3TAMA

Crystal structure of hiv-1 reverse transcriptase (k103n mutant) in complex with inhibitor m06
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
557
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse transcriptase/ribonuclease H
publication title Design and synthesis of pyridone inhibitors of non-nucleoside reverse transcriptase.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase/transferase inhibitor
total genus 160
structure length 553
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3tamA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tamA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tamA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tamA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3tamA05
4GC6A 5DMRA 4BACA 2NUBA 3OYJA 1NHVA 4OGEA 5L1JA 4Y1CA 1CXUA 3OYFA 3DMJA 4FCYA 5KGWA 4PWDB 4XPCA 4DF4A 1JKHA 2DFEA 3KHGA 4CJ4A 4N56A 3MAQA 4TQSA 1JLCA 4KHYA 3K5LA 1S1TA 3AVMA 3KJVA 2LSNA 3DLHA 4OGCA 1NJYA 4W5NA 4JV2A 1S9EA 3HP9A 1TKXA 2IGIA 5KI6A 4J9SA 1S0NA 2B5JA 3K5OA 3MR2A 1C1CB 3JYTA 3V6KA 4CECA 4KB1A 1J54A 4TN2A 3IG1B 2VG7B 2HMIA 5DQGA 3A2FA 4UQGA 3VA3A 5C25B 3HT3A 3FFIB 4CF0A 5KFWA 5J2PA 2QK9A 4R5PB 2KFZA 1TAUA 3U3GA 3ZT2A 1JXLA 2FLLA 3AA3A 5KG7A 1UWBA 4KHQA 4FBTA 4KPYA 1HYSB 3RB6A 1HNVA 2W8KA 3M9OB 4ZMMA 5F8GA 2OPPA 4AHTA 3NH1A 3FQLA 2C28A 1NKCA 4I9QA 4NLGA 4DSFA 2DPIA 4AHVA 4CJPA 3BSOA 1FKPA 4IOBA 1JL2A 2BE2A 3OYGA 2W9BA 2R7YA 4OPKA 3HK2A 2GC8A 3AVKA 4NLQA 3DRPA 1JLGB 4O3OA 4LSNB 4IH7A 4M45A 4O0IA 3SFGA 2ZD1A 3OL9A 2OYQA 3HM9A 2KTQA 4KB7A 1D9DA 2BQ3A 1TKTB 2IC3B 4IDKB 1BCOA 4M95A 2XI3A 2C2DA 3HVRA 4ID1A 1DLOA 5KGXA 2JC0A 3MR6A 4R0EA 4CESA 3I0SB 4URSA 2ALZA 1X9WA 3PHEA 4DG1A 2FLNA 1A5VA 3KLIB 1EXQA 3V4IB 1JXEA 5KG4A 3LWLA 3P83D 1KRPA 3RMCA 4CERA 3NAEA 3MTKA 3ZT1A 1VSJA 3RB0A 2B43A 1Z26A 1K1SA 5E41A 2R2RA 4MK8A 2QXFA 5EWEA 4FW1A 3OJUA 3FRZA 2XC9A 4HVJA 3SI6A 2F8SA 4CGJA 5KFKA 1R0AB 4J9KA 3SJJA 3AVNA 4KI6A 4U6PA 1S6QA 3QGIA 1TKZA 1RCHA 5J2NB 3VQ5A 1RTJA 1KLNA 1LW2B 4Z4GA 4J9MA 4WE1B 3HPHA 4NCGA 5C24A 1JLQA 1F21A 2XHBA 4M3YA 5F8JA 3M8PB 2HNZA 2AGPA 2FVRA 4DQRA 5KFCA 5KFAA 1RA7A 3DI6B 2EX3A 4IFYA 5HLFA 1NJZA 1T05A 1MU2B 3ITHB 1QAJA 4DL7A 3E01A 2YKMB 5KFTA 4CJFA 2IM3A 4FYDA 1LWFB 4RNFA 3CFPA 3D28A 2E4LA 3NE6A 1RT6A 3D0PA 4DMNA 4RW8A 1KHWA 1XI1A 3H5YA 1HARA 1RBSA 4YQWA 2PY5A 3DRRB 4MKAA 2W7OA 4PWDA 4DQPA 5DLFA 3RMBA 3LP3A 3QIPB 1JLAB 4DTRA 4M3UA 1FKOA 1HQUB 1C0MA 4NLRA 3C6TB 3QO9B 4HKQA 3KMSA 4CEDA 1ASVA 2JEGA 3KLEB 2ZKUA 1RNHA 2P5OA 5K14B 3V6JA 1S10A 4EZ6A 1RTDB 2KFNA 4GVMA 1QHTA 1C1CA 3OL7A 2A1SA 3AVBA 3GIMA 4FJLA 3SV3A 3MXIA 3CIZA 1RDAA 3SPZA 1C1BB 3TAMB 5C25A 5JUMA 3KHHA 1UOCA 1NJXA 4BE1A 3ZSZA 1T94A 1WSFA 4DS5A 4R5PA 1HPZB 1NK8A 3LAKA 1LW0B 5EDWA 3PW7A 4CJTA 2J6TA 3CDWA 1KCFA 3QEXA 3I0RB 4B9SA 2XGQA 3CJ5A 5KFPA 4X2BA 3CQ8A 4KI4A 4CGDA 4CHZA 1TGOA 4CGFA 4O4RA 1YTAA 3M8SA 1ZTTA 5KFSA 3AVJA 4FJMA 4H4MA 4CJWA 1QSSA 2GUIA 2OPQB 4CHYA 4RNMA 4LSNA 2Q3SA 3TAGA 5KG0A 3O3HA 3AVLA 1IKWB 4ED7A 3EZ5A 3HVTB 3VQQA 4B8AB 1XWLA 3V6DB 2BANB 2IC3A 4IDKA 2HAIA 3V9XA 3KK1B 4RW7A 4ED8A 4AHRA 1KFSA 4KAIA 3SUNA 3AA4A 3AO3A 3M8QA 2YKNB 4MIBA 2R2TA 2BGGA 2OZSA 1NK9A 3QGGA 1EETB 4E7JA 1FK9B 4WYWA 3EY1A 3NL0A 2KZMA 2D7SA 4NZ0A 2ATQA 3OL6A 2AGOA 1EX4A 3KLIA 4PY5A 4Y1DA 4JUZA 2R8KA 1W0HA 5DQIA 4DFPA 1S6PB 4O3NA 3BSNA 1IH7A 1TL3A 3K59A 1N5YB 4Z4IA 4HYKA 3H2LA 4DL6A 5I42A 4C8LA 1Z4UA 5J2QA 4Z4FA 1SL1A 4IG0B 1W9HA 2IA6A 1YVFA 3U6FA 3DMJB 3H5SA 1R0AA 4IRCA 3SQ1A 5J2NA 1JKHB 1TAQA 1RT2B 2ILYA 3CG7A 3KLFA 4O5BA 1NOZA 1BI4B 4DTNA 4DL2A 1S1TB 2RKIB 2OPRB 3KJVB 4ID5B 4HTUA 5KFXA 4WE1A 4ICLA 4ECYA 5CYQB 3M8PA 3S9HA 4LH5A 1KFDA 4EBEA 4TXSA 3OYKA 3BSCA 1S0MA 4NLPA 4WXWA 3D5MA 4DEZA 3IS9B 3ZSQA 2HMIB 3WNFA 1MU2A 4Q0BB 3ITHA 1NOYA 4KHRA 3BR9A 4N5SA 2YKMA 2UVRA 1LWFA 3KLHB 3HSTB 4M3XA 4URGA 3KTQA 3CFOA 2HHTA 3VQEA 3KKSA 4F3TA 4CGHA 5SWMA 1TV6B 4M3WA 4ZHRB 1NK4A 4RW6B 4WFYA 4DS4A 1RT3B 2D3UA 1C0TB 3OYDA 2I5JB 1DTQB 4K4YA 2VG6B 1D5AA 4F4ZA 2HNYB 3PJXA 4KO0B 3QIPA 3Q8PB 1JLAA 5KFYA 5KFGA 2FBYA 4H54A 1HQUA 1LV5A 3ZSVA 1RA6A 3QO9A 3PO4A 4Y2CA 1U49A 2P51A 4KTQA 3MFIA 3OY9A 2Z1IA 3S3OA 5KTQA 2HWHA 4F4KA 1SL2A 5K14A 2V0NA 1X9MA 4OKEA 1RTDA 4PQUA 4Z4CA 1RT1B 2Z1HA 1BGXT 1J9AA 3EYZA 4IKAA 3AV9A 3TAMA 1D8YA 2PZSA 4IBNA 1DLOB 2X74A 1C1AA 4FLTA 4B08A 5KFHA 1KVAA 3FDSA 4K4TA 4J9PA 1HPZA 4F2RA 3AVHA 2DTUA 1X9SA 2F8EX 3AO2A 4DWIA 5KFRA 4DG1B 1RDCA 3I0RA 2P5GA 3MR5A 1X1PA 4KHMA 4ZVEA 4IQXA 3IGNA 4EO8A 4FK2A 3C6UB 5KFNA 5L9XA 2X78A 4CIEA 5F9LA 4FZZA 3NAIA 3HPGA 2XO7A 4NLOA 1CZBA 1WSEA 1YVUA 5HRPA 3V9ZA 3HVTA 4M3TA 3K5MA 2XCPA 3V6DA 4O0JA 2BANA 3VQ6A 3KK1A 4DF8A 4W5QA 2E9ZA 3SV4A 3LP2A 2YKNA 4Z4HA 1ZYQA 3V6HA 4E7LA 4ECSA 3P5JA 3RRHA 4BE2A 1EETA 2UUWA 1FK9A 4BWJA 5FRMA 4MFBA 1IM4A 5HROA 1JLBB 1ASWA 1TVRA 2YNHB 4HUGA 3H98A 5L1LA 2HW3A 2W9CB 2C22A 4MK7A 5DG7A 1FXXA 2JEFA 3LZIA 2IM1A 4FJGA 1N4LA 2JEIA 4CJKA 1S1WB 2V4QA 4QOZB 4NLVA 1HYVA 4B9NA 4EZ9A 4FK4A 4IRKA 4IG0A 3KK2A 1L3SA 4NLWA 1S0OA 3NBPA 3LZJA 4CJVA 3G6XA 2AU0A 1RT2A 1FKOB 4FZXC 2IJFA 3MFHA 4O4GB 1BI4A 4CHQA 2RKIA 2OPRA 4ID5A 3QGHA 3NF7A 3ASMA 3PW0A 4QWEA 3Q8RB 3TQ1A 4CK2A 3G6YA 5CYQA 4AH9A 2HHXA 1NHUA 1CZ9A 1UA0A 1REVA 3SNNA 4CIGA 3IS9A 4CCHA 2EHGA 5EU7A 3IGVA 4Q0BA 4FBUA 4FM1A 4KTWA 1U04A 3KLHA 4J2EA 5F8MA 1A5WA 3SZ2A 4QW8A 2J6SA 4O44A 2KQ2A 5FROA 3RWUA 4C8KA 2G8VA 4DQSA 1TV6A 2J6UA 3CWJA 4CJRA 4ECXA 4ZHRA 4IH5A 1VRTA 1BHLA 1D1UA 1VSDA 4KB0A 3MEGA 2V9WA 4RW6A 1NK0A 3OSPA 1RT3A 4XPEA 1C0TA 3ULDA 3PW2A 2I5JA 4ZP6A 4M3ZA 1IKXA 1DTQA 2IJNA 1W25A 2E9TA 2RPIA 2D0BA 2VG6A 4ZPDA 3AVFA 3H5XA 4L8RB 2HNYA 1U4BA 5KT6A 4KO0A 3WNHA 3T5JA 2FJWA 3VQ9A 1JIHA 4H4MB 3TWHA 3L3VA 4CJ5A 1U48A 5F8LA 1RT1A 3NGYA 5KFFA 4K4WA 3L2VA 2HHSA 4DQQA 4ZPBA 4RW7B 1XR7A 2D3ZA 3SPYA 4ED1A 1SKWA 3NCIA 1SH0A 1WLJA 4B9VA 3M8QB 3THVA 4RNOA 2XI2A 3T3FA 5D3GB 4OKJA 4BDZA 4K4XA 3T5KA 1N48A 3NDKA 3QIDA 1BQMB 5KFJA 3ZSYA 4KHSA 1RDBA 3O3GA 3VA0A 3I5BA 3C6UA 1RYSA 4ED2A 1TL3B 5HRSA 3PW4A 5I42B 2WB4A 3UIQA 5FDLB 4I9LA 2G8FA 5J2QB 2HHQA 5KFBA 1UA1A 2E9RX 2DFHA 1KHVA 3BGRB 4QWAA 5J1EB 1TP7A 4LQ9A 3KLVA 4TYAA 4JV1A 3ISNC 4AILC 4FLVA 1VSHA 3KLFB 4Y3CA 4TYBA 1S1UB 2A1RA 5EWGA 4FS1A 5DGAA 1QTMA 3KLGB 3TAEA 1U09A 4ICLB 4ED6A 3AO5A 3SYZA 4ZPCA 3AO1A 3M8RA 1L3UA 1DTTB 3N6MA 4J2BA 3H5UA 2O4GA 1VSMA 1GX6A 1RBUA 5CYMB 3RR7A 2I1RA 4O3RA 4LSLA 2FVCA 1KLMB 1JLBA 2YNHA 1J5OB 2BRLA 4LH4A 4CEZA 4O3PA 3QZ8A 4J9OA 2UVWA 4IH6A 2D0CA 2W9CA 3PW5A 5SZTA 1WAFA 1ZBLA 4HCBA 3EZUA 4ZTFA 1Q9XA 1RDDA 4KKOB 3GYNA 1S1WA 3HJFA 4DFJA 1RDRA 4EBCA 4H8KA 3DM2B 4MH8A 4W5OA 2AWZA 5KG2A 3LWMA 1ITGA 5DLGA 2QKBA 4HCCA 4DTPA 4O4GA 3BQ1A 2UVUA 2G8KA 1ZTWA 4CF1A 3BQ2A 5KFUA 2FLPA 4FJJA 2ITGA 1QAIA 1N6QB 3DLKB 4PQUB 2AX0A 4HUFA 2KW4A 4ZVHA 4HHTA 1WSIA 3NH0A 4CEBA 2IAJB 3CDUA 3G6VA 3KD5E 4OL8A 3HYFA 4TLRA 2QV6A 1S48A 4RNHA 4MIAA 1KVBA 4CJ3A 3VQ7A 4RW4B 4R8UB 4DTOA 2CKWA 4CHOA 4J9QA 4DLEA 2W7PA 3CO9A 2BDPA 1JX4A 4FS2A 1G15A 4B8CA 4RUAA 3OS0A 4N76A 4I7FA 4CF8A 1S9FA 3SUPA 3OLBA 3JSMA 3CJ0A 1GOAA 4QPXA 4GMJB 2ILZA 2XY6A 3OSNA 4YMEA 4CJUA 5KFZA 4WZQA 3TAPA 3TANA 5HRRA 3DOLB 1QS4A 4ECRA 1I3AA 1NK6A 4FW2A 1CSJA 3BDPA 2HB5A 4ZP7A 4RU9A 3V1OA 4J2AA 4FJKA 5DQHA 3AO4A 3T5LA 1WNEA 4KE5A 3QINA 4OLAA 4NRTA 4CJQA 1RILA 4CK3A 2O5DA 5CZ2A 3OYIA 3LP2B 3HO1A 4F8RA 4IG3B 3TI0A 2RF2B 1HRHA 2F8TA 4ECVA 1TK5A 4FJNA 3U3YA 5D3GA 2FVSA 4TY8A 3DLRA 3LP1B 3O4QA 1SL0A 3CVKA 2XCAA 3L2QA 4MFBB 4NYFA 2IM2A 5HROB 1BQMA 4J9LA 2Y1IA 1B9FA 1TVRB 3T1AA 4WFXA 1EKEA 4BDYA 3RAXA 2IS3A 4ECUA 1S9GA 2WK4A 2KZZA 4EP4A 4WYLA 2R8GA 3OHBA 4RW9A 1K6YA 5FDLA 2HNDA 4WXOA 3PY8A 3L3UA 3GV5B 3KK2B 3GQCA 3BGRA 3NBPB 4E0DA 4CEQA 5J1EA 4CIFA 2IBKA 2B6AB 1TK0A 1S1UA 3CM5A 3UQSA 1NNDA 2ZQBA 3KLGA 4JS5A 4C8NA 3MEEB 3NHGA 1TK8A 3IRXB 1DTTA 3PJWA 5F8IA 4DFMA 1REVB 4FLUA 3OYBA 4TQRA 4DTMA 1TKDA 3L2WA 3P1GA 2ASLA 3OYAA 3OYLA 3G10A 3SI8A 2R2SA 5CYMA 1WAJA 2GV9A 3WNEA 4KRFA 4G1QA 2AGQA 1KLMA 3QIOA 2RN2A 1J5OA 4F2SA 4IFVB 3RB3A 4O44B 3IAYA 1S4FA 3VQBA 3NF8A 4I2QB 4DU1A 4NRUA 4KHUA 4KKOA 1WNSA 1VRTB 3MEGB 1WN7A 2XRIA 3CJ3A 3AA5X 2IDOA 3DM2A 5KT3A 1S1VB 3VN5A 4DL4A 1IKXB 2E6LA 3D45A 3QERA 1RAJA 4YR3A 5CY4A 2W8LA 1JXBA 3MECB 1KTQA 4J2DA 1T7PA 4RG8A 4Q43A 4LY7A 3V1QA 2UVVA 4ELTA 5F8NA 3AVCA 4U7CA 4AHSA 1KSPA 2YNGA 1N6QA 3DLKA 3CJ4A 4QW9A 5EUHA 5C42B 1YT3A 2G8IA 4K4UA 2IAJA 1BQNB 3L8BA 3GIIA 4C8OA 3OS1A 3MXMA 1UAXA 4KAZA 4RW4A 3PV8A 4R8UA 2ETJA 2G8HA 3PX0A 2C2EA 4B9UA 4NCBA 4WZMA 1O1WA 5T7BA 1VRUB 3RBEA 4KSEB 1S5JA 3PR5B 3RTVA 4JRPA 4ZVGA 3GV8B 1TL1A 4Q8FA 3EPGA 3ZT4A 4BDPA 5JXSA 5T14A 4E7HA 1ZBIA 2HHVA 2W42A 4O55A 3DOLA 1SH2A 1Q8IA 4JV0A 4FJXA 2OZMA 5F9NA 3K57A 4DFKA 1ZETA 4ZP8A 2IM0A 1NJWA 2W9AA 5KFEA 3QEIA 1YTUA 1RT5A 1C6VA 4E3SA 3RMDA 1J53A 2YHAA 1VSIA 4CK1A 2FBVA 4CEAA 1IKVA 3OL8A 1VSFA 2HVIA 2PYLA 3IN5A 4IG3A 3NF9A 2RF2A 2YNIA 3KKRA 4OKKA 5KFQA 2WCXA 3SQ2A 4Y34A 3TVKA 3RBDA 2WRMA 2XY7A 3LP1A 4EEYA 4Q44A 2B4JA 4LSLB 2HVHA 3VQDA 4FJIA 4EP5A 2DPJA 3C94A 3T5HA 1D9FA 4GW6A 4DQIA 4KBIA 2VWJA 1U45A 3H4DA 5KG6A 4FM2A 5L1KA 3CFRA 3VQ4A 1RBTA 1HJRA 1GX5A 4HUEA 5KG5A 3FSIA 4DL5A 4FLZA 4FJ8A 2X6NA 2DFFA 4N47A 4M94A 2B6AA 3QEVA 3L2UA 2VA3A 3OHAA 4XIUA 1RTHB 1T8EA 4W5TA 3MEEA 2VG5B 3TAFA 3IRXA 1ASUA 2OPSA 4NYNA 4YR2A 5EWFA 2FBTA 3AA2A 3DOKB 3VQPA 3KMQA 1SV5A 3DYAA 5KT2A 3NGDA 4FK0A 1JLFA 4KFBB 4B9TA 4CFCA 2YV0X 3DLEB 2FJXA 1L3TA 2GBZA 1Z25A 2R8HA 3CJ2A 1XC9A 4IFVA 2BRKA 4CFBA 4O3QA 3UDLA 4I2QA 4KHWA 1CXQA 3Q8QB 4WFZA 3LAMA 1VSKA 4CHNA 5DGBA 2P1JA 5CZ1A 2RDIA 4QAGA 1T3NA 1T03A 3DRSB 4ECWA 4I7FB 1HMVA 1S1VA 3JSMB 3OJSA 2FBXA 4FJ9A 4CJLA 3MECA 1BIUA 3RRGA 4CF2A 4AHUA 3V81A 5KFIA 2PYJA 1ZBHA 3PZPA 4CEOA 3OYNA 4CGIA 5KG3A 3HVAA 4K4SA 3QEPA 4H4OA 1GOBA 1GOCA 3S3MA 3O3FA 3VQAA 4CEEA 5C42A 2GIRA 5KFVA 1RBVA 4M3RA 1BQNA 1JL1A 2G8UA 1KVCA 4DTUA 3NH2A 3PVXA 4IR1A 4PA1A 5I3UA 4DLGA 4FLWA 4FJ5A 1VRUA 4TY8B 2WTFA 1RTIA 3SUQA 3L2RA 5HBMB 2BQUA 4YFUA 3ZSXA 3SUOA 1OS5A 1SUQA 1S9GB 3FQKA 5KFMA 1VSEA 3HHKA 4RW9B 4NLXA 4DTSA 1LWCB 3M9NB 2HNDB 3DDKA 4ELUA 2XWYA 2FVPA 3CM6A 1IKYB 3PR4A 1S1XB 3PUFA 4OPJA 2HHWA 4ZPAA 3BREA 1VSLA 1NKEA 1QSLA 1NK5A 3KD1E 5KFDA 3ZSRA 4ELVA 3KNAA 4MKBA 2D41A 4J9RA 1VK0A 2G8WA 1N56A 3QYYA 3MR3A 4ZVFA 4IR9A 5KRSA 1IG9A 2ATLA 4G1QB 2R8JA 2YNFB 3NF6A 3RAQA 3H40A 1C0UB 3OLAA 4LD0A 1EP4B 4RNNA 4K4VA 1ZBFA 3AVAA 3T19A 1B92A 3PX6A 4EBDA 4DTJA 5KT4A 1S97A 3PX4A 4Q5VA 3ICLA 1XR6A 3RR8A 4KV8B 2Y1JA 3QNOA 3F9KA 3KOAA 3HXMA 3QLHB 3PO5A 3C95A 3HKWA 1RTHA 3HVWA 4YNQA 2VG5A 3LPUA 4EO6A 2YNGB 3MEDB 2ASJA 1BL3A 3KK3B 2QKKA 3GILA 4KREA 4PUOB 3DOKA 1Q9YA 4KFBA 3I5CA 1K1QA 4JRQA 3DLEA 4ECTA 4K8XA 2XY5A 4KHNA 4FLYA 4ECZA 1I6JA 3QNNA 4QWBA 4FLXA 3EPIA 3IG1A 4IRDA 4E1MA 2VWKA 2VG7A 5JS1A 5F8HA 3FFIA 5FRNA 3DRSA 3N6LA 2VA2A 1TL1B 4F3OA 2CJQA 5KFLA 5KG1A 3KIOA 4DTXA 3ZSOA 3ZT0A 4I2PB 4TY9A 2XY8A 3H08A 5DK5A 1HYSA 3TABA 1HNIB 1S49A 3O4NA 3UR0A 5KRTA 2DY4A 4Z4EA 5J2MB 4Q8EA 4K4ZA 4B3OB 3M9MB 4NLUA 2V4RA 2R2UA 3Q8SB 1RT5B 2HHUA 2XGPA 1WSHA 3S3NA 2GIQA 4XO0A 1LWEB 1MMLA 3K5NA 3TR8A 1IKVB 2JGUA 4YP3A 3OVNA 3G0ZA 4BWMA 3OS2A 1JLGA 3NAHA 2JEJA 2YNIB 4CJEA 2IOCA 3F73A 1CLQA 1RT7B 3I8DA 3E51A 2OH2A 2WONB 1TKTA 4LQ3A 3GV7B 1QE1B 3ALYA 5HBMA 4EYIB 4FJHA 2HWIA 4FXDA 3I0SA 4RUCA 1QSYA 4E1NA 3LALA 3V9WA 2AX1A 3B6PA 5HP1B 2JC1A 1QUVA 3DLGB 4CF9A 2WOMB 3LP0B 2Z1GA 1LWCA 3ZCMA 2ZE2B 3V4IA 3V9UA 1JLEB 2IMWP 3MF5A 3NFAA 3B6OA 1IKYA 2O4IA 1S1XA 5DG8A 4CEFA 3HP6A 1HQEB 1C2PA 2E6MA 1RT4B 2BR0A 4G3IA 1B9DA 4FVMA 4NYZA 2ASDA 2OPSB 4B9LA 4Z0UA 2AQ4A 2WHOA 1BISA 2RDJA 3SQ0A 1SV5B 3DYAB 4DSKA 1JLCB 2OA8A 1JLFB 4MK9A 1Y97A 4ZP9A 1LW2A 3N6NA 3BQ0A 2YNFA 5DG9A 3ZSWA 4FJ7A 1S9EB 1C0UA 1BIZA 1EP4A 4FM0A 4FZYA 1TKXB 5C5JA 3OYCA 2B5JB 4QWCA 3JYTB 1XHXA 3DI6A 1TQLA 4NLYA 3K58A 3I5AA 3CYMA 2F96A 4URQU 3OYEA 4QCLA 1T03B 4MQ3A 4W5RA 1XHZA 1HMVB 4BE0A 1SKSA 4YR0A 5J2PB 3WNGA 4KV8A 3UPFA 1WSJA 4DU4A 1IO2A 1UWBB 4CHPA 4DSIA 3V81B 1HNVB 3QLHA 3NMAA 2Z1JA 4DSJA 5L1IA 4J9NA 4GC7A 1L3VA 4OJRA 4CFAA 3DRRA 4H4OB 3LANA 3MEDA 4JS4A 4Q45A 4NLTA 2OPPB 3KK3A 2FVQA 4PUOA 1LAVA 3AVIA 4OVLA 5KT7A 3H59A 3VQ8A 3CDEA 4E7IA 1FKPB 2BE2B 4DU3A 2W9BB 3C6TA 3NKYA 2JLEA 4CGGA 3DRPB 3KLEA 3SFUA 1U47A 4M41A 4ED3A 1LAWA 3QEWA 2ZD1B 3G86A 5I3UB 3TARA 3QESA 4F50A 4DL3A 1RTIB 1C1BA 3AVGA 3HPOA 1WSGA 3DLBA 2EC0A 4RZRA 4CFDA 3VQCA 4N41A 4NLSA 4C8MA 2C2RA 2D0AA 3SCXA 1SUQB 1NKBA 1D0EA 4I2PA 3H4BA 1LW0A 3BSAA 2FC0A 1HNIA 2X6SA 3KHLA 1ZBUA 3V9SA 2UUTA 3OYMA 1RYRA 4QWDA 4B9MA 3LPTA 3SQ4A 5J2MA 4B3OA 1L5UA 1BCMA 3GIJA 1HYZA 3ISND 4K8ZA 1RBRA 1QQCA 3RMAA 3K2PA 1LWEA 1NK7A 3RB4A 2FJVA 1SH3A 3TAQA 1SKRA 1I39A 2D5RA 4CJSA 2OPQA 4F4XA 4ED0A 2AJQA 3V1RA 4E7KA 4F4WA 2BQRA 4M42A 2QE5A 1RT7A 1S6QB 1TKZB 1IKWA 1RTJB 4CE9A 4F4YA 4DSLA 2WONA 3ZT3A 3VQSA 5JS2A 4NLDA 1QE1A 4EYHB 4NCGB 5C24B 1JLQB 3NGZA 1XR5A 4K50A 4TSXA 5KT5A 5KFOA 2HNZB 4E89A 4NCAA 4ECQA 5HRNA 1A5XA 4IKFA 4AHCA 4IFYB 5HP1A 5HLFB 3QZ7A 3DLGA 1T05B 2WOMA 3LP0A 4E19A 4Y2AA 4O3SA 3LDSA 3E01B 2YHBA 2R8IA 3MXJA 2ZE2A 3BJYA 1JLEA 4DSEA 3OYHA 3NGIA 4KTZA 4OLBA 3GIKA 3KHRA 1RT6B 1S6PA 4ZTJA 4RW8B 1HQEA 3QETA 4JLHA 1N5YA 3HL8A 1RT4A
chains in the Genus database with same CATH superfamily
3AA8A 4KBOA 3TJ9A 1IBKJ 4GY2B 3CCQN 2E2PA 2P2CB 4FCYA 4OYXA 3O08A 3IFRA 4XPCA 3MAQA 1MWMA 1R8PA 3A1YG 4I68A 2UUAF 3U9ZA 3KJVA 3W9JA 5KI6A 2C2NA 3K5OA 2FD2A 1C1CB 3PEHA 4CECA 1VDHA 2F8MA 4K5SA 5CHCB 3W1YC 3ZX3A 3A2FA 2R7XA 5B8HA 1JJ2M 3ISZA 1YK9A 1YKWA 3L7OA 5GADI 4R5PB 4OI1A 2FC9A 1MWZA 2FLLA 4CRJA 2N3OA 4NXNK 1R8AA 3PTWA 4KPYA 3I8BA 2UUCF 2RQCA 3ZZYA 4LF7F 3M9OB 4ZMMA 2HZVA 1Q82T 3TPQA 4AHTA 3NH1A 4I9QA 4AHVA 4IOBA 1JL2A 4ENOA 3OYGA 2GC8A 1UKUA 2DY9A 1JLGB 2EC2A 3ETOA 4IH7A 2P9SB 2VH7A 5AQUA 4B17A 2OYQA 4B3TK 4KB7A 1D9DA 2BQ3A 3MAAB 2C2DA 5KGXA 2JC0A 4DR4K 2QSWA 4R0EA 4GVBA 5JLHA 3UNYA 3I0SB 1IBLF 1RK8A 3TUIC 1NJIO 3D1OA 2PC6A 5DRKA 2FLNA 2ROEA 4DMZA 1VC5A 5LXRA 3V4IB 1JXEA 2WSCC 3TUJC 3VF6A 5KG4A 5BJRA 1VQMS 2R7TA 4DV3K 3B82A 3RBXA 3ZT1A 1K9MT 1PBAA 1H38A 2MQMA 4NXNJ 2BX6A 3SEOA 4Z7CA 3IBWA 2DGXA 2KFYA 2VQEK 3AFGA 5FPMA 3FRZA 3RU0A 3MPUB 3EE3A 4Q2LA 4J9KA 3QGIA 1RWUA 1WEZA 1RCHA 4DOZA 1RTJA 2HS4A 4Z4GA 4WE1B 2ZVIA 1PJ7A 1JLQA 1F21A 2BW2A 1CVJA 4DV6K 4UY8T 4CO1A 2GUPA 2Y0SD 4IFYA 1N5QA 1NLVA 4B3TJ 1Q8BA 1NJZA 1VMBA 3QMLA 2YKMB 3I56N 4FPBA 1W2BR 2DT9A 4DR4J 1RJJA 3Q23A 1YG0A 1RT6A 1KONA 4B1UB 2R7QA 1FKAF 1HARA 3HD1A 3KJQB 1TFWA 4CQ1A 2PY5A 3F41A 2G0IA 3OW2R 4M1KA 1SJ3P 4DV3J 1SBRA 4HVZA 1UPMB 4DTRA 2XEXA 1FKOA 3C6TB 2VQEJ 4FWKA 4LIRA 1V3RA 3KLEB 4YDUA 2V8GA 2ZKUA 4RLEA 3V6JA 2QWMA 4GVMA 1QHTA 2A1SA 3A8KA 1O0PA 3MWBA 3ZETB 1NMNA 4FJLA 2ZOFA 5C25A 3AOCA 2HBKA 3TX0A 3D6TB 4DV6J 2E2NA 1HPZB 3H45C 2COLA 5IQQA 3CUNA 4HT7A 1N0UA 1VIXA 3J80O 2HLUA 5F1XA 2HMPA 3I0RB 4B9SA 3CJ5A 4RWXA 1NRKA 2HG4A 4JI3F 3X1LB 4KH6A 4X2BA 2DGOA 4CGDA 4CHZA 3NGRA 1TGOA 4FXWA 4O4RA 8AT1B 2M5YA 4BCAA 2HBRB 1ZTTA 4ZK7M 2IRUA 3GL1A 1EO1A 3VAKA 4FJMA 1T3VA 3RSEA 2B4OA 2GUIA 2OPQB 4LSNA 1WG4A 1VC0A 4BRAA 3CCMS 4P7VA 4J7CA 3TAGA 2AEJA 4JKAA 3O3HA 2H3EB 4Z2XA 4ED8A 1OSCA 1UZHA 4QR2A 1J6ZA 1UVMA 4I6MA 3L6QA 3FK4A 3M8QA 3CCQS 4DBQA 2GO8A 4K7QA 3QGGA 4YB5A 2E66A 4WYWA 4JI6F 4NXMK 2KZMA 3T1YK 2D7SA 4NZ0A 4KC5A 2B51A 1YZ7A 2AGOA 1S57A 5THWA 4JUZA 1V3ZA 4UF4A 3VGMA 3V2UC 3BSNA 3FCVA 1PJ5A 3ZZOA 4Z4IA 1GTEA 4HYKA 4WQ4C 3H2LA 4C8LA 1Z4UA 1JK9B 4KPCA 1CJUB 2BJ1A 3U6FA 3DMJB 3H5SA 1R0AA 5M1QA 3O6WA 3IWNC 1G99A 2V50A 1TAQA 1RT2B 2B0GA 1IBMF 3EL2A 4E1JA 1YJNS 1S1TB 1F2HA 4HTUA 1RWXB 3HF5A 4ECYA 3M8PA 4LH5A 1WHYA 2DGQA 3H42A 3CQXA 4NLPA 2QWPA 4WTYA 4FF4A 4AXJA 4WFNL 4DX7A 4M3XA 4URGA 4A8YA 3CFOA 4ILGB 3VQEA 3R97A 2P9LA 1ZZNA 1Y11A 5CZXA 2AYMA 4OX9F 4NXMJ 3T1YJ 3VESA 1UL3A 4ZPWR 5HVHA 4DS4A 2VFSA 1C0TB 2MQOA 4JN4A 3KG0A 2V52B 3MR7A 3D67A 3ENQA 1F5AA 2JZ5A 2G0JA 4JYAK 5J1PA 2HNYB 4M5IA 1U1QA 4BQLA 5KFGA 1WOOA 2AP1A 4JD2A 3QO9A 1KKHA 4KTQA 2Z1IA 1ZPWX 4PZVA 4KQZA 3VAFA 5K14A 3QJPA 1RTDA 4PQUA 5CYJA 4Z4CA 1RT1B 1BGXT 2BTFA 2EVZA 2E5JA 2WVDA 3EYZA 4DV1F 5G4DA 3AV9A 2H3GX 3TAMA 4ZLJA 3NY0A 1CS4B 2FSNA 4H0XB 4J9UE 4X65F 5KFHA 2F8HA 1KVAA 1H7WA 5LJ5Y 4BC2A 2EKYA 1ZH5A 1UP1A 3AVHA 5AFUA 5KAKA 2DTUA 3NNAA 1KTVA 4ES2A 5KFRA 3HSGA 2DGVA 3FZ2A 1ILYA 1S6OA 1BWVA 5DDOC 5C12A 4FVCA 5AQRA 2VFRA 4IQXA 2BMBA 1HPMA 3IGNA 3B8AX 5KFNA 4CIEA 2AYGA 1HD0A 3VWSA 4X66K 3I56S 2YJFA 3W3SA 2HOEA 3KHYA 4FWPA 4JYAJ 3MCMA 4IWVA 3WUHA 3VGTA 1F2GA 1WHWA 4JKBA 5D0EA 4W5QA 2F4VK 2E9ZA 3SV4A 3LP2A 3QMQA 3TOQA 4ECSA 2DR9A 3RRHA 1H3DA 2YWKA 4QYZK 4BWJA 4ZVTB 3GONA 1IWAA 2F9DA 1IM4A 2N7CA 1U1OA 2FIUA 3HHLA 4JKDA 3B4DA 4HUGA 2DIVA 2RT3A 5L1LA 1Y5LB 4K59A 4MK7A 5DG7A 1FXXA 4X4UA 3N4PA 3MUMP 3LZIA 2IM1A 1CULB 4F02A 1N4LA 2JEIA 4FJGA 1OYDA 4NLVA 4QOZB 4EZ9A 2KG0A 1S7IA 1Z6RA 3FGUA 2HSEB 2LDYA 5H9EK 1NPPA 2LDIA 4HH1A 3G6XA 2HWTA 4OJ3A 4O4GB 1BI4A 1Q95G 1IN0A 3ASMA 4YHHK 4X66J 2HFSA 3G6YA 5CYQA 4AH9A 4XH5A 5G0RB 2UUCK 5E33A 4CIGA 3IS9A 2CUYA 4FBUA 2F4VJ 3ENWA 3C6AA 2PFUA 4P9SA 4O44A 3KYLA 4PRFA 3RWUA 2UZAA 1R6VA 2G8VA 3CWJA 4ECXA 4IH5A 2QRRA 4QYZJ 1BHLA 1D1UA 4KB0A 3MEGA 2CPHA 3OSPA 1RT3A 3VERA 1VQ7S 2UXBF 2I5JA 3DJCA 1VJQA 3EVOA 3LM9A 1W25A 2GQ2A 3AVFA 3H5XA 3WNHA 2HRUA 3DWLA 4U7UD 4H4MB 2E1YA 3L3VA 3KFWX 1NSAA 2FHOB 4O0NA 5F8LA 2YY3A 5H9EJ 2CPYA 2N7YA 1HBNB 3L2VA 4OHWA 4DQQA 1RBLA 2CADA 4RW7B 1XR7A 4YHHJ 2X1AA 1LEOA 3PG9A 4B9VA 2BZ2A 3T3FA 5AQVA 1WF0A 1FNMA 3OVSA 3O1LA 4A61A 1VQSA 2QL5B 1P1TA 2W2OP 4S0MA 1IUJA 3HT0A 1HBUA 3BF1A 3U1NA 1AT1B 1MLAA 3NDKA 2DISA 1BQMB 3QIDA 2BXJA 4KHSA 2CQBA 3D6FB 4M63A 2Q3PA 1H1VA 4IJAA 3VA0A 1X5TA 3C6UA 2OUGA 1X31C 1LOTB 1LQ9A 3VHQA 4F36A 3H2UB 4DV2K 2WB4A 3UIQA 4I9LA 5J2QB 3JS6A 4PXEA 1DZ5A 1F5BA 3IFEA 2CPEA 1RSCA 2EW9A 3ISNC 4FLVA 2E1CA 4G1IA 3A3OB 4ZIWA 1KD1T 1OVYA 5DGAA 3EICA 1WOSA 3CPWR 1U09A 4ZPCA 2HIQA 2P9NB 2XMTA 2VBZA 2C42A 4LFAF 2KRRA 4BRLA 1KEKA 2A3ZA 1BOTO 2J9EA 3RR7A 4NL5A 4LSLA 1JLBA 2YNHA 4O3PA 2XS5A 1KC8O 1BQXA 2RSQA 1ZBLA 3EZUA 2VD3A 5BR8K 2WSEC 1EB0A 1AFIA 4DFJA 1L3KA 1X4GA 1RAEB 4H8KA 3SDEB 2PBDA 3LPEA 1E4GT 3A3PB 2OP5A 3WIVA 4A8QA 3R8EA 4DZ6A 2BJDA 1QJHA 1WEXA 5AXKA 4CYUB 4UZCA 3BQ1A 2UVUA 2CXEA 2GVDB 1ZTWA 5A8RA 4DV2J 4X64K 2QC3A 1B0PA 4GO5X 1OH8A 3LQVA 2J7UA 2KKZA 2RB7A 2AX0A 3S7RA 1TL7B 4JHDB 2PN6A 4Y2MA 1WSIA 3NH0A 1XMOF 5HOOA 2YWGA 4OL8A 3QBXA 2I8EA 2B3TB 1TMMA 3VQ7A 4RW4B 4DTOA 1N88A 4DX5A 4PCQA 3TJAA 4X84A 4CHOA 1VQLS 4DLEA 3G8TA 2Y8YA 5E84A 4AF1A 3D2EB 4BC5A 2BDPA 1G15A 4FS2A 5E3PA 4B8CA 4N76A 2AJ4A 1R8HA 3TU5A 1HKAA 4I69A 2NRZA 3TAPA 5HRRA 5BR8J 2EEYA 1MWYA 1NK6A 4LF8K 1KOOA 1CSJA 1GLAG 2HB5A 3CJ1A 3G82A 2MKCA 3W7BA 4RU9A 4FJKA 2L9NA 2IYGA 4KE5A 3QINA 3R5CA 4NRTA 1RILA 5HQ8A 1YJUA 1SQKA 1N52B 3M2RB 4X64J 3OYIA 2XSJB 2VASA 3HSDA 1W7WA 4YOVA 3LDQA 4DQ8A 1GAOA 5A2QY 3F2KA 2G2OA 3ZZPA 4WJBA 4FJNA 3G25A 1GFWB 2UYTA 4ZCLA 3K17A 3PSFA 3D7SB 1NUEA 2QIFA 1TVRB 4WFXA 3OTOK 4NLBA 3R27A 1EKEA 4BDYA 3RAXA 2NUHA 4ECUA 1UMJA 1ZM9A 2KZZA 3DOMB 3EGWB 2E1ZA 4WYLA 3OHBA 4RW9A 1K6YA 2RU3A 5AQMA 2HNDA 2OD4A 3L3UA 1EKRA 3BGRA 1G3OA 4H0YB 3KVGA 2DYAA 1YJWS 4C1NK 3VAJA 3OXGA 2B6AB 1AUSL 3WIUA 2ZEJA 2E5HA 3AD9C 2ZQBA 4LF8J 2K3KA 4YEAA 3ETMA 4H0TB 2ASPA 3MEEB 1TK8A 1UFWA 2CDRB 4PYDA 3IRXB 3ZO7A 1T0TV 3I82A 1REVB 1FNXH 4FLUA 3OYBA 3Q89A 4TQRA 2HK3A 4FYVB 1N33F 3OYAA 3SI8A 2R2SA 5AQLA 1C0GA 2JLGA 3P39A 1S12A 1FJGK 2H51B 1PG5B 4Y2KA 2KG1A 2B9EA 2DO0A 4K2JA 1Q81O 2Y9HA 1WNSA 4JKGB 1VRTB 5D4PA 1IJJA 3LDOA 4AXIA 2WFBA 4DV7K 1IKXB 4YR3A 3OTOJ 2PGCA 5A2QU 3DXSX 5CY4A 1PGZA 1KTQA 1UEKA 1T7PA 3NMRA 4H03B 5JVGL 4CZKA 1SC3B 2ACMA 2Q0UA 5IT0A 4F0MA 3L0QA 2WBMA 4WTOB 3V5RA 4FWRA 1HR0F 4G9ZA 1N6QA 3MMCA 5AQKA 3VEOA 5C42B 1ELOA 2DNYA 2G8IA 1FF2A 2F63A 1BQNB 1IXKA 1YAGA 2Q1LA 1UAXA 1A6LA 4KAZA 4BBYA 5AQOA 2C2EA 5KPZA 4NCBA 3WQUA 2A10A 2O8BA 5DM6Q 3TR5A 1ZPVA 2FUG9 1VRUB 1CQNA 1NDPA 3BB5A 4KSEB 2W41A 1F9EB 1FJGJ 4BRCA 3MM5A 1TL1A 2NNWA 3ILOA 4Q8FA 2K1RB 5AQQA 2MKJA 3M2VB 5T14A 3H20A 4USKA 4EI2A 4UY85 3W8GA 4E7HA 4O55A 4JV0A 4DR6F 2RQKA 1NSQA 1I51B 1RDWX 2W9AA 2ROPA 4DV7J 1RADB 1WF2A 1YTUA 1RB0A 3BM7A 1T9WA 3RMDA 2YHAA 3R5GA 1VSIA 4CK1A 1C0FA 2ZHOA 2NRRA 1VQ6S 2HVIA 3IN5A 4IG3A 4LFCK 4V19X 2XWXA 1GMWD 1LFPA 3I9ZA 4LREA 4ZLPA 2CJBA 3LP1A 3U1LA 4Q44A 2UXCK 2OAUA 1J5EF 4IDHA 5LY3A 1K0TA 2HVHA 4FJIA 1RHUB 4H4KA 1KQFB 2LECA 1S0VA 4KY3A 3O1BA 2QTDA 4PWUA 1NMEB 1CJVA 3NXZA 2NYHA 2CQDA 3CFRA 1HJRA 4HUEA 4QR0A 4KHPK 4L75A 1XN9A 3L4IA 2G9OA 2DPNA 2M8HA 3UN2A 4M94A 1VBKA 2VBWA 2VA3A 4FWNA 4XIUA 3DU6A 4BC3A 2QYCA 2P5VA 3MCAB 4YR2A 3AA2A 1XNRF 3VQPA 3DYAA 4FF2A 3RZAA 3NGDA 1JLFA 4IFEA 3VF0B 3WX4A 2CG4A 3FBBA 5DZ7A 2GBZA 5DJBA 1SQEA 3GCXP 3FCWA 4LFCJ 5E3RA 3R5DA 4M5HA 3Q8QB 4HTJA 1G6BA 5DGBA 2P1JA 1NGEA 3THWB 2UXCJ 5LOQA 3MAHA 4QAGA 3BN7A 4I7FB 3OJSA 3GDQA 4FJ9A 2DJWA 4LSZB 2D1KA 3G71N 4AHUA 2MQQA 2V8PA 1ZBHA 4OZ3A 3OVAA 3OYNA 1OH7A 4K4SA 3WBZA 2DVIA 3UKRB 1GOBA 3S3MA 4ZIVA 4KHPJ 3CC2N 3O3FA 4M5NA 3JSBA 4CEEA 3BZKA 2LLZA 1KN6A 2LEPA 4OHVA 1I3OB 4E2FB 3EXYA 1KVCA 3LGNA 3QFWA 3ZNJ1 3PVXA 4ZCIA 3R2DJ 5C2GA 3PXGa 4DLGA 5T7LA 2HBYB 5IXUA 1TR0A 3SUQA 2DXFA 2WBNA 2RQMA 2IYIA 3ELHA 2BQUA 2MZ1A 2HS3A 3T9NA 1S9GB 1NLKL 1VSEA 4NLXA 1PCAA 3CMEN 1LWCB 1SJRA 1NGGA 3CM6A 2J8SA 4QR1A 1S1XB 4WCEQ 2FGCA 4OPJA 4ZPAA 1ULRA 3O2IA 2YHXA 1Z2LA 5DM7L 3PRVA 1Q5VA 4ED5A 2DNHA 1QSLA 2YWHA 1AZSB 3VTIA 2J5AA 3CPEA 5KFDA 4PKDB 2LQ8A 3RYLA 2VCPA 1N34F 4YN3B 1VBZA 3MR3A 4USJC 4IR9A 3QT5A 3UE5A 3PRDA 5KRSA 4TU8A 4A8WA 2CNNB 2XTJP 4OPHA 5FPNA 2EG1A 2FXUA 2ZZNA 3RAQA 2IIHA 3BP8A 1R31A 1J27A 2DO4A 3HHEA 2CYYA 3CC7N 5K8MA 1B92A 3GLJA 1I94K 1QHAA 4BGAA 3KDNA 3VETA 4DTJA 3T69A 1UJ6A 4JK8A 3ICLA 2A40A 4M5JA 3D54A 1HNWK 1QLNA 3RBZA 3P3DA 5GVQA 1LK5A 3HXMA 2RE1A 1NDKA 4N8OA 3KNGA 3HVWA 5M1NA 3MEDB 1HHSA 3TZXA 3R5BA 1BL3A 4ZS6A 3THYB 2CA9A 4KREA 3M2UB 1UVJA 5BN9A 2MMYA 1X4HA 4KYZA 3AARA 4KHNA 2XY5A 4FLYA 3GJQB 4UOHA 4CZGA 4ZJQA 5L38A 1HKBA 4FLXA 5IQ6A 2RRBA 4K5RA 2PFFB 5D0GA 5JS1A 1SJQA 2GGPB 4I6YA 3FFIA 5FRNA 3DRSA 4CLLA 1ZBTA 3N6LA 4OX6A 2QL7B 3ILLA 2CJQA 4C9DA 3DLLQ 4CZEA 1NG9A 2MYFA 2XY8A 3TABA 1S49A 1I94J 4B3SK 2O8EB 5KRTA 5AQWA 4K4ZA 4R0JA 5LMNF 2HRTA 3IR6B 2V4RA 3Q8SB 2HHUA 1QQMA 1HNWJ 1Q1KA 2GIQA 2ATCB 2BEFA 3OVNA 5IS2A 1SVDA 1UW9A 4BWMA 4PG6A 1KDNA 3NAHA 2JEJA 3F73A 1UFLA 2NRXA 1N36K 1ACMB 2GEMA 2E8AA 2DHXA 2OH2A 3OVBA 1W97L 5IM0B 2WONB 1TKTA 3CCRN 1JQGA 2YBVA 2OEJA 1DRZA 1WKLA 1OYEA 5I3QA 5M2PA 2D1CA 3LALA 2FPHX 1X3MA 2XNQA 4M8LA 2YHWA 4CF9A 1NBWA 2WOMB 5F41A 1JLEB 1GEHA 2ZJPL 3MF5A 1U2FA 3SQGB 3B6OA 2YX6A 2XLJA 4AQYF 3OUYB 4DV0K 1C2PA 3D0IE 2QJ3A 4UT4A 4B3SJ 2BR0A 2R7UA 1B9DA 4FVMA 4JI4F 4Z0UA 5ETKA 3J7ZT 3CCTA 5LJWA 4L72B 3J80U 1SV5B 2DHHA 2QMXA 3TNVA 1NWKA 2VPYB 4MK9A 2D4WA 3BQ0A 2Y0BB 3POTB 1S9EB 4FM0A 3UN5A 2GX8A 1TKXB 3GB0A 2B5JB 1U1RA 3JYTB 1N36J 3DI6A 3TZYA 3CYMA 2UU9F 5BREA 1H7XA 2V9KA 4URQU 4GV6A 2JHEA 2LQJA 3OYEA 1NM2A 1T03B 4MQ3A 4BROA 1E6VB 1HMVB 1DGKN 2GVZB 4IOCQ 1WSJA 4A47A 1WBDA 4FXVA 3MMAB 4WK1A 3QLHA 4DSJA 3RG6A 2EFPA 4WFBQ 4RPFA 4NLTA 2CVEA 2OPPB 4PUOA 3AVIA 4DV0J 1FDAA 1SI9A 3LPYA 4E7IA 1M1KT 2W9BB 3DXBA 4XEIA 4JKFA 4OZ1A 5GAGP 3MZIA 3DRPB 3V4MA 4CGGA 4ILLA 4M41A 2FHJD 4ED3A 3GG4A 2EK6A 4FOIA 5BPNA 3QEWA 3I32A 4FSVA 1D9AA 2ZD1B 2Y1LB 3TARA 5BRDA 2D74B 1HX1A 4DL3A 1YLXA 5LMUK 5D0HA 1Q7YT 3DLBA 4LVOP 1Q82O 4NLSA 4ZPTR 1NKBA 2CNOB 4I2PA 1LW0A 3D2WA 1MN9A 1T02A 2UUTA 2M3DA 2FLOA 1RYRA 4B9MA 3DGPB 5J2MA 3E9PA 3E8OA 3ZX0A 8RUCA 1RAIB 1QQCA 4NI2A 3ILIA 1LWEA 4USUA 1K8KB 2YPZA 3H0PA 3RB4A 1YBAA 1MN7A 4CJSA 3V1RA 3UW1A 1LOUA 3MM9B 4M42A 1ATSA 2JH3A 1S6QB 3QDKA 3MEKA 4CE9A 4F4YA 3MX5A 3ID6A 4EYHB 1VGYA 1K44A 3GPAA 3NGZA 5AQTA 1XR5A 5EY4A 1FRHA 4K50A 2JDJA 3M32B 5KFOA 3LDLA 4NCAA 4ECQA 1KVKA 4PWWA 4IKFA 4AHCA 5AQPA 5AQNA 4FYXB 3QZ7A 5LL6Z 2BH1A 1NHKL 5LMUJ 2IVYA 4O3SA 2YHBA 3TSUA 3OYHA 2MKHA 3NGIA 3CMAS 2DCUB 3GIKA 2JWNA 3KHRA 3VGLA 3JTOA 3SLCA 2GHWA 2DRBA 3GE9A 1JCFA 2DEIA 3HBTA 3UDCA 5B0DA 4MKVA 5DMRA 4BACA 2NUBA 3OYJA 4OGEA 1CXUA 3CCES 5A6PA 4PWDB 2DFEA 4N56A 4K0KF 1X8DA 1QVGM 1Q4RA 2G13A 1JLCA 3K5LA 1IQZA 3W2VB 1B3TA 2OHDA 4OQJA 2V2QA 4JV2A 3HP9A 2U2FA 1NGIA 2IGIA 4L74A 2V8DA 2F3JA 5B09A 3BBBA 1VQ8S 3MR2A 1J54A 4RTFD 4TN2A 5K5MA 3SCKE 2VG7B 2HMIA 1FJEB 4P75A 4UQGA 3VA3A 4CF0A 3WX8A 4JI0K 5E5NA 4OLOA 5J2PA 2QK9A 2H65B 3CCVS 1X4FA 1TAUA 3CGIA 3ZT2A 1JXLA 3AA3A 1HYSB 3UKUA 4USMA 1NU0A 1F3FA 2GMJA 1DT9A 3NRBA 4CBXA 4UOCA 3MHYA 5F8GA 2Z57B 2ZBCA 1FCAA 3FQLA 2C28A 1NKCA 4JK9A 2DPIA 1RHKB 3MN6A 2L08A 2AIRB 2X3DA 2IRYA 3KG1A 1V5VA 2AEMA 2BE2A 3Q22A 1PC4A 3EDQB 4O3OA 3HMJG 2RUSA 1T11A 2GS8A 1QZ6A 4PHTX 4O0IA 3SFGA 1AA1B 3HM9A 1R43A 3VOVA 1K0VA 3MMJA 2IC3B 4M95A 3IDHA 4M5LA 2CQCA 1DLOA 3MR6A 1BG3A 1AFJA 4CESA 2XHWA 3HCXA 3EE9A 1JMTA 4B1ZA 4H0OA 2MEWA 1F60B 2ASOA 4WQ5A 5KQDA 4GO7X 4DG1A 3UNGC 5JVHQ 3KLIB 1GLFO 1EXQA 5CAAA 4JI0J 9RUBA 1VAZA 3RMCA 3A5OC 3NAEA 4ETZA 3F9MA 4NMLA 5L9NA 2KXFA 3RB0A 1RE1B 2B43A 1Z26A 2R7VA 3UWTA 2D3O1 1NGJA 2QXFA 4FW1A 2CQHA 2VKZG 1M90O 4CGJA 5KFKA 3MXHP 5J2NB 1BU6O 3I55N 4QIFA 2I2YA 3NS7B 2E44A 3M30B 4J9MA 5AZIA 5JLFA 4OV1A 3QNWB 2D3OR 2XHBA 4M3YA 4F26A 5F8JA 2HNZA 2FVRA 2AJ1A 2XMMA 5KFCA 1B0TA 2HF3A 4DR7K 2OTJN 4K41A 1T05A 3ENHA 3OPKA 3ITHB 1QAJA 1HNZF 2HBQB 3E01A 3OHRA 4FYDA 4CJFA 1LWFB 1XNQF 2DGSA 1R8CA 4RNFA 3CFPA 3GFXA 5K8PA 3D28A 2E4LA 5H1SV 4DMNA 4DUYF 3IC1A 1FERA 1XI1A 1RBSA 4FF3A 4YQWA 5B0BA 4MKAA 3CD7A 3UFCX 2NZ4A 1BC6A 3GG0A 3A3NB 4DQPA 4KT0C 3BV8A 3CT9A 5DLFA 3MM8B 2JX2A 1M5HA 3QIPB 4MDBA 2DNGA 4CJ7A 4CH0S 3DXKB 1ASVA 5H9FK 2AZ1A 2DNQA 4C4WA 1Q8LA 1RNHA 2HQ3A 4AT1B 3R7BB 4EZ6A 2KFNA 1GQEA 1C1CA 1RUSA 2VFVA 1M5VC 3AVBA 3JXUA 4IO8A 3SV3A 3S6EA 3CIZA 3PJ9A 4ZJOA 4BR0A 5JUMA 3KHHA 1NJXA 2V6AA 3K8WA 3GTYX 4DS5A 4R5PA 4WF9L 4CNZA 2UUBK 1GT8A 4DR7J 3W63A 1RAAB 2B7BB 4CJTA 3DDIA 3CDWA 3RRKA 1KCFA 1KAYA 2IBOA 3BGLA 4WIQA 3CW2C 1M5KC 3CQ8A 2OI2A 4QPTA 4CZFA 3Q0AA 2X51A 1TZ0A 2MQLA 3Q8YA 4RNMA 2P9SA 5KG0A 1DQ9A 1S77D 2Z58B 3D0GE 4ED7A 3EZ5A 2M8DB 3HVTB 4CT9A 2IVOA 1WC4A 3PIPL 1XWLA 3V6DB 3V9XA 3MAAA 3P49B 1KFSA 2IDLA 4KAIA 3NWRA 5H9FJ 4DV4F 4MIBA 1U1LA 3FZKA 2BGGA 1NK9A 1VI7A 1EETB 4FDFA 4E7JA 2NXCA 1FK9B 5ETNA 2PI4A 2J0WA 2ZH6A 4U9RA 4HHHA 2ATQA 4C23A 1NH7A 2OTLS 4GKKF 4C1NI 3FSYA 4Y1DA 1FX4A 4CBUA 5DQIA 4U67Q 3MOJB 5HMXA 5ITHA 1YJVA 1S6PB 2UUBJ 1XUPO 1U1KA 3PIOQ 4WU3A 5I42A 1VIOA 4FF1A 4BRIA 2C3PA 1W9HA 1ZBSA 2IA6A 1YVFA 4FKXA 3SQ1A 2UU9K 4LR9A 3KLFA 1NOZA 1S99A 2YWWA 4DL2A 2RKIB 3KJVB 5F3TA 4WE1A 1WJ9A 3O5BA 2PIIA 1VR6A 2Z0GA 4QIGA 3SMSA 3H3OB 2QA4S 2ZM6F 5HJXA 4UUWA 2LP4A 1VQNS 2YKMA 3NGTA 4DDFA 4C8ZA 3HRGA 2VUGA 3KLHB 5GAGU 5A76A 3EGVA 3KKSA 3MN9A 2ROGA 4CGHA 5SWMA 2CH5A 1TV6B 3QWUA 4ZHRB 2DHAA 1NK4A 2BUNA 1X60A 1YI2N 4RW6B 3OFFA 4WFYA 2D3UA 3AAWB 1P8GA 4X4QA 3BR8A 1DTQB 1D5AA 1ZS6A 4A4JA 1F5CA 3Q8PB 5KFYA 2KU7A 1LV5A 3ZSVA 1RA6A 2MSSA 4P72A 2FGOA 1BUPA 2YH1A 5KTQA 3VGKA 1SL2A 1X9MA 5ETOA 1ITPA 4KGVB 3DU5A 4B3RF 3CC4N 1Q86O 1D8YA 3P4UB 3J81j 4GVBB 3AOAA 1HPZA 3OFGA 5C7PA 4B1YB 2E5GA 4F2RA 5FPDA 3I55S 2F8EX 3TYTA 4DWIA 4KH1B 2FTRA 4DUZK 1PYOB 3I0RA 1U8SA 2P5GA 2POKA 4QU7A 2GCFA 3CCSN 4D3GA 1UVNA 1KQKA 2QYGA 3VENA 1T9UA 2X78A 2LFVA 2P9PA 4QZVB 4FZZA 3NAIA 3HPGA 1W2IA 3ENAA 2XO7A 4ISFA 4U8VA 2H1YA 2QEXN 1A7GE 2QI2A 2GELA 2OCEA 3MCNA 4RL1A 4O0JA 2O01C 3SXLA 1VHXA 3FCHA 1GXLA 3RW7A 2F65A 5LSRA 2CJYB 3V6HA 2V2KA 4X4PA 2E5IA 2GTDA 2UUWA 2ZF5O 4YOUA 4MFBA 1O51A 4C8YA 1ASWA 4BRNA 3MMBB 2HYIB 2CQ3A 2HW3A 2DKOB 4OMFG 7FDRA 2W9CB 4USIA 3S1TA 3P6YC 3PCOB 2BW7A 4ZCMA 2DRDA 4CJKA 1S1WB 5GIOA 4DUZJ 3UD4P 3C19A 1HYVA 2Z56B 3KK2A 1CJUA 3I4HX 1L3SA 4JI8F 4P74A 5KOWA 1S0OA 4CJVA 4OI3A 1RI7A 1RT2A 1FKOB 2XYPB 2IJFA 3I33A 4CHQA 1GMWA 3VVUA 1R0BG 2L3MA 3BPDA 3TQ1A 2J0XA 2QGFB 2MHEA 3ATVA 1NHUA 1CZ9A 2JWKA 1N0VC 4MJKA 3EE8A 4CCHA 4HH0A 3ZZ0A 2EHGA 2V63A 2E2OA 5F8MA 2GAHC 3CCWA 2W1BA 2XBPA 5H1SQ 2KQ2A 4C98A 2J6UA 2KI2A 3W9HA 1VSDA 1NK0A 2GQQA 4XPEA 1C0TA 3ULDA 2H4YB 3EZOA 3CJSA 2HHHK 5AE2A 2RPIA 2JVRA 2IIRA 3Q7CA 2HNYA 2OSRA 1U4BA 3D3CJ 3T5JA 1VJWA 2HBLA 1VLYA 2PFDA 2FJWA 1JIHA 3RSEB 2E1PA 4TU9A 4CJ5A 2XSFA 1U48A 3CCLS 3VAHA 2RE2A 3UCUP 1IR2A 3DLJA 5JMVA 1RT1A 4A57A 3I9V9 3VALA 3SSSA 2D3ZA 2DXEA 1SKWA 1CS4A 1RWKB 3NCIA 3M8QB 3THVA 4RNOA 4C97A 2HFUA 3T1HK 5SUHA 4A5BA 2G2ZA 3J7Z5 4RWTA 2RH3A 4L3KA 1U1MA 2J9CA 5KFJA 3ZSYA 3O3GA 2V67A 1EZZB 4LRAA 2MKYA 3AHPA 3I5BA 1TMJA 2BYCA 4NPOA 3AAPA 2CWKA 4LF9F 3CEDA 2GO9A 4AYBD 3A5NC 1C4CA 4IO9Q 3QT7A 5FDLB 2HHQA 1UA1A 2DFHA 1VS3A 5CH7B 2A41A 6AT1B 2HHHJ 1WOQA 3M8WA 3KLVA 3EXCX 4GKJF 1EHWA 4JV1A 4AILC 2K7KA 1WDDA 4WBFA 4XDCA 3FBCA 4TYBA 5EWGA 4FS1A 1QTMA 3M7VA 2RRAA 3AO5A 2C2MB 3M8RA 1DTTB 3MM7B 4NEYA 3JAMY 5KPTA 3H5UA 2O4GA 1RZMA 1VSMA 2CPJA 2IFXA 1GX6A 4EFAC 1RBUA 3FMBA 2X3GA 2O8FB 3PRBA 1U1PA 4JI1F 1KLMB 3AAQA 1J5OB 4LH4A 4CEZA 2UVWA 3QZ8A 4LF6K 4HCBA 2P9LB 3T1HJ 4ZTFA 3F5TA 1RDDA 4KKOB 4F25A 3GYNA 1RDRA 1U6BA 2E5LK 2QFIA 4QIVA 2L48A 2P9EA 3UCGA 4MH8A 3GYXB 2AWZA 3ZFVA 3TWZA 3LWMA 4J37A 1K8AO 2BV3A 1R8BA 1MMNA 2QKBA 4JD2B 4O4GA 2G8KA 4ISGA 1EQYA 3O6QA 3FZLA 1XBWA 3BQ2A 5KFUA 2FLPA 2ITGA 1WDTA 2EPIA 3DLKB 4PQUB 4HUFA 4ZVHA 4HHTA 2MZJA 4CEBA 4OJGA 3KD5E 2QV6A 3BF3A 4MIAA 3CE8A 4DXLA 3L4QA 4CLPA 2W40A 1ICEB 4ERDA 3W60A 1RACB 1I1GA 3PM9A 2ZHAA 2W7PA 3CO9A 2HFVA 1JX4A 3MI7X 2HQIA 1H2VZ 3OLBA 3JSMA 2ZH5A 4QPXA 1M5OC 5FLXO 4LF6J 5KFZA 2DH7A 3L9ZA 1YITS 2E1RA 3GMGA 4ES1A 3DOLB 1NJIT 1QS4A 2O8CB 4KH5A 1TFYA 2QLXA 2E5LJ 4OYAA 4Y65A 4ZP7A 3ZTOA 1DKGD 2V51B 5DQHA 4NYPA 3L7PA 1HNXF 4I6AA 2DHGA 1NGHA 3LP2B 3HO1A 3ADAC 1WSRA 3D1HA 5HI7A 3TZZA 1S72N 3KK7A 2VQFF 3B54A 1KVIA 4NYFA 2IM2A 3GE1A 1BQMA 5U47A 4J9LA 3HHLB 1M1HA 3TVZA 4NA3A 1XQIA 1N5SA 3IA0A 2BVZA 1TELA 2QL9B 1FXLA 3GBTA 3PY8A 4NASA 4ER8A 3GQCA 2MJUA 4CTAA 4C2MA 3AT1B 2N82B 3UDEA 1TK0A 3UQSA 1NNDA 1GLCG 4JS5A 4OX8A 1D4XA 3D6RA 3BKTA 3PJWA 2P9NA 2WSFC 3N5FA 4JI7F 4BREA 4DTMA 2ZKTA 1TKDA 4FZVA 3L2WA 3OYLA 3F56A 3N4WA 4HDGA 1WAJA 3WNEA 2WB1D 1QTNB 3QIOA 2RN2A 4F2SA 4IFVB 1VQMN 4DR2K 4O44B 1P9QC 3VQBA 4I2QB 4DU1A 4NRUA 4KHUA 5C2CA 3FEYB 3LF0A 5K8OA 2M7SA 3MEGB 4O8UA 2XRIA 3AY9A 3CJ3A 3N4QA 1S1VB 1BE4A 4DL4A 3VN5A 3VZHA 1RAJA 2YX1A 3MECB 2BKNA 3JS9A 4WK3A 4CYUA 3FNNA 1SZ2A 4ELTA 5F8NA 3AVCA 2MGZA 1MMDA 3ZZRA 5LM7E 1B0VA 4YORA 3AGKA 1EQMA 3BZCA 3I4PA 4DZDA 3MTJA 3MCSA 1TL7A 1CZAN 2WUSA 4JHDA 4LF4K 4ZVSB 2I7NA 4ZVOB 1YT3A 4MO5A 5B0CA 5BXIA 4RW4A 1XC3A 2ETJA 1EAYC 4R25A 2DB1A 5B0FA 4H5WA 1RHQB 2YPYA 4FL9A 2V69A 4IOXA 3D2EA 2XQCA 1XERA 4JRPA 2HBMA 1GNKA 2W25A 2YCHA 3GV8B 3EPGA 4BDPA 5EX5A 4DR2J 4YS2A 5E3QA 4FJXA 2CG8A 3CETA 5LXYA 1NJWA 3EMTA 4DU7A 1HKCA 5CABA 5AQSA 1RT5A 3M05A 3BO2A 1NDCA 1RBAA 3THXB 3W8PA 2FHJA 2W7AA 3W9IA 1ZC6A 3HJVA 1IKVA 1NGCA 3M2RA 3WDOA 3C16B 3OBIA 2X1BA 3ZZUA 4X4VA 5L46A 2MHNA 1P1LA 3IRWP 3KKRA 4CD1A 5KFQA 1WD6A 3QJJA 2WRMA 4LF4J 4EEYA 2B4JA 4USHA 4DR3K 4LSLB 4B3MK 1VQ9S 3BGUA 1H2UX 2DPJA 3C94A 4KBIA 3D2FA 1YDLA 4FM2A 5L1KA 1R89A 3VQ4A 1RBTA 1WTFA 1TTHB 2CGLA 1GX5A 4A5AA 3L7UA 1RWVB 2Z2MA 2QWRA 4HL9A 2X6NA 3TUPA 1DQAA 3U4LA 3C2PA 1HI1A 2B6AA 3QEVA 1OH5A 5A8RB 4L76A 1T8EA 3MEEA 2VG5B 2CQIA 3IRXA 2OPSA 4NYNA 4JV5K 2E29A 1BA1A 4X62K 3UN3A 1RWOB 1N8RT 3DOKB 3WXJA 3MK6A 3N28A 5HK4A 2NSCA 1VC6A 1VYAA 1Z25A 2QG9B 2R8HA 1FESA 1XC9A 4LBHA 1NB2A 4FWOA 3KXDA 1NSPA 4CFBA 1HHTP 4XTTA 3CIMA 1CXQA 4JKGA 3LAMA 1NBEB 1U6ZA 5AJ3K 5E3CA 2RDIA 1N32K 4DR3J 1WUAA 1QUPA 4ECWA 4B3MJ 3CCUS 2ZH7A 2FBXA 1RGIA 3ET6B 1S72S 2CPZA 4CD3A 1FEEA 2VFUA 3V81A 5KFIA 1N5VA 3UR3C 1YJNN 2HQDA 2VU5A 2BM0A 3EKUA 2MY8A 4CGIA 3WXIA 2ZZTA 3QEPA 3NVKA 4H4OA 2OKQA 1DFDA 1GOCA 3VQAA 4DR1K 2CQ1A 3W62A 5C42A 1AUDA 1BQNA 2FSJA 4RR5A 4LF5F 1JL1A 2G8UA 3HHDA 4DX6A 4DTUA 5TKWA 2HZAA 4DCHA 1F3VA 2AYEA 5ETLA 3ULHA 2OSQA 4I0WA 4JV5J 4WFAL 4X62J 1S6UA 2BE9B 5I3UA 1VRUA 4KGXB 4DCJB 3L2RA 3SAFA 3O9QA 5HBMB 4HACB 3SUOA 5KQ8A 3M2VA 2DXDA 1YTYA 2OGUA 2W2PP 1SUQA 1P6TA 1HQ2A 3SAGA 3U7JA 5KFMA 3FQKA 4OO1J 2QX0A 3AD7C 2HVDA 3HHKA 4RW9B 3WXLA 4DJBA 4DPUA 5AJ3J 3IM8A 2HNDB 4DI6A 4EIAA 1N32J 3C6HA 3QWPA 3CDAA 4JI2K 3MD3A 1FTRA 1RABB 4HHUA 2QFJA 4FN5A 4UUXA 4WFNQ 5BYSA 3NCPA 4OYWA 2I7PA 3KD1E 1V4SA 2NREA 4QJVA 3KNAA 2QA2A 4J9RA 4DR1J 4DKWA 3AY0A 4LBPA 1YHQS 3QYYA 3SIPB 4CP5A 1IG9A 1OO0B 3TEGA 4BS2A 2M9KA 2CJXB 1Z2ZA 5HATA 3LO3A 1LXNA 3EZWA 1FA0A 4K4VA 1RWMB 4XDDA 3AVAA 1XIQA 3MOZA 2ZGZA 2GW8A 3GJTB 4KH0B 3JB9k 1MROB 3PX4A 1BA0A 4Q5VA 1OPIA 3RR8A 4KV8B 1CBKA 2Y1JA 1WC3A 2PMWA 3F9KA 4UZBA 3HFVA 2PD1A 2NZCA 3HKWA 3HZGA 2FZGB 4YNQA 3J7AP 4JI2J 4PXCA 4A48A 5AQXA 3C15A 4CI6A 2OEMA 2E1MC 5F0UA 1XMQK 1DURA 4AD6A 1K1QA 2LCWA 4JI5K 4AL6A 4A2BA 1RCXB 3QNNA 2VC1A 1GLEG 4QWBA 3FBFA 5GMDA 2KXHA 3IG1A 4E1MA 2DY1A 3THWA 4ZDNA 2AF6A 2GJIA 1TL1B 1GLLO 2HF4A 3U8XA 1NZ8A 2ZJQQ 5KOXA 4F3OA 1UVLA 4DTXA 3ZSOA 3ZT0A 3H08A 4ZN1A 4IZ9A 1VQPS 3UR0A 5D8HB 4DV5K 2DY4A 4Z4EA 2QLWA 3UKRA 3HHNB 4B3OB 2R2UA 4WQ5C 2XGPA 4XO0A 2L9WA 3HDSA 1X4EA 2K06A 1MMLA 2DIUA 3K5NA 3TR8A 1U1NA 2JGUA 2EG2A 3G0ZA 2DTJA 4G65A 1K73O 1CLQA 4KGZB 1RT7B 2IJRA 4H0VB 4ALZA 1S22A 3E51A 1XMQJ 2XLIA 3ALYA 4JI5J 1VQ7N 5AZJB 2A6AA 2VJVA 3QGPA 5CHIA 4RUCA 4E1NA 3V9WA 2AX1A 2ZUGA 3B6PA 2JC1A 2HZCA 3ATUA 1QVGR 5BYRA 4A8SA 4ATNA 4CM0A 1LWCA 3GWCA 3O3LA 1YXQA 2ZE2B 3I87A 4D3HA 2IMWP 2F9TA 3OR1A 3R1LA 1S1XA 1QY7A 1KC8T 3HP6A 1PBUA 4ZITA 1HQEB 2E6MA 4LJMA 1HI0P 2AZ3A 1RT4B 2C3UA 4NOHA 2NYIA 1X4AA 4DV5J 1R27B 2EWHA 1AZSA 4B9LA 2G1HA 5AQZA 5F2RA 2XYGB 2WHOA 1BISA 2RDJA 5ETMA 3DYAB 1SXLA 1M5PC 1JLFB 2AJ0A 5HAOA 1LW2A 4FJ7A 4PQAA 3THPA 4I56A 2CZ4A 1R0CB 3EGNA 3MD1A 2PA3A 2C2ZB 2ZBQA 4NLYA 2BACA 2CIMA 2UXDK 1Q7LB 1XHZA 4BE0A 1SKSA 3AJDA 1QZ5A 1UWBB 4HR2A 2CJAA 1H74A 4NZ7A 3CERA 1HNVB 3NMAA 2Z1JA 1UVKA 5L1IA 4GC7A 1L3VA 1JJ4A 1G7CB 3DRRA 3MEDA 4Q45A 1D8ZA 3THYA 1FTCA 3LGMA 2FVQA 5A8KB 2H48B 3M2UA 2AMCB 1S3XA 5KT7A 1FKPB 3NKYA 4KIAA 2DHSA 1RHMB 3CJRA 4DPWA 5L39A 3EEQA 5K20B 3WQPA 5EHHA 5C10A 1WG5A 1QM9A 1Q0NA 5HVGA 4JKCA 1I5OB 4RBUA 4W90B 4F50A 1C1BA 4YY3K 4QIWD 2GGPA 2VDHA 4LFBK 3UI3A 4P71A 4UOGA 3CXCM 4DR5F 5DDRC 2I0XA 2D0AA 3H4BA 3TSPA 2FC0A 1SS6A 1ZBUA 1VQ5S 3E66A 4CLKA 3V9SA 2VBXA 2MXYA 4QWDA 2CPFA 4CO0A 2EWSA 3FGVA 2UXDJ 4P2XA 3QRPA 4CLTA 5E3AA 1QQOA 4K8ZA 1RBRA 4CW7B 2P9GA 3RMAA 1VQOS 1FE0A 5IWAK 2ZJRL 5LT5A 3H3NO 3TAQA 5F0XA 1SKRA 3NEKA 2D5RA 3MUVP 5CZVA 2AJQA 1IBKF 4E7KA 4F4WA 2PEBA 2VJUA 4EUVA 2QE5A 1TKZB 1WKKA 5E7OB 1IKWA 2DGTA 1VQLN 2MY7A 4K2XA 5IM0A 2WONA 3ZT3A 3VQSA 4NLDA 4CI0B 3H8YA 4NCGB 5C24B 3BO4A 4C3LA 5AT1B 4TSXA 2A5XA 5KT5A 4BG9A 3BUZB 2ZNZA 5HLFB 2YKOA 2MKKA 1SQGA 2GMLA 2WOMA 3HFZB 4YY3J 4LFBJ 3CD0A 1NM1A 3QT6A 1JLEA 4DSEA 4QOTA 3SQGA 2AV5A 3AXMA 3CIPA 2Y1RI 2UUAK 3H1VX 1YGYA 4RW8B 1Q81T 3QETA 1N5YA 4A8MP 2HS0A 4GC6A 1BD6A 1WC5A 4Q2MA 4RJVA 1QAXA 1M1GA 5L1JA 4Y1CA 2EXUA 3KZBA 5KGWA 3K89A 4OV6A 4DF4A 1JKHA 1HA1A 5LSOA 4BR4A 5IWAJ 3W5YA 4IOAL 1YZ6A 3E9OA 4KHYA 1JNZB 5JJBA 3AVMA 2LSNA 3DLHA 3BKFA 2KJVA 3POTA 2WTUA 1YQHA 2B4PA 1S9EA 1TKXA 4J9SA 5B0GA 2B5JA 3JYTA 3NWGA 3VEVA 4LF7K 5DQGA 4NA1A 3HT3A 3FFIB 1NO8A 1E6VA 4LR7A 1SIZA 3T9ZA 2CPIA 3QB0A 2GVZA 3U3GA 5KG7A 4PPDA 4KHQA 1YJWN 3MMAA 1AW0A 5AXMA 3QATA 3G8SA 1MW7A 2OPPA 3OTEA 4NLGA 2LMIA 4RCHA 2UUAJ 4CJPA 3BSOA 2DR5A 5M1KA 1T95A 4DPTA 2W9BA 4NXNF 4BRDA 4OPKA 2R7YA 3AVKA 3CD6S 3OR2B 2WVCA 1IBLK 3DRPA 5T41A 3F44A 2C3YA 3AA9A 1WG1A 2OO4A 2ZD1A 2FY1A 3HLUA 2OMLA 3OL9A 5CCMA 2KHOA 4AUKA 2KTQA 4IJNA 1TKTB 4Y00A 4IDKB 2FJBB 5ELZA 3OV7A 3HVRA 3G6ES 4ID1A 4FNIA 5A6WA 2FB0A 4URSA 2KO1A 2E2QA 5HN0A 2CRLA 1X9WA 2UUCJ 3PHEA 2MZSA 2HKEA 4LF7J 1P9YA 4B3TF 4PABA 5M2RA 1A5VA 3DGPA 2W2MP 2YHYA 4XH1A 2KM8B 4JNEA 4DR4F 3MTKA 2EFQA 3M6UA 3B6BA 2NRWA 1VSJA 1K8KA 1K1SA 5EWEA 3OJUA 2XC9A 4HVJA 1FRKA 2F8SA 3FBEA 3AVNA 1S6QA 2RILA 3VQ5A 4DV3F 3ZEUA 4H0PA 3HPHA 1IBLJ 2VQEF 3L4BC 4GRSA 2JJ4D 4DQRA 5KFAA 1RA7A 3DI6B 2EX3A 3AXKA 2VC0A 1MU2B 5C2FA 5JVGQ 5KFTA 2XS7A 5ETRA 1OY6A 3THTA 4JK7A 3H1QA 4DV6F 3D66A 3MM6B 3R6MA 3D0PA 3R2CJ 1ATRA 1KHWA 3H5YA 1VQ6N 1YJRA 5CQGA 1XEZA 3P8BB 1UPPA 4X4TA 4BC7A 1VLOA 2PT0A 1FW6A 4PWDA 2BOAA 2WVBA 3RMBA 1M5SA 3LP3A 1JLAB 2OLWA 1HQUB 1C0MA 4CLWA 2D69A 3KMSA 3W2VA 4HKQA 1HWKA 4CEDA 2JEGA 1FVQA 4B9QA 1S4EA 1Q78A 2P5OA 1S10A 2RU9A 3OL7A 2DBBA 3NOGA 1YIJS 1Y0HA 1ZAVA 5AFUH 3MXIA 4JI3K 1RDAA 3SPZA 2DNRA 2ZGYA 4BE1A 3I96A 3QRQA 3ZSZA 1T94A 2HQGA 1WSFA 4AFFA 3PDNA 3T6JA 1FRIA 2KJWA 2LQ9A 2OEKA 3LAKA 1LW0B 5EDWA 4OZ5A 1H0HB 2BOPA 2O8DA 2MDAA 4Y28C 1CQMA 2XGQA 1R6YA 2KN4A 4Z94A 3JSYA 2OJ3A 2NCKL 5FLXY 2DRAA 3TTFA 2RNEA 1X5PA 5HL7L 3SSRA 1DEJA 3G4SN 3HFKA 3M8SA 4CH7A 5KFSA 3AVJA 3UB5A 2AA4A 3TP2A 1QSSA 2P9IA 3HZ6A 3FMWA 4JI6K 2MZTA 1HBOB 3AVLA 3EM1A 1UAWA 2BANB 2IC3A 3KK1B 4AHRA 3SUNA 1U24A 3NGUA 2IA0A 4L73A 2YKNB 3CJBA 4OJ1A 2OZSA 3R5JB 4P10A 1BWEA 4ANDA 1YJTA 3EY1A 4A8OA 3NL0A 2DGUA 1JNRB 1GH8A 4JI3J 1B64A 1EX4A 3KLIA 2H5IB 3GSDA 4C0BA 4BRKA 4U8YA 1IBMK 4DFPA 1RAFB 2PSZA 1RXOB 1TL3A 3K59A 5FIIA 1IVZA 2M70A 5HQLA 3J81O 4NXMF 3T1YF 4Z4FA 1SL1A 4IG0B 3HX9A 1SCJB 4IRCA 1RKJA 2P9UB 5J2NA 2CH6A 3CG7A 2I6WA 3M30A 1T3OA 3OT9A 5CE3A 4DTNA 2OPRB 4ID5B 3M5RA 2PA8D 1HWJA 2Z30B 4ICLA 3N0VA 4U96A 5FLXU 4TXSA 3BSCA 4AM7A 3L09A 1S0MA 2YX7A 4JI6J 4OX9K 5ETSA 2YXLA 3D5MA 1EWRA 3ZSQA 2HMIB 4Q0BB 3ITHA 3WXKA 1NOYA 4N5SA 3LW5C 2UVRA 5B0AA 1LWFA 3KTQA 2YWEA 2HHTA 3BEXA 2CGKA 2B8PA 4M3WA 3NP5A 1CEZA 3VR1A 2VHGA 3OYDA 3PEJA 1X4DA 2VG6B 4DV1K 3Q8UA 3CF5L 4F4ZA 4OYZA 1IBMJ 5HMWA 3MM8A 3PJXA 4KO0B 3QIPA 1U2VA 1V3SA 2FBYA 2I9SA 4H54A 3FUYA 3PO4A 3DXKA 4X65K 1U49A 1O8BA 2P51A 3OY9A 4NWBA 1FDBA 3S3OA 1NU4A 4OZ0A 2V0NA 3FR0A 4OKEA 1NPRA 3AD8C 2Z1HA 2EFGA 1J9AA 3D3BJ 1VRQC 4IKAA 3B8HA 4M5KA 3W61A 4G1PA 4JYAF 2FQQB 4CNYA 2PZSA 2VGMA 1DLOB 2GHVC 1IR1A 4ZVRB 2Q36A 4K4TA 2ITMA 1VQKS 3KG4A 3W0LA 3R7NB 4OX9J 1X9SA 3AO2A 5AQJA 4DG1B 3K8VA 2GNKA 3CCZA 1X1PA 4WIIA 3EN9A 2R42A 2P9CA 5B7WA 4EO8A 5IC4B 5F9LA 4ILHA 5ADZA 3T6BA 3N5BA 4ANEA 4USTA 2U1AA 1CZBA 4PG5A 5EXWA 4F67A 4EU0A 3OXFA 4AM6A 1CJKB 4DV1J 1YVUA 1WORA 2QM1A 3V9ZA 3HVTA 4F7VA 4MTPA 4M3TA 3V6DA 3VQ6A 4DF8A 1WC1A 4X65J 1TL4A 3UCZP 2DNPA 1ZYQA 4X66F 3WZ0A 5CCLA 4E7LA 4A62A 3P5JA 1EETA 1FK9A 4C11B 1UFKA 5FRMA 1HFEL 5HROA 2XHCA 2QLBB 2H5JB 2F4VF 3FVYA 2C22A 4RUBA 2WC9A 1SJFA 4BG8A 3CJCA 2KVQE 4FK4A 4OFZA 4LMZA 2XULA 3D1QA 4IRKA 1NGBA 1RLCL 1URNA 2NRHA 2A18A 3QJLA 3NBPA 3VAMA 4A59A 2AU0A 1KQSM 3ENBA 3UD5A 4FZXC 2JSXA 4Z7YA 2RKIA 3PW0A 4QWEA 3Q8RB 1TUYA 1Q18A 4M5DA 4ZVPB 2HHXA 1UA0A 2G4BA 4WPAA 3G4SS 3SNNA 1Z1ZA 1O5JA 4CZLA 3IGVA 2UXBK 4KTWA 3KLHA 2XMJA 4YHHF 4QW8A 4ZJLA 4FYYB 3CJAA 1TV6A 4CJRA 4ZHRA 1RWPB 4ES3A 3M1VB 4RW6A 1TUVA 5AQHA 4M3ZA 4ZP6A 3M1FA 4C7QA 3C14A 3IMQJ 1DTQA 2IJNA 2E9TA 2D0BA 3M3ZA 4I1TA 2ADBA 2HQCA 4L8RB 2ZC3A 2OD6A 4O8KA 3VQ9A 2O3DA 4WKYA 3VGSA 4P2SA 3OTBA 3CD5A 1U0HB 2RD5C 3M8ZA 1GXTA 2BJ7A 3NGYA 4K4WA 1VQYA 4EK2A 2HHSA 3K5PA 1HD1A 4ZPBA 3SPYA 2E7XA 5DO2A 1SH0A 1N5TA 3AJ1A 2XI2A 2ZJPQ 3ENVA 1YJ9N 5D3GB 1PO6A 4OKJA 1UZDA 1EIYB 2CQ2A 4BDZA 2UXBJ 4K4XA 1N48A 3FKBA 4YOEA 2ZOMA 3A5LC 3TA0A 4DX8H 1KWMA 4CZHA 1RYSA 3ZLJA 3PW4A 5I42B 2MPUA 2G8FA 4V1Ak 2E9RX 4LFAK 3TVYA 4HDHA 5J1EB 4LQ9A 4GV3A 3OBYA 5A8WB 3EX7B 3KLFB 4CT8A 1PSDA 4QYRA 1S1UB 2A1RA 3GJRB 3KLGB 4OYMA 3TAEA 2L41A 4DV2F 3AO1A 2FC8A 4ZA1A 1LKZA 3JAMO 1G2EA 2GZOA 5M1OA 5CYMB 4CLUA 2XO6A 1Q16B 2FVCA 2E7WA 4BGBA 3A0IX 3MMBA 4J9OA 2D0CA 2YKQA 2W9CA 1CJTB 3O4WA 1Q9XA 1VFJA 2FF6A 3NNCA 1WKJA 4PL7A 4CH1A 1QVFM 1S1WA 3HJFA 4JB8B 5C2DA 5JICA 1FWPA 3UVJA 3DM2B 1UW4A 1A0OB 4J9VA 1F9HA 3J7AN 1JB0C 5KG2A 1XMOK 4RWWA 3HKZD 2NPFA 4DTPA 5BR8F 4LUBA 2AJ2A 4CF1A 2LEBA 4FJJA 4LFAJ 4BRFA 2R9LA 1VQ4S 2KW4A 4BRPA 3G87A 5IT4A 2J9DE 2IAJB 1O6XA 3HYFA 4TLRA 1S48A 4RNHA 1KVBA 3NLCA 4R8UB 2ZDOA 4X64F 1FX2A 3CMAN 2HFNA 4J9QA 1UTAA 2RHQB 1T9YA 1MNEA 2LA4A 2DNLA 1RAOA 2YQ3A 3R8YA 4RUAA 2XY6A 1FEHA 3CCEN 4YMEA 1SPBP 3DXMB 5BPLA 3WC0A 1BMQB 4WZQA 1FI4A 3TANA 2V68A 1YSJA 3NOCA 2CAJA 5D4OA 2D0PA 3PYGA 3KUEA 2P9PB 1ATNA 4FW2A 4DHVA 3BDPA 4OHXA 3BDEA 4BR5A 4J2AA 3AO4A 5HANA 4K8RA 1VQ8N 2W2NP 2AD9A 3DN9A 1XMOJ 4CK3A 1FWLA 1U2RA 4LF8F 4F8RA 5CA5A 3TI0A 4BVOA 2HPUA 1MG7A 2RF2B 1M90T 4ECVA 3CCVN 1TK5A 4ZPVR 1KBRA 3VGUA 3HOSA 2N4CA 4BR7A 3AJ2A 4TY8A 3LL3A 3O4QA 1SL0A 3CVKA 2XCAA 4MFBB 2HGLA 3T1AA 3U02A 2ZC4A 4X4SA 1HBMB 5LL6d 4MIWA 3BF4A 2MZRA 2IS3A 3Q83A 4EP4A 3BY5A 3R9PA 2R8GA 5D4NA 3WC2A 3IWLA 4HHJA 2V2VA 5FDLA 2PMHA 3GV5B 3KK2B 1XTZA 4PEOA 1OQ6A 1N33K 4CIFA 3CTRA 3OTOF 3M6VA 4CIOA 4ZCKA 2IVFB 1RQ0A 2D9PA 3FSXA 5E2QA 5IT9O 1JJ2R 3CO0P 5A0YB 4C8NA 3I31A 1VBYA 2LA6A 4FKYA 1DTTA 3MM7A 2P9KB 1WOPA 5F8IA 4DFMA 3P45B 4TVAB 6FDRA 3VQTA 1U8WA 7FD1A 5JMNA 3QPIA 2O8FA 4G1QA 2CQGA 2JFDA 3TTDA 1KLMA 2XNRA 1J5OA 3SBTA 1OIAA 4KKOA 1YJ7A 3CULA 4PPZA 3FRYA 4W92B 1WN7A 3G9CA 1HR0K 4BLGA 3J7A1 2K3IA 1FJGF 1N8RO 3KJNB 2W8LA 1JXBA 1LNQA 2BM1A 1YJ9S 4J2DA 3KDOA 1IM6A 4Q43A 2SXLA 3PKYA 4ETXA 3KWMA 4LY7A 3V1QA 2ERRA 2Q1NA 4AE5A 1KSPA 4AHSA 2YNGA 4EMDA 4DV7F 3DLKA 1LWXA 3H2VE 3CJ4A 1N33J 2NZTA 4K4UA 2GWKA 3FC9A 3SCJE 3L8BA 5EN1A 3R3TA 3MXMA 3UO0A 3FE1A 2G8HA 3PX0A 1WI8A 4B9UA 3EVWA 2WZ1A 1SAZA 2R7SA 2VOPA 4DR6K 4USWA 3DDNA 4F4AA 2UV8A 2YI1A 4CBWA 3EKSA 2Z4PA 3RBEA 2J0SD 2FZKB 4RUHA 1RU1A 2Z8QA 3CJ9A 3F0NA 2HFOA 1P90A 2XM3A