3TAMA

Crystal structure of hiv-1 reverse transcriptase (k103n mutant) in complex with inhibitor m06
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
557
structure length
553
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse transcriptase/ribonuclease H
publication title Design and synthesis of pyridone inhibitors of non-nucleoside reverse transcriptase.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase/transferase inhibitor
total genus 160
structure length 553
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3tamA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tamA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tamA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tamA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3tamA05
4LSNB 1N5YA 3PZPA 2V9WA 3RBEA 3CFRA 4FLZA 3RMAA 3KLEA 1LWFB 4RNOA 4DTMA 3OYIA 1FKOA 3S3MA 1BL3A 4ZTJA 4LH5A 1S48A 2RDIA 2RPIA 1RDDA 1S10A 2IA6A 2E9TA 1IKYB 2DY4A 4RG8A 3GV7B 4HTUA 4QCLA 3QEXA 3IG1A 5DQHA 4RW8A 1JKHB 3C94A 3NGZA 3PY8A 3VQDA 4LQ3A 2GV9A 4LSNA 3AVKA 3WNFA 4O3SA 4NCBA 3AA2A 1LWFA 1CSJA 1RDRA 4DEZA 5KFTA 3NF6A 3P1GA 5F8HA 1Z26A 2GBZA 3K5NA 5D3GB 3H40A 3C6TB 1RYSA 1RDCA 1IKYA 3RAXA 1VSDA 2IM0A 1HYSB 1JKHA 3V9XA 3VQEA 3KK1B 2YNIB 1KSPA 2BQUA 2R8HA 4AHSA 3MFIA 4TSXA 1UWBB 1QUVA 5KG7A 2GIRA 2HMIB 2IDOA 1SKRA 1TAUA 1FK9B 3M9OB 4EEYA 3QESA 5HRSA 3I8DA 2P5OA 4FVMA 5D3GA 3TAMB 3C6TA 4CGJA 4EP5A 1JL1A 4O3PA 3PX4A 1T8EA 4XO0A 3L3VA 4CHZA 3PW0A 2OPSB 1TV6B 1UWBA 4AHCA 1RBRA 3ICLA 2HMIA 1Q9YA 1TK5A 1FK9A 4K4XA 3VQ6A 1S1TB 1RT5B 4FLYA 3U6FA 4LSLB 1IM4A 3TAMA 4PY5A 4NCGB 3VA0A 3F73A 4NYZA 4HUEA 4EYIB 1S97A 5HROB 3VQ9A 5HRRA 3HVRA 4IH6A 3VQ4A 5FRMA 3OVNA 2OPSA 1ASVA 3LP1B 4IH5A 3ZT1A 1TV6A 3EZ5A 4Y2CA 2FVSA 1S1TA 3QEWA 1RT5A 4CJ3A 4LSLA 4E7KA 4NCGA 4AHTA 5KG1A 4KHUA 1S6QB 2OYQA 2Q3SA 4FYDA 5HROA 4DL6A 1Z25A 3LP0A 1RT6B 3KHRA 4CJKA 4FS1A 4HUFA 1JIHA 3V4IB 4TQSA 5L1KA 1D5AA 4I2QB 5HP1B 4HHTA 3CJ3A 3LP1A 4E7IA 3RB0A 1K1QA 3DYAB 4F2SA 1CLQA 2JEFA 3JSMB 2D0AA 5KG3A 2WB4A 4M3RA 3DLRA 2D3UA 2FLPA 3CWJA 4FBUA 1S6QA 4O44B 4CGFA 2AJQA 5KFRA 1RT6A 2UVRA 4DL4A 3O3FA 3CDEA 3V4IA 3QYYA 4DSKA 5C24B 4DFKA 3RB6A 3IAYA 4N76A 4I2QA 5KT7A 5HP1A 1Z4UA 2IC3B 3DI6B 4FJ8A 1RA6A 1BI4B 3DYAA 3KLFB 3JSMA 2DTUA 3HKWA 2ILZA 4Z4EA 4RNMA 4O44A 1GX6A 5J2MB 4EYHB 3FQKA 1SKSA 2V0NA 2RF2B 4GMJB 2RN2A 4ZPBA 4CJPA 5KT5A 5DG7A 3LDSA 5C24A 2ASJA 3OYCA 3KTQA 4NLDA 5DK5A 3M8PB 5C42B 4O4GA 4DQRA 2IC3A 3DI6A 4IDKB 3CJ4A 3HHKA 3VQAA 3ZSQA 1JXLA 1BI4A 2GIQA 3KLFA 3OL6A 3HO1A 3WNGA 3HSTB 4ZPAA 5CYQB 5DG9A 3NAEA 3SJJA 3V9UA 1TKTB 5HBMB 3RR7A 3LANA 1W0HA 4DS5A 1L3UA 3DLBA 4J9RA 3CM5A 2DFEA 5J2MA 4F8RA 2RF2A 4M45A 1U48A 4ZVHA 3H4DA 1FXXA 4URQU 3QLHB 3V6JA 3M8PA 5C42A 2W9CA 5J1EB 2HVHA 4IDKA 4FJHA 1TP7A 2WCXA 4ED7A 4QPXA 4CJRA 2R2RA 3CO9A 4DU4A 4DTXA 1RA7A 2FJXA 5CYQA 3VQQA 2B6AB 4ZP7A 3PX6A 1RT2B 2R2UA 1S9EB 4DQIA 4RW7B 1SL1A 3BSCA 5L9XA 2F8EX 3TAPA 3RMCA 3QLHA 1HPZB 3CFOA 1KHVA 4YR0A 3TANA 1REVB 1BGXT 3ZCMA 2O4IA 2YKNB 3V9SA 4E7LA 3RMBA 2OPQB 4DL3A 3AVFA 3WNEA 2KFNA 2B6AA 1SL0A 3ZT3A 3VQ5A 3OLAA 4J9NA 4O3NA 1NK4A 1S9EA 1YTUA 4CJTA 4CEZA 4RW7A 3QIDA 3THVA 1VSFA 2HHWA 5JUMA 3D5MA 3GV8B 2WONB 3MFHA 3FRZA 1C6VA 4ECSA 1HPZA 4CJLA 2XGPA 1REVA 1MMLA 4YR2A 3RBDA 3BJYA 2OPQA 4ED0A 4KHRA 1U04A 2HWHA 4Q8EA 4B9SA 3B6PA 3PVXA 4MIAA 4WE1B 3BSNA 1HYZA 4OKEA 3NKYA 3K59A 4FLVA 2JC1A 2KTQA 1S1WB 1HQUB 2WONA 3UPFA 1NHVA 4ZP8A 4WFZA 3PJXA 5C25B 3OYBA 3RRHA 1NOYA 1RBVA 1X9MA 4IOBA 1B92A 3I0RB 1T03B 1NJXA 1S1VB 4QWBA 4WE1A 1BCOA 2G8FA 4M3UA 2ITGA 3TR8A 4DSEA 4RW4A 1J53A 1R0AB 1NKCA 4Y1CA 2XO7A 4E19A 1S1WA 3AO2A 3ISNC 5J2PB 1RT4B 4B9NA 3HVWA 3NF8A 5C25A 4TYAA 4FBTA 4CF9A 2W42A 3KHHA 1HYVA 4DTJA 4OPJA 1T03A 1HJRA 4RUAA 4IG3B 1S1VA 3NFAA 3PX0A 4PUOB 2VA2A 3ISND 4CEOA 2UUTA 3E51A 1WN7A 1VSHA 2KW4A 3GIMA 1VRTB 1R0AA 4H8KA 3SQ2A 3SV4A 4OVLA 5J2PA 1RT4A 4J9OA 3FQLA 2HNYB 2HHVA 2HNDB 3TAQA 4B9TA 3DOLB 2CKWA 4QWEA 4Q43A 2Z1HA 4FJ9A 3PV8A 4YFUA 1TL3B 1TL1A 5KT3A 4E89A 4NLGA 1LAWA 2AGOA 1VRTA 4DSJA 1XR6A 1NOZA 5L1JA 1I6JA 1WAFA 1ZYQA 1X9SA 3BQ2A 3CJ5A 2HNYA 4IRDA 2HNDA 3DOLA 4CIEA 4E3SA 3KLVA 5KFLA 5CY4A 5KT6A 4ED2A 3V1RA 4NCAA 1S9GB 1TL3A 2Y1IA 1W9HA 1HNVA 2QKBA 4KPYA 4DL7A 1X9WA 1CXQA 4ECZA 4NLYA 1I39A 1JX4A 5EWGA 3HP6A 3ALYA 5KRTA 4YMEA 2FLLA 3SFUA 1S9GA 1XWLA 2XWYA 4CE9A 2YKMB 4CF0A 3OYDA 4F50A 3ZSRA 2G8IA 3V6HA 4WXWA 4JV2A 3M8SA 3I5CA 2AX0A 4EO6A 5KFYA 3ZSYA 2BRLA 1J5OA 4B9UA 1S5JA 4OGCA 3QERA 1EP4A 3GQCA 2UVVA 4CERA 5T14A 3L3UA 2EC0A 4ZVEA 4E7HA 1EXQA 4DU3A 4BWJA 4KB0A 4DFMA 2VG7B 1KTQA 4KHQA 4Q0BB 4NRTA 4EZ6A 3VQSA 2F8TA 4H4MA 4CK1A 2G8HA 3IG1B 4HKQA 3PW5A 3MF5A 3G86A 2BR0A 4F3OA 3SZ2A 4DL5A 1N56A 3TWHA 3TVKA 2B43A 4Y1DA 4CHNA 3HT3A 4DQSA 2E6MA 4KTWA 4DSFA 2YNHA 4CEBA 2F96A 3V9ZA 3GIKA 2VG7A 4KFBB 2GUIA 3O4QA 3H5UA 4Q0BA 3GV5B 3PO4A 4Z4FA 4E1NA 2D0BA 4M3WA 1U47A 4F4ZA 1O1WA 3O3HA 3T5JA 3VQCA 4N5SA 4KI4A 3I0SB 3PW4A 4WYWA 4DFJA 3V1OA 3OYJA 4O4RA 1U4BA 1JLBB 3KLGB 1S4FA 5F9LA 4RNNA 5KFIA 4LY7A 4JRQA 4NZ0A 3CDWA 1IO2A 5SWMA 1XHZA 3MR2A 4FJ7A 5F8IA 3Q8SB 4KFBA 1L3TA 3K58A 3WNHA 3SPZA 4YNQA 3AV9A 4KSEB 3NF9A 1WSFA 2YNFB 4MKAA 4JLHA 4K8ZA 3SQ1A 2BANA 2AU0A 3NHGA 3I0SA 3CJ0A 1QQCA 3VQPA 1ZBFA 1TK8A 4WZMA 3AVLA 2XGQA 5DQGA 1JLBA 3KLGA 3M9NB 1ZBIA 3QEPA 3NDKA 2IJNA 2E6LA 1BQMB 3QEVA 2Z1JA 4Z0UA 3V6KA 5SZTA 2XC9A 4E0DA 4QWCA 2YNFA 3OS2A 3OYNA 4RZRA 2NUBA 2ZD1B 2HHTA 3OSNA 3QETA 1SKWA 3U3GA 4KE5A 4DTRA 3QNOA 1XC9A 4FM0A 1BQMA 4W5QA 2ZE2A 3MTKA 4DLGA 5KFGA 4LH4A 4IQXA 2LSNA 5KFOA 3D28A 4ECWA 3HJFA 4DSLA 4YQWA 3MR5A 4IFVB 3DDKA 3L2WA 3LP0B 4ELVA 2JGUA 5KFWA 4QW9A 2ZD1A 2XHBA 3H5YA 5F8NA 4I2PB 2R8JA 4HUGA 2ZQBA 1NK6A 5DGAA 3ITHA 2P5GA 1A5XA 3H08A 2IGIA 1IKVA 1DTTB 3LALA 1RTIB 1WSHA 1VK0A 3AVGA 4NYNA 3CYMA 4HCCA 1SH3A 1LW2B 2D3ZA 1JXBA 2W7PA 4IFVA 3OJUA 4KTQA 2UVUA 4KHMA 4I2PA 1C0TB 2DPJA 3NMAA 3CFPA 2UVWA 4ZPCA 2VG6B 4L8RB 1KVCA 1DTTA 3FDSA 1RTIA 4B9LA 3G10A 3RAQA 5EWFA 1A5VA 1BCMA 1LW2A 5KFNA 2WTFA 3TI0A 3T1AA 2VWKA 4LD0A 1B9FA 3NAIA 4OL8A 3Q8QB 1JXEA 2FLNA 3LP3A 1C0TA 3H59A 4O4GB 3BDPA 1QS4A 3OL7A 2QK9A 4J9QA 4G1QB 2JLEA 4NRUA 5I42A 1U49A 2VG6A 4F4KA 4PQUB 4QW8A 3KNAA 3LWLA 4YR3A 4IFYB 4FS2A 1NK9A 4M41A 4MQ3A 3CQ8A 1QSLA 4FZXC 5KFBA 4NLWA 4ELTA 4J2EA 2D0CA 3DRRB 4FW1A 3NH1A 1C0UB 3AO1A 1S9FA 4FLUA 3S9HA 2PYLA 4ECQA 3ZSXA 4BE2A 4H54A 3CIZA 1JLCB 3LAMA 2FBXA 4MK8A 1GOCA 2FVQA 4KTZA 2W9CB 3HVAA 4CIGA 1CXUA 4XPEA 4G1QA 1C2PA 5L1IA 1B9DA 2AWZA 4U6PA 4PQUA 4IFYA 1YT3A 3K5OA 4AHUA 4WFXA 1DTQB 3KKRA 3DRRA 2IM3A 1C0UA 2R2TA 5KI6A 5KFZA 3ZT2A 3SV3A 3T5KA 2I1RA 4OKKA 1JLCA 5CZ1A 5DLFA 3B6OA 3V1QA 5KGXA 3U3YA 3A2FA 1D9FA 4X2BA 3UQSA 4ED6A 4J9PA 1ZETA 3O3GA 3HPGA 4ZVGA 1DTQA 3G6VA 2VA3A 3AO4A 4F3TA 1RTHB 3MECB 5K14B 3AVHA 1XI1A 4H4OB 1RT7B 4ECYA 1NKEA 1UAXA 4KRFA 1RNHA 3K2PA 2X6NA 1JLFB 1BHLA 4F4YA 3MEDB 1ZTTA 4ED1A 2Y1JA 3DM2B 3K57A 1RTHA 3MECA 5K14A 4Z4GA 1C1CA 3IGVA 4H4OA 1RT7A 5JXSA 4J9SA 4HCBA 4CCHA 2HW3A 4TQRA 4Q5VA 1TGOA 2CJQA 1JLFA 4FJMA 4FJXA 4ZP9A 5KFKA 2JEIA 1ASWA 4KAZA 5C5JA 3MEDA 3LWMA 2R8GA 3JYTB 4NLUA 2XY5A 4RW4B 3DM2A 3ZSWA 3TARA 4DTSA 3OL8A 4IRCA 5F8JA 5HLFB 2HVIA 2ILYA 2JC0A 4CHQA 4WZQA 4DS4A 3RB3A 2Z1GA 4R5PB 4HVJA 2PY5A 4YP3A 4I9LA 4J9LA 3EY1A 3GIIA 3QGIA 1IH7A 4ZHRB 1TKXB 3O4NA 1RTDB 2P51A 5FRNA 3DRPB 1KLNA 3JYTA 2QE5A 5KG2A 4F4XA 3G6YA 4Y34A 4EO8A 3V6DB 5HLFA 2ZKUA 3H2LA 5FROA 3E01B 3BREA 4FK4A 3OHBA 4KB1A 3L8BA 2XY8A 4R5PA 4NLSA 1KFSA 3HPHA 3C95A 3IGNA 4KB7A 3RTVA 4ZHRA 1HMVA 1TKXA 2YV0X 4RNFA 1RTDA 2EX3A 4EBDA 4TXSA 1TKZB 3SYZA 4CHPA 3DLHA 3DRPA 4EBEA 4CGGA 3UDLA 1TL1B 1NK0A 3KJVB 3RR8A 2IMWP 3OSPA 3HM9A 3V6DA 3T19A 3OL9A 3E01A 4N41A 2X78A 3DLGB 1SV5A 4Y3CA 3DOKA 1BQNB 4I7FB 4MK7A 3NH2A 4DQQA 4EBCA 4BWMA 3H4BA 3OYAA 2FVPA 1TKZA 2BRKA 1SUQB 4FK0A 3V9WA 4FJLA 4DG1B 2B5JB 1XR5A 1HRHA 1NK8A 3KJVA 4HYKA 3SUOA 3AO5A 5KFQA 2YHAA 3L2QA 1HNVB 4FW2A 4RW9B 4UQGA 1GOBA 1NNDA 4TY8B 4GW6A 2OPPB 3DLGA 4IRKA 3BQ0A 3P5JA 3KHLA 4OLBA 2XCAA 4F4WA 1K1SA 1BQNA 4I7FA 3NGYA 4E1MA 4B08A 3KK2B 4J2BA 4NLRA 2BDPA 4DTUA 3I5AA 4KHNA 3H98A 1SUQA 1QE1B 3HVTA 5FDLA 4KREA 3BR9A 2OZMA 4CEEA 4DG1A 3PR4A 4W5TA 2B5JA 4CEDA 2G8VA 3SFGA 4RW9A 3NCIA 5KFFA 2G8KA 5F8LA 2FBVA 3S3OA 4TY8A 2OPPA 4CEQA 3QZ7A 4TN2A 3AVAA 4IBNA 4JS5A 4FJGA 2IBKA 3KK2A 3PW7A 3TAGA 4O5BA 1K6YA 4OGEA 1J5OB 3VQ7A 1QE1A 1SL2A 1EP4B 3OS0A 1NHUA 1KHWA 2A1RA 4TLRA 2W8KA 4E7JA 4CJ4A 3DMJB 5J2NB 3EPIA 5KG5A 1Q9XA 4O0IA 3OJSA 5HRPA 4QWDA 4NLTA 2R8KA 1EKEA 1WNSA 3AA4A 5KGWA 4ZTFA 1C1AA 4H4MB 1KRPA 1C0MA 5L1LA 1QSYA 1WSIA 3S3NA 3HL8A 2HB5A 1CZBA 4GVMA 4ECUA 4CJUA 4JS4A 3HPOA 4WXOA 4C8MA 3LZIA 3NAHA 2YNHB 3DMJA 4RW6B 5J2NA 3MEGA 2G8UA 3V81A 4ZMMA 1ZBUA 4ZPDA 2WRMA 1WSJA 3SUPA 3LP2B 1XR7A 1VSIA 4KHYA 4JV1A 3ZT4A 4FXDA 4MFBB 3RB4A 4ID5B 3KK3B 2FJWA 2V4RA 1RCHA 3M8RA 4CJ5A 1UA0A 4ECXA 4M3YA 4NYFA 1VRUA 3T5HA 3KKSA 1IKXB 3GIJA 4RW6A 2C2RA 2ALZA 5KFSA 4AILC 4FZYA 3NF7A 5KT4A 2B4JA 3NGIA 4GC6A 3D0PA 1IG9A 3LP2A 2AGQA 1LW0B 2BANB 4B9VA 4MFBA 4ID5A 3KK3A 4CECA 1Y97A 3IS9B 2C22A 4DU1A 4DF8A 1IKXA 4DTNA 5DMRA 1QAJA 3QGHA 4DTPA 4CJWA 1KVBA 1RDAA 3QINA 5KT2A 5EU7A 5EDWA 1ZBHA 4ZVFA 4DWIA 3PW2A 4URSA 3SI6A 2C2EA 2KQ2A 2OH2A 4N47A 3FFIB 1LW0A 1A5WA 3IN5A 3AVBA 3HP9A 2ETJA 2BQRA 1C1BB 3IS9A 3KD5E 4Z4HA 4I9QA 4K8XA 2XCPA 1GX5A 4B8AB 3T5LA 3NBPB 1SH0A 5KFAA 4CFCA 4M42A 2ZE2B 1S1XB 2FC0A 4KHSA 2QXFA 2R7YA 4G3IA 3OYGA 1RTJB 4CF8A 3BSAA 4J2DA 3FFIA 4DL2A 3ZSVA 2AGPA 4QOZB 1C1BA 4AH9A 5KG6A 2D5RA 3LZJA 1F21A 5KFPA 1TQLA 1LWCB 3ITHB 2AQ4A 3NBPA 2OPRB 4URGA 4C8KA 4JUZA 3QGGA 1S1XA 1IKVB 5EUHA 2BQ3A 4RNHA 3QZ8A 4OKJA 5KRSA 1J54A 1HYSA 3G0ZA 1RTJA 3KK1A 2YNIA 2D7SA 4FZZA 3SQ0A 4BDYA 3OYLA 4RUCA 3QNNA 4IH7A 3AVNA 4ELUA 1LWCA 1FKPB 2OPRA 2VG5B 4Q45A 3MAQA 5KFUA 1QAIA 3K5LA 4Y2AA 1L5UA 2FBTA 4J2AA 2HHQA 3VQBA 1RT3B 1I3AA 4DTOA 3ZSOA 3C6UB 2E9RX 4FM1A 5KFMA 3SCXA 4PWDB 3TQ1A 3IRXB 4XIUA 5KFDA 2DFFA 1FKPA 2VG5A 1N6QB 5I42B 4IR1A 4R0EA 3ZT0A 1NKBA 3MXMA 4U7CA 3PR5B 4CFDA 2IJFA 3GILA 2YNGB 1L3SA 1MU2B 4W5RA 5KG0A 2C28A 3DLEB 2RDJA 1ITGA 2WHOA 4F2RA 1RT3A 4K4VA 1U45A 3CJ2A 3CG7A 3MR3A 3HXMA 1RT1B 1KVAA 3C6UA 5KFJA 4LQ9A 2J6TA 4PWDA 1TVRB 3MXJA 4CIFA 3IRXA 4J9MA 2X74A 1BIUA 2FBYA 3G6XA 1N6QA 4J9KA 1D1UA 1VSMA 4KO0B 3EYZA 2PYJA 2YNGA 1MU2A 4CK2A 3Q8RB 3DLEA 4FLXA 3UR0A 1G15A 1ASUA 5F9NA 1NJZA 3OYKA 4IG0B 4MKBA 3KHGA 4NLVA 3OYMA 3KMSA 4GC7A 4EZ9A 1RT1A 4ED3A 3SUQA 2JEJA 1TVRA 5KFVA 4KBIA 4CJEA 4PA1A 2F8SA 4KO0A 1KLMB 2XY7A 4CF2A 2JEGA 4XPCA 1TKDA 2AX1A 2C2DA 1VSLA 3OYFA 4K4UA 3VN5A 3K5MA 4FJKA 4CJFA 4IG0A 3OHAA 4K4YA 4FLTA 2W9AA 4NLOA 4TY9A 1GOAA 1HNIB 2ATQA 1U09A 5CZ2A 4KHWA 4C8LA 4MH8A 4CK3A 4CHOA 4C8NA 1JLEB 1VSEA 3KLHB 1NJWA 3TAEA 2FVCA 1KLMA 3N6NA 2EHGA 4KI6A 1RDBA 4NLXA 3D45A 3HK2A 4CEAA 1RBSA 4IKFA 4Q8FA 1EX4A 3FSIA 2O4GA 3SPYA 1HNIA 3KMQA 1C1CB 1W25A 4ECVA 4QAGA 5KFCA 3NGDA 4DSIA 2HHUA 3EZUA 1TKTA 4O3QA 1JLEA 2QKKA 3KLHA 1VSJA 5HBMA 4BE0A 1YVFA 1NJYA 3QIOA 3TABA 5I3UB 4M3XA 3ZSZA 4Z4CA 2IS3A 1RAJA 4ZP6A 1UA1A 5J1EA 3KIOA 3BSOA 3CM6A 1TK0A 3LPTA 1S0OA 4KKOB 4K4ZA 2XY6A 3M9MB 5JS1A 1RT2A 4FK2A 4O0JA 2KZMA 4K4TA 3OS1A 5I3UA 5KFXA 3KLIB 1S0MA 3VA3A 1JLGB 4EP4A 2RKIB 5CYMB 2FJVA 3DRSB 3ULDA 5DQIA 3H5SA 2YKNA 3M8QB 2ASDA 4KKOA 2W8LA 3MR6A 1NK7A 3QIPB 1BISA 4DFPA 1WNEA 5HRNA 1QHTA 2WK4A 2DPIA 4CFAA 1HMVB 4DF4A 3MEEB 1X1PA 3AA5X 1WAJA 3AVJA 1QTMA 2D41A 5JS2A 3AVIA 4OJRA 4OPKA 1LWEB 3KLIA 2YHBA 4BE1A 1RYRA 4FJNA 1JLGA 3LPUA 2RKIA 5CYMA 3DRSA 3RRGA 3P83D 2Z1IA 3M8QA 3OYEA 1RBTA 1RILA 4M95A 1S1UB 1SV5B 3QIPA 4CJQA 2HHSA 4M3ZA 3DOKB 4IR9A 4AHRA 4B9MA 3EPGA 3ASMA 2J6SA 1BIZA 4KV8B 3F9KA 3NH0A 3H5XA 4FJ5A 2IOCA 4R8UB 3MEEA 4WFYA 3PHEA 1N48A 3AA3A 4ECTA 3L2RA 1HQUA 4CGIA 1LWEA 2I5JB 4IKAA 4FJIA 1KCFA 4CGDA 3SI8A 3KD1E 4CJVA 2WOMB 2E9ZA 1SH2A 5EWEA 3KOAA 3NE6A 2OA8A 2QV6A 4B8CA 1S1UA 1XHXA 3I0RA 3RWUA 1T3NA 4FJJA 1T94A 3LAKA 4KAIA 4ICLB 2X6SA 1NK5A 4CESA 1LAVA 4KV8A 3Q8PB 4R8UA 1JLAB 1S49A 3T3FA 3L2UA 1D8YA 4M94A 2XI2A 3PJWA 3HVTB 4W5NA 5FDLB 1WLJA 5KFHA 2I5JA 3CVKA 4CJSA 1VSKA 3OYHA 3HYFA 2ASLA 4AHVA 5DGBA 4DMNA 2WOMA 1T7PA 3SUNA 1J9AA 4FM2A 3UIQA 5T7BA 1S6PB 4CF1A 4MK9A 4DQPA 4JRPA 4ICLA 4IG3A 4PUOA 4TYBA 4Z4IA 1YTAA 4BDZA 4Q44A 2GC8A 1JLAA 2J6UA 5KFEA 5E41A 2DFHA 1T05B 3PO5A 4BDPA 2O5DA 1HQEB 2VWJA 4FLWA 2BE2B 4B3OB 4CGHA 2IM1A 1RBUA 3BGRB 5F8MA 3SNNA 4ED8A 5J2QB 2ATLA 3AO3A 4C8OA 3DLKB 4ID1A 4M3TA 1S6PA 3PUFA 2KZZA 4N56A 4QWAA 4FCYA 2W7OA 2KFZA 3GYNA 4BACA 3SQ4A 1IKWB 4ECRA 4DLEA 3VQ8A 1ZBLA 1T05A 2IM2A 1WSEA 2R2SA 1OS5A 1D0EA 1YVUA 1EETB 3CDUA 1HQEA 2BE2A 4B3OA 4K4WA 3BGRA 4WYLA 1DLOB 1JLQB 3QO9B 3AVMA 5J2QA 3QEIA 4O3OA 2W9BB 3MEGB 4CHYA 3MXIA 2P1JA 3DLKA 3V81B 4NLQA 2HHXA 2HNZB 3N6LA 2E4LA 2A1SA 2XI3A 2R8IA 4K50A 1UOCA 4MIBA 3N6MA 1IKWA 1JL2A 1LV5A 4CEFA 4O3RA 1VRUB 1EETA 2HWIA 2BGGA 2IAJB 1ZTWA 5DLGA 4NLPA 4OLAA 1DLOA 1JLQA 3QO9A 2XRIA 1Q8IA 3I5BA 2W9BA 4CFBA 4O55A 3L2VA 1QSSA 4JV0A 3AVCA 3OLBA 2HNZA 3TAFA 3RMDA 2FVRA 5KTQA 2V4QA 1WSGA 2YKMA 3BQ1A 5F8GA 2G8WA 1N5YB 1N4LA 1L3VA 4W5OA 3KLEB 1TAQA 5KG4A 1D9DA 2IAJA 1CZ9A 1FKOB 3NL0A 4K4SA 1S0NA 2OZSA 2PZSA 4RW8B 3OY9A 2HAIA 5DG8A 4RU9A 1HARA 1KFDA 2UUWA
chains in the Genus database with same CATH superfamily
2XZTB 3RBEA 1Y5NB 4PKDB 3FKBA 3O5BA 3GIRA 4ZN1A 4AF1A 3CD6S 4RNOA 1T3OA 2P2CB 4LH5A 4NZ6A 1S48A 2RDIA 4CH7A 2DO4A 2YH1A 3FSYA 2YXLA 4DV1J 1XNRJ 3QEXA 2P5VA 5DQHA 4A8FA 5ADZA 4LQ3A 2QO3A 4JI3F 4LSNA 3RZAA 4M1KA 1BWFO 1UJ6A 4NI2B 2G0JA 1LWFA 3BPSP 1XN9A 4DEZA 2QL9B 1LXNA 1A7GE 1WORA 4C11B 1UL3A 3BM7A 2HS4A 1IKYA 1VSDA 1HYSB 2E44A 4FWPA 3V9XA 3O08A 2DGWA 4FWKA 2R8HA 4AHSA 5JICA 4X4OA 2GIRA 2HMIB 3T1HF 4A2BA 4MMOA 4DUYJ 4EEYA 3PACA 3QRPA 3L7UA 1L3KA 2ZHAA 4PCQA 5D3GA 3TAMB 2OMLA 3C6TA 4QS8A 3G71N 4LF4K 1HNWK 4CGJA 4EP5A 5IWAK 2DRDA 2MLYA 4O3PA 2P9EA 2E88A 2LXFA 1HKGA 2QWPA 3L3VA 2OPSB 1IUJA 1RK8A 2HQFA 3ICLA 1BHNA 1Q9YA 2YCHA 1FK9A 1S22A 3VWSA 4HHJA 1RT5B 3W9JA 3GB0A 2KM8B 2Y0SD 5DJBA 4NCGB 3UKRB 3VQ9A 1ILYA 2RUGA 3P4IA 5HQ8A 2E1CA 2VHGA 3L0QA 4DZDA 5A76A 2V7YA 4Y2CA 1B3TA 3S6EA 2FVSA 5AXMA 4DCPB 5E0OA 1H0HB 2UV8A 2QW9A 3V4MA 4IQMA 4ZVQB 4FYDA 2Q3SA 1HBNB 3UFCX 1Z25A 3K0JA 3LP0A 1RT6B 4HUFA 4X66F 3L4BC 5L1KA 5MLCQ 1D5AA 1IJEB 5ITHA 4I2QB 3LP1A 5B08A 1K1QA 3DYAB 2XZDB 2N4DA 2JEFA 2W41A 4LSZB 3R8YA 3ZLJA 3DLRA 2D3UA 4NYOA 1VQ5S 1S6QA 1UFKA 1XNQJ 4LUBA 1KAZA 2UVRA 3M2RA 2AP1A 4DSKA 2AA4A 5KT7A 2ZH1A 1IBLF 2FSNA 1Z4UA 1WELA 4QR2A 1LOTB 1ZM9A 1IXKA 5FLXU 4AQYF 2HQ3A 1MW7A 4PWUA 3HKWA 3VGKA 1Y10A 3N9UC 2BH1A 5J2MB 3SEOA 2JJ4D 2KHOA 3EDQB 2ZHOA 2VQFJ 1F0XA 5KT5A 4NLDA 5DK5A 1FRKA 2KXFA 3JQKA 2A40A 1BI4A 1GMUA 1RCOB 2M4MA 1OPZA 3OL6A 1N0UA 2H65B 3HSTB 3WNGA 3NAEA 2KYXA 5KQ8A 4OX9J 5B0EA 3CNQP 5JLFA 5ADXA 1W0HA 1NGGA 1L3UA 1C4AA 3DLBA 1B0VA 2D0OA 4ZVHA 2G2ZA 4PKIA 3UVJA 2W9CA 5J1EB 1TP7A 8AT1B 2ITMA 2XQCA 4RWXA 2R2UA 3O9RA 1VBYA 2I9SA 1CQNA 4ZJQA 4ZCKA 3CFOA 1BGXT 2YKNB 1JCFA 3QWUA 3V9SA 3RMBA 2R7RA 3M32B 3WNEA 3IAS9 1F60B 5LMNK 3HI0A 1S9EA 1YTUA 4CJTA 4RW7A 4DV0F 3CJSA 3BGOP 3CPWM 2WONB 1EQYA 4WQ4A 5F1XA 3H1VX 4PG8A 2BW2A 1REVA 1R8HA 1R8CA 3RBDA 1GAOA 4I56A 2HVDA 2ZH9A 4TVAB 1TL4A 1NBWA 1KD1T 5HQMA 2M0GB 4OKEA 4LF5J 1T9VA 2FZKB 4IJNA 2BV3A 4QIFA 1BUPA 3LPEA 2HHHF 2KTQA 1FF2A 1WHWA 4M7XA 3FMWA 1MG7A 2NUHA 4ZP8A 5C25B 2XMMA 2VASA 4PG7A 3J81j 4OHVA 3RW7A 1RBVA 3P38A 2WAQD 4IOBA 1B92A 2QMWA 3MHYA 5GINA 1S1VB 2W4PA 5BRFA 4WE1A 2EKYA 4LC9B 4X62K 1QVFM 2W6KA 4FNIA 3CDBA 1S1WA 3WT0A 2MQLA 4YDUC 4I6MA 3KWMA 4NMXA 5J2PB 3QDKA 2FSJA 3LUYA 4OLPA 2W42A 3G8SA 4RX6A 4DTJA 2ATCB 3UDVA 3RUBL 1T03A 1D4XA 4FL9A 3BYRA 4IG3B 2XLKA 1WOOA 2VA2A 1WI6A 2UUTA 2EK1A 1VRTB 4H8KA 4I6AA 3UD4P 3OVSA 1JB0C 3QBXA 4ZKAA 2FPHX 2GELA 1SI9A 2HNYB 2CH5A 1F5CA 2ZNYA 3SCJE 4I68A 3TAQA 4B9TA 3DOLB 4IDHA 2YJEA 3H6EA 1NGCA 5I3PA 4FJ9A 1MWQA 4C8YA 4YFUA 5KT3A 4DX8H 3WUHA 1Q4RA 3ZETB 4O8KA 1XR6A 3CJQA 1KDNA 4OYXA 1X3NA 4CQ1A 5CHCB 1IQZA 5L1JA 3SMPA 4JI8J 2ZZNA 3T9ZA 1ZYQA 1X9SA 3VHQA 3CJ5A 3D2FA 4C3LA 1FE4A 3HHNB 2UXCJ 5L8RC 2UZAA 3VAJA 3KLVA 5KFLA 2XM3A 2E5IA 3IMXA 1S9GB 2E20A 1TL3A 5I9EB 3UD3P 2ADBA 1DGKN 4DV7J 3BO2A 3CO0P 2OGUA 1X9WA 4QQBA 1HFEL 4P73A 2MQOA 1KVIA 1JX4A 2X1AA 3ALYA 3W5YA 4M7YA 3IBWA 2V94A 4S0MA 2WBNA 5ETLA 4BRHA 4F50A 3ZSRA 2G8IA 1TMJA 2A1BA 2ASYA 2Q1LA 1ZZNA 3W5ZA 3KKFA 4LJMA 2AYEA 4Y2IA 1K9MT 1WC0A 4DR7J 3TU5A 1Q7LB 2WC9A 3K8VA 4B9UA 3U1NA 4OGCA 5HSPA 1FRJA 3QERA 4DR1K 3GQCA 1QJHA 5KPTA 2LP4A 3M8ZA 3I4PA 5T14A 4LF7F 4DU3A 3EGVA 3W60A 4KB0A 3ILOA 1IWGA 2ZOFA 3ENWA 1YRXA 4NRTA 7FD1A 1VQLN 4LF8J 3THXB 1NJIT 4P2XA 3MF5A 4G65A 1X60A 3SZ2A 3GFYA 1SC1B 2V4JA 1EX8A 4XK8C 2XNQA 2O8DA 3ZZRA 4H4KA 1R0BG 2R7WA 2YHWA 2XSJB 3EKUA 2YNHA 1RHUB 2GQQA 2KKHA 4CEBA 2YWEA 4HACB 4KFBB 3U9ZA 4DCOB 4Q0BA 4P9SA 3UR3C 3GV5B 3PO4A 2D0BA 2ZH6A 3O3HA 1SJ3P 1SJ1A 2GO9A 3THYA 1CULB 3OYJA 4O4RA 1U4BA 2KXNB 5F9LA 5KFIA 3H0PA 4I1TA 3CDWA 2GUPA 4CLYA 3AA9A 2EPIA 1MMNA 2DNMA 3Q8SB 2ZH4A 3MOJB 5HQLA 1L3TA 4DCHA 6FD1A 2H48B 3OTOF 3DXSX 3CJ7A 2JDJA 1G6BA 4C8ZA 3AVLA 1NXIA 3SCLE 3KLGA 4ZCMA 3QEPA 3NDKA 2E6LA 4U7UD 3CCMS 1W2IA 3N01A 3AT1B 1CJKA 5HVFA 3FGUA 3HZEA 2XC9A 3H7HB 4QWCA 3FSXA 1S7HA 4LIWA 3OYNA 4RZRA 5H9FK 4IWVA 3AAPA 2NUBA 3NCPA 2HHTA 2VKRA 1J5EF 2RE2A 1VQ7S 4RCHA 4NZ7A 2F65A 1Y5IB 1O51A 5AQLA 3UCZP 4NA1A 2MKSA 3MTKA 3CXCR 3OW2R 4IJAA 2DD8S 5GADI 4ZN3A 4DSLA 2BBEA 2F8HA 4FSVA 2Y9HA 5K5MA 3VF0B 4IFVB 3L2WA 3R7SB 1N33K 1HBOB 4QIGA 4ZA1A 2XHBA 4C2MA 4ZITA 3DLJA 4HUGA 4CBWA 5D15A 4C0BA 2RDDA 4Y2KA 1IKVA 3L3CA 4A8SA 1GLDG 3LALA 1RTIB 3EO3A 1ZAWA 1SC3B 1EIYB 2F8MA 9RUBA 1SH3A 4IO9L 1JXBA 2Q1NA 4M5JA 3ZTOA 2BKOA 2DVIA 1ELOA 3NVKA 1RTZA 2ROEA 3NMAA 4EHTA 1RQ0A 4CT8A 2BA9A 2HFVA 3F41A 4JK8A 3FDSA 2MGZA 2E2NA 2P9NA 2MZQA 3T6BA 3HCXA 3CCSS 5CR4A 2VBXA 2RJZA 1BCMA 1G99A 3OFEA 1T6CA 5KFNA 1YJ9S 2WSFC 1JXEA 2FLNA 3MM5A 4ZVUB 3NNCA 1UEKA 4O4GB 3BDPA 1OKJA 1HHQA 3AY0A 4J9QA 3MMBA 4NRUA 3CCLN 3O3LA 4U96A 1U02A 4B3TF 2CPIA 4MQ3A 4NLWA 2GVZB 4LR7A 3W1YC 4ED4A 2D0CA 4J2EA 1T9TA 4H5TA 2XSFA 5M2UA 2NXJA 1S9FA 4FNHA 4ECQA 1XEZA 4BE2A 4H54A 2HGMA 1JLCB 2YHYA 2FBXA 1UVNA 5BJRA 1PILA 4CIOA 4ZCLA 5L1IA 1M1GA 4JI1J 1M1KT 1YT3A 3CCEN 1RCXB 2PFDA 1VQMS 4DR5K 2YVSA 2YJFA 4WFXA 4M5HA 4NOHA 3P4UB 2IM3A 1N34F 1C0UA 2IY5B 2JWLA 3POTA 5KI6A 3ZT2A 3HI9A 2I1RA 2MHNA 1NMEB 4OKKA 1CZAN 2GVDB 2HQIA 1RWWB 2I6WA 2JLGA 3NMRA 5EHHA 3B6OA 3V1QA 4NL5A 3LOUA 2CNKB 4K2XA 5LXYA 1TUVA 2WTUA 3VMFB 2HRYA 3R97A 4BRAA 4I67A 1NH8A 1U1OA 4YUDA 3MECB 1MMDA 1PBUA 3UD5A 1XI1A 3NXZA 2PN6A 3VAMA 3EJMA 1NKEA 3IM9A 1BY9A 3VVUA 2ZITA 3R6MA 4WFAQ 1DURA 2MYFA 3H3NO 2D1CA 4YHHF 4ALZA 1ZTTA 3TQEA 2Y1JA 3K57A 1T3VA 3N4WA 4Z4GA 3GCWP 1VR6A 1U1RA 3GONA 2DGSA 1RADB 3W2WB 3WXMB 5IT0A 4CCHA 1T44A 2ROPA 4JKHA 3OTDA 4C7QA 3IR7B 4DCJB 4NYPA 3MEDA 2R8GA 4ETXA 4NLUA 2HAFA 1AT1B 4RW4B 3DM2A 2YH0A 3TARA 1RFQA 5I4MA 1YJRA 4USMA 2F63A 3NS7B 1LOUA 2JC0A 1SCJB 4CI6A 1SQFA 5E3AA 1FRLA 2ZFHA 4R5PB 2PY5A 4BS2A 2QMXA 1IH7A 1TKXB 1LEOA 3HFVA 4ANCA 1RTDB 5FRNA 1HBMB 3DRPB 5LSRA 1U24A 3EKSA 1KLNA 3CD6N 3VEXA 3M4XA 5HLFA 2E1YA 3K7RA 2OI2A 1CPZA 3SAFA 3E01B 5ADXH 4E98A 3PJ9A 2HF3A 5A6WA 1NLKL 4ZHRA 1HMVA 2KO1A 5HANA 2EX3A 3M05A 4LF4J 1TKZB 1HNWJ 3SYZA 5IWAJ 4HT5A 3UDCA 1BWEA 1T9WA 3RR8A 2VFTA 2J0QD 4F0KA 2X78A 4Y3CA 2QEXS 2O66A 5D0HA 2CPFA 4BWMA 3H4BA 3S41A 2IFXA 3ZZYA 4X64F 3OD2A 5AQWA 4FK0A 2G2YA 4RO0A 1KTVA 1H98A 4C0HA 2VDIA 1HRHA 1NK8A 4LF6K 1HNVB 2KFYA 1UVMA 1V3RA 2A3JA 3W5XA 1NRKA 3G2XA 7FDRA 3AJDA 1UVLA 1KQKA 4GW6A 3DLGA 3KHLA 4OLBA 3D0IE 1V5VA 4E1MA 2M9KA 4BG9A 4NLRA 3I8BA 4QJVA 3MGJA 1SAZA 4YB6A 5FDLA 4KREA 3PR4A 1SQEA 1XUPO 1K9MO 2YX1A 2G8VA 3SFGA 3SJHA 3NCIA 2AIRB 4DV6K 1UJ5A 2XHWA 2OJ3A 5D0EA 3UB5A 5ETNA 1FVSA 4ES3A 1ESVA 2IBKA 4FDFA 2N3OA 4AT1B 1EHWA 4MYUA 4V1Ak 3P5TL 2GNKA 3PYEA 2VJVA 1WBDA 2A1RA 3DMJB 4RU2A 5KG5A 1WI8A 1Q9XA 3L7OA 4CI0B 1NGEA 4NLTA 4ANDA 4BVOA 2ZOMA 3HZ6A 1NJIO 4JI3K 1WNSA 3O9TA 1VS3A 2HFNA 2DNPA 3M8YA 1C1AA 4Y0WA 5AQUA 1KQSR 4YOWA 5L1LA 3Q89A 1B7FA 4K5SA 2AEJA 1U1PA 1CZBA 1NPRA 3HL8A 4ISEA 1NGHA 4JS4A 1MROB 2ZJQL 3CT9A 3NAHA 3R3LA 5CXTA 2DNLA 5B0BA 1WSVA 1HNZF 2E5HA 1YX2A 1W97L 3NVMA 3E2EA 1VQ5N 3QMLA 3RAMA 3CCWA 4ZPDA 1U0SA 2WRMA 3LP2B 4NB4A 3GYGA 1VGYA 4KHYA 3T1HK 2DRAA 1MN9A 3LH2S 2GJFA 5ETSA 1URRA 1PAUB 4NYFA 3D2WA 1VRUA 3D2EA 2GAHC 2RUSA 1IKXB 2MJNA 3GIJA 2Y3YA 4WK1A 1RKIA 2ALZA 4FZYA 2F1FA 5KT4A 2F9WA 3NGIA 3D0PA 5K8OA 1IG9A 2ZH2A 4B9VA 4ID5A 3KK3A 4ED5A 4NPOA 1Y97A 5LMUJ 2CPXA 2CWKA 1MWMA 3M8WA 2B8PA 1Y0HA 1OH8A 2DIUA 3JTOA 2N82B 4JYAF 2WVDA 1QAJA 3QGHA 5KT2A 5EU7A 3FEYB 4N8OA 3HT0A 1F6TA 4ZVFA 2Z57B 4OLOA 1WOQA 1AZSA 2C2EA 2OH2A 1XQIA 4BHQA 3FFIB 1LW0A 1BWVA 3IN5A 3WXKA 2KT3A 2RU9A 4K8XA 2XCPA 2GX9A 4A8MP 2MKYA 4CFCA 2Z2YB 4R0JA 2VWBA 2NUUG 2QXFA 4PKGA 4G3IA 4X66K 4JKGB 4Y6IA 3OYGA 5GMEA 1FDBA 3NP5A 1RAEB 1TZ0A 2V8GA 4BRNA 1HA1A 1Q8LA 4EAHD 3M5RA 4KH4A 1VQKS 2AGPA 1VLYA 3U4LA 2P9KA 4CBXA 1C1BA 5KG6A 1PO6A 5AZIA 2AQ4A 1SQGA 2WZ1A 3TA2A 3CSKA 2YWFA 3QZ8A 4OKJA 3CMES 5KRSA 2K1RB 1J54A 1RHJB 3G0ZA 1IBLK 3NMUA 1HNXK 2D9PA 3JB9k 2BXJA 3D0GE 4AQYK 2VH7A 3SQ0A 5E2QA 4RUCA 4IH7A 3TSPA 4OJHA 4X62J 3OVBA 3AVNA 3M1VA 5GAGP 1FKPB 3EM1A 2YQ0A 1CS4A 3TUIC 1QAIA 2K7JA 1DHMA 4GV3A 4Y2AA 1L5UA 3PSIA 2FBTA 3VERA 3VQBA 1J2VA 3PIOQ 5EX3A 4BBYA 3PEHA 4ZS6A 3C6UB 2E9RX 1RWUA 1IBKF 3SCXA 2G2OA 5KFDA 4ITSA 4DV3F 1QVGR 1N6QB 4IR1A 1NKBA 2QA2A 2Z2LA 4FF1A 4U7CA 3PR5B 4DI6A 3UKUB 4CFDA 3WC0A 2NLXA 2XZWA 3FVYA 2IDEA 1F5BA 3C15B 3MR3A 3IRXA 2X74A 5GAGI 1BIUA 1EWQA 2FBYA 2JNJA 2GGPA 3A0IX 1PC4A 2M7SA 2N3LA 3HOSA 1YHQS 3TTFA 3LGMA 2PT0A 3Q8RB 3NWRA 1WEZA 3UR0A 2GQ2A 1ASUA 5F9NA 4MKBA 4EZ9A 3H45C 3M6VA 2FC9A 4J5OA 4A8KA 2JEJA 3SBGA 3DGPA 4DV0K 4KBIA 5F3ZA 2F8SA 4UF4A 2VB6A 1JNRB 4KO0A 1KLMB 1VRQC 3KNGA 4XPCA 1TKDA 5DDRC 3VAFA 1RAFB 3OYFA 3D6FB 4CO4A 4FJKA 3J81U 4NXMF 4IG0A 4FLTA 1TR0A 2W9AA 4B1UB 4C8LA 5LJ3Y 5C7PA 1VSEA 2HHHK 1WEYA 3A3NB 2G4BA 2DHAA 5A8RB 2DCLA 5DDOC 1YZ6A 4DPYA 3CQYA 3HK2A 2ASPA 2E5LF 4Q8FA 2GMLA 1PYSB 3FSIA 5T7LB 3DDIA 4LF2A 1HNIA 1REGX 4LMZA 4DR1J 1MWZA 4CO0A 5KFCA 1HR0F 3NGDA 1RU1A 2QI2A 2CDQA 1TKTA 4O3QA 5LY3A 1B7YB 3KLHA 1VHFA 1YVFA 3QIOA 1RWNB 5A0YB 3ZSZA 2B8QA 2IS3A 1UA1A 2VUGA 1I94F 2C2MB 3KIOA 1VQNS 1TK0A 3C14B 3AJ2A 3R1XA 1S0OA 2GHVC 4KKOB 4K4ZA 2PBDA 2Q31A 2MMYA 2GX8A 3W9IA 1RT2A 1ZH5A 4OYBA 5AT1B 3O44A 2V5HG 1KXPA 3TA1A 2IVNA 2N7CA 3DRSB 5AZJA 4OIXA 3IFEA 3EVOA 1JJ2R 5DDPC 2ASDA 1C0GA 2RVJA 2DPIA 2X51A 2CPJA 4N8NA 4FOIA 1KKHA 1X1PA 3AA5X 1N36F 2VJUA 4XH4A 4OJRA 4OPKA 3KLIA 1FNOA 3MM8A 1RYRA 1JLGA 2RKIA 3RRGA 3SMSA 3M8QA 3QT6A 1TUYA 3R2DJ 5J1PA 3JAMU 5C12A 2J76E 2B56A 2HHSA 5CABA 3DOKB 3HSDA 3ASMA 1AA1B 4WQ5C 2J6SA 1BIZA 3NH0A 4RBVA 4FJ5A 1GH8A 4R8UB 3AA3A 1FXLA 1FCAA 4OHXA 3CJ8A 5H9FJ 2DEIA 4KC5A 3BBBA 5D77A 4X4UA 5B0AA 2E9ZA 3KOAA 2QV6A 4B8CA 2V8HA 3MAAB 3ET6A 1S1UA 3I0RA 4FJJA 1T3NA 4KAIA 1RXOB 1UAWA 1NK5A 2G0CA 3T3FA 4M94A 3PJWA 4W5NA 1T9UA 2LXUA 1P8ZA 1N33J 5BYSA 1VSKA 3OYHA 3VGMA 3I33A 1JK9B 4JKFA 4DMNA 3SUNA 1J9AA 2RQCA 4FM2A 3UIQA 2V8DA 3B78A 3FRYA 1S6PB 4DQPA 2LQ5A 4ICLA 1OY6A 4PUOA 5IV3A 4TYBA 1YTAA 1UZHA 1VQ7N 4LF7K 2GC8A 3HTVA 4X84A 1NUEA 3S01A 3MN6A 4BDPA 2VWJA 3UNGC 2UXBF 3BGRB 2JVRA 4ED8A 4OZ2A 1GLEG 5J2QB 4EHUA 2ATLA 3R5JB 3DLKB 1E4GT 4AD6A 2DXEA 2KZZA 2X1FA 3WX4A 4A61A 4QOTA 2AJ1A 4LFAF 1NGDA 2XMWA 2KFZA 3GYNA 1VC5A 4PL8A 3SQ4A 1IKWB 4ECRA 3Q8UA 5L46A 3LL3A 3OQ2A 3PEJA 1D0EA 1EETB 1HQEA 2YWHA 3QO9B 1FDDA 3TSQA 3AVMA 2DNNA 3VVTA 3QEIA 2W9BB 2KI2A 2VBYA 3V81B 4C4WA 1SQKA 2HNZB 4KGMA 3W2VB 4WQ4C 4RPFA 4ZJLA 4QIWD 2R8IA 3Q86A 3G82B 2Q79A 5CCLA 3IBCB 4TU7A 3T9NA 3O4WA 2V50A 3OTOK 2BGGA 3EZOA 2QL5B 4NLPA 1DLOA 1VOMA 3I5BA 3CCSN 4CFBA 2W7AA 1QSSA 2BKPA 3RMDA 4JI7K 5AQVA 5KTQA 2V4QA 3A3PB 4DR5J 4J7CA 3D67A 3C66A 5BPNA 1U6BA 1Z05A 4W5OA 3TZXA 1V4SA 2D4WA 1Q5VA 1VFJA 1RBAA 2DY1A 1D9DA 2NZ4A 1E6VB 1FKOB 3R5AA 4K4SA 4AFFA 3PYGA 4FVCA 2CVEA 1J5EK 2OZSA 1VQ6S 5ETPA 4H5RA 4DBQA 1UZDA 4V19S 3W7BA 1VLOA 2R7OA 1KEKA 1HARA 3HHLB 3PRBA 3JSRA 2QL7B 1E6YB 2MQNA 1N5YA 3RMAA 2KRBA 3CD5A 3KLEA 2HZVA 4DTMA 3OYIA 2CWXA 4ZTJA 4KGVB 2RPIA 1VQMN 3NS6A 2IVMA 2IA6A 2E9TA 1H72C 1CLFA 4QCLA 2MEWA 3OXFA 3IG1A 4FF3A 1JKHB 5H9EK 2LEBA 1RAAB 2O01C 3MMJA 1K47A 4ID8A 2G13A 5IOLA 3KK7A 4CZEA 3AVKA 1MLAA 1M5HA 2HBQB 3WNFA 4NCBA 4USTA 4UOGA 1VHXA 3H90A 3NF6A 1Z26A 3KVGA 3K5NA 3D1QA 4KGZB 1IR2A 3VF2A 3MCOA 4C3MA 2BQUA 1CBKA 3WQUA 1FRHA 2QG9B 4BRGA 4NI2A 2LU1A 2H51B 2VC0A 2QFJA 1HLUA 3QESA 4H0PA 4OHYA 2P5OA 2GCFA 5IZHA 2W2QP 1JL1A 4FF4A 5L39A 4LFBF 3PX4A 2FIUA 3OTCA 4XO0A 4CHZA 3PW0A 3MAHA 5GAHU 4B3TK 1TV6B 2KDOA 2PSZA 1RBRA 2HMIA 1TK5A 4JI5K 4K4XA 4FPAA 3EXYA 3NOGA 5IV4A 1SJQA 1HKBA 4FLYA 3U6FA 1IM4A 3TAMA 4PY5A 2G0IA 4F26A 1O5JA 4NYZA 3MDQA 4HUEA 2AZ1A 2H4WB 1S97A 5HROB 4GV6A 2CVIA 4CW7B 3EE3A 2OPSA 3O80A 4IH5A 2ZWOA 1D3WA 4OI2A 3E9OA 1RT5A 4RLEA 1N34K 4BR9A 2PI5A 5E3CA 3NCRA 4NCGA 4AHTA 1E3MA 5LT5A 1DFDA 2E1AA 2JHEA 4DL6A 3Q2SC 4WP8A 2FQQB 3AB2B 4FS1A 1JIHA 2GJIA 2CZ9A 5HP1B 2DT9A 1IVZA 4E7IA 4F2SA 2E7WA 1NM1A 2M8HA 4DR4F 2OHDA 5C2CA 3IBFB 1HW8A 2EFGA 2FLPA 4CM2A 3G9CA 4H4KC 2CQ4A 4O44B 1HBNA 1RT6A 1U2FA 3O3FA 3CPEA 3TNVA 3VGVA 5C24B 4PAAA 5K8NA 4N76A 4I2QA 3O6WA 1ACMB 2IC3B 4OZJA 1RA6A 3DYAA 3KLFB 4BCAA 2ZM6F 2ZJRQ 4XH5A 4H0OA 2R3VA 2ROGA 4ZVTB 2FUG9 1CJUB 4BRQA 5M2PA 5HJXA 4EYHB 3FQKA 4GMJB 2RF2B 2QX0A 1P1TA 3SAGA 4ZPBA 4CJPA 3LDSA 1ROFA 5C42B 2JVOA 4IDKB 3HHKA 3VQAA 4LRCA 2CIMA 2MZ1A 1UVJA 2IVOA 1Q81T 2DNRA 3HO1A 3BR8A 4ZPAA 2PEBA 3LANA 2BE9B 2DFEA 5J2MA 1X4AA 1U48A 2M88A 1FXXA 3QLHB 2HPUA 2LQBA 3V6JA 3LGHA 2RS8A 5C10A 4FJHA 1QTNB 4CZKA 2HBZB 4CJRA 2E7VA 1GTEA 1YG0A 2R2RA 2ALYB 2FJXA 3F56A 3VQQA 4AE5A 4UZBA 1YQHA 2B6AB 3P45B 5FPEA 5K8PA 3RJMB 2W2NP 4DQIA 1F3FA 2J7WA 3J8AA 3RSEB 4ZVPB 4E2FB 3BSCA 2F8EX 3TAPA 3T1HJ 2L9NA 1RWVB 1HPZB 1KHVA 3TANA 4ZK7M 3M2UB 4W4MA 1FEEA 2VBWA 1NB7A 2EXUA 2DGOA 1HKCA 2XS7A 2P9IB 2IIRA 3MCPA 2P9UB 3ENBA 3ZT3A 4OZ1A 3VQ5A 3OLAA 1P90A 4A62A 4J9NA 2GS8A 2BOPA 2W2OP 3QIDA 3THVA 3D5MA 1M5KC 4WTOB 1DEJA 3P49B 1VIOA 2KJVA 2VC1A 2MHEA 1OYDA 1C6VA 4ECSA 2NZTA 4CJLA 3MDFA 4DX6A 5K8MA 4Y65A 2AJ0A 3DU5A 2YTCA 3L09A 1VQPN 2KG1A 3M32A 4Q8EA 1H74A 2KL8A 3BGFA 3EUNA 2PD1A 2CNLB 1HYZA 3BSNA 3NKYA 3BKUA 4DR6J 5D78A 1GMWD 1HQUB 2WONA 5BYRA 4ZLJA 3UPFA 4WFZA 2LKZA 1OIAA 3DFEA 3CJKB 3CJRA 1KBRA 2FLOA 3U27A 3MM7B 4X66J 3BEGB 4Q7AA 2H5EA 4M3UA 3J81Y 1WKKA 2XO7A 4FPBA 1RT4B 4B9NA 2PMHA 4KGXB 3NLCA 5C25A 1S0VA 4ER8A 4TYAA 4CF9A 2IIHA 1H38A 3G4SN 1UEVA 1S1VA 2VOOA 4CEOA 1N5QA 3KHYA 1WN7A 3CETA 3W8PA 3GIMA 3JXUA 2PDAA 1E4FT 1HNXJ 2DR8A 3SV4A 2GV1A 4AQYJ 5J2PA 4G9ZA 1HKAA 3D9BA 3K17A 2OKQA 4FF2A 1VQKN 1CQMA 1CJTB 2GJ2A 4FPRA 1TL1A 1HNZK 2IRXA 3HBTA 1UFWA 1VRTA 3QMQA 2AGOA 4GNIA 4IO8A 1NOZA 5JMVA 2KXHA 2VCPA 2WVCA 4O0NA 1YXQA 1I6JA 3SQGB 2HZCA 3BQ2A 1PG5B 3GJTB 2B0GA 2HNYA 5A2QU 2HFZA 3QRRA 3DOLA 2AYBA 2H3EB 1IJJA 3FFKB 4NCAA 2MKJA 5KAKA 1PJ5A 3ZETA 1W9HA 2EBGA 3LM2A 3SDEB 2LDYA 2QKBA 3WZ0A 4L3QA 2OTLS 4ECZA 5MAOA 4C97A 3Q7BA 3T6JA 3CTRA 4NE9C 2EI5A 5EWGA 1W2BR 3ZNUA 3MEKA 2ADCA 4NXNF 1X4DA 3NNAA 4GKKF 1S9GA 1XWLA 4CE9A 2YKMB 4CF0A 4Z94A 2LFVA 3US5A 4JV2A 4GO7X 2CQ3A 2PO4A 1YI2S 3M8SA 3I5CA 3I87A 4EI2A 3EX7B 3UN5A 1IN0A 2AX0A 2COLA 3ZSYA 3CQXA 2O8CA 4B02A 1GXLA 2B9WA 1S5JA 1Q95G 3P96A 1XNQF 3L3UA 4FWMA 1G2EA 1WKLA 4ZVEA 4U8VA 2VG7B 1KTQA 4KHQA 1YHQN 3VQSA 4H4MA 2G8HA 4HKQA 2HHHJ 3ADAC 2F9TA 4DL5A 2WB1D 3TWHA 3TVKA 2B43A 2PA3A 5B0GA 3HT3A 2M5YA 3PIPQ 2X3DA 1U6FA 5B0CA 5RUBA 2RT3A 4LRBA 3O4QA 2CQDA 1QAYA 4C1NI 2VYPA 1U47A 1UCNA 4J9UE 1B4SA 3THXA 4OHZA 1IQTA 3X3UA 3I0SB 4OX9F 1X0FA 4FVUA 1T6DA 3NGKA 4RNNA 3UN2A 1Q86O 3KG4A 2XSJA 3OR2A 4JRQA 4NZ0A 1IO2A 3ZFVA 5SWMA 2LQ8A 4G1PA 1S4EA 1FFSB 4KFBA 4HACA 3IA0A 3K58A 3WNHA 4C1NK 3O9SA 1P8GA 4KSEB 4J9VA 1KQFB 2WVBA 4BRIA 1YJNN 2K3KA 1YIJS 2W01A 1FRIA 1IBKK 4LFCJ 1ZM3A 1CULA 3VQPA 4DV3K 1ZBFA 2KLAA 1ZBIA 3DLLQ 2IJNA 1BQMB 4H5VA 4X65F 2E5GA 2ZOGA 2AEMA 1RISA 3SSRA 1VI7A 4E0DA 2ZBQA 4OV6A 3T7ZA 3G6ES 1VQNN 2MSSA 5KPZA 4MIWA 5D4PA 3R7NB 3U3GA 1WBBA 3QNOA 1VQ4S 4FM0A 3GJRB 4W5QA 2ZE2A 1QHAA 1ATRA 3VV2B 4IQXA 4ECWA 2XMUA 4ISGA 2AD9A 2CNNB 1Y3JA 3HULA 4YQWA 3VGTA 1BD6A 2DY9A 1DZ5A 2O8EB 1R8PA 3CJBA 3DDKA 3VAHA 1AXQA 3LP0B 1RUSA 4IFEA 1DRZA 3MPYA 2UUBF 5F8NA 2R8JA 4LF5F 2B9XA 5ETVA 5DM6Q 5M2RA 3DXKA 2DXFA 2YQ3A 2HWTA 3H08A 1U2RA 1YBTA 2BJ1A 4ENOA 3FR0A 5JVHQ 3R6LB 4A59A 3BBCA 4E8UA 3AVGA 1RDUA 4NXMK 3O9UA 2NXNA 1NSAA 3L95X 4HCCA 1LW2B 3K2YA 4IFVA 5HAOA 1HBOA 3VGSA 1IWAA 3TX8A 3M2RB 4KHMA 3ZEUA 1FEHA 2UVWA 4P7TA 2PMZD 1UWAA 2VG6B 2A0FB 1RTIA 4B9LA 2E5LK 2L9WA 4PWWA 3MUTP 1A5VA 2WTFA 2VWKA 1HR0K 4LD0A 3IRWP 4LF7J 2DHXA 1DBDA 2CFXA 4BRCA 2CPDA 1Q81O 3CMAS 2Q36A 2JLEA 2YY3A 2P8IA 3KNAA 4IFYB 4FS2A 4M41A 3CQ8A 1I94K 2PC6A 4ELTA 2RQMA 3KUGA 2AP6A 3GG4A 3DRRB 4FW1A 3NH1A 3AO1A 4FLUA 2WBMA 3ZSXA 3QB0A 2YX4A 2GQCA 3CIZA 3LAMA 3FEXB 2FVQA 4YOYA 3OT9A 5D4OA 2W9CB 3HVAA 2VPXB 3MURP 1C2PA 1RWXB 1B9DA 2H3GX 1TELA 3MWTA 4E1JA 4JI2F 2C2KB 2JRSA 1HW9A 2YKOA 5E3RA 2GVZA 3K5OA 1BU6O 5F0UA 1DTQB 2E66A 3KKRA 4NLCA 2OEKA 2R2TA 1Z2ZA 3EL2A 5AXLA 3SV3A 1T11A 3T5KA 1JLCA 5CZ1A 2W2MP 3CW2C 4QR1A 1NU4A 3GLJA 2MXYA 1N36K 3U3YA 4FZVA 4X2BA 4L75A 2HYIB 1Y11A 2FF6A 2R7TA 4CO2A 2C3OA 3G6VA 2VA3A 3T69A 2I7NA 4K8RA 3AO4A 1RTHB 5K14B 3AVHA 4JI7J 1QD1A 2GVDA 3QGPA 4H4OB 1RT7B 3N5BA 2KH9A 4WFAL 1UAXA 1V3ZA 3KWGA 3TVZA 4OPHA 1UKUA 1BA0A 2X6NA 2CQ1A 4YORA 2Z56B 2CJXB 3DXMB 4H0TB 2WVEA 4FP9A 1J5EJ 4XTTA 2EBEA 2FJDB 4ED1A 3ZX2A 1OH6A 3MECA 3OXGA 3TA0A 4JP8A 3AODA 4JD2B 4P72A 3TW0A 2FXUA 2FY1A 3VEOA 2FD2A 4FJXA 3SSSA 5KFKA 4KAZA 4B3MJ 4P6QA 5C5JA 3LWMA 3D6RA 3JYTB 4LF8F 5H9EJ 3ZSWA 4HEA9 1KS2A 4CBUA 4IRCA 1VQON 3FC9A 2ZGYA 2ILYA 4F36A 4CHQA 4WZQA 1W7WA 2IMOA 3O1WA 4HVJA 3GTYX 4YP3A 4WK3A 2CQCA 3IWNC 3O4NA 2P51A 1NGBA 2CGJA 2DH7A 3U9DA 2NRZA 2Q6BA 2QN6B 1RWMB 4ZCIA 4ZIWA 4F4XA 3G6YA 3PKYA 4FWOA 3V6DB 4CD1A 3GSDA 3IP0A 4FK4A 1BXNA 4LFAK 5L38A 3B6BA 3L8BA 3H3OB 1AUDA 4R5PA 5H1SQ 1KFSA 3HPHA 4HL9A 3HFZB 2RSQA 1VBKA 4U7UK 5BR8J 1TKXA 2VODA 1RTDA 4UTGA 3DLHA 4CHPA 1HBMA 2AW0A 3DRPA 4CGGA 1ZZFA 1X7VA 3VR1A 2KHCA 3VALA 2PGCA 3OSPA 2JZ5A 4B3TJ 3E01A 4N41A 4OI6A 4KH0B 5AQZA 3G87A 1SV5A 4JI5J 3OUYB 4I7FB 3PYFA 4W90B 1XTZA 3QJLA 1V9OA 3PFOA 1TKZA 1OPIA 1FWPA 3TX0A 3MR7A 3FLCO 3ZC4A 3O6QA 4HYKA 3AO5A 3L2QA 3ENVA 2Y0BB 4RW9B 1GOBA 1NNDA 4BROA 1VDHA 1I51B 1QDUB 2RRAA 1JQGA 3TTCA 2L48A 1WHXA 1N34J 4B08A 3KK2B 2FYXA 3I5AA 4KHNA 3H98A 5TKYA 1QE1B 3OVAA 5B09A 1QQOA 4W5TA 4CEDA 5G0RB 1WC3A 3BYPA 3KZBA 1LFPA 3GYXB 3EDRB 2G8KA 2VL1A 2CGKA 1DQ9A 2VQEJ 3AVAA 4RKUC 4FYXB 4L6V3 4CLTA 3RBXA 2ASOA 3VQ7A 2LYVA 3LTOA 1XMOF 4AL5A 3M2VB 2ZF5O 2W8KA 4CJ4A 2X3GA 3LDLA 4MDAA 2AJ4A 4O0IA 3OJSA 5M1FA 3NGUA 4QWDA 2R8KA 3K0SA 1Q78A 1U26A 3AA4A 4ZTFA 3O8MA 3ZXWA 4P71A 2LECA 2QRRA 3U7JA 1C0MA 1WSIA 4HT7A 3EWGA 3LZIA 4WYBA 2YNHB 3DRXA 2E1ZA 4CRJA 3DMJA 4JNEA 5KOWA 4ILMA 1WOSA 2FHKA 2LCWA 1XR7A 3TZWA 3D3BJ 3ZT4A 4FXDA 1HWLA 4P7VA 2V4RA 1RCHA 3ZTPA 4M3YA 3CCRS 1RHRB 2GA7A 2NZCA 3D7SB 3KKSA 3BO4A 2SXLA 3HHEA 5HOOA 2C2RA 2AMCB 1MNEA 4LFBK 1PCAA 3QICA 1RBLA 4OI4A 3MPUB 3NF7A 4GC6A 5EOYA 5BXIA 1H6KX 1GLFO 4KIAA 3T41A 3LP2A 2AGQA 2CQHA 1RAGB 2IYIA 4CECA 4XDCA 2C22A 2KB2A 3TUZC 1YJTA 1IKXA 4ZLNA 4DTNA 1T02A 1GFWB 5A2QY 5DMRA 4K42A 4BC3A 3TZYA 1FW6A 1IR0A 4DTPA 1H2VZ 3VENA 4CJWA 1KVBA 1ZBHA 5DETA 4URSA 3MM6B 1ZA2B 3SI6A 2KQ2A 2KU7A 2HFOA 1A5WA 4N7TA 2ETJA 3N5FA 1TFWA 1C0FA 4FWLA 4DV2F 3NBPB 4Q2MA 5KFAA 1S1XB 2FC0A 5B0DA 3AGKA 4WTYA 2YI1A 1RTJB 2LEAA 2X7IA 3A8YA 4CF8A 3FFIA 3R8EA 3ZSVA 4DR4K 4USIA 1U1LA 2D5RA 1RWPB 1F3VA 1RLDA 1TQLA 1LWCB 2E5JA 2OPRB 4URGA 1YVNA 4C8KA 5I3QA 3K5PA 2GWJA 2QWMA 1IKVB 2LA4A 4RNHA 4Y2MA 4JKGA 2IVPA 3BN7A 1WC6A 3NY0A 4G6VB 3KK1A 2YNIA 3M6GA 3DXBA 4FZZA 2CDRB 2MKCA 4ILHA 2ZM6K 2L08A 3OYLA 2NSCA 4GKJF 3QNNA 3DOMB 2IRUA 1JJCB 3UDEA 2VFRA 5KFUA 2MGZB 3U02A 2QT7A 2D3OR 2K1RA 3FUYA 5EX0A 3PIOL 3E1YA 5JJBA 1GMWA 2DR5A 2OD6A 4DTOA 3KJQB 4FM1A 3MM5B 5KFMA 3VPZA 3TQ1A 1DY3A 3ONQA 1FKPA 3BV8A 2MY7A 4R0EA 3M30B 4GMKA 3TJ9A 1MWYA 3GILA 1NH7A 2YNGB 4DHVA 3THPA 3C16B 4W5RA 1C4CA 3DLEB 3MN5A 2RDJA 2WHOA 4F2RA 4K4VA 3J81O 1F5AA 3ZTRA 1U45A 3CJ2A 2RIJA 1KVAA 3C6UA 4JHDB 5IWAF 1U2VB 4JKDA 1TVRB 3BY5A 2EFNA 1N6QA 3TSUA 1H2UX 3UWTA 3C6AA 3U1MA 3UKUA 1HL6A 2PYJA 1KAXA 1YZ7A 4LF9F 4YY3J 2RD5C 3A13A 3C15A 3ENAA 5GAEI 4A2AA 2C3PA 3C46A 3D54A 3PFEA 4PA1A 4X4TA 2WFBA 2PEHA 3ZTQA 4CF2A 3DN9A 2JEGA 3DCAA 2BTFA 2VD3A 4K4UA 5HK4A 4CJFA 3PHTA 3OHAA 4A8XA 4IOCQ 2ATQA 5CZ2A 3JTPA 4DR3J 1JLEB 4CP5A 3VZIA 3AOBA 2FVCA 1KLMA 1OWXA 3CUNA 1RDBA 4NLXA 2ZHBA 3D45A 4I0WA 4PR6A 4CEAA 1RBSA 1NPPA 4IKFA 2OTLN 1Y9OA 2O4GA 3R27A 3J7Z5 3KMQA 4U7BA 4OQJA 4QAGA 3FCWA 2WW8A 3DC2A 4UW2A 4WFNQ 5DM7Q 1R0CB 3QFPA 3R6GB 5HBMA 1KOOA 2FTRA 4DPUA 1FXDA 5A8RA 3ZZUA 5I3UB 1U2CA 2E2QA 1FI4A 5T7LA 3BSOA 1SBRA 3CM6A 1YI2N 2JOQA 5HI7A 4DU7A 2M2BA 5AQRA 3W9HA 2KN4A 3J7A1 1LKZA 2HBLA 1R6YA 2QWQA 3M9MB 4CZGA 1YK9A 2D1KA 4GVBB 5IM0A 3OS1A 5A0YA 2HFUA 5KFXA 1K0VA 1UEUA 2KM8C 3ZTSA 1R8BA 3C14A 4DHYA 2DHSA 2XULA 5T41A 4JKBA 1NGIA 4KKOA 2W8LA 2KJWA 1NK7A 3QIPB 1BISA 1TYQA 1WNEA 4Y00A 3QSYB 1HMVB 2V2KA 3EGZA 5FJ4A 1WAJA 1YRUA 3GPAA 1J6ZA 1ZBSA 2H54B 1IBKJ 2YHBA 2JSXA 1S72S 4FWNA 3VF4A 4BE1A 3LPUA 4DV3J 2UU9J 3DRSA 3OBWA 1NSPA 5LMUF 4K0KF 3OYEA 2QTDA 4M95A 2RNEA 3FZMA 2HKEA 4M3ZA 4AHRA 1MN7A 2HBRB 3HRGA 4UOFA 4KV8B 4ECTA 4OHWA 1NNEA 2I5JB 4FJIA 4NXNK 1IV0A 2P9SB 3N4PA 3KD1E 2WOMB 1SH2A 3QRQA 4GKKK 3NE6A 3G8QA 1YITN 4PQAA 1YIJN 3RWUA 1YF5L 5ETQA 3HKZD 2X6SA 5E5NA 4ATNA 2I38A 1X3MA 1LAVA 4O8UA 1TUGB 4R8UA 3MWPA 1JLAB 4DUTA 2OFHX 3L2UA 5FDLB 3KUHA 3THTA 2NQPA 5KFHA 1WLJA 4A8OA 4BY9C 3CVKA 3ZX3A 4AHVA 2D69A 2HIYA 4GO5X 3EXCX 1TU0B 4MK9A 3G6EN 3THWB 1XNQK 3WQTA 4PABA 4MO5A 2L3MA 4NXMJ 4BDZA 3CCVS 4AXJA 2J6UA 5KFEA 1VQ4N 1T05B 2E8AA 2O5DA 3AOAA 4UQTA 2HGLA 4FLWA 3I82A 3UI3A 4B3OB 4YB1P 4A47A 2R7UA 4QU6A 2F4FA 3ETMA 3AO3A 4X62F 3TZZA 1KONA 1RU2A 4ID1A 4M3TA 1S6PA 2CUYA 1O13A 1FJCA 3CCQS 1NBEB 2E5LJ 3W62A 1ZAXA 4BACA 2UYTA 2IM2A 5HN0A 1TL7B 1OS5A 5E26A 3CDUA 3J80Y 1FTRA 1YKWA 3FEZA 4EWTA 3BGRA 4ZOSA 1JLQB 3DRYA 2IVFB 4CLZA 5J2QA 3MCNA 1IBCB 2HQDA 1HIYA 4OX9K 2J4RA 2P1JA 3DLKA 4NLQA 3FCHA 4QYRA 2XI3A 1BA1A 2CA9A 2HLTA 2NRWA 1UOCA 3CXCM 1IKWA 1RZMA 3C65A 3O8WA 3K9KA 3CE8A 1VRUB 1EETA 2IJRA 3KG0A 4DR2F 2IAJB 5DLGA 2N7YA 4OLAA 3QO9A 3N79A 1RAOA 1WD6A 2W9BA 1FESA 4DL0C 4O55A 4FWQA 3HJVA 2HNZA 3W2VA 3BH6B 4H03B 2FJEB 2XMKA 1WC1A 4CZIA 2BX6A 2F5GA 3G82A 4X65K 5F8GA 1L3VA 3CMAN 1VQ9S 1N5TA 4WJBA 3PKMA 1X4FA 1T95A 3NL0A 3EZWA 4CNYA 3GP9A 4ES2A 2CJKA 4BRKA 1N36J 4RW8B 3OY9A 5DG8A 3JS9A 2NXCA 1KFDA 3W8GA 5KQDA 1SIZA 2ZH5A 3R5CA 2V9WA 3HMJG 4L72B 3CFRA 4FLZA 3Q24A 1FKOA 3S3MA 3I9V9 1BL3A 3EGNA 3W66A 1Q82T 1N32K 2O8FA 2UUBK 4PEOA 3M6XA 2DY4A 4RG8A 4LF5K 3L4QA 5A6PA 2V2VA 2K3IA 1X5TA 1SC4B 3HHLA 1Q8BA 3QNWB 1VQ8S 1YJ7A 3PY8A 4IZ9A 3VQDA 2HSTA 1EZZB 3RYLA 4Z2XA 1E6YA 2F4VJ 1GNKA 3TRGA 1YWXA 4O3SA 2RRNA 3P39A 1K73T 1FT8A 5F8HA 2KT2A 3CD7A 5GADP 4BGBA 4QPTA 5EX5A 1RYSA 3SBTA 1RAIB 3EEQA 1DQAA 2DNHA 1JKHA 1J27A 2P9GA 3BKFA 4M63A 3VQEA 3P6YC 1KSPA 3WEEB 4TSXA 1UWBB 1WF1A 1XBWA 5A8KB 3W61A 5KG7A 4BC9A 3NCQA 1TAUA 4JEPA 4C0OC 3ULHA 2ZNZA 4FVMA 5GAGU 4ETZA 4YOXA 3CCJS 2IPOB 3ATUA 4FXWA 2HVZA 3QATA 1FWKA 5AE2A 3TOQA 4ZLLA 3WHIA 4AHCA 1RB0A 4FYYB 2M52A 4YDDB 2CADA 1S1TB 4I4BA 2OEJA 5AQYA 4LSLB 4H0YB 4IOAQ 2WUSA 4LFAJ 3VA0A 3F73A 1N5VA 3HVRA 1NDCA 3TR5A 3VQ4A 2E1MC 5FRMA 2C3UA 2KVQE 5CH7B 3OVNA 4P74A 1R3NA 1ASVA 3ZT1A 1TV6A 4JI2K 1WACA 2UUCF 4KJIA 5KOXA 1IBMF 2IHR1 3KYLA 2GGPB 3WIVA 4E7KA 4A4JA 3GFXA 2OP5A 1BOTO 4HHUA 5JMNA 5HROA 4R79A 4CJKA 4QS7A 4TQSA 3V4IB 1BO5O 1UVKA 2Q6CA 3H20A 2NRVA 2MZTA 4RUHA 1VQSA 4TU9A 2LDIA 2EG1A 4HHTA 1MDUB 4IOXA 3RB0A 4CVNE 3JSMB 2H9ZA 3R1HA 3MD3A 3DNCA 2WB4A 4WKRA 4FBUA 5AXNA 2DKOB 2EWHA 2AJQA 1K44A 4W98A 5KFRA 4M5IA 3GFHA 4K59A 3G96A 3CDEA 3QYYA 3WBZA 5GAHI 3E9LA 4DFKA 3IAYA 4LREA 5HP1A 3DI6B 2ZJRL 4M5NA 3LM9A 3D6MB 2QSWA 2DTUA 2DYAA 4Z4EA 4RNMA 4RWTA 4O44A 4X4PA 4J90A 4QZVB 4BR7A 1SKSA 3UE5A 1FD2A 2RN2A 5DG7A 3L9ZA 5C24A 3DHWC 2ASJA 3KTQA 3M8PB 4DQRA 1I5OB 2IC3A 3FJ2A 3I56S 1JXLA 3KLFA 3A8KA 5CYQB 5DG9A 1T9XA 3V9UA 4LF8K 1TKTB 4OYOA 3RR7A 1HBUB 3GG0A 3J7AN 3CCUS 1CJUA 4XAKA 5E3QA 4JI0F 3BZQA 3ETOA 4J9RA 1ITPA 2RF2A 5MLCV 3S7RA 4M45A 4KYZA 3H4DA 1W26A 3AHPA 4URQU 2M70A 5C42A 2B4OA 1EQMA 2HVHA 3PDNA 4IDKA 2NRXA 4QPXA 3O5TB 4GVLA 3CO9A 1SJ4P 1RA7A 2FGCA 1UMJA 4GRSA 1GTHA 1OJ4A 4ZP7A 2XTJP 2QLWA 3PX6A 1RT2B 4TNOA 2DHGA 2C42A 1SL1A 3EN9A 3ZZTA 5L9XA 2PAVA 3QLHA 2VF3A 4J37A 4FWSA 2O4IA 2OPQB 1OY9A 1KD1O 2FJAB 3AVFA 1P9YA 2KFNA 1KAYA 2B6AA 2CYYA 2BUPA 4PPZA 2PFFB 3D1HA 4CEZA 5JUMA 3RSEA 3AD8C 3GV8B 2VOPA 3MFHA 3FRZA 4A5AA 1HPZA 4WU3A 3M2UA 4HH0A 2BYCA 2UUAF 1B0TA 2CJAA 1SXLA 2EFPA 1U04A 2HWHA 3D0HE 4B9SA 3MPDA 2P9IA 2P9UA 3VTIA 3PVXA 4MIAA 2B3TB 5F0WA 3TPQA 4FLVA 3FE1A 2FSKA 3M3ZA 2ACYA 4BVPA 1M5VC 3ZZOA 5FLXY 4OZ0A 2C2OB 1NHVA 2F9JA 1KQSM 4F3QA 3RRHA 1NOYA 4HDHA 5AR0A 3I32A 3I0RB 1UW4A 1BCOA 4Z7CA 2UV8G 3FBEA 1HD0A 2ITGA 1NEEA 1R0AB 4O23A 1H7WA 4B3RF 4Y1CA 4BQZA 5CCMA 4E19A 3VGLA 5BYQA 4OYIA 4USKA 1R6VA 3ISNC 3IR5B 3H2UB 3TP2A 3PCOB 4DR4J 4LIRA 1GLAG 2QLXA 2DISA 1HWUA 1HYVA 3CJKA 1XMOK 5A2QO 2KVIA 4HTLA 1HJRA 1V6HA 3MM7A 4LBIA 2QWNA 3NFAA 1EARA 4PUOB 4EU0A 1LCUA 2JX2A 2XBPA 3E51A 3OPKA 1VSHA 1H7XA 2KW4A 1N52B 5K20B 4ZVOB 4QBUA 4B3SF 3UCGA 1SKUB 4L76A 1RT4A 4JKCA 1X5PA 4USWA 2HHVA 2HNDB 2RH3A 3PNIA 3NRBA 2FY8A 2CKWA 2POKA 3C19A 2CQPA 2Z1HA 3PV8A 2MDAA 3CCES 2J7KA 4DSJA 5L9NA 4ZVSB 2JFDA 4IRDA 3BB5A 4E3SA 1Y3KA 5CY4A 5KT6A 1N88A 3DGVA 1U1KA 1GLJO 4ED2A 1APSA 1CJTA 4RBUA 3V1RA 2ACMA 2FHJD 2A6AA 2GTDA 2ZH8A 3R9PA 3SQGA 1KR4A 3AB4B 2R7QA 1SZ2A 1I3OB 3AXKA 2DNOA 2YWKA 3HP6A 2DGVA 3OTBA 2JL9A 3BZKA 4YMEA 3CCZA 3OYDA 3V6HA 2DNZA 3SDEA 4WXWA 3IDHA 2MQPA 5CAAA 4XEIA 3FZ2A 4H0VB 4EO6A 2OANA 5KFYA 4EFAC 3M6UA 2BRLA 4PPDA 2V34A 3TVYA 5LXRA 1YTYA 1J5OA 4BC2A 4DV2K 2W2PP 2MZJA 1EP4A 3NGSA 4MLHA 2UVVA 4F67A 2B4PA 4P2MA 1CC8A 2DCUB 2DNYA 2XEXA 1Q82O 4E7HA 4DX7A 4ZDNA 4BWJA 2Q3PA 4HI2A 2Y1RI 1Z2LA 3PM9A 4LR8A 3MPVA 3R7BB 4EZ6A 4O5FA 1FA0A 3LQVA 3IG1B 3PW5A 3G86A 4F3OA 5EVZA 3KWIA 2ZUGA 3PIPL 1QVGM 3D6TB 1K73O 1S12A 2E6MA 2QGFB 3V9ZA 4RWWA 2VG7A 2RAQA 4E1NA 4GKJK 5AQNA 4M3WA 2ZC4A 1CC7A 4F4ZA 4HTJA 4N5SA 2BJ3A 4WYWA 4DFJA 3D68A 1KP6A 2GW8A 1JLBB 1HWKA 5DRKA 5EXWA 1O8BA 5IT9U 4NA2A 1XHZA 4FJ7A 3PRDA 5ELZA 3MD1A 3AV9A 3X1LB 2YNFB 4OMFG 4ILLA 4K8ZA 1DQ8A 2C1EB 2BANA 5LMNJ 2AU0A 3NHGA 3I0SA 3OR1B 3DLLL 2B4UA 2NRHA 1TK8A 4WZMA 5DQGA 1IG8A 1FRMA 2A6MA 5AQFA 4ISFA 5IQ6A 3QEVA 2Z1JA 4Z0UA 3V6KA 2Q66A 3J7YP 4JN4A 1P1LA 3V5RA 4F9OA 1YBAA 2LEPA 4C48A 2JLFA 4YEAA 2ZD1B 2DNKA 3OSNA 2BZ2A 3QETA 1SKWA 1HWIA 4CLLA 1XC9A 2OUGA 1BQMA 3ID8A 1WEXA 3I4HX 5KFGA 4C23A 4X4RA 4LF9K 1Y00A 3R5BA 5KFOA 4DQ8A 3ULEA 3HJFA 1U8WA 3KDOA 3MX2A 3JS6A 2HHPA 5KFWA 1FHTA 1V3SA 4QW9A 3FK4A 5DM6L 3ENQA 3H5YA 3K9JA 4I2PB 1UFLA 1WB9A 3CC2S 2XYGB 2MKIA 4CYUB 3ITHA 5JVHL 4DR6F 2IA0A 1A5XA 2ZKTA 2DRBA 3ZZPA 3ZZ0A 1DTTB 1JCEA 1WSHA 3J7YI 4NXNJ 1NAQA 5LJWA 5IFMA 4GKKJ 1Q79A 3CYMA 4B1VA 5DZ6A 3UO0A 2O8EA 1R59O 4CO3A 2W7PA 1S72N 3OJUA 4KTQA 2UVUA 1QQNA 4CZFA 4IXCA 1C0TB 2DPJA 3WXIA 2MQQA 2DGTA 1B70B 2DGQA 4DUZF 3VETA 4L8RB 3IKMA 2R7SA 2ZVIA 3RAQA 5EWFA 1P6TA 4K2JA 1JJ2M 1LW2A 4WFBQ 4N77A 3W3DA 3T1AA 3FCVA 4OL8A 4V19X 4UY85 5AJ3F 3LP3A 3H59A 3GE9A 4WQ5A 1M1KO 2QA4S 1QS4A 4G1QB 5I42A 1HNXF 1U49A 2VG6A 4F4KA 4PQUB 1NK9A 3LWLA 4YR3A 2YPZA 4FZXC 5KFBA 1TUWA 3PXGa 3MM9B 3S9HA 1WKJA 4MK8A 1GOCA 1HJOA 4KTZA 2ZDPA 4CIGA 1CXUA 2BW7A 4PYDA 4XPEA 1FXRA 2AWZA 2PE8A 4IFYA 4GVEA 2ZJPQ 3CCVN 5AQJA 1RABB 4AHUA 3DRRA 3OTEA 1F2HA 1VHIA 1F9HA 2YBVA 4X4NA 2RHKA 1NZ8A 2HOEA 4KH5A 5KGXA 3A2FA 3UQSA 4BRMA 3CCQN 4AXIA 3O3GA 3HPGA 4DXLA 4ZVGA 1DTQA 4LF1A 2DGUA 5LMUK 4K0KK 1SC6A 4EK2A 2V51B 2GMHA 3Q8VA 2RRBA 4X65J 3D4JA 2CH6A 4ECYA 4TKTA 2VPWB 3H25A 3J80O 2Q0RA 1RNHA 4RUBA 3K2PA 3TO8A 4CTAB 3UNYA 1JLFB 4WF9Q 1U0HB 1BHLA 2OCEA 1CJVB 4DDFA 3SIPB 2ZEJA 2X1BA 1S99A 1RTHA 5K14A 3BGUA 2CG8A 1C1CA 1R8AA 3IGVA 4H4OA 1RT7A 2HG4A 5JXSA 2RU3A 1QZ6A 4J9SA 3AD7C 3L6QA 1HI8A 4K5RA 2FHOB 4Q5VA 4X4VA 4G1IA 2W4DA 4H5NA 2CQIA 2CJQA 2D74B 3G8TA 4FJMA 1N32J 1AYEA 3IM8A 1YDLA 2JEIA 2UUBJ 3DXMA 4M5DB 3IUCA 3GSIA 5AQXA 1VQ9N 2XY5A 5HMZA 4DTSA 2V69A 3OL8A 5B8HA 4BGAA 5CZXA 4NA3A 4NO7A 1G7CB 4A8WA 3WXJA 4JD2A 3EVMA 3WIUA 3RB3A 2Z1GA 3L4IA 3EY1A 3QGIA 4JI6F 1WG1A 2P9PB 3QWPA 3JYTA 1O0PA 5HO4A 5KG2A 3BGLA 1Y7PA 2Y8WA 3CEDA 1ULRA 3D7EO 4CZHA 3K8WA 3H2LA 2QC3A 3GZ7A 5FROA 6AT1B 1Q5YA 3T1YF 2BJ8A 3A3OB 3C95A 3IGNA 2K7KA 4KB7A 3RTVA 4AL6A 2YV0X 1VQ8N 3RVCA 4RNFA 2F3JA 2P9LB 4EBDA 4TXSA 5B7WA 3UDLA 2A5XA 1TL1B 4D3GA 1U25A 4MKYA 1FJGF 3KJVB 3MI7X 4LFCF 2XYHB 2IMWP 4U95A 1F1BB 3N0VA 3V6DA 1WHYA 2JH3A 2HK3A 1VQYA 3CC7S 3KFWX 2MB0B 1BQNB 4MK7A 2DPNA 3FMBA 3PSFA 4DR2K 2FVPA 2O67A 2V68A 1SUQB 1WF0A 3V9WA 1S3XA 4DG1B 3CCMN 2B5JB 4BR0A 1VIXA 5AQKA 3SUOA 5HVHA 2YHAA 4FW2A 2CQ2A 5IC4B 2KRRA 5CHIA 4UQGA 2ZBRA 2E29A 4JI2J 3CCJN 4TY8B 2OPPB 1F9FA 3BQ0A 1EWRA 2X1GA 2MZSA 2XCAA 4F4WA 1K1SA 4I7FA 3OUYA 1OYEA 5IXUA 1VAZA 3AQOA 2VONA 4J2BA 2BDPA