU A;  4GC6 A;  4DSI A;  2BCV A;  2V9W A;  2R8H A;  1ZQY A;  4FE3 A;  3PML A;  1UPH A;  4R8U B;  2DKZ A;  1IM4 A;  4FZM A;  4Y2X A;  5KG5 A;  2HBL A;  1Z4N A;  3KZX A;  4EX7 A;  3MR2 A;  3PMN A;  2IOF K;  5EE1 A;  1NK9 A;  1BGX T;  2BR0 A;  4F8R A;  7ICG A;  3I76 A;  1QCK A;  4Q8E A;  4UAZ A;  4J9L A;  3MDA A;  2IMW P;  3SEN A;  5G5H A;  1T8E A;  3L3F X;  9ICM A;  2I6X A;  5J0W A;  4PGY A;  3QU2 A;  1Q3U A;  1RM6 C;  2E1F A;  1ZQZ A;  1L7O A;  2WTF A;  1LKY A;  3C2M A;  2M0N A;  5J2I A;  3RH4 A;  1TVA A;  1DK2 A;  5CJ7 A;  4DOA A;  4RUC A;  4DF8 A;  2NRZ A;  2H3Q A;  5KFY A;  3GZF A;  3B0Y A;  3HWT A;  1NJY A;  2NYV A;  3KHL A;  2UVV A;  2J6T A;  1T3N A;  7ICI A;  4DOC A;  4F2R A;  4ECW A;  3M8R A;  2B6G A;  3QUC A;  4Z6D A;  4UB4 A;  4QZH A;  1ZRM A;  2K60 A;  2RDI A;  3RBE A;  1L3T A;  4UAW A;  4RQ2 A;  4QIW C;  3D2Q A;  2VAN A;  1SV0 C;  4DSL A;  4TUS A;  4O3R A;  1BNO A;  3OJU A;  2BDP A;  4EZ6 A;  5J0Q A;  4EEK A;  1NK0 A;  2L5Y A;  4PPX A;  2NO4 A;  4I2B A;  2LM1 A;  2ES6 A;  3BQT A;  4B9V A;  2CPR A;  3IRU A;  1J2N A;  1L7P A;  5ALR A;  3SD7 A;  2Y0S C;  1IXR A;  1JIH A;  4K4I A;  2I1Q A;  1N56 A;  4NXZ A;  4FFD A;  3OSN A;  4G9B A;  2XI9 A;  1SB3 C;  4I2J A;  4M04 A;  3TAR A;  2MSN A;  3ORY A;  3PSF A;  4AP9 A;  5AM2 A;  3SAG A;  3M6Z A;  4BGD A;  2RHF A;  8ICC A;  4F71 A;  2OYY A;  2H3Z A;  3A0H U;  4R8U A;  1D9F A;  5DGA A;  3OJS A;  4P0Q B;  3AU2 A;  4KIT B;  4DQQ A;  2KKV A;  1ZJM A;  5C0Y A;  3FYH A;  4R66 A;  1ZD3 A;  4Y2Q A;  4EEY A;  3ICX A;  3LYS A;  3JPO A;  5H2F U;  5DBC A;  3MR5 A;  4IC9 A;  3OTQ A;  2W9B A;  4GXJ A;  1KDH A;  4J9O A;  3ZDA A;  2K8A A;  1XSL A;  4ED2 A;  2FPM A;  2K4E A;  7ICF A;  2NRX A;  4NY8 A;  5KFH A;  4ECR A;  2WF7 A;  3SAH A;  3HPO A;  3G6X A;  1SXD A;  5HHI A;  2P6R A;  5L1K A;  1ZQR A;  4PZN A;  9ICA A;  1COO A;  3NVV A;  8ICM A;  2LKY A;  5KFM A;  3M9M B;  5J2A A;  4TQR A;  1ZQD A;  3V7L A;  4GLX A;  2WAQ F; 
#chains in the Genus database with same CATH homology
 2EAO A;  4IS7 A;  2L5Y A;  1COK A;  3TAC B;  1X40 A;  1B0X A;  1KW4 A;  1WWV A;  2ES6 A;  2KE7 A;  3H8M A;  4MHV A;  5JRT A;  3BS5 B;  1F0M A;  1X66 A;  3BS5 A;  2QB0 B;  3IDW A;  2D8C A;  2DKZ A;  3KKA A;  2JV3 A;  2QAR B;  1OW5 A;  1WWU A;  2KIV A;  1SV4 A;  2EAP A;  1PK3 A;  5J8Y A;  2Y9T A;  5L1M A;  2F44 A;  4NJ8 A;  2F3N A;  2KMD A;  1UQV A;  1RG6 A;  2LMR A;  2FE9 A;  2KG5 A;  2E8M A;  3SEN A;  5KNI A;  2QB0 A;  1V38 A;  4PZO A;  2QAR A;  1JI7 A;  1V85 A;  2DKX A;  4NL9 A;  3SEI A;  3TAD C;  1SGG A;  3HIL A;  2DL0 A;  2ESE A;  2QKQ A;  3TAD A;  2LPE A;  2EAN A;  3BQ7 A;  2QB1 A;  1LKY A;  4RQN A;  3KKA C;  1SV0 A;  2Y9U A;  2KSO B;  1X9X A;  2KSO A;  2GLE A;  1B4F A;  1Z1V A;  5JU5 A;  1DXS A;  1SXE A;  4NL9 C;  2D3D A;  2B6G A;  5J8Y C;  2E8P A;  3K1R B;  1PK1 A;  1LKY B;  2K60 A;  1PK1 B;  5JTI A;  1UCV A;  2EAM A;  1OXJ A;  5F3X B;  1SXD A;  2F8K A;  1SV0 C;  2K4P A;  3BS7 A;  4PZN A;  2E8N A;  4RQM A;  2YTU A;  2E8O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...