3TADC

Crystal structure of the liprin-alpha/liprin-beta complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
252
structure length
252
Chain Sequence
PFAKWTKEQVCSWLAEQGLGSYLSSGKHWIISGQTLLQASQQDLEKELGIKHSLHRKKLQLALQALGSEEETNYGKLDFNWVTRWLDDIGLPQYKTQFDEGRVDGRMLHYMTVDDLLSLKVVSVLHHLSIKRAIQVLRINNFEPNCLRRRPSDENSITPSEVQQWTNHRVMEWLRSVDLAEYAPNLRGSGVHGGLMVLEPRFNVETMAQLLNIPPNKTLLRRHLATHFNLLIGAEAQHQKRDAMELPDYVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Liprin-alpha-2
publication title Liprin-mediated large signaling complex organization revealed by the liprin-alpha/CASK and liprin-alpha/liprin-beta complex structures
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 84
structure length 252
sequence length 252
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00536 SAM_1 SAM domain (Sterile alpha motif)
C PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3tadC01
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3tadC03
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 3tadC02
5KNIA 3K1RB 1WWUA 3KKAC 2EAPA 2DL0A 2QKQA 1LKYB 4RQMA 2E8NA 4IS7A 5J8YC 2Y9TA 1B4FA 2KE7A 2KMDA 2ES6A 3HILA 2F44A 1Z1VA 2K4PA 1UCVA 1COKA 3BS5B 5JTIA 1SXDA 1OXJA 2ESEA 4PZOA 2E8MA 1JI7A 1LKYA 3BS7A 3TADA 1PK1B 2QARB 1DXSA 2QB1A 4RQNA 2YTUA 2JV3A 2QB0B 2KG5A 4NL9A 5L1MA 1SV0A 2DKXA 2LMRA 1X66A 3IDWA 1UQVA 2L5YA 1PK3A 2QARA 2DKZA 1F0MA 3TACB 2D3DA 3TADC 2B6GA 4PZNA 2QB0A 2D8CA 1V85A 3H8MA 4MHVA 1B0XA 3BS5A 2K60A 4NJ8A 4NL9C 3BQ7A 2KIVA 1KW4A 1SV0C 2KSOB 2GLEA 5JU5A 2EANA 1SGGA 1V38A 1PK1A 3SENA 5JRTA 2FE9A 2E8OA 1OW5A 1X40A 3KKAA 2KSOA 2EAOA 1WWVA 1RG6A 5J8YA 1SXEA 5F3XB 2LPEA 2EAMA 1SV4A 2F8KA 2E8PA 2Y9UA 3SEIA 2F3NA 1X9XA
chains in the Genus database with same CATH superfamily
2GWSA 3J81j 1JXLA 4F5NA 2E5SA 3D6JA 1KKXA 4ELVA 3H40A 4IS7A 4FZNA 7ICSA 3S6JA 3WK8A 1ZQLA 4Q45A 2K4HA 2O6KA 4KLIA 5FP0A 3TKAA 1NK8A 5DB6A 2FMPA 3OPXA 3KZXA 2IMWP 2ZIUB 1ZD3A 4C8KA 1DXSA 1QQ6A 2ASJA 1A76A 5KFWA 5KFOA 2MRLA 7ICLA 2VJ4A 2M9NA 2W9CB 2XY6A 5KFMA 3QEAZ 5DG9A 4RUAA 1KN5A 4XQ8A 3IRUA 3PR4A 7ICHA 2I1QA 1XSLA 4CRXA 2R8IA 3GFKB 3CP8A 4ECTA 2BPFA 4GC7A 3F53A 1WCNA 4NJ8A 2HBJA 5CHGA 1O03A 2HOFA 3U26A 1N5XA 3L3FX 5AICA 2XIDA 1Z4NA 5AI6A 2ZIVA 3JPOA 3M1YA 4ECZA 2RP5A 4Y2VA 4OJLA 2W9BA 9ICRA 1MA7A 4KLSA 2ZIXB 3SR6A 4G3IA 4O5KA 1SB3C 4I2CA 1XWLA 1J2NA 5DQHA 4Y2QA 2P6RA 4C8NA 4QZBA 1CRXA 4F4KA 9ICEA 2GOLA 1OUQA 2ZUDA 2DWQA 2RHFA 4R65A 4DWIA 3H8WA 1NJWA 3IG8A 2MA1A 2AGPA 2JEGA 2R8JA 4JV1A 1WG8A 1ZD5A 1TV9A 2CPRA 2ZJAA 5AKYA 3RAQA 5KFKA 4UASA 2IBKA 2ESEA 1BNOA 1MC8A 2EQYA 1JI7A 3UXOA 1DRGA 3CYMA 5EE9A 3TFRA 4YMOA 1LB2B 1X9WA 1NZBA 2FPMA 3C23A 4OO1J 2BPGA 5KFLA 3L5KA 1ZQ1C 1KDHA 1WCLA 4P4PA 4R63A 4YCXA 3LVVA 3HWTA 4I2DA 3RTVA 4ELUA 5AM4A 3QU9A 3N7PD 1ZQEA 1ZD4A 2ODGA 3BQ1A 5DG7A 2PFNA 5DQGA 4F5RA 2LI6A 3HKZF 4QZHA 2KIVA 3K1ZA 5KFYA 5JU5A 3H4DA 1KFSA 2IA6A 2F77X 3BDPA 8ICBA 3PR5B 4CGZA 2M0NA 4CE6A 1QQ7A 3RJHA 5DB7A 4NM1A 4ECRA 4ECUA 2KICA 4KLQA 1T7PA 2OM6A 4DL7A 2FPLA 3LWMA 3PSIA 4KTQA 3NS1A 5CWRA 1ZRNA 2XY5A 4RNNA 5J2HA 5ALJA 5KFNA 9ICLA 3SEIA 3SYZA 5DBBA 1K1QA 4YVZA 2KJ9A 4C4TA 2JEJA 1QQ5A 1WWUA 3KKAC 3RBDA 3EPGA 1QCKA 2IHNA 5KFDA 1ZOLA 4P2HA 5F9NA 2DBYA 4MFAA 3QNMA 3FYHA 5JTIA 1SXDA 3JPPA 4NWIA 7ICKA 4PHEA 3QUBA 5JUMA 5CR0A 2Q4TA 2OEHA 5HP4A 2IHMA 1ZQTA 9ICFA 4PH5A 2HVHA 5AI4A 1X66A 4B6JA 1UQVA 4RQ4A 3RR8A 1WYGA 5AM0A 3Q8RB 3M7DA 3PO5A 3MC1A 4US8A 3H0RB 3H8JA 5ALXA 3CRXA 3FM9A 4GIBA 2KJ8A 4PGYA 2JEFA 3BS5A 2MU2A 3BJYA 5AKLA 8ICSA 3C5GA 1L3TA 2BDPA 5KFUA 2VKQA 3PMLA 3SQIA 3V7KA 3WK5A 3RB4A 4RNOA 3B0YA 4I29A 1Q3VA 3GV7B 1S0VA 2MSNA 3FC4A 4F71A 1N61A 5L1KA 3HX0A 1JALA 4DL5A 5KT6A 3CNHA 2EAOA 4O3MA 2EAMA 4IQTA 1IXRA 5DQIA 3K4GA 3QZ7A 3QXGA 3PX6A 2IOFK 3T5HA 5ALDA 3GU3A 1U4BA 2BKEA 4I2GA 8ICCA 3PVXA 5KFPA 4RQMA 1JUDA 4UB5A 2KVSA 2YN4A 3WKCA 1T3QA 1IM4A 1XSNA 1NKEA 2RRDA 4TQSA 4RQ3A 4J9NA 4DO9A 4F4XA 1KFDA 4GFJA 2RLTA 2HOQA 4DLEA 3PMNA 1T94A 4EENA 1UT8A 2E8MA 3I28A 2HSZA 1Z3EB 3QU2A 4I2JA 1ZQQA 1L8LA 2Y1IA 5J0PA 3QUCA 3EZ5A 3QEBZ 5AI0A 3NUQA 3SAHA 3PW0A 4M6WB 1HUZA 2BCVA 1JROA 4P4MA 9ICVA 2JMGA 3BQ0A 3RJKA 2R18A 1MQ3A 4M6WA 8ICJA 8ICYA 5AKGA 3WK9A 5EOZA 4CF3A 4ED8A 1N48A 1C20A 2VIXA 1ZQOA 4JWNA 3ED5A 2WHEA 3BZCA 3M9NB 1S10A 4QWEA 3OSNA 4UB1A 2BHNA 4QW9A 4EYIB 2PI4A 1SZPA 5ALRA 1OW5A 4AYBF 4K4IA 4FS1A 3JPNA 5C5JA 1HIWA 2WAQF 4USAA 2C2EA 4DL2A 4YR0A 3G6XA 4YXJA 2LKYA 4LVSA 5HMLA 1TFRA 3C2LA 5AKXA 1KL9A 2F3NA 5BOLA 4YR3A 2EZZA 4XUSA 4ECXA 2A1JB 3PO4A 4NLNA 1KLNA 4M04A 2LM4A 4P0PA 2FI1A 9ICOA 1LKYB 4KLMA 2P35A 3N7SC 2P6UA 3ISBA 4ED6A 2H3QA 4UB8U 2KK0A 1XO1A 5DLGA 4O9MA 7ICTA 2E1EA 3KD3A 1COKA 4KX3A 5E79U 4DS4A 1HUOA 1RZTA 1SZHA 4RUCA 3WKBA 5G5GA 4Z6CA 4C4RA 1LKYA 3ICXA 1SL1A 9ICCA 4FO6A 4YFKA 4EZ6A 3QZ8A 2G07A 4KN7A 2BQUA 3NVZA 4DL6A 4CF5A 4JV0A 1N5WA 4WJ3B 4F4ZA 2AU0A 4DFKA 1JXEA 5KT4A 1FIQA 3BQ2A 4DQPA 4JV2A 2AH5A 5BOMA 3NASA 3BZKA 5J0SA 1RYSA 1S76D 9ICSA 3WK7A 1XU4A 1TK0A 3RH6A 4ED1A 9ICPA 5T14A 2NRXA 3KTQA 4K4HA 1A6SA 4Z6FA 3HW8A 4F92B 3SV4A 3RB0A 2FPKA 3WK6A 1D8BA 5KL8B 5KFBA 4PHDA 2HHVA 3ETRA 4DOBA 4KLTA 2E1FA 9ICAA 5KG1A 4MFCA 3GIMA 1SGGA 2W43A 4QZ9A 1RDFA 3SENA 4QZCA 3C21A 3WKDA 4OJ5A 2I6XA 2EZYA 1ZQXA 2EZXA 2W7OA 3F5EA 4FFDA 4RQ1A 4O5CA 3K75D 1NOMA 3H4BA 4EEKA 3MBYA 2PFPA 2KV2A 5KFFA 1WUDA 1UPHA 3IHQB 2K4EA 4UAWA 2ZTEA 5K4LA 2Y1JA 4DFMA 2FLNA 2H3FA 3QX7A 4F50A 3K1RB 3MFIA 2NYVA 2EAPA 4J9PA 1FFVA 5KFGA 2ALZA 1B4FA 3TARA 3MR6A 2ES6A 5KFAA 9ICUA 1Z1VA 3AL0B 3ZDCA 4JUZA 1V9PA 3AU6A 2FJ6A 3WK4A 1ZQWA 1SKRA 3IP4B 2W3SA 3AUOA 5J0RA 4RQ5A 3JPTA 9ICKA 2KG5A 2OH2A 3E2EA 2YMQA 3OTQA 4PPXA 5DGBA 3IDWA 2VA2A 2ASLA 4RNMA 2C22A 1TE2A 4FBTA 2ZJ5A 3SZ2A 8ICRA 5KAFU 1S0OA 2F76X 4PHPA 3MFHA 3TADC 1NK4A 3IG5A 1P7DA 1S77D 2D8CA 3G6YA 2OWOA 5IILA 1ZJNA 4F8RA 1FEZA 3B0XA 4DFJA 4UBBA 4O3NA 2ZIUA 4QIWC 4BXOB 3F2CA 2KEYA 4KLDA 4NLGA 2PMZC 1QH9A 4NLBA 2NO5A 1S0MA 1UT5A 7ICRA 2K8BB 2W9CA 1NKCA 2HW3A 4UQGA 4LZDA 4UB2A 4B9NA 2F1JA 2GH1A 4O3OA 5KFXA 4KLHA 4AP9A 2E8PA 2KHQA 2PXIA 5KFRA 4EBEA 4DSFA 3FDSA 1ZQAA 1F44A 5KFSA 2NV3A 2QLTA 5AM5A 3UM9A 5EWFA 1ZQFA 3PW5A 5EWGA 1A0PA 8ICFA 2FMQA 3RJGA 3GV8B 1SWVA 5DG8A 4IQWA 2ZIXA 1OXJA 3M6ZA 9ICTA 4PGXA 4UAZA 5HHIA 3RAXA 2W03A 2HHSA 2VJ5A 2XY7A 2J6UA 4C4SA 4RQNA 2YTUA 4QZIA 2BDUA 2XCPA 3UXNA 8ICQA 5H2FU 1SV0A 1TK8A 2AQ4A 4QZGA 4U6PA 4CNQA 2C28A 4G9BA 4J9OA 8ICOA 3AM9A 5AI5A 2PI5A 5KTQA 2AHOB 3Q8LA 2VA3A 2BCSA 4UATA 5J2CA 2BQ3A 5ALFA 2KZZA 1L3SA 5CJ7A 2K89A 1ED1A 2KSOB 3KHGA 3DEEA 3T3FA 4KLOA 3KHRA 3RRGA 3PSFA 2KSOA 1N60A 4Y2SA 1ZQIA 3LYSA 3M8SA 1RYRA 2WB1C 2WF5A 1QSYA 4C8OA 1SV4A 1PUZA 3QU4A 1KBUA 2YMLA 2KNJA 4PL1A 4P4OA 5IIIA 1X2IA 4GXKA 4J9RA 4OJ6A 2JRZA 4DSEA 4EYHB 3T5LA 2WF9A 2XGQA 4Z6DA 1ZQGA 3AEVA 4R66A 2JZBB 5ALHA 2Z7JA 8ICZA 5TZVA 4IC9A 5HR7A 5KFVA 1X42A 3WU2U 2UVUA 4EZ9A 4IRCA 5J2IA 2K8CB 3LVWA 5ALQA 5DB8A 4RPXA 2JZBA 2EDUA 2ZXHA 4Q8FA 4YQWA 3KZIU 4BWJA 3QUQA 4FBUA 2DKXA 4JWMA 2LMRA 1ZQZA 2XI9A 4NLZA 1DK2A 1F0MA 4ICAA 4RQ7A 2D3DA 3NRZA 3UMGA 1N2XA 2C2RA 5ALKA 5J0TA 2XO7A 4I2IA 5ALWA 5CA7A 5KG6A 2RDIA 3NRWA 2WF7A 2JXJA 9ICWA 2G0AA 3Q8QB 4Q44A 2OYYA 4KLJA 4YMNA 5AKHA 3PV8A 3C28A 5J2DA 4R8UB 1UA1A 1UA0A 3RJFA 3AN1A 4MEXA 5ALOA 3SAFA 2ZG6A 2HOIA 1NZPA 1T3NA 2BCUA 2Y9UA 5IIJA 5AI8A 4E0DA 4R8UA 4UB6U 3NVYA 3NVWA 1ZYQA 4M9HA 5CP2A 4I28A 5KNIA 2KHVA 3KBBA 3FAHA 2QKQA 2RQ5A 4IQVA 3T5KA 5J8YC 7ICEA 1IV8A 3OJUA 3ISDA 2KIWA 8ICKA 4EELA 4O3QA 2H3ZA 4C80A 3QU5A 5DDYA 1BNPA 5J2GA 2YQEA 3E58A 2UVRA 2YB4A 3IN5A 1NK5A 1YZ6A 3DV9A 4O5EA 9ICMA 3LK9A 1QTMA 4I2EA 1Z4OA 2W8KA 2FLLA 3GZFA 1SL0A 2N1RA 5KG5A 4BDPA 3A0BU 2K4IA 9ICGA 2Y0SC 3C1YA 4F91B 2W9AA 5AKKA 2ISPA 2WFAA 2GO7A 3NTUA 1NNLA 4ACOA 2ZIWB 4NL9C 2PFOA 3TI0A 3KHHA 2VA8A 1TKDA 3PW7A 4QNLA 2R8KA 2H3VA 1ZQCA 4IQUA 5AK3A 2E8OA 2W3RA 1D8YA 4QWAA 2OHFA 5IIKA 1RYUA 3KKAA 3MR5A 3SD7A 4Y2XA 4TURA 2AGQA 1RG6A 1ZQNA 2BGWA 3TQ1A 1LV5A 1V97A 4F72A 4DOCA 4M2YA 5J0WA 1BGXT 2HHWA 3AQEA 1Q46A 5DBAA 2CN1A 4C7YA 3HPOA 5ALIA 9ICNA 2DGZA 5AI9A 5AM3A 4P0QB 5IIOA 2W04A 5ALSA 2LYHA 2HBKA 3N97B 1D9FA 2E8NA 4GC6A 4TUQA 1DGSA 8ICAA 4EX7A 4Q8EA 2ZTDA 1NJZA 1CEZA 5AKJA 1BPEA 1SKSA 3M6KA 2E3TA 5KG2A 1ZQBA 4B9MA 4P0QA 5KG4A 4RT3A 2XICA 5A0LA 5J2AA 3H7IA 2JGAA 5HMMA 1KEJA 4BX9C 2OXOA 4QIWF 2KJ5A 2PMZF 2QB1A 7ICJA 1U9LA 3Q8MA 2V4QA 1URJA 5KFIA 3UQ0A 3C1ZA 7ICVA 3LDAA 4DF4A 9ICQA 1D8LA 1YZ7A 2HBMA 2A1JA 2KZ3A 1PK3A 2HCFA 5KL1B 3AMZA 5D49A 2DKZA 5KG0A 2CRXA 4QJFB 2BCRA 3GDXA 4QW8A 3TAQA 3AQFA 1U47A 3NGDA 1ZQMA 2ASDA 1N63A 1AROP 3Q8PB 2R8HA 8ICXA 1S97A 2G08A 3EPIA 2G5HB 5DGAA 2GLEA 3ISCA 5D4BA 4FZLA 3QYPA 3PZPA 1K5OA 4F5OA 8ICMA 4LJXA 2KKVA 2NRTA 1VDVA 4ZOHC 4TUPA 3SV3A 2HVIA 5IIMA 4J03A 1ZJMA 1SXEA 5F3XB 1L7OA 2G5IB 1IG6A 4MF8A 4NY8A 5TISU 5B66U 5KFZA 2NRVA 4R64A 4IRKA 8ICVA 4KLEA 1L7NA 5J2JA 3OHAA 2ZUCA 4YP3A 1JIHA 1L6NA 2A19A 2Y9TA 5ALGA 5ALUA 2F44A 4BGDA 1UCVA 5CB1A 1S8OA 5J0OA 4ED2A 5AK5A 3JPRA 2YMMA 4Y2UA 2KD1A 2HHQA 5J0QA 3GQCA 1SWWA 1KTQA 1PK1B 2QARB 4UAUA 2LBOA 4UB4A 4K4GA 3H8SA 3V6HA 3MDCA 2DQNB 3I76A 4MF2A 1ZXIA 3F2DA 4FS2A 4ECQA 1PZNA 2WB1F 3IV6A 5CRXA 2L5YA 3GIIA 3UXPA 2QARA 2ATLA 1X9MA 2H5XA 3PX0A 8ICNA 3JPQA 8ICWA 4M9NA 5J0XA 8ICPA 5EE1A 2WF6A 3LWLA 1ZQJA 1ZQSA 5ALNA 1NJXA 1V85A 2YY6A 1B0XA 8ICGA 4ECVA 3D2SA 1N62A 4JK1A 5L1JA 5KT2A 4J9LA 1L8OA 1KSPA 4YG2A 3DDHA 2P66A 9ICHA 2LYAA 1U45A 2EH9A 4KMUA 1L7PA 1PVRA 3SI8A 4ZH4A 5ALVA 4A8EA 1B22A 2AQ0A 4DL3A 4GLXA 8ICTA 5KT3A 5KG7A 3V6KA 1NK9A 1DGJA 3M9OB 1NJYA 4CF4A 2A1AA 1XNSA 5AKEA 1ZETA 1FFUA 4DQIA 4AYBC 3IM1A 1XC9A 1A77A 4I2HA 4F93B 4J9KA 2BCQA 5KT7A 4RPYA 2WAQC 1N56A 3VCBA 2NRWA 1K1SA 3HP6A 2H3IA 4Y2RA 5L9XA 2HMXA 3ZD9A 1F5SA 2KMDA 5G5HA 4IR1A 3RJIA 4BXOA 3KHLA 3HILA 2BZFA 2DPIA 4US9A 4DF8A 3ALRA 5DDMA 5J0UA 2ZIVB 2W11A 2HDOA 1QLNA 3R9KA 2W9BB 1LVHA 1UHUA 1ZQRA 3UQ2A 1M6YA 4CCHA 4HAIA 1FO4A 4YXMA 2QB0B 4QZFA 2G09A 5L1MA 4PJ0U 3MGIA 2G06A 4GXJA 1MQ2A 3GV5B 2XVTA 2XC9A 3V6JA 2B0CA 4Y2YA 4DQQA 3N7RC 5KFCA 1T8EA 4ED3A 4DSJA 2B6GA 2W55A 4IRDA 3PY8A 2QB0A 2UVWA 1BPDA 4I27A 4QWDA 1TAUA 1ECWA 9ICXA 1ZQKA 1NK7A 3H8MA 2F8LA 4RQ6A 3GIJA 1X6JA 3V7LA 4CDGA 1MSWD 1XSPA 5ALMA 4BUGA 1BPBA 1ZQVA 3EWAA 2HHXA 3B9JA 4F2SA 3MR2A 2V4RA 1L3UA 1S5LU 5AM2A 1D9DA 3AU2A 1CUKA 7ICMA 2LM1A 1ZQHA 3VC8A 3H0LB 5ALPA 1BPYA 5F9LA 1RM6C 4TUSA 1J97A 4EBDA 3C5FA 2F8KA 5HHHA 3OHBA 4O3RA 2LYBA 4RT2A 3OJSA 4QZEA 1O08A 5HNKA 4KLUA 1X9XA 3PSTA 2W54A 4NLKA 4DS5A 4MFFA 4YD1A 2Y0SF 2DL0A 4YN4A 1BVSA 1RPLA 1X6IA 2JEIA 1ZRMA 1YT3A 1RXVA 4QZDA 2IOHA 1J2MA 3EYZA 5AK6A 4DCCA 3BQTA 3HRDD 3KOOA 4Y2JA 3BS7A 3TADA 4M0AA 2KFZA 4LZGA 4PL2A 7ICFA 5HR6A 3G6VA 2JH1A 1PVPA 2JV3A 2ISOA 1JX4A 3TAPA 2KOBA 4Y2PA 7ICPA 5DLFA 3OSPA 1L7MA 3TACB 4B9SA 8ICIA 1NK0A 2HHTA 2YMPA 2HHUA 4KMOB 2HI0A 3MR3A 3ORYA 3V72A 3UMBA 2NO4A 4DQRA 3QE9Y 3L4PA 7ICUA 5KG3A 1BPZA 3M9MB 2ZTCA 5GTHU 2IOFA 1KFTA 4KITB 3ZI4A 3M8RA 4M9JA 2KN7A 1QSLA 4FE3A 1NKBA 2A3VA 2AJQA 1DK3A 5KT5A 9ICBA 4ECSA 1Z19A 2B21A 4NM2A 4PHAA 3C29A 1SKWA 5D46A 4UB3A 5EE3A 4ED0A 1DOQA 1SIJA 5AIAA 4I2BA 4F4YA 5ALZA 4UAYA 1GO3F 4RQ8A 3GILA 1TVAA 2XGPA 2I5HA 3BS5B 5AKZA 5B5EU 4OJPA 3KFUF 4XRHA 4O3PA 2I9GA 4YR2A 1ZQYA 3PW4A 4DLGA 3F5AA 4XA5A 4C0ZA 1QSSA 4X5VA 2YB1A 5IINA 5J2BA 3RBEA 2KTQA 4IR9A 5AKIA 1IIPA 4DSLA 8ICEA 1B43A 1U48A 4QZ8A 3N4MB 1Z1BA 4UARA 4RQ0A 3RH5A 1ZQUA 1S9FA 1EXNA 2F2AB 3QUTA 2AXTU 5J2FA 1MN8A 4ED7A 2JH7A 3SMVA 4OJOA 1CI4A 2WF8A 4KX5A 1NI3A 3ZDDA 4Y2TA 5KAIU 8ICLA 3MGHA 3C2KA 4RU9A 3C2MA 3ZDBA 5JRTA 4EX6A 2FE9A 4B9UA 1Q8KA 4DSKA 3N28A 4ECYA 1T4GA 2V9WA 3RJJA 4B9LA 5ALYA 5KFHA 2KKPA 1ZD2P 4DFDA 1WWVA 5AIBA 4Z6EA 1Q3UA 4MEYA 2DF4B 2W9MA 2C2DA 1KQQA 2KVCA 1AQ6A 4UW9A 5KFEA 3RRHA 1JN3A 2ZIWA 1H38A 4M9LA 4KLLA 5AHXA 2JHDA 4ECWA 3HKZC 3WKEA 2XCAA 3D2NA 5J0YA 2K8AA 2KE7A 3EW9A 4B9VA 4KLFA 2K4PA 2ZJ8A 5GTIU 3PNCA 3ZDEA 4DSIA 4PZOA 2W7PA 2BR0A 3OGUA 5C0YA 1Z00B 4BWMA 4RQ2A 3UPQA 1KRPA 3O0FA 2FDRA 5EWEA 3MABA 3TANA 5KFJA 1L3VA 3Q8SB 4DFPA 1Z00A 3PSPA 4UAVA 5DKWA 5CEHA 3T5JA 4M9GA 4EEYA 4Q43A 1RXWA 2ZUBA 1SL2A 1HJPA 1TAMA 1COOA 4PZNA 3A0HU 4I2AA 4UBCA 5DBCA 2RDJA 4J9MA 5J29A 1C7YA 4MHVA 3MDAA 2K60A 4DEZA 4F3OA 3H0MB 3BQ7A 1KW4A 4P0PB 4FZMA 4QWBA 1VJ5A 3NVVA 2EANA 1ZQPA 4F2RA 4M47A 1V38A 4NXZA 9ICIA 1XS9D 4C8LA 1VLBA 4OCZA 2Q0ZX 7ICIA 4JB3A 3HJEA 7ICGA 4TQRA 1X40A 4BJQA 4F5PA 4KLGA 2VANA 3UMCA 3RR7A 2HBLA 4F5QA 5J8YA 4B9TA 4NV0A 2PKEA 4GXIA 1S0NA 2BPCA 2DFLA 3PW2A 2LHTA 4C8MA 1JMSA 5ALEA 4QZAA 4F4WA 2JR5A 3GIKA 1L5UA 4U7CA 3WKAA 2UVVA 1TK5A 2CXYA 2YX8A 2J6TA 3MGVA 2AGOA 7ICQA 5KFTA 5BPCA 4HYKA 3ETLA 3E0FA 3F2BA 2R8GA 4C7ZA 3SAGA 2BQRA 2FMSA 5ALTA 2OCEA 4RZRA 3RB3A 5J2KA 1PVQA 2F1HA 9ICJA 4KN4A 2WTFA 4ELTA 2KFNA 3RFAA 8ICHA 2MUTB 3RJEA 2MAXA 4NL9A 4IL6U 5J2EA 3HT3A 4DQSA 1ZQDA 2ZXIA 2KP7A 5L1IA 3TFSA 3THVA 4I2FA 3D2QA 1JRPA 4RPZA 1RQNA 2MUTA 1HEKA 7ICOA 4OD0A 4PGQA 3EUB2 5L1LA 1NK6A 3I1YA 5AK4A 1RQLA 5KFQA 4NLCA 2D6FC 3PX4A 2KZMA 1U49A 1SV0C 2DUYA 4YMMA 4J9SA 3ZD8A 1PK1A 3RB6A 3ZDAA 4JMUA 1X9SA 3CW2C 2DPJA 3JPSA 5EE0A 5ALLA 3RH4A 1BPXA 3QU7A 2W8LA 1XO0A 2J6SA 1Y88A 2LPEA 2NRZA 5AM1A 4DL4A 3V7JA 5DB9A 4J9QA 4EBCA 2F1IA 2PFQA 4QWCA 4O3SA 7ICNA 2FLPA 3RF9A 8ICUA 3ONNA 4YD2A 4O0IA 3Q8KA 1TAQA 3T79A 4DOAA
chains in the Genus database with same CATH topology
5KNIA 3K1RB 1WWUA 3KKAC 2EAPA 2DL0A 2QKQA 1LKYB 4RQMA 2E8NA 4IS7A 5J8YC 2Y9TA 1B4FA 2KE7A 2KMDA 2ES6A 3HILA 2F44A 1Z1VA 2K4PA 1UCVA 1COKA 3BS5B 5JTIA 1SXDA 1OXJA 2ESEA 4PZOA 2E8MA 1JI7A 1LKYA 3BS7A 3TADA 1PK1B 2QARB 1DXSA 2QB1A 4RQNA 2YTUA 2JV3A 2QB0B 2KG5A 4NL9A 5L1MA 1SV0A 2DKXA 2LMRA 1X66A 3IDWA 1UQVA 2L5YA 1PK3A 2QARA 2DKZA 1F0MA 3TACB 2D3DA 3TADC 2B6GA 4PZNA 2QB0A 2D8CA 1V85A 3H8MA 4MHVA 1B0XA 3BS5A 2K60A 4NJ8A 4NL9C 3BQ7A 2KIVA 1KW4A 1SV0C 2KSOB 2GLEA 5JU5A 2EANA 1SGGA 1V38A 1PK1A 3SENA 5JRTA 2FE9A 2E8OA 1OW5A 1X40A 3KKAA 2KSOA 2EAOA 1WWVA 1RG6A 5J8YA 1SXEA 5F3XB 2LPEA 2EAMA 1SV4A 2F8KA 2E8PA 2Y9UA 3SEIA 2F3NA 1X9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KNI A;  3K1R B;  1WWU A;  3KKA C;  2EAP A;  2DL0 A;  2QKQ A;  1LKY B;  4RQM A;  2E8N A;  4IS7 A;  5J8Y C;  2Y9T A;  1B4F A;  2KE7 A;  2KMD A;  2ES6 A;  3HIL A;  2F44 A;  1Z1V A;  2K4P A;  1UCV A;  1COK A;  3BS5 B;  5JTI A;  1SXD A;  1OXJ A;  2ESE A;  4PZO A;  2E8M A;  1JI7 A;  1LKY A;  3BS7 A;  3TAD A;  1PK1 B;  2QAR B;  1DXS A;  2QB1 A;  4RQN A;  2YTU A;  2JV3 A;  2QB0 B;  2KG5 A;  4NL9 A;  5L1M A;  1SV0 A;  2DKX A;  2LMR A;  1X66 A;  3IDW A;  1UQV A;  2L5Y A;  1PK3 A;  2QAR A;  2DKZ A;  1F0M A;  3TAC B;  2D3D A;  3TAD C;  2B6G A;  4PZN A;  2QB0 A;  2D8C A;  1V85 A;  3H8M A;  4MHV A;  1B0X A;  3BS5 A;  2K60 A;  4NJ8 A;  4NL9 C;  3BQ7 A;  2KIV A;  1KW4 A;  1SV0 C;  2KSO B;  2GLE A;  5JU5 A;  2EAN A;  1SGG A;  1V38 A;  1PK1 A;  3SEN A;  5JRT A;  2FE9 A;  2E8O A;  1OW5 A;  1X40 A;  3KKA A;  2KSO A;  2EAO A;  1WWV A;  1RG6 A;  5J8Y A;  1SXE A;  5F3X B;  2LPE A;  2EAM A;  1SV4 A;  2F8K A;  2E8P A;  2Y9U A;  3SEI A;  2F3N A;  1X9X A; 
#chains in the Genus database with same CATH topology
 2GWS A;  3J81 j;  1JXL A;  4F5N A;  2E5S A;  3D6J A;  1KKX A;  4ELV A;  3H40 A;  4IS7 A;  4FZN A;  7ICS A;  3S6J A;  3WK8 A;  1ZQL A;  4Q45 A;  2K4H A;  2O6K A;  4KLI A;  5FP0 A;  3TKA A;  1NK8 A;  5DB6 A;  2FMP A;  3OPX A;  3KZX A;  2IMW P;  2ZIU B;  1ZD3 A;  4C8K A;  1DXS A;  1QQ6 A;  2ASJ A;  1A76 A;  5KFW A;  5KFO A;  2MRL A;  7ICL A;  2VJ4 A;  2M9N A;  2W9C B;  2XY6 A;  5KFM A;  3QEA Z;  5DG9 A;  4RUA A;  1KN5 A;  4XQ8 A;  3IRU A;  3PR4 A;  7ICH A;  2I1Q A;  1XSL A;  4CRX A;  2R8I A;  3GFK B;  3CP8 A;  4ECT A;  2BPF A;  4GC7 A;  3F53 A;  1WCN A;  4NJ8 A;  2HBJ A;  5CHG A;  1O03 A;  2HOF A;  3U26 A;  1N5X A;  3L3F X;  5AIC A;  2XID A;  1Z4N A;  5AI6 A;  2ZIV A;  3JPO A;  3M1Y A;  4ECZ A;  2RP5 A;  4Y2V A;  4OJL A;  2W9B A;  9ICR A;  1MA7 A;  4KLS A;  2ZIX B;  3SR6 A;  4G3I A;  4O5K A;  1SB3 C;  4I2C A;  1XWL A;  1J2N A;  5DQH A;  4Y2Q A;  2P6R A;  4C8N A;  4QZB A;  1CRX A;  4F4K A;  9ICE A;  2GOL A;  1OUQ A;  2ZUD A;  2DWQ A;  2RHF A;  4R65 A;  4DWI A;  3H8W A;  1NJW A;  3IG8 A;  2MA1 A;  2AGP A;  2JEG A;  2R8J A;  4JV1 A;  1WG8 A;  1ZD5 A;  1TV9 A;  2CPR A;  2ZJA A;  5AKY A;  3RAQ A;  5KFK A;  4UAS A;  2IBK A;  2ESE A;  1BNO A;  1MC8 A;  2EQY A;  1JI7 A;  3UXO A;  1DRG A;  3CYM A;  5EE9 A;  3TFR A;  4YMO A;  1LB2 B;  1X9W A;  1NZB A;  2FPM A;  3C23 A;  4OO1 J;  2BPG A;  5KFL A;  3L5K A;  1ZQ1 C;  1KDH A;  1WCL A;  4P4P A;  4R63 A;  4YCX A;  3LVV A;  3HWT A;  4I2D A;  3RTV A;  4ELU A;  5AM4 A;  3QU9 A;  3N7P D;  1ZQE A;  1ZD4 A;  2ODG A;  3BQ1 A;  5DG7 A;  2PFN A;  5DQG A;  4F5R A;  2LI6 A;  3HKZ F;  4QZH A;  2KIV A;  3K1Z A;  5KFY A;  5JU5 A;  3H4D A;  1KFS A;  2IA6 A;  2F77 X;  3BDP A;  8ICB A;  3PR5 B;  4CGZ A;  2M0N A;  4CE6 A;  1QQ7 A;  3RJH A;  5DB7 A;  4NM1 A;  4ECR A;  4ECU A;  2KIC A;  4KLQ A;  1T7P A;  2OM6 A;  4DL7 A;  2FPL A;  3LWM A;  3PSI A;  4KTQ A;  3NS1 A;  5CWR A;  1ZRN A;  2XY5 A;  4RNN A;  5J2H A;  5ALJ A;  5KFN A;  9ICL A;  3SEI A;  3SYZ A;  5DBB A;  1K1Q A;  4YVZ A;  2KJ9 A;  4C4T A;  2JEJ A;  1QQ5 A;  1WWU A;  3KKA C;  3RBD A;  3EPG A;  1QCK A;  2IHN A;  5KFD A;  1ZOL A;  4P2H A;  5F9N A;  2DBY A;  4MFA A;  3QNM A;  3FYH A;  5JTI A;  1SXD A;  3JPP A;  4NWI A;  7ICK A;  4PHE A;  3QUB A;  5JUM A;  5CR0 A;  2Q4T A;  2OEH A;  5HP4 A;  2IHM A;  1ZQT A;  9ICF A;  4PH5 A;  2HVH A;  5AI4 A;  1X66 A;  4B6J A;  1UQV A;  4RQ4 A;  3RR8 A;  1WYG A;  5AM0 A;  3Q8R B;  3M7D A;  3PO5 A;  3MC1 A;  4US8 A;  3H0R B;  3H8J A;  5ALX A;  3CRX A;  3FM9 A;  4GIB A;  2KJ8 A;  4PGY A;  2JEF A;  3BS5 A;  2MU2 A;  3BJY A;  5AKL A;  8ICS A;  3C5G A;  1L3T A;  2BDP A;  5KFU A;  2VKQ A;  3PML A;  3SQI A;  3V7K A;  3WK5 A;  3RB4 A;  4RNO A;  3B0Y A;  4I29 A;  1Q3V A;  3GV7 B;  1S0V A;  2MSN A;  3FC4 A;  4F71 A;  1N61 A;  5L1K A;  3HX0 A;  1JAL A;  4DL5 A;  5KT6 A;  3CNH A;  2EAO A;  4O3M A;  2EAM A;  4IQT A;  1IXR A;  5DQI A;  3K4G A;  3QZ7 A;  3QXG A;  3PX6 A;  2IOF K;  3T5H A;  5ALD A;  3GU3 A;  1U4B A;  2BKE A;  4I2G A;  8ICC A;  3PVX A;  5KFP A;  4RQM A;  1JUD A;  4UB5 A;  2KVS A;  2YN4 A;  3WKC A;  1T3Q A;  1IM4 A;  1XSN A;  1NKE A;  2RRD A;  4TQS A;  4RQ3 A;  4J9N A;  4DO9 A;  4F4X A;  1KFD A;  4GFJ A;  2RLT A;  2HOQ A;  4DLE A;  3PMN A;  1T94 A;  4EEN A;  1UT8 A;  2E8M A;  3I28 A;  2HSZ A;  1Z3E B;  3QU2 A;  4I2J A;  1ZQQ A;  1L8L A;  2Y1I A;  5J0P A;  3QUC A;  3EZ5 A;  3QEB Z;  5AI0 A;  3NUQ A;  3SAH A;  3PW0 A;  4M6W B;  1HUZ A;  2BCV A;  1JRO A;  4P4M A;  9ICV A;  2JMG A;  3BQ0 A;  3RJK A;  2R18 A;  1MQ3 A;  4M6W A;  8ICJ A;  8ICY A;  5AKG A;  3WK9 A;  5EOZ A;  4CF3 A;  4ED8 A;  1N48 A;  1C20 A;  2VIX A;  1ZQO A;  4JWN A;  3ED5 A;  2WHE A;  3BZC A;  3M9N B;  1S10 A;  4QWE A;  3OSN A;  4UB1 A;  2BHN A;  4QW9 A;  4EYI B;  2PI4 A;  1SZP A;  5ALR A;  1OW5 A;  4AYB F;  4K4I A;  4FS1 A;  3JPN A;  5C5J A;  1HIW A;  2WAQ F;  4USA A;  2C2E A;  4DL2 A;  4YR0 A;  3G6X A;  4YXJ A;  2LKY A;  4LVS A;  5HML A;  1TFR A;  3C2L A;  5AKX A;  1KL9 A;  2F3N A;  5BOL A;  4YR3 A;  2EZZ A;  4XUS A;  4ECX A;  2A1J B;  3PO4 A;  4NLN A;  1KLN A;  4M04 A;  2LM4 A;  4P0P A;  2FI1 A;  9ICO A;  1LKY B;  4KLM A;  2P35 A;  3N7S C;  2P6U A;  3ISB A;  4ED6 A;  2H3Q A;  4UB8 U;  2KK0 A;  1XO1 A;  5DLG A;  4O9M A;  7ICT A;  2E1E A;  3KD3 A;  1COK A;  4KX3 A;  5E79 U;  4DS4 A;  1HUO A;  1RZT A;  1SZH A;  4RUC A;  3WKB A;  5G5G A;  4Z6C A;  4C4R A;  1LKY A;  3ICX A;  1SL1 A;  9ICC A;  4FO6 A;  4YFK A;  4EZ6 A;  3QZ8 A;  2G07 A;  4KN7 A;  2BQU A;  3NVZ A;  4DL6 A;  4CF5 A;  4JV0 A;  1N5W A;  4WJ3 B;  4F4Z A;  2AU0 A;  4DFK A;  1JXE A;  5KT4 A;  1FIQ A;  3BQ2 A;  4DQP A;  4JV2 A;  2AH5 A;  5BOM A;  3NAS A;  3BZK A;  5J0S A;  1RYS A;  1S76 D;  9ICS A;  3WK7 A;  1XU4 A;  1TK0 A;  3RH6 A;  4ED1 A;  9ICP A;  5T14 A;  2NRX A;  3KTQ A;  4K4H A;  1A6S A;  4Z6F A;  3HW8 A;  4F92 B;  3SV4 A;  3RB0 A;  2FPK A;  3WK6 A;  1D8B A;  5KL8 B;  5KFB A;  4PHD A;  2HHV A;  3ETR A;  4DOB A;  4KLT A;  2E1F A;  9ICA A;  5KG1 A;  4MFC A;  3GIM A;  1SGG A;  2W43 A;  4QZ9 A;  1RDF A;  3SEN A;  4QZC A;  3C21 A;  3WKD A;  4OJ5 A;  2I6X A;  2EZY A;  1ZQX A;  2EZX A;  2W7O A;  3F5E A;  4FFD A;  4RQ1 A;  4O5C A;  3K75 D;  1NOM A;  3H4B A;  4EEK A;  3MBY A;  2PFP A;  2KV2 A;  5KFF A;  1WUD A;  1UPH A;  3IHQ B;  2K4E A;  4UAW A;  2ZTE A;  5K4L A;  2Y1J A;  4DFM A;  2FLN A;  2H3F A;  3QX7 A;  4F50 A;  3K1R B;  3MFI A;  2NYV A;  2EAP A;  4J9P A;  1FFV A;  5KFG A;  2ALZ A;  1B4F A;  3TAR A;  3MR6 A;  2ES6 A;  5KFA A;  9ICU A;  1Z1V A;  3AL0 B;  3ZDC A;  4JUZ A;  1V9P A;  3AU6 A;  2FJ6 A;  3WK4 A;  1ZQW A;  1SKR A;  3IP4 B;  2W3S A;  3AUO A;  5J0R A;  4RQ5 A;  3JPT A;  9ICK A;  2KG5 A;  2OH2 A;  3E2E A;  2YMQ A;  3OTQ A;  4PPX A;  5DGB A;  3IDW A;  2VA2 A;  2ASL A;  4RNM A;  2C22 A;  1TE2 A;  4FBT A;  2ZJ5 A;  3SZ2 A;  8ICR A;  5KAF U;  1S0O A;  2F76 X;  4PHP A;  3MFH A;  3TAD C;  1NK4 A;  3IG5 A;  1P7D A;  1S77 D;  2D8C A;  3G6Y A;  2OWO A;  5IIL A;  1ZJN A;  4F8R A;  1FEZ A;  3B0X A;  4DFJ A;  4UBB A;  4O3N A;  2ZIU A;  4QIW C;  4BXO B;  3F2C A;  2KEY A;  4KLD A;  4NLG A;  2PMZ C;  1QH9 A;  4NLB A;  2NO5 A;  1S0M A;  1UT5 A;  7ICR A;  2K8B B;  2W9C A;  1NKC A;  2HW3 A;  4UQG A;  4LZD A;  4UB2 A;  4B9N A;  2F1J A;  2GH1 A;  4O3O A;  5KFX A;  4KLH A;  4AP9 A;  2E8P A;  2KHQ A;  2PXI A;  5KFR A;  4EBE A;  4DSF A;  3FDS A;  1ZQA A;  1F44 A;  5KFS A;  2NV3 A;  2QLT A;  5AM5 A;  3UM9 A;  5EWF A;  1ZQF A;  3PW5 A;  5EWG A;  1A0P A;  8ICF A;  2FMQ A;  3RJG A;  3GV8 B;  1SWV A;  5DG8 A;  4IQW A;  2ZIX A;  1OXJ A;  3M6Z A;  9ICT A;  4PGX A;  4UAZ A;  5HHI A;  3RAX A;  2W03 A;  2HHS A;  2VJ5 A;  2XY7 A;  2J6U A;  4C4S A;  4RQN A;  2YTU A;  4QZI A;  2BDU A;  2XCP A;  3UXN A;  8ICQ A;  5H2F U;  1SV0 A;  1TK8 A;  2AQ4 A;  4QZG A;  4U6P A;  4CNQ A;  2C28 A;  4G9B A;  4J9O A;  8ICO A;  3AM9 A;  5AI5 A;  2PI5 A;  5KTQ A;  2AHO B;  3Q8L A;  2VA3 A;  2BCS A;  4UAT A;  5J2C A;  2BQ3 A;  5ALF A;  2KZZ A;  1L3S A;  5CJ7 A;  2K89 A;  1ED1 A;  2KSO B;  3KHG A;  3DEE A;  3T3F A;  4KLO A;  3KHR A;  3RRG A;  3PSF A;  2KSO A;  1N60 A;  4Y2S A;  1ZQI A;  3LYS A;  3M8S A;  1RYR A;  2WB1 C;  2WF5 A;  1QSY A;  4C8O A;  1SV4 A;  1PUZ A;  3QU4 A;  1KBU A;  2YML A;  2KNJ A;  4PL1 A;  4P4O A;  5III A;  1X2I A;  4GXK A;  4J9R A;  4OJ6 A;  2JRZ A;  4DSE A;  4EYH B;  3T5L A;  2WF9 A;  2XGQ A;  4Z6D A;  1ZQG A;  3AEV A;  4R66 A;  2JZB B;  5ALH A;  2Z7J A;  8ICZ A;  5TZV A;  4IC9 A;  5HR7 A;  5KFV A;  1X42 A;  3WU2 U;  2UVU A;  4EZ9 A;  4IRC A;  5J2I A;  2K8C B;  3LVW A;  5ALQ A;  5DB8 A;  4RPX A;  2JZB A;  2EDU A;  2ZXH A;  4Q8F A;  4YQW A;  3KZI U;  4BWJ A;  3QUQ A;  4FBU A;  2DKX A;  4JWM A;  2LMR A;  1ZQZ A;  2XI9 A;  4NLZ A;  1DK2 A;  1F0M A;  4ICA A;  4RQ7 A;  2D3D A;  3NRZ A;  3UMG A;  1N2X A;  2C2R A;  5ALK A;  5J0T A;  2XO7 A;  4I2I A;  5ALW A;  5CA7 A;  5KG6 A;  2RDI A;  3NRW A;  2WF7 A;  2JXJ A;  9ICW A;  2G0A A;  3Q8Q B;  4Q44 A;  2OYY A;  4KLJ A;  4YMN A;  5AKH A;  3PV8 A;  3C28 A;  5J2D A;  4R8U B;  1UA1 A;  1UA0 A;  3RJF A;  3AN1 A;  4MEX A;  5ALO A;  3SAF A;  2ZG6 A;  2HOI A;  1NZP A;  1T3N A;  2BCU A;  2Y9U A;  5IIJ A;  5AI8 A;  4E0D A;  4R8U A;  4UB6 U;  3NVY A;  3NVW A;  1ZYQ A;  4M9H A;  5CP2 A;  4I28 A;  5KNI A;  2KHV A;  3KBB A;  3FAH A;  2QKQ A;  2RQ5 A;  4IQV A;  3T5K A;  5J8Y C;  7ICE A;  1IV8 A;  3OJU A;  3ISD A;  2KIW A;  8ICK A;  4EEL A;  4O3Q A;  2H3Z A;  4C80 A;  3QU5 A;  5DDY A;  1BNP A;  5J2G A;  2YQE A;  3E58 A;  2UVR A;  2YB4 A;  3IN5 A;  1NK5 A;  1YZ6 A;  3DV9 A;  4O5E A;  9ICM A;  3LK9 A;  1QTM A;  4I2E A;  1Z4O A;  2W8K A;  2FLL A;  3GZF A;  1SL0 A;  2N1R A;  5KG5 A;  4BDP A;  3A0B U;  2K4I A;  9ICG A;  2Y0S C;  3C1Y A;  4F91 B;  2W9A A;  5AKK A;  2ISP A;  2WFA A;  2GO7 A;  3NTU A;  1NNL A;  4ACO A;  2ZIW B;  4NL9 C;  2PFO A;  3TI0 A;  3KHH A;  2VA8 A;  1TKD A;  3PW7 A;  4QNL A;  2R8K A;  2H3V A;  1ZQC A;  4IQU A;  5AK3 A;  2E8O A;  2W3R A;  1D8Y A;  4QWA A;  2OHF A;  5IIK A;  1RYU A;  3KKA A;  3MR5 A;  3SD7 A;  4Y2X A;  4TUR A;  2AGQ A;  1RG6 A;  1ZQN A;  2BGW A;  3TQ1 A;  1LV5 A;  1V97 A;  4F72 A;  4DOC A;  4M2Y A;  5J0W A;  1BGX T;  2HHW A;  3AQE A;  1Q46 A;  5DBA A;  2CN1 A;  4C7Y A;  3HPO A;  5ALI A;  9ICN A;  2DGZ A;  5AI9 A;  5AM3 A;  4P0Q B;  5IIO A;  2W04 A;  5ALS A;  2LYH A;  2HBK A;  3N97 B;  1D9F A;  2E8N A;  4GC6 A;  4TUQ A;  1DGS A;  8ICA A;  4EX7 A;  4Q8E A;  2ZTD A;  1NJZ A;  1CEZ A;  5AKJ A;  1BPE A;  1SKS A;  3M6K A;  2E3T A;  5KG2 A;  1ZQB A;  4B9M A;  4P0Q A;  5KG4 A;  4RT3 A;  2XIC A;  5A0L A;  5J2A A;  3H7I A;  2JGA A;  5HMM A;  1KEJ A;  4BX9 C;  2OXO A;  4QIW F;  2KJ5 A;  2PMZ F;  2QB1 A;  7ICJ A;  1U9L A;  3Q8M A;  2V4Q A;  1URJ A;  5KFI A;  3UQ0 A;  3C1Z A;  7ICV A;  3LDA A;  4DF4 A;  9ICQ A;  1D8L A;  1YZ7 A;  2HBM A;  2A1J A;  2KZ3 A;  1PK3 A;  2HCF A;  5KL1 B;  3AMZ A;  5D49 A;  2DKZ A;  5KG0 A;  2CRX A;  4QJF B;  2BCR A;  3GDX A;  4QW8 A;  3TAQ A;  3AQF A;  1U47 A;  3NGD A;  1ZQM A;  2ASD A;  1N63 A;  1ARO P;  3Q8P B;  2R8H A;  8ICX A;  1S97 A;  2G08 A;  3EPI A;  2G5H B;  5DGA A;  2GLE A;  3ISC A;  5D4B A;  4FZL A;  3QYP A;  3PZP A;  1K5O A;  4F5O A;  8ICM A;  4LJX A;  2KKV A;  2NRT A;  1VDV A;  4ZOH C;  4TUP A;  3SV3 A;  2HVI A;  5IIM A;  4J03 A;  1ZJM A;  1SXE A;  5F3X B;  1L7O A;  2G5I B;  1IG6 A;  4MF8 A;  4NY8 A;  5TIS U;  5B66 U;  5KFZ A;  2NRV A;  4R64 A;  4IRK A;  8ICV A;  4KLE A;  1L7N A;  5J2J A;  3OHA A;  2ZUC A;  4YP3 A;  1JIH A;  1L6N A;  2A19 A;  2Y9T A;  5ALG A;  5ALU A;  2F44 A;  4BGD A;  1UCV A;  5CB1 A;  1S8O A;  5J0O A;  4ED2 A;  5AK5 A;  3JPR A;  2YMM A;  4Y2U A;  2KD1 A;  2HHQ A;  5J0Q A;  3GQC A;  1SWW A;  1KTQ A;  1PK1 B;  2QAR B;  4UAU A;  2LBO A;  4UB4 A;  4K4G A;  3H8S A;  3V6H A;  3MDC A;  2DQN B;  3I76 A;  4MF2 A;  1ZXI A;  3F2D A;  4FS2 A;  4ECQ A;  1PZN A;  2WB1 F;  3IV6 A;  5CRX A;  2L5Y A;  3GII A;  3UXP A;  2QAR A;  2ATL A;  1X9M A;  2H5X A;  3PX0 A;  8ICN A;  3JPQ A;  8ICW A;  4M9N A;  5J0X A;  8ICP A;  5EE1 A;  2WF6 A;  3LWL A;  1ZQJ A;  1ZQS A;  5ALN A;  1NJX A;  1V85 A;  2YY6 A;  1B0X A;  8ICG A;  4ECV A;  3D2S A;  1N62 A;  4JK1 A;  5L1J A;  5KT2 A;  4J9L A;  1L8O A;  1KSP A;  4YG2 A;  3DDH A;  2P66 A;  9ICH A;  2LYA A;  1U45 A;  2EH9 A;  4KMU A;  1L7P A;  1PVR A;  3SI8 A;  4ZH4 A;  5ALV A;  4A8E A;  1B22 A;  2AQ0 A;  4DL3 A;  4GLX A;  8ICT A;  5KT3 A;  5KG7 A;  3V6K A;  1NK9 A;  1DGJ A;  3M9O B;  1NJY A;  4CF4 A;  2A1A A;  1XNS A;  5AKE A;  1ZET A;  1FFU A;  4DQI A;  4AYB C;  3IM1 A;  1XC9 A;  1A77 A;  4I2H A;  4F93 B;  4J9K A;  2BCQ A;  5KT7 A;  4RPY A;  2WAQ C;  1N56 A;  3VCB A;  2NRW A;  1K1S A;  3HP6 A;  2H3I A;  4Y2R A;  5L9X A;  2HMX A;  3ZD9 A;  1F5S A;  2KMD A;  5G5H A;  4IR1 A;  3RJI A;  4BXO A;  3KHL A;  3HIL A;  2BZF A;  2DPI A;  4US9 A;  4DF8 A;  3ALR A;  5DDM A;  5J0U A;  2ZIV B;  2W11 A;  2HDO A;  1QLN A;  3R9K A;  2W9B B;  1LVH A;  1UHU A;  1ZQR A;  3UQ2 A;  1M6Y A;  4CCH A;  4HAI A;  1FO4 A;  4YXM A;  2QB0 B;  4QZF A;  2G09 A;  5L1M A;  4PJ0 U;  3MGI A;  2G06 A;  4GXJ A;  1MQ2 A;  3GV5 B;  2XVT A;  2XC9 A;  3V6J A;  2B0C A;  4Y2Y A;  4DQQ A;  3N7R C;  5KFC A;  1T8E A;  4ED3 A;  4DSJ A;  2B6G A;  2W55 A;  4IRD A;  3PY8 A;  2QB0 A;  2UVW A;  1BPD A;  4I27 A;  4QWD A;  1TAU A;  1ECW A;  9ICX A;  1ZQK A;  1NK7 A;  3H8M A;  2F8L A;  4RQ6 A;  3GIJ A;  1X6J A;  3V7L A;  4CDG A;  1MSW D;  1XSP A;  5ALM A;  4BUG A;  1BPB A;  1ZQV A;  3EWA A;  2HHX A;  3B9J A;  4F2S A;  3MR2 A;  2V4R A;  1L3U A;  1S5L U;  5AM2 A;  1D9D A;  3AU2 A;  1CUK A;  7ICM A;  2LM1 A;  1ZQH A;  3VC8 A;  3H0L B;  5ALP A;  1BPY A;  5F9L A;  1RM6 C;  4TUS A;  1J97 A;  4EBD A;  3C5F A;  2F8K A;  5HHH A;  3OHB A;  4O3R A;  2LYB A;  4RT2 A;  3OJS A;  4QZE A;  1O08 A;  5HNK A;  4KLU A;  1X9X A;  3PST A;  2W54 A;  4NLK A;  4DS5 A;  4MFF A;  4YD1 A;  2Y0S F;  2DL0 A;  4YN4 A;  1BVS A;  1RPL A;  1X6I A;  2JEI A;  1ZRM A;  1YT3 A;  1RXV A;  4QZD A;  2IOH A;  1J2M A;  3EYZ A;  5AK6 A;  4DCC A;  3BQT A;  3HRD D;  3KOO A;  4Y2J A;  3BS7 A;  3TAD A;  4M0A A;  2KFZ A;  4LZG A;  4PL2 A;  7ICF A;  5HR6 A;  3G6V A;  2JH1 A;  1PVP A;  2JV3 A;  2ISO A;  1JX4 A;  3TAP A;  2KOB A;  4Y2P A;  7ICP A;  5DLF A;  3OSP A;  1L7M A;  3TAC B;  4B9S A;  8ICI A;  1NK0 A;  2HHT A;  2YMP A;  2HHU A;  4KMO B;  2HI0 A;  3MR3 A;  3ORY A;  3V72 A;  3UMB A;  2NO4 A;  4DQR A;  3QE9 Y;  3L4P A;  7ICU A;  5KG3 A;  1BPZ A;  3M9M B;  2ZTC A;  5GTH U;  2IOF A;  1KFT A;  4KIT B;  3ZI4 A;  3M8R A;  4M9J A;  2KN7 A;  1QSL A;  4FE3 A;  1NKB A;  2A3V A;  2AJQ A;  1DK3 A;  5KT5 A;  9ICB A;  4ECS A;  1Z19 A;  2B21 A;  4NM2 A;  4PHA A;  3C29 A;  1SKW A;  5D46 A;  4UB3 A;  5EE3 A;  4ED0 A;  1DOQ A;  1SIJ A;  5AIA A;  4I2B A;  4F4Y A;  5ALZ A;  4UAY A;  1GO3 F;  4RQ8 A;  3GIL A;  1TVA A;  2XGP A;  2I5H A;  3BS5 B;  5AKZ A;  5B5E U;  4OJP A;  3KFU F;  4XRH A;  4O3P A;  2I9G A;  4YR2 A;  1ZQY A;  3PW4 A;  4DLG A;  3F5A A;  4XA5 A;  4C0Z A;  1QSS A;  4X5V A;  2YB1 A;  5IIN A;  5J2B A;  3RBE A;  2KTQ A;  4IR9 A;  5AKI A;  1IIP A;  4DSL A;  8ICE A;  1B43 A;  1U48 A;  4QZ8 A;  3N4M B;  1Z1B A;  4UAR A;  4RQ0 A;  3RH5 A;  1ZQU A;  1S9F A;  1EXN A;  2F2A B;  3QUT A;  2AXT U;  5J2F A;  1MN8 A;  4ED7 A;  2JH7 A;  3SMV A;  4OJO A;  1CI4 A;  2WF8 A;  4KX5 A;  1NI3 A;  3ZDD A;  4Y2T A;  5KAI U;  8ICL A;  3MGH A;  3C2K A;  4RU9 A;  3C2M A;  3ZDB A;  5JRT A;  4EX6 A;  2FE9 A;  4B9U A;  1Q8K A;  4DSK A;  3N28 A;  4ECY A;  1T4G A;  2V9W A;  3RJJ A;  4B9L A;  5ALY A;  5KFH A;  2KKP A;  1ZD2 P;  4DFD A;  1WWV A;  5AIB A;  4Z6E A;  1Q3U A;  4MEY A;  2DF4 B;  2W9M A;  2C2D A;  1KQQ A;  2KVC A;  1AQ6 A;  4UW9 A;  5KFE A;  3RRH A;  1JN3 A;  2ZIW A;  1H38 A;  4M9L A;  4KLL A;  5AHX A;  2JHD A;  4ECW A;  3HKZ C;  3WKE A;  2XCA A;  3D2N A;  5J0Y A;  2K8A A;  2KE7 A;  3EW9 A;  4B9V A;  4KLF A;  2K4P A;  2ZJ8 A;  5GTI U;  3PNC A;  3ZDE A;  4DSI A;  4PZO A;  2W7P A;  2BR0 A;  3OGU A;  5C0Y A;  1Z00 B;  4BWM A;  4RQ2 A;  3UPQ A;  1KRP A;  3O0F A;  2FDR A;  5EWE A;  3MAB A;  3TAN A;  5KFJ A;  1L3V A;  3Q8S B;  4DFP A;  1Z00 A;  3PSP A;  4UAV A;  5DKW A;  5CEH A;  3T5J A;  4M9G A;  4EEY A;  4Q43 A;  1RXW A;  2ZUB A;  1SL2 A;  1HJP A;  1TAM A;  1COO A;  4PZN A;  3A0H U;  4I2A A;  4UBC A;  5DBC A;  2RDJ A;  4J9M A;  5J29 A;  1C7Y A;  4MHV A;  3MDA A;  2K60 A;  4DEZ A;  4F3O A;  3H0M B;  3BQ7 A;  1KW4 A;  4P0P B;  4FZM A;  4QWB A;  1VJ5 A;  3NVV A;  2EAN A;  1ZQP A;  4F2R A;  4M47 A;  1V38 A;  4NXZ A;  9ICI A;  1XS9 D;  4C8L A;  1VLB A;  4OCZ A;  2Q0Z X;  7ICI A;  4JB3 A;  3HJE A;  7ICG A;  4TQR A;  1X40 A;  4BJQ A;  4F5P A;  4KLG A;  2VAN A;  3UMC A;  3RR7 A;  2HBL A;  4F5Q A;  5J8Y A;  4B9T A;  4NV0 A;  2PKE A;  4GXI A;  1S0N A;  2BPC A;  2DFL A;  3PW2 A;  2LHT A;  4C8M A;  1JMS A;  5ALE A;  4QZA A;  4F4W A;  2JR5 A;  3GIK A;  1L5U A;  4U7C A;  3WKA A;  2UVV A;  1TK5 A;  2CXY A;  2YX8 A;  2J6T A;  3MGV A;  2AGO A;  7ICQ A;  5KFT A;  5BPC A;  4HYK A;  3ETL A;  3E0F A;  3F2B A;  2R8G A;  4C7Z A;  3SAG A;  2BQR A;  2FMS A;  5ALT A;  2OCE A;  4RZR A;  3RB3 A;  5J2K A;  1PVQ A;  2F1H A;  9ICJ A;  4KN4 A;  2WTF A;  4ELT A;  2KFN A;  3RFA A;  8ICH A;  2MUT B;  3RJE A;  2MAX A;  4NL9 A;  4IL6 U;  5J2E A;  3HT3 A;  4DQS A;  1ZQD A;  2ZXI A;  2KP7 A;  5L1I A;  3TFS A;  3THV A;  4I2F A;  3D2Q A;  1JRP A;  4RPZ A;  1RQN A;  2MUT A;  1HEK A;  7ICO A;  4OD0 A;  4PGQ A;  3EUB 2;  5L1L A;  1NK6 A;  3I1Y A;  5AK4 A;  1RQL A;  5KFQ A;  4NLC A;  2D6F C;  3PX4 A;  2KZM A;  1U49 A;  1SV0 C;  2DUY A;  4YMM A;  4J9S A;  3ZD8 A;  1PK1 A;  3RB6 A;  3ZDA A;  4JMU A;  1X9S A;  3CW2 C;  2DPJ A;  3JPS A;  5EE0 A;  5ALL A;  3RH4 A;  1BPX A;  3QU7 A;  2W8L A;  1XO0 A;  2J6S A;  1Y88 A;  2LPE A;  2NRZ A;  5AM1 A;  4DL4 A;  3V7J A;  5DB9 A;  4J9Q A;  4EBC A;  2F1I A;  2PFQ A;  4QWC A;  4O3S A;  7ICN A;  2FLP A;  3RF9 A;  8ICU A;  3ONN A;  4YD2 A;  4O0I A;  3Q8K A;  1TAQ A;  3T79 A;  4DOA A; 
#chains in the Genus database with same CATH homology
 5KNI A;  3K1R B;  1WWU A;  3KKA C;  2EAP A;  2DL0 A;  2QKQ A;  1LKY B;  4RQM A;  2E8N A;  4IS7 A;  5J8Y C;  2Y9T A;  1B4F A;  2KE7 A;  2KMD A;  2ES6 A;  3HIL A;  2F44 A;  1Z1V A;  2K4P A;  1UCV A;  1COK A;  3BS5 B;  5JTI A;  1SXD A;  1OXJ A;  2ESE A;  4PZO A;  2E8M A;  1JI7 A;  1LKY A;  3BS7 A;  3TAD A;  1PK1 B;  2QAR B;  1DXS A;  2QB1 A;  4RQN A;  2YTU A;  2JV3 A;  2QB0 B;  2KG5 A;  4NL9 A;  5L1M A;  1SV0 A;  2DKX A;  2LMR A;  1X66 A;  3IDW A;  1UQV A;  2L5Y A;  1PK3 A;  2QAR A;  2DKZ A;  1F0M A;  3TAC B;  2D3D A;  3TAD C;  2B6G A;  4PZN A;  2QB0 A;  2D8C A;  1V85 A;  3H8M A;  4MHV A;  1B0X A;  3BS5 A;  2K60 A;  4NJ8 A;  4NL9 C;  3BQ7 A;  2KIV A;  1KW4 A;  1SV0 C;  2KSO B;  2GLE A;  5JU5 A;  2EAN A;  1SGG A;  1V38 A;  1PK1 A;  3SEN A;  5JRT A;  2FE9 A;  2E8O A;  1OW5 A;  1X40 A;  3KKA A;  2KSO A;  2EAO A;  1WWV A;  1RG6 A;  5J8Y A;  1SXE A;  5F3X B;  2LPE A;  2EAM A;  1SV4 A;  2F8K A;  2E8P A;  2Y9U A;  3SEI A;  2F3N A;  1X9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...