3TAMA

Crystal structure of hiv-1 reverse transcriptase (k103n mutant) in complex with inhibitor m06
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
557
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Design and synthesis of pyridone inhibitors of non-nucleoside reverse transcriptase.
pubmed doi rcsb
source organism Hiv-1 m:b_hxb2r
molecule tags Transferase/transferase inhibitor
molecule keywords Reverse transcriptase/ribonuclease H
total genus 160
structure length 553
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3tamA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tamA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tamA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tamA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3tamA05
5SZTA 3VA3A 2VG6B 4ECXA 4URGA 2ZQBA 3B6PA 2CKWA 2YNHB 3K5OA 4ECQA 4DSFA 5KT4A 3FFIB 5J2QB 4BWJA 2NUBA 1K1SA 3GIJA 4JV1A 1NK6A 1Q9XA 4CFBA 4NLWA 2IJFA 2HVHA 3H4BA 3V6HA 4KTZA 4I2QA 3G6YA 4ZMMA 3ZT4A 3LZIA 3VQ6A 1VSMA 4CCHA 4B9VA 3H08A 3AVIA 4BE1A 3RR7A 4ELTA 4DF8A 2YKMA 5L1JA 5L1LA 1I3AA 1IKWB 3VQ7A 4ED1A 2BANB 4E7KA 3KOAA 3PR5B 4CECA 3T19A 1CSJA 4NLSA 4KKOB 1QHTA 2IM2A 2E6MA 4EO8A 1SUQA 1RDRA 2LSNA 4FJ7A 2YNIA 4RG8A 5KG3A 4CF8A 1ASVA 4MKAA 3S9HA 1DTTB 3KLGA 3AVKA 4CF0A 4JRQA 1TQLA 3VQSA 4F4ZA 5KG6A 1JX4A 3TAMB 3LP2B 1S1UB 4URQU 1D9DA 3D0PA 3BSOA 3CFRA 1LAWA 3OSPA 2IGIA 3CWJA 2BANA 4CF9A 5F9NA 1RT3B 3KK3A 3PHEA 3DI6A 4HKQA 3Q8QB 4K50A 4RW4A 2EX3A 3CG7A 4IR1A 1WNSA 3HT3A 3QLHA 3RB4A 4O4GA 3F9KA 1XC9A 4HUEA 2ZE2B 1IKYB 3GILA 5KFMA 4B9MA 2P1JA 3PW7A 2R8JA 1QQCA 3NF6A 4OPJA 4DL4A 2R8HA 1TAQA 1RBUA 3OYMA 2IMWP 3AV9A 2RF2B 4HCBA 3A2FA 3RB3A 3SV4A 4B08A 1TP7A 3DLKA 4RW4B 1WSGA 4R0EA 2HMIA 4FYDA 5KFSA 3KK3B 1QSSA 2W9BA 4FJ5A 2G8WA 4FS2A 2IOCA 3OS0A 5J1EB 4KFBB 3G6XA 1S0NA 2J6SA 2F96A 4IR9A 2HHXA 2UVVA 4QWEA 3OYJA 3ULDA 3KLFB 3V9ZA 1D8YA 5EDWA 4OGCA 3G86A 1S49A 4DL6A 4ELVA 1LW2B 4DTRA 3SFGA 1EP4B 1JLAA 4KPYA 1B9DA 2C2DA 3AA2A 3CO9A 4CGGA 2YNGA 4KO0A 2CJQA 1QTMA 3NFAA 2YNIB 4ZVGA 4IRKA 4K4WA 4DU1A 4BWMA 2F8SA 3Q8PB 1IO2A 5KFIA 4YFUA 2I5JB 2ZD1A 2V0NA 3OYKA 3RBDA 2FVCA 1RT3A 3AO2A 3DYAA 4ECYA 4F2SA 2ZD1B 3OL6A 1NK0A 4FLWA 4LQ9A 4O3QA 4NLXA 1HNIB 4CJQA 5KT6A 3M9MB 3RR8A 3M8QA 1S1XB 3D28A 3HYFA 4KV8B 4MK8A 4Y34A 4RZRA 2W9AA 4KAIA 4I2QB 4U6PA 4M42A 4TQSA 5HP1B 1BCOA 3OHBA 1MU2B 2ILZA 4E7IA 1VSFA 3NMAA 4ICLA 3M8SA 3SZ2A 1VRUB 3E51A 1U48A 3KHGA 2YNHA 1NK5A 4TSXA 3DRPA 4JUZA 4E19A 4F8RA 3LP3A 3BR9A 5CZ1A 4W5NA 2R2TA 5KT2A 2XGQA 3OYLA 1Z26A 3KLEB 3OYAA 2B6AA 1HMVA 4AILC 4BDYA 4DSKA 4WXOA 2HHUA 3UPFA 2HNDA 1RDBA 5EUHA 3SQ1A 3SQ0A 3PW0A 4NLYA 4Q45A 4RNNA 4K4ZA 3VA0A 2AJQA 4DSIA 2FLNA 4J2AA 4J9QA 5KFUA 1CXUA 1VRTB 1HYZA 2W8LA 5KRSA 3V9UA 1NKCA 3PW5A 2W9CA 5HLFB 5KG7A 3ZCMA 1VSIA 3IRXB 1B92A 1D9FA 3CYMA 1S6QB 1GOBA 1JKHB 3QLHB 2Z1JA 1S1XA 4CEAA 2FVQA 4CJEA 4LD0A 4FJKA 2C2EA 1KLMA 3L2VA 2HAIA 4NCGA 4O44B 1TVRB 3TWHA 4KAZA 3OY9A 2IAJB 3HK2A 4KBIA 2RKIB 4CEFA 3QETA 2FJXA 4NLGA 1S0OA 2R7YA 3VN5A 4W5QA 3SUNA 3M9NB 4DS4A 4PY5A 3CQ8A 1QE1A 3NH2A 4DF4A 4YR0A 4DWIA 4M45A 1RDDA 4E7HA 1N6QB 2GV9A 4CJLA 4TLRA 3KLVA 2V4QA 3C95A 3AVBA 5KG1A 1NJXA 1N6QA 4IDKA 3I0SA 1DLOB 3WNHA 2HHSA 4YQWA 4JLHA 1NHUA 2X74A 5JS1A 4WFYA 4KHNA 4IG0A 3DLEB 5CZ2A 5DGAA 1ZBIA 3MFIA 1XHZA 1JLCA 4CGJA 4Q0BB 4QPXA 4W5RA 3L2WA 4NLOA 3CM6A 4FZXC 4FVMA 1N48A 1I6JA 2HHQA 2P5OA 3MAQA 3V6KA 3OYIA 3K2PA 4K8XA 3V9WA 3NF7A 3MEDA 4PA1A 2G8IA 2JGUA 4IG0B 3MXIA 3LZJA 4KRFA 4CJWA 3KLIA 4N47A 3CFOA 3CVKA 4F4XA 4QCLA 1VSLA 4Z4FA 3THVA 1NK8A 5DQHA 4J9MA 2XI2A 3E01B 1L5UA 3I0RA 4GC6A 1UA1A 4O3PA 2WK4A 3MFHA 1XHXA 1RNHA 2JEJA 2WHOA 4GW6A 3DOKA 5HROB 4J9KA 3CFPA 2KFZA 1WSEA 3TAMA 1Z4UA 2B5JB 3TAPA 2VWKA 3PJXA 3OYBA 3GQCA 3O4QA 1O1WA 1ITGA 2BR0A 2J6TA 2OPQA 4EYIB 1VK0A 2V4RA 4ZHRB 3BDPA 2XI3A 4MQ3A 1WN7A 3AVJA 4XPCA 2FLLA 1D5AA 2BRLA 4IG3B 1ZTWA 2D3ZA 2HHVA 3DLGB 2FJVA 2OH2A 2XY8A 4DTNA 1S1WA 4NCGB 2XO7A 4BACA 4EYHB 2DTUA 1LV5A 3RRGA 1TK5A 5L1IA 2AU0A 4M3YA 4R8UB 5KFRA 1LWFA 4X2BA 3B6OA 1VSJA 3AVLA 4HUGA 5HBMA 4LQ3A 4J9SA 4N5SA 2QK9A 1TKTB 1J5OB 4MK7A 1TKXA 2QXFA 4J9RA 3SQ4A 1JLGB 3VQPA 3CJ3A 5DQGA 3TQ1A 4CHQA 3ZSZA 4ELUA 4I9QA 1HYVA 3V4IA 2XY7A 4NRTA 5C25A 1QAJA 1RTDB 3SNNA 3RBEA 1TGOA 3AA4A 4I2PB 2D7SA 5JUMA 2RDJA 3HO1A 3O3GA 2ATLA 2FBXA 3HVTB 4EEYA 3KK2A 1JLBA 1S1TA 5KFFA 2FJWA 1X1PA 4F3OA 1S1VB 2GUIA 4B9LA 2G8FA 3KK2B 2YNFA 4BDZA 3O3HA 3SFUA 4CHYA 3LDSA 5FROA 5HP1A 3OL8A 1NJWA 1C6VA 4I2PA 3VQCA 2BQ3A 3WNGA 1W0HA 1QUVA 3QO9B 3SUOA 4WE1A 1C2PA 3TARA 3ZSRA 1TL1B 5I42A 4AHCA 2OPRB 4B8CA 3GIKA 1ZBLA 1TKZB 1TAUA 1WSIA 4Q44A 3OYNA 4DTJA 5KG4A 1C1BB 4IRCA 4FJMA 2HMIB 4DSJA 4KHMA 3TAEA 4FJ8A 3F73A 3DYAB 4RW7B 4CIGA 4J2EA 3DM2A 3QEVA 2HWIA 4FZYA 1ZYQA 2J6UA 3WNFA 4ZP9A 4M94A 4J9LA 3ZSWA 1ZBHA 3OSNA 2WONB 1BISA 3HSTB 4U7CA 1UWBB 2O5DA 3TAFA 3V6JA 1CZ9A 4J9NA 1LWCB 4Y2AA 1EXQA 5KG2A 4LSLB 4JS4A 3H98A 1NHVA 1BI4B 1NJZA 1YTUA 1W25A 4CERA 4IDKB 4Z4GA 3AA5X 1BGXT 2R8GA 1WAJA 2FBVA 4Z4EA 3HP9A 1FKPA 2P5GA 3QIOA 4DU4A 5C5JA 1TV6A 1QE1B 3G10A 2OPRA 1RYRA 4CEEA 4DTXA 2YKNB 4O3SA 3MTKA 5DG7A 1ZBUA 5HRSA 4Y1DA 1IKXA 2RKIA 4KFBA 3H40A 3CDWA 3MF5A 4NRUA 1IKVA 4M95A 4IRDA 2I1RA 3HP6A 1WAFA 3HM9A 1KLMB 3NAEA 2G8VA 3OYEA 5DK5A 1CZBA 5KFXA 3K57A 3IGNA 4O3NA 1HJRA 2HNYB 5J2MA 1WSFA 3C6UB 5I3UB 5CYMA 2XHBA 1UWBA 5KG0A 4B3OA 3PX4A 3SJJA 3BQ0A 3SI8A 4HHTA 4LH5A 1KVAA 2FC0A 2X78A 2PYLA 1KHVA 3HPHA 1CLQA 3IRXA 1X9WA 3RMBA 1RTIB 3VQDA 4CHOA 4E7LA 1C0TB 5HRPA 3QIPA 2Z1GA 1WNEA 4DQIA 1C1BA 4C8OA 2FLPA 4FM2A 3KLHB 2IJNA 3QZ7A 1JXBA 3M9OB 4C8LA 3NDKA 4FJJA 3GIIA 4YR3A 1TL1A 3KJVA 3NBPB 5K14B 1KSPA 3KLEA 3QNNA 4QAGA 1KVBA 1S1UA 1J9AA 1LAVA 5KGWA 3NH1A 1RT5B 3MEEA 1HQEB 4EP4A 5DQIA 4QOZB 1SH2A 3KMQA 5KFNA 4DTOA 4EBCA 3ZT0A 4CJKA 4MH8A 1TL3A 3PO4A 4ZPAA 4XPEA 4I7FA 3QGGA 2X6NA 1RTDA 4FK0A 4J2DA 3QEWA 5SWMA 4Z4HA 1LWEB 1TV6B 5KFPA 4DQPA 3D45A 4ID5A 4ED8A 3SUPA 3FDSA 2IM3A 5DG8A 4O0IA 2XCPA 3TABA 3VQ5A 2R2UA 4MFBA 3ITHA 1L3UA 2IAJA 4E3SA 1QS4A 1BIUA 4B9NA 3MXJA 4NYNA 2XRIA 2XWYA 3PY8A 3H2LA 1J53A 1L3VA 2OYQA 4PUOB 4MKBA 5KRTA 4L8RB 4KO0B 5KFLA 2B4JA 4RW9B 1U04A 3Q8RB 3FFIA 1YVFA 2AGQA 1KHWA 4QWBA 4CJVA 4CK3A 2JLEA 1WSJA 4AHUA 1JXLA 3DLEA 4IFYA 1HQUB 5KFAA 4ECWA 2HB5A 3AO3A 4AHTA 2OA8A 4ZPBA 5F8HA 2KZMA 2ASLA 4OKEA 4EP5A 3CJ5A 2OPSA 5JXSA 4KHRA 4URSA 4DG1A 3CDEA 4AH9A 3GIMA 4EBDA 1A5WA 4JV0A 3KLIB 3NF9A 3OYHA 4M3TA 3KHLA 4CJRA 2HNZA 5T14A 4CJSA 4KHQA 4F4YA 3EZUA 4QWAA 3DLRA 4HCCA 4IH5A 4M3RA 2DFEA 4DTSA 2WOMA 4Y1CA 4K4TA 1X9MA 3OJSA 1W9HA 4AHRA 5C42B 5F8MA 1TKTA 1J5OA 2KZZA 3VQBA 5KFTA 1U47A 4RNMA 4EBEA 4CFDA 4ZP7A 1C0UB 3RAQA 3VQQA 2W42A 4E0DA 3T3FA 4KB7A 3JSMB 3AO1A 3K59A 1RAJA 4R8UA 3NGZA 4MK9A 2HHTA 3NCIA 3AVCA 1RT2B 2OPPA 1FK9A 4MIBA 1HNVB 4JRPA 4Y3CA 2PZSA 3DLBA 1LW2A 4IG3A 2IC3B 3EYZA 4KHSA 4EZ9A 3IN5A 4KB1A 1JXEA 5KFYA 2WCXA 1RT1B 4O55A 2B43A 4FJHA 4O3RA 4N56A 3S3MA 1HQUA 3QO9A 3G6VA 3KHHA 3JYTB 3HJFA 4CEDA 5DMRA 3PZPA 4LSNB 4CGIA 1K1QA 3T5JA 3BGRA 1RT5A 3GV7B 4DFKA 4Q5VA 1KTQA 4CIEA 4WXWA 1NOZA 4CK1A 1N56A 3PUFA 4FLVA 4WZQA 5KFWA 3AVGA 1KFSA 3QINA 1IKYA 3ZT2A 1S6PB 3NGYA 4M3UA 1S97A 4LY7A 2PYJA 2FBYA 3PV8A 4R5PB 4NYFA 1SKWA 3RRHA 1N4LA 2AGOA 2FVPA 1RTIA 3LP1B 4F3TA 2WRMA 1RTJA 2OZMA 4G1QA 4TXSA 4ED0A 3NAIA 2B6AB 1JL1A 3P5JA 4RW8B 3RAXA 4B8AB 2HWHA 4K4SA 4B3OB 3BSNA 5KT5A 1F21A 3PX6A 2OZSA 3C6UA 3IAYA 4QW9A 3HXMA 2HNYA 5J2MB 4M3XA 3LPUA 3FQKA 4DS5A 5FDLB 3ZSOA 4E7JA 1BCMA 3DDKA 3TAGA 3C6TB 5HRNA 1X9SA 1MU2A 3AO4A 4YP3A 2R8KA 2UUWA 4ED7A 3MEEB 5D3GA 1HYSB 2UVRA 3H5XA 3T5LA 4J9PA 4CGFA 4RW8A 3HKWA 2VA3A 1C0UA 2IS3A 3NKYA 1A5XA 1FKPB 3ZSQA 4RNHA 4DSEA 3EPGA 4CF1A 2PY5A 4FS1A 5KI6A 4F2RA 4FK2A 2D0CA 4Q43A 1JLFB 2IM0A 3I5CA 4FXDA 2YKMB 2ASJA 3DLKB 1VSEA 2EHGA 1S9EB 1LWCA 2ASDA 1NOYA 4ZPDA 3QNOA 4FJXA 3IS9A 3NE6A 2VG5B 4IKFA 3AO5A 1GX6A 3QEXA 4FJIA 2R2SA 2XCAA 1GOAA 2FVSA 5I3UA 3H4DA 1RT6B 1QSYA 5KFHA 1VRTA 3ZSXA 3BGRB 4DQRA 4CGHA 5J2PB 2QKKA 3K5LA 3ZT1A 2OPSB 4O0JA 4ZP8A 4CEBA 1RBSA 4FJLA 2E4LA 1YVUA 3P1GA 3SQ2A 3UR0A 5CYQA 3V1OA 3AVFA 3LAKA 4AHSA 1QSLA 4WE1B 3L3UA 3L8BA 1SH3A 3AA3A 3NF8A 1FXXA 4FJGA 1KRPA 4QWCA 4NLUA 3LPTA 1HYSA 2YNFB 5J1EA 5F8LA 3N6LA 4DEZA 4CF2A 4NCBA 1VRUA 1ZTTA 3C6TA 3ZT3A 4UQGA 4ED3A 1ZETA 4GC7A 1RDCA 3QZ8A 4OPKA 4Y2CA 3V9XA 1HNVA 3DOLA 4KI6A 1RT2A 1KLNA 5KFEA 1TK8A 4PUOA 4Q8FA 4FLTA 1VSDA 2X6SA 2KFNA 2JC1A 3IS9B 1JL2A 3O3FA 2WONA 1L3SA 3IG1A 1NK4A 3M8QB 1S9EA 3RWUA 2AWZA 2ITGA 1RTJB 5J2NA 1JLGA 3DI6B 5DLGA 3OL9A 4FZZA 5FRNA 4F4KA 4IQXA 1U09A 3CJ2A 4NYZA 2YHBA 4E1NA 3OS1A 1HRHA 1KCFA 1LWFB 1BQNB 4DLEA 3U3YA 4ZVEA 1RTHA 1C1CB 4WFXA 1RT4A 1FKOB 3CDUA 4YR2A 3HPGA 4KE5A 1XR5A 4CIFA 3PW4A 3O4NA 1D1UA 3UQSA 3PJWA 4ECUA 2BDPA 4MIAA 5KFDA 3TVKA 2KW4A 4OLBA 1S1TB 4QW8A 1YT3A 4PQUB 3HPOA 5KFGA 5HROA 4CESA 4IFYB 1HMVB 3QGHA 5HRRA 4M41A 2AX0A 4FLZA 4KREA 2BE2B 1GX5A 4XO0A 4DL7A 5CY4A 3ZSYA 4DFJA 4PQUA 3KLHA 4HTUA 5J2PA 1KVCA 5DGBA 2HW3A 4NCAA 5KTQA 3Q8SB 2BGGA 4OLAA 1RT6A 4DFMA 2D0AA 5FRMA 4FM0A 4RW6B 2HVIA 2D41A 1RILA 4IFVA 4N76A 5KT3A 1BL3A 3H5UA 4CHZA 3L2RA 2C22A 1BQNA 2G8KA 1SL1A 3VQAA 1Z25A 3T5KA 3RB6A 1S1WB 1JLFA 4FBUA 2Y1IA 1IG9A 3V6DA 3ITHB 1S9GA 1ZBFA 1REVA 4ZTFA 3JYTA 2Z1IA 3PW2A 4Q8EA 4ID5B 3KD5E 4OKJA 4K4XA 3MEGB 3QERA 2G8UA 1LWEA 3L3VA 2IBKA 3LANA 3LP2A 4H4OB 4KI4A 2XY6A 4W5TA 1T3NA 3DLHA 5D3GB 4KHUA 1QAIA 3GV8B 4N41A 4RUAA 1C0MA 3DOLB 3V81A 5F9LA 1T94A 1TL3B 4IBNA 3MR2A 4NLPA 4JS5A 2IC3A 3I5AA 3I0RB 2JEFA 4CK2A 3KTQA 1S5JA 2JEGA 3V81B 3KMSA 3K5MA 2OPPB 3AVMA 2ETJA 4J2BA 3LP0A 2Z1HA 1SUQB 2JC0A 2W8KA 1NNDA 3BQ2A 4KHWA 3NBPA 2UUTA 4G1QB 4H54A 4Z4IA 3LP1A 4K4VA 4WFZA 4C8KA 3IGVA 2ATQA 1IKWA 4DQQA 4DL5A 3RMAA 3HVAA 1S48A 4E89A 2IA6A 2W9BB 4GMJB 1TVRA 4ECSA 5KFQA 4CEOA 4B9SA 4KHYA 1C0TA 5EWEA 3VQ8A 1LW0A 4RUCA 5C24A 2C2RA 4FCYA 1ASUA 4ECRA 3EZ5A 4DU3A 3OJUA 2D5RA 4ECTA 3L2QA 4FW2A 3SV3A 3LALA 4RW6A 4RNFA 3BJYA 2P51A 3S3OA 2AGPA 3QESA 4WZMA 4TY8B 5KFJA 4FLUA 4F4WA 1NK9A 2E9ZA 1JLBB 4IH7A 3PVXA 2E9TA 4O4RA 4J9OA 3FSIA 2GBZA 4ZP6A 3K58A 3SYZA 4DL2A 3SPZA 4BE0A 4K8ZA 2JEIA 3U6FA 4H4OA 3HHKA 4FJNA 1RT1A 4CFAA 3OHAA 2GC8A 4RU9A 3VQ4A 5KG5A 4TY9A 4G3IA 1UA0A 3MXMA 5KFVA 4KB0A 4M3ZA 1SKRA 5KGXA 2V9WA 2RN2A 5EWGA 1FKOA 2E9RX 1RT4B 4AHVA 4ECZA 5F8IA 1JKHA 1RA7A 1HARA 4KV8A 2WB4A 2O4IA 1T03B 3ISND 2WTFA 3MR6A 3KJVB 1T8EA 3RMDA 4ZPCA 3KD1E 2F8EX 4IH6A 2A1RA 1EKEA 3SUQA 2E6LA 4DTMA 4NLTA 4MFBB 3OYFA 4R5PA 5C42A 3RMCA 1Q8IA 4M3WA 4OVLA 4LH4A 2Q3SA 2OPQB 1JLQB 3IG1B 4OJRA 1S6PA 1RYSA 3BSAA 4WYWA 4CJPA 3QEIA 4NLRA 2YNGB 4I7FB 4OKKA 4GVMA 5F8JA 5CYMB 2O4GA 2ALZA 3QGIA 3E01A 1S1VA 3DRRB 3V9SA 1EETB 3DRSA 3KLFA 4PWDB 4ZVFA 4DMNA 1HQEA 4ED6A 2BQUA 1C1CA 3NL0A 2VA2A 1D0EA 3MECB 4CJTA 1B9FA 4IOBA 1N5YA 1XR7A 2XY5A 1WLJA 4DQSA 1XWLA 4DL3A 2DPJA 3QIPB 4DSLA 4EO6A 4CEZA 4KTWA 2YHAA 2KTQA 1SV5B 2F8TA 3MR5A 1R0AA 1OS5A 1NK7A 5KFCA 4H8KA 2I5JA 2QKBA 5HBMB 4CHNA 2VG5A 3T1AA 1BQMB 1Q9YA 3BREA 2YV0X 4DTUA 3CJ0A 3C94A 3VQ9A 4FLXA 1DTQB 3KK1B 3OVNA 1NKBA 2XGPA 1SV5A 4EZ6A 3KKSA 4RW7A 1IKXB 5F8GA 1S0MA 4Z4CA 3N6NA 5KFBA 3HVRA 1VSKA 2RPIA 3RTVA 1S9FA 4H4MB 1YTAA 3OYGA 1UOCA 1BIZA 4JV2A 1RCHA 1U49A 5EU7A 2C28A 4O5BA 2HNZB 1REVB 4FW1A 1S9GB 4WYLA 1BHLA 2UVWA 1EETA 3DRSB 4PWDA 3CJ4A 3FRZA 3V1RA 3KK1A 4ED2A 4K4YA 3SPYA 3NGDA 1BI4A 4CHPA 4TY8A 1A5VA 2RF2A 1NJYA 1BQMA 5L1KA 2DFFA 3RB0A 1JLEA 4NLDA 3OLAA 5K14A 4CJ4A 4FJ9A 3WNEA 4C8NA 5HLFA 4NLVA 3HL8A 3NAHA 1T7PA 2ZE2A 2AQ4A 5C25B 1SL0A 5KFZA 1LW0B 1T05B 1G15A 4QWDA 3EPIA 4OGEA 3NGIA 1VSHA 3T5HA 4DTPA 3N6MA 2D0BA 4TYAA 2XC9A 4TYBA 1T05A 4Q0BA 4RW9A 3L2UA 1TKZA 5KFKA 3OYDA 3QEPA 4FLYA 1T03A 3D5MA 1JLEB 2ZKUA 2QE5A 3TANA 1S10A 2W7PA 1NKEA 2FBTA 4TQRA 3DRPB 4FM1A 5J2QA 2AX1A 3CM5A 2KQ2A 4ZVHA 1C1AA 1GOCA 4RNOA 3OLBA 5F8NA 4ICLB 1SH0A 3K5NA 1UAXA 3MR3A 3HVWA 3KNAA 4BE2A 1MMLA 3BQ1A 3OL7A 4W5OA 1RTHB 2YKNA 5E41A 2Y1JA 2R8IA 2EC0A 2IDOA 4H4MA 5KT7A 3H59A 1XI1A 4O3OA 3BSCA 5JS2A 3TI0A 1IM4A 4NLQA 3AVHA 1HNIA 2BQRA 1U45A 4Z0UA 4I9LA 4KSEB 2ILYA 1K6YA 3VQEA 4TN2A 1TKXB 3P83D 3UIQA 3V6DB 1Y97A 3KIOA 1KFDA 1TK0A 4F50A 1FK9B 3GV5B 1HPZA 2DFHA 3S3NA 3LWLA 3OYCA 4CE9A 4DLGA 4ECVA 2RDIA 3QIDA 4CGDA 1S6QA 2W7OA 3JSMA 3MEDB 4IFVB 4HYKA 3NHGA 3M8PB 3U3GA 1EP4A 1JLAB 3ISNC 1RBRA 3DM2B 2A1SA 1IH7A 3DLGA 3UDLA 3H5SA 4KTQA 1J54A 4CJ5A 4BDPA 3KKRA 4ZHRA 3EY1A 2DPIA 1RBTA 1RA6A 4LSNA 2HNDB 5EWFA 2FVRA 1N5YB 2R2RA 2VG6A 3PX0A 1I39A 2HHWA 5KFOA 1RBVA 2BE2A 4YMEA 2DY4A 5CYQB 4ID1A 3M8RA 4CEQA 1RT7B 2VG7B 4HUFA 3PO5A 3ASMA 3I0SB 3G0ZA 3DRRA 1EX4A 4DG1B 2BRKA 4CJUA 3FQLA 2IM1A 1IKVB 1RT7A 2VG7A 2QV6A 3HVTA 4FK4A 4OL8A 2UVUA 1SL2A 3SI6A 4ZTJA 4B9UA 2D3UA 3OS2A 5C24B 3QYYA 4YNQA 4O4GB 4XIUA 3V4IB 2G8HA 1ASWA 2GIRA 4HVJA 3MEGA 1U4BA 3TR8A 2GIQA 1JLQA 5T7BA 3DMJB 4CFCA 2VWJA 3GYNA 1JLCB 3ZSVA 4FBTA 3AVAA 4CJ3A 3M8PA 1RDAA 4O44A 3V1QA 3I5BA 5J2NB 1DTQA 3DMJA 1XR6A 1TKDA 4LSLA 2WOMB 1SKSA 1S4FA 3LP0B 3LAMA 3H5YA 1HPZB 4DFPA 1CXQA 1DLOA 3I8DA 3SCXA 2W9CB 4B9TA 3KHRA 1R0AB 5DG9A 5DLFA 4E1MA 4CJFA 1DTTA 3KLGB 5L9XA 3PR4A 5FDLA 3ALYA 3TAQA 4IKAA 3NH0A 2B5JA 3LWMA 4K4UA 3CIZA 4C8MA 3AVNA 5I42B 1WSHA 3DOKB 3MECA 4NZ0A 1JIHA 4KKOA 1L3TA 3ICLA
chains in the Genus database with same CATH superfamily
2QC3A 1MA9B 2WVBA 2XNRA 2HKEA 1NGIA 2FJDB 2YNHB 3NEKA 5LT5A 2OIHA 4X4NA 1NSKL 1OO0B 3MZIA 1N36J 3K5OA 4ECQA 1ELOA 4DSFA 3K8VA 1VQKN 2QL9B 2UUBJ 1CC7A 2JNJA 1NK6A 2CZ4A 4H5RA 4AXJA 2ZH3A 2NXNA 1H74A 3GU0A 3ZT4A 2RMLA 4ZLNA 4LF9J 3DJCA 3LZIA 4CCHA 2Z2YB 3MAAB 3OFHA 4DHVA 4GVBA 4ALZA 1OSCA 2JJ4D 2VQEJ 4ED1A 4LF6K 2KHOA 4E7KA 1T9VA 3PR5B 1QHTA 3GOIA 3QT6A 5IT4A 1SUQA 1N33F 2LSNA 2YNIA 1XMQJ 4ZPVR 2WVEA 1ZXOA 3Q89A 4MKAA 4BHQA 2NXJA 2ALYB 3KK7A 5B0EA 4CF0A 4ZLJA 1IG8A 3H7HB 4LFAF 4IFEA 2B8PA 4F4ZA 5KG6A 1NUEA 4G6VB 2OUGA 1I94F 1XNQF 3CCSS 4RWWA 2BJ9A 3UW1A 1YZ7A 1LAWA 2IGIA 2CH5A 4FPBA 2BANA 1RT3B 4HKQA 1UVMA 2EX3A 1Y5LB 4IR1A 3HT3A 1VDHA 2ACMA 3RB4A 2RT3A 1XC9A 4HUEA 1M5OC 1SAZA 4CLSA 1M5SA 4GO7X 4AQYK 4OPJA 1TAQA 1RBUA 1UAWA 1T11A 1TP7A 2MGZA 4RW4B 4R25A 1QQOA 4DV6K 5KFSA 1QSSA 1GXLA 1TFYA 3FK4A 4FJ5A 2IOCA 2A2DA 5J1EB 3FZBA 2XZTB 3IFEA 1NPRA 4KFBB 1FE0A 3KKFA 2YWGA 1FX2A 3NVMA 5IT9O 2KHDA 1S0NA 2XQCA 1S0VA 1YHQS 4WF9Q 4YN3B 2F96A 3VAGA 3UCUP 1KC8O 4CDIA 3MOJB 3MDQA 1X4CA 2V7ZA 4BRQA 4OGCA 3I6PA 2DGOA 3R3LA 4BREA 1B9DA 4YOYA 3AA2A 5RUBA 4CGGA 2YNGA 4KO0A 1QTMA 3O1BA 4OIXA 5IC6B 3Q8PB 1IO2A 3THXB 1Q8LA 3PIPL 3ZNUA 1M5VC 4A62A 1MWYA 5HANA 3A3OB 2HEKA 1VCTA 2GJIA 4ILJA 3M2RA 3AO2A 4QIFA 2F4VK 3N5FA 5F0UA 1NK0A 2HQGA 1VQPS 3M9MB 3FLCO 3OVBA 3M8QA 1S1XB 4NMLA 4RZRA 1SJ1A 3OW2R 4KAIA 3I55S 4U6PA 2QXLA 2WZ1A 5HQMA 4TQSA 3GCXP 4DR3K 2KLAA 1MU2B 4E7IA 5K8MA 3MWBA 3TSUA 5M1KA 3A0IX 1U48A 4CYUA 2VBZA 2HYIB 3DRPA 4JUZA 3J80Y 1IWGA 4ED4A 4JKCA 3LP3A 1URRA 1FJGK 5F1XA 1Y4ZB 2Z58B 2RRBA 4BDYA 4DSKA 4ZJOA 2HNDA 1HNXJ 5A8RB 4U96A 1ATSA 4DPTA 1EIYB 4K4ZA 4DSIA 5B0BA 4RBTA 2VDIA 3J8AA 1EKRA 1N54B 3KDNA 3R7NB 3V9UA 2HGNA 2CFXA 1X4DA 1FESA 1VSIA 3IRXB 3OTEA 1D9FA 1HBNA 3I4PA 1N33J 3QSIA 1JKHB 3QLHB 2Z1JA 2KYZA 3OPKA 4CEAA 5GAEU 1M1KO 1KLMA 3TJ8A 4O44B 1TVRB 4CQ1A 3OR1B 3M8WA 1NMNA 3OY9A 4OZ2A 2QJ3A 2VICA 3J81O 1QUPA 2OD6A 3QETA 1S0OA 2R7YA 2DIUA 4HACA 4PPDA 5A76A 4PY5A 4DXLA 3G82A 4JI6K 1BE4A 4DWIA 2MLYA 1RDDA 4E7HA 2UP1A 2OD4A 1N6QB 2GV9A 3AVBA 3DGPB 4USWA 3CJRA 4ZS6A 2E1ZA 3HSDA 4MMOA 5MAOA 3W2WA 5BYRA 2X74A 2ZOMA 4RWTA 4KHNA 4IG0A 3SBTA 3DLEB 5LJ5Y 1B70B 4LR9A 4NLOA 5IT9Y 3FR0A 5F2RA 4MYTA 1SJRA 3EEQA 4JI4F 1I6JA 3MAQA 3OYIA 3V9WA 3CCMN 1TMMA 2XG8A 3CTRA 2KM8C 3EGNA 1I94J 4PA1A 2G8IA 2OSQA 2F1FA 4KRFA 5AE3A 3UKUA 1SQEA 3P6YC 4B3RJ 1D3WA 3CFOA 3CVKA 4F4XA 4QCLA 2IMOA 1YG0A 1I94K 1K47A 3FCHA 2XI2A 1SC3B 4NWBA 3EVOA 1UA1A 4O3PA 5ETTA 4I64A 4OYZA 3JQMA 3SIPB 3MFHA 3FEYB 1XHXA 1RNHA 1XIQA 3AJ2A 2JEJA 1RABB 3CETA 3IBCB 3CIPA 3CFPA 2KFZA 1CULA 1F5BA 1Z6RA 2E44A 2M0GB 3OYBA 1EQ0A 2CIMA 1OYEA 3VVUA 4MQ3A 3AVJA 1Q7YT 4WF9L 3JTPA 3NMRA 3BZCA 1J5EJ 2FJVA 3MURP 3M8ZA 4I56A 1S1WA 4EYHB 3KNGA 1K73T 3W64A 2RE1A 4AL5A 4OPHA 3GSIA 3V4MA 3AVLA 2NRXA 4BRNA 1DY3A 4JI3F 2CGKA 4J9SA 2HQDA 2HBKA 2BKOA 3X1LB 4MK7A 1KEKA 1TKXA 3VF0B 1S6UA 1JLGB 3IM9A 3WZ0A 2CZVC 4I67A 5F0WA 3OBYA 1SQGA 3ZSZA 1HYVA 4NRTA 1XNRJ 1FA0A 1RTZA 3SNNA 3J7YP 2CJXB 1LK7A 4YDUC 4X62K 3HO1A 1T9YA 3KK2A 4I69A 1X1PA 2KRRA 4F3OA 1S1VB 2GUIA 3FSYA 4DBQA 3MCMA 3LDSA 2NZTA 2MDAA 5HP1A 4ZCLA 5A8KA 1NJWA 2EWHA 2BQ3A 3OR2B 3W2VB 4NX9A 1C2PA 2NSCA 2OPRB 1ZBLA 1JCEA 1QDUB 4DTJA 3QWUA 2QMWA 3WBZA 1RGIA 3CCTA 1NMEB 3EX7B 2HWIA 4OI3A 4LFCJ 4JHDB 4EFHA 4TKTA 4J9LA 3GJRB 1ZBTA 3OSNA 2WONB 1BISA 3MAHA 4C8YA 2MKSA 1UWBB 1RHKB 2UUAJ 1A0OB 1HQ2A 4JI2J 2NRZA 4NI2A 4CLLA 3U8XA 1NJZA 2GVZA 4CLKA 3K0JA 1YTUA 5I3QA 4IWVA 2R8GA 1WAJA 2OGUA 4M7XA 1JQGA 3HP9A 4NYPA 2VDHA 1EWRA 2CPYA 2IVOA 5LM7E 1O8BA 2QEXS 4DR1K 3DC2A 1TV6A 4GV3A 5DM6Q 3G10A 2OPRA 2FDNA 5TKWA 5DG7A 1ZBUA 5D0HA 1ZS6A 2IBOA 2RKIA 1Q5YA 3CDWA 2UXDJ 3MF5A 1QAYA 1IKVA 4BC2A 4A8KA 4IRDA 2V5HG 5M1FA 4B3MF 3M6VA 3NAEA 5KFXA 2RAQA 1WSFA 4E1JA 3C6UB 5I3UB 5CYMA 2DHXA 5KPZA 3M7VA 2VPZB 3BQ0A 5DS7A 2M4MA 4TU8A 1KVAA 2FC0A 4I4BA 4CHOA 4I68A 1WD6A 3DU5A 2FGOA 2IIRA 4C8OA 2E7XA 3O08A 2GV1A 3KLHB 3CCQS 2IJNA 4WPAA 2RSQA 5DZ7A 3M32B 1JXBA 3NWGA 1PAEX 2QWLA 4WJBA 3KLEA 3H0PA 1XQSC 5C2DA 5BN9A 4OFZA 2VASA 2Q31A 5KGWA 3LDLA 2EWSA 2P6TA 4JNEA 2MJUA 1F9FA 5DQIA 1VI7A 1S5ZA 2HBLA 4CJKA 3OD2A 4IEIA 3LGMA 4MH8A 1TL3A 2X6NA 5C15A 2KJVA 3KVGA 4X65K 3MDFA 4CBXA 3QEWA 4DQPA 3SUPA 4ID5A 2FB0A 2IM3A 2O8FA 4K42A 1WC5A 2C3MA 3TABA 2SXLA 3O6QA 2YHWA 3WEEA 1EKSA 1BIUA 2DHAA 4DUTA 2YI1A 4A8YA 2VC1A 1R8PA 2CPEA 3PCOB 2PGCA 4MKBA 1Y5IB 3RBZA 4IOXA 4A59A 4V19J 3CJKB 2ZH6A 1XNQK 2B4JA 3OXGA 4CZHA 1J5EK 4RW9B 3IR6B 1LQ9A 2ZDPA 1IR2A 1H98A 4CNZA 2V7YA 4H0XB 2N7YA 2JLEA 2NQPA 2MKHA 1PJ5A 3DLEA 5KFAA 2IY5B 2RHQB 4ECWA 2HB5A 4DUZJ 2V34A 4AHTA 3R5GA 4ZPBA 1IQTA 5F8HA 1Z1ZA 2PO4A 4USMA 5JXSA 2XBPA 2CQ0A 4DG1A 2JLFA 5LJWA 4Y0FA 4KGZB 1X5OA 1A5WA 4Y65A 4CZFA 3I9V9 3KLIB 3GTYX 3NF9A 3ATVA 4CJSA 4BC7A 4KHQA 4OX6A 2H5EA 4EUVA 2QFJA 1P8GA 3W9HA 3HHLA 2A3ZA 1IUJA 1X9MA 3OJSA 5IV3A 4AHRA 2ZC3A 1KVJA 5HQLA 1RDWX 1J5OA 5EX5A 5KFTA 3FEZA 4RNMA 4CFDA 2WFBA 1WKJA 4ZP7A 3RAQA 4KB7A 3L0QA 4UQTA 3HHLB 2MKCA 4DPYA 3G2XA 1XK8A 4NXMJ 3SQOP 3CW2C 4FSVA 1RT2B 3HZGA 2OPPA 1NSPA 2XMUA 2OMLA 3FZ2A 4BRDA 1NBEB 2J76E 2Q6BA 3DLBA 2UXCJ 2LU1A 3EYZA 4KHSA 2ACYA 1NO8A 3JXOA 4EZ9A 4FPRA 3C15B 4UW2A 4KB1A 3BV8A 2QMXA 2WBRA 3EXCX 4AM6A 3UD4P 4J7CA 2UXBF 2CQGA 3BZQA 4U8VA 5AZIB 3JYTB 2HRYA 5E3RA 4CEDA 4ANCA 4LSNB 3HFZB 4LR7A 2VB6A 2YHYA 2DR6A 2N4CA 4CGIA 4WIQA 1E4FT 4ZPTR 2VF3A 3BGRA 4CLTA 2J9DE 2RE2A 4JI8K 4Q5VA 1R6YA 1KTQA 5LMNK 2HRTA 3T1HK 1N56A 4PKGA 2Q0UA 4ES3A 1KFSA 3QINA 2DNZA 1Q7YO 2EFVA 2W1BA 2W2QP 4DV3K 4LY7A 5F3TA 1BG3A 2ZH5A 2ZUGA 2FBYA 3UN5A 2BE7D 4NYFA 1OY6A 3R1XA 1Y3KA 2R7UA 2VJUA 2YPYA 2MZQA 2O8FB 4TVAB 1Q86O 4LF8K 4ED0A 1UKUA 3THXA 4ZKAA 1M5KC 4ER8A 5KT5A 1F21A 3VEVA 3C6UA 2GQCA 3HOSA 3IAYA 5DDOC 3P39A 3F2KA 3HLUA 3W60A 4DS5A 5E5NA 3ZX2A 3EE9A 3AXKA 3AO4A 1CPZA 2R8KA 2F40A 1OY9A 5D3GA 5K20B 1NGHA 3T5LA 4CGFA 2XMWA 5J1NA 3L95X 1S22A 5KOXA 3EPGA 2GJFA 2BYCA 4BG9A 4BRCA 4F2RA 1FDNA 3FGVA 4FXDA 3I5CA 2YKMB 2FY8A 3TYTA 2AEJA 4H03B 1K9MT 2GEMA 4ZPDA 2J0SD 2MQLA 3A5NC 3AO5A 1GX6A 2APOA 3P45B 3BGLA 4C9DA 5I3UA 4LF4F 2M88A 2L08A 3BKTA 2DY9A 5CQGA 1N34F 3U1MA 3LL3A 2L48A 3K5LA 4ZP8A 2OANA 1R0BG 4FJLA 2E4LA 3SQ2A 2EFQA 3AVFA 3LAKA 2BE9B 1SH3A 1R8AA 3DHWC 2UUCJ 2MKIA 3ID6A 2QSWA 3P38A 2CQDA 3EE3A 5F8LA 3JSYA 3OT9A 4D3HA 3OHRA 4GC7A 4BR4A 1RDCA 4Y2CA 4GRSA 4KI6A 1NSQA 2N82B 2I6WA 1KLNA 5KFEA 1KD1T 1NWKA 2DGQA 2RJZA 1JL2A 1CJKB 1UCNA 2WONA 2KVQE 3IG1A 2B8QA 1RTJB 2IHR1 3BGOP 1JLGA 3TUIC 2VCPA 4B1UB 1IBMK 1JMTA 2DK2A 1YJWS 4TU9A 3G6EN 2RNEA 2DXDA 1NGGA 1OVYA 1R7IA 5TKYA 4NYZA 5CYJA 4E1NA 2I8EA 4I0WA 4J5OA 1KCFA 1BQNB 3W3SA 1CLFA 4DLEA 1BO5O 1YJRA 2VODA 1RTHA 4HH0A 4WTOB 4YR2A 3HPGA 1XR5A 2J0XA 3PW4A 3O4NA 1D1UA 3IUCA 2DGVA 3QFPA 4ECUA 2BDPA 4MIAA 5AQJA 3THWB 1XMQK 4U7UD 3TVKA 1QZ6A 4JD2B 4OLBA 5L46A 3RW6A 3EM1A 1YT3A 1RE1B 2ZBPA 1Y0HA 1KS2A 2V8DA 4LIWA 5HRRA 4M41A 4DV1F 2AX0A 4FLZA 2N7CA 1GX5A 4CLPA 2IRYA 3KUGA 1HLUA 4DR2J 3ILOA 2ABYA 3E9LA 2EW9A 2OSRA 2HW3A 4NCAA 3DLLL 1VGYA 3NNHA 4FYWB 4FM0A 3AAQA 2CJBA 2YKPA 4PG6A 1RILA 4N76A 3A8KA 2V68A 4JI1K 3H5UA 2ROEA 3EVWA 1P6TA 1BA0A 4MAKA 2G8KA 2LYVA 4CLUA 3VQAA 2W24A 2Y1RI 1ZH5A 1S1WB 2Y1IA 1IG9A 3V6DA 2NNWA 2XTJP 1TL4A 1F2HA 2XLJA 3JYTA 3K5PA 2G0IA 3ENAA 1HWLA 2B51A 3IAM9 4K4XA 2G8UA 1VQ8N 2IBKA 4H4OB 3LP2A 4X65F 1QD1A 5D3GB 1KR4A 4DR5J 4KHUA 1QAIA 3GV8B 2VKZG 4RUAA 1YITN 3GJQB 3SQGB 1D8ZA 3WUHA 1S5JA 2PA3A 1RHUB 2OPPB 3CQXA 3K7RA 3LP0A 3M6GA 2XO6A 4NZ6A 2FHKA 1NNDA 3SCKE 1TYQB 4KHWA 4JI4K 2MQPA 2ZF5O 2UUTA 4FOEA 2NREA 4H54A 3F44A 4K8RA 3MMAB 4OYOA 3C16A 3PYDA 4DQQA 1IR0A 4BGBA 3GCWP 4USHA 4GMJB 2C3PA 1TVRA 4CEOA 4B9SA 3N28A 2XYHB 3C7NB 4DR4J 2CAJA 1PYTA 1KN6A 4RUCA 4DPUA 4AL6A 2Y0BB 5GIPA 3OJUA 5BR8K 3VERA 1U6BA 1AA1B 3L2QA 4FW2A 1HBOA 3O5BA 4RW6A 4RNFA 4DCOB 2DGXA 3Q7CA 1K0TA 3CMES 2ZJRQ 5KFJA 2PC6A 3OQ2A 3PVXA 4FO0A 4O4RA 2C3YA 3NCRA 1U8SA 2GBZA 2GVDB 4X64K 3TRGA 2M9KA 3SYZA 4CD1A 3SPZA 3DNCA 3E9PA 1RHMB 3J81Y 2OTLS 1X3MA 1V5IB 2XLIA 3U6FA 4USUA 3HHKA 4FJNA 3F9MA 4MO5A 1KOOA 1YK9A 5KG5A 1UA0A 1YWXA 1GH8A 2J8AA 5KFVA 3CC2N 3D54A 4DR6K 1HA1A 3OV7A 1SKRA 3WIVA 1T95A 2BABA 2RN2A 2E9RX 4H0VB 1RAOA 2CQHA 2CXEA 5F8IA 4JKAA 1JKHA 1RA7A 4B3TF 1HARA 4ZPWR 2O4IA 1T03B 3EO3A 2WTFA 1NGBA 3NVKA 3FMWA 1GQEA 2AZ1A 2A1RA 1EKEA 3SUQA 2F63A 3R97A 1YJVA 5GAGP 3RMCA 1Q8IA 2AJFE 4M3WA 1YX2A 2IVFB 4S0MA 1JLQB 2GGPA 2CNOB 1CJVB 4CBUA 2QLXA 4OJRA 2UUCF 4MDBA 1S6PA 3TTFA 3MD1A 2KM8B 5EXWA 4CJPA 2F9TA 1Q0NA 3W7BA 2YNGB 3S7RA 3HX9A 3J7ZO 5F8JA 2VPXB 1H2TZ 1HWKA 3V9SA 3BPSP 3NGUA 5FLXU 4H0TB 3ONQA 1RWNB 1RK8A 3VGTA 4OZ1A 2B9EA 1D09B 3AT1B 2XSJA 2YWKA 2ZBQA 4CJTA 4A61A 1B9FA 2L9WA 3FBEA 1N5YA 1XR7A 1WLJA 5D4LA 2NUHA 4OZLA 4DQSA 1XWLA 2VQFJ 1HI8A 2EK1A 2CVIA 3PNIA 4DSLA 4KTWA 1YXQA 1SV5B 5L38A 1NK7A 1OS5A 3DKDA 5KFCA 2KDOA 4FDFA 4PL7A 5HBMB 5ETLA 4YB1P 1XN9A 4IJAA 3T1AA 1VQNS 1BQMB 1Q9YA 2K06A 4DTUA 3CJ0A 5G0RB 1OH5A 3CCVN 2IIHA 4FLXA 3OVNA 6FDRA 4HEA9 2HFSA 1Y00A 3WQTA 2LECA 4ETXA 1IBLF 5JMNA 2RPIA 3CD0A 5IM0B 4B1VA 4XTTA 3HFVA 1YF5L 4K2XA 1AW0A 4O23A 5ADZA 3MM9B 5LSRA 3HI0A 1FFWB 1BHLA 1VC6A 1EETA 3DRSB 4PWDA 5CXTA 4YORA 2OAUA 3S01A 1ZBSA 3ZETA 3NGDA 1VQ9N 2HHPA 1DEJA 4CHPA 2DGTA 3FSXA 1A5VA 4WFNQ 2LQJA 5L1KA 2UV8G 2OFHX 3GWCA 3RB0A 1VQ8S 4NLDA 4DV5J 4FJ9A 2NLWA 4LF5F 5HLFA 1SL0A 2VC0A 5HK4A 1G15A 1VIOA 3ELHA 4QWDA 1VSHA 3JAMO 1NGDA 4P2MA 1N8RO 3IBFB 3CCLS 4KJIA 1QHAA 2J7WA 5LXRA 3PYEA 5FJ4A 1KD1O 3EZOA 1RBAA 3UO0A 3GG4A 2RS8A 2DJWA 5A8KB 1S10A 2K1RB 4P73A 4C3LA 1NKEA 4GKJF 4WQ5A 1C1AA 3VEZA 2XHCA 3UE5A 1DAXA 1SH0A 2EFOA 2V69A 3MR3A 2W6KA 1WELA 2KXHA 1ZA2B 3VZHA 1RTHB 3BEGB 5E41A 3CULA 2IDOA 4H4MA 2CADA 3MN5A 2KT3A 1IM4A 4NLQA 1HNIA 5LMUF 3U1LA 3FZFA 3A8IA 4Z0UA 3AARA 3AB2B 3FFKB 2Y1LB 1SJ3P 2NPFA 1TKXB 5BPMA 2ZM6J 1KFDA 4F50A 1WSRA 4IOAL 1WACA 3WQUA 5KQ8A 3N5BA 3OYCA 2DEJA 5AXMA 4CE9A 4C0BA 2BA9A 3CHWA 1SIWB 1FE4A 1PCAA 2W7OA 3JSMA 3TZYA 5AQUA 4JI7J 4IFVB 5CCLA 4JHDA 3M8PB 1EP4A 5BJRA 1JLAB 3ISNC 4BCAA 1RBRA 2A1SA 3TZWA 4KTQA 4DR4K 3QATA 2EPIA 3BH6B 4CJ5A 3GBTA 3O80A 5KPTA 5EWFA 3E9OA 3AB4B 4J90A 2ZH9A 1VC0A 1DQ9A 3PX0A 3R6LB 3CJBA 3L3CA 1RBVA 4YMEA 3OR2A 4CVNE 4JYAJ 3FE1A 2VBYA 4OX7A 3M8RA 4WQ4A 2N3LA 1RT7B 4DV5K 2ZGYA 4HUFA 2IVYA 5DO2A 5GVQA 2BRKA 4CJUA 3BR8A 4P74A 2QV6A 1X4AA 3M1VA 4RL1A 1TUWA 4OL8A 1HNXF 3DOMB 2XMMA 1SL2A 4X66K 2KH9A 2CGJA 2G0JA 2D3UA 2UV8A 1YJTA 4CM2A 4XIUA 1U4BA 3MEGA 4C3KA 2AJ4A 3D0GE 4HR2A 2YKAA 2HFNA 2NZCA 1FJGJ 1P8ZA 3AVAA 3R27A 2DHSA 3G71N 3I5BA 3I9ZA 3RZAA 4OI6A 2V94A 2CQ3A 1JJ2M 2ZBIA 3LAMA 3SCXA 5IFMA 1UPPA 2W9CB 4CJFA 1DTTA 4V1Ak 1MWMA 3CMAN 3EVMA 1YZ6A 1VJQA 4CO5A 3ALYA 3TAQA 4DUZK 1YRTA 3CF5L 3S1TA 3W63A 4K4UA 1RI7A 1JNZB 4C8MA 5JVGL 5I42B 5ETQA 2XSJB 5SZTA 2VG6B 1RFQA 5DRKA 2ZQBA 2ZJPQ 3B6PA 3WXIA 1CQNA 3KDOA 1UMJA 4OZJA 1Q9XA 4LR8A 4CFBA 4NLWA 2IJFA 3T41A 3H4BA 3V6HA 1SC6A 3G6YA 4PRFA 4ZMMA 1WHXA 1BC6A 3VQ6A 1ZM3A 2Z0GA 4QS7A 2BUNA 5GAGU 1FRHA 1TTHB 2DEIA 3MMBB 5L1JA 4OI0A 1IKWB 2CQCA 3PDNA 4MKYA 3LO3A 4B3RF 2VQEK 5JICA 1CSJA 2PMHA 5H9EK 4GKKK 4KKOB 2H51B 4LRCA 3ZZYA 2LEPA 1RDRA 5FPNA 1JJHA 5KG3A 4HVZA 4CF8A 4JI7K 3S9HA 4BROA 3Q2TC 3QT5A 3SEOA 2UUBK 2ZM6F 1RU1A 2DH9A 1LEOA 1FTCA 3VQSA 3ZX3A 3TAMB 3QFHA 2ASYA 3PIOQ 4URQU 4DV2K 3B4DA 3VMFB 3GONA 2B4PA 4PXBA 1X31C 1PG5B 1OY8A 3TZXA 3AQOA 4OJHA 3QBXA 5F9NA 2J7KA 5FLXO 3OR1A 3KK3A 3GR1A 3DI6A 3Q8QB 1X4FA 3SSQA 2M8DB 3DDIA 2AEMA 1WNSA 3A8EA 4UTGA 5LMUJ 3QLHA 1W7AA 1W26A 2EEYA 1E4GT 3PSFA 2ZE2B 4X4PA 2LXUA 2V2QA 5KFMA 4GKJJ 1YHQN 3OTOF 1QQCA 3NF6A 4DL4A 4JI5K 3AV9A 3MCPA 2O8EA 3DLKA 1M1HA 3J7A1 3QRPA 4FYDA 1YLXA 4UZBA 1FNOA 3KK3B 3R1HA 3K9KA 5DM6L 5L39A 3EDQB 3Q23A 1SQFA 3CI5A 5EN1A 1K8KB 4JI2F 2C2NA 3BYPA 5ETVA 4IR9A 2ERRA 1NMDA 1REGX 2UVVA 4G1PA 1BD6A 2A41A 1D8YA 1WC6A 2X3GA 3VEXA 1AFJA 2LA6A 3G86A 4X4QA 1S49A 3J7YI 1LW2B 2BW7A 2CG8A 2UUAK 1HHSA 2F65A 1U26A 5M2UA 5E7OB 3NFAA 2MY7A 4IRKA 2JSXA 4NA1A 4DU1A 2PMWA 3MI7X 1JWWA 5KFIA 4DR5K 4YFUA 2DD8S 2XNQA 2V0NA 3WEEB 1UTAA 2ZH8A 3RBDA 4FZVA 3OYKA 1FRXA 2FVCA 1RT3A 3HBTA 4H0YB 1V3ZA 4F2SA 1VMBA 4LQ9A 4JP8A 4CJQA 3RR8A 1TU0B 2RQCA 3D28A 5HSPA 4MK8A 4Y34A 3GLJA 3I33A 3VGMA 4M5KA 2FLOA 2UZAA 3UWTA 7AT1B 5DM7Q 2QIFA 2ILZA 3CCRS 4OJ1A 4X4TA 4KY3A 3SZ2A 1VRUB 1RCXB 4HH1A 3E51A 6FD1A 1HPMA 4BY9C 4KRWA 2FZGB 2ZWPA 2WC9A 2ATCB 4W5NA 2R2TA 2NRRA 5KT2A 3SMSA 3KLEB 4DN9A 3O2IA 2CQIA 3K89A 4WXOA 2HHUA 2J0QD 4DR1F 3CCUN 2Q36A 3Q83A 4JD2A 3PW0A 3SQ0A 4RWXA 5JJBA 1WSVA 5B0AA 4J2AA 5KFUA 1CXUA 3MAAA 2H65B 1HYZA 4K41A 2W8LA 2ZJPL 2BJEA 2W9CA 4BRIA 2YX1A 2P2CB 2F9WA 2HOEA 4KYZA 4U67L 1LWXA 4C0OC 2H3EB 4LFAJ 4PZVA 3W1YC 4B9QA 1WDDA 2DY1A 2DHHA 3TWHA 4KAZA 2X1GA 4A4JA 2RKIB 1OVQA 3CCZA 1XC3A 1F3FA 2FJXA 3TJ9A 3IWXA 4MYUA 1XJWB 4O0NA 3VN5A 4JKGB 3SUNA 3ZC4A 1ILYA 3RRKA 3CQ8A 3VF4A 3D68A 2KFYA 3KG1A 1M1KT 1FNMA 3NH2A 4DF4A 2V2VA 4M45A 4XK8C 4A8QA 1QVGR 4CJLA 2V4QA 1WB9A 4DI6A 1W7WA 2CWKA 2ZVSA 5KG1A 1DLOB 2ASPA 4AE5A 4KC5A 1TUGB 2K7JA 1NDKA 1N52B 1KNZA 4ID8A 1ZBIA 3MFIA 3BGUA 4W92B 4W5RA 5GAHI 1AROP 2MLXA 4M5HA 3TA1A 4JB8B 3CM6A 4FVMA 2CVEA 2LMIA 4FKYA 1N48A 1NH8A 5LMNF 2CPXA 2FTRA 2NR0A 1V9OA 3P31A 2B0GA 2UU9J 1UEVA 1V3SA 1FWKA 4CBWA 2HS0A 2NXEA 2QYCA 4FF2A 5H9FK 3W61A 1VSLA 4Z2XA 2GNKA 3R2CJ 3THVA 2DITA 3MR7A 4WU3A 2OLWA 3GFHA 3E01B 5ETMA 4F4AA 3CJSA 4NB4A 4BG8A 2BM1A 1NEEA 3LPEA 1AXQA 1OPZA 1MWQA 5EOYA 2WHOA 2I38A 1YBUA 4EHUA 2F4VJ 1WSEA 3TAPA 3GQCA 3O4QA 4JKGA 1O1WA 3VF6A 2J6TA 3UKRA 2R7SA 2HSEB 2OPQA 4KH1B 1S12A 4ZHRB 3IXQA 1WN7A 2FLLA 2BRLA 2HHVA 3DLGB 1C0FA 2DO4A 2XY8A 4JKBA 4UOHA 2B7CB 3UD5A 2XO7A 2DKOB 5GAHP 3J7AP 5G0RA 4FYVB 3RRGA 1MN9A 5CABA 2AU0A 1Q95G 2KVIA 4R8UB 1B7YB 4X2BA 3B6OA 4HUGA 3D1QA 3AGRA 3QRRA 3D0IE 1UFLA 4FWOA 5HBMA 4LQ3A 3AH6A 4FF3A 1IN0A 2QK9A 1GAOA 2QXFA 5K8NA 1B3TA 3SQ4A 1K73O 1DZ5A 4DU8A 1WBBA 4ELUA 4KBOA 4I9QA 2DISA 4DX8H 3V4IA 4OHWA 1CULB 4LF9F 4B1YB 1N88A 4FWQA 2JWLA 3SDEB 2K3KA 3AA4A 4I2PB 2D7SA 3FJ2A 2C2KB 1GT8A 2J9CA 4F0HA 4OYIA 3HVTB 1YVNA 1JLBA 4FXWA 2VONA 2WSFC 4DR3J 2G8FA 5BRHA 4ILHA 1MMDA 4CHYA 3BUZB 4FP9A 1YBAA 2GAHC 2VYPA 2LVWA 3MOZA 1TL1B 3FBFA 3GIKA 1VQOS 1TAUA 1WSIA 4YOWA 4P71A 3OYNA 2JOQA 2GWJA 2XULA 4F67A 4MKVA 1C1BB 4FJMA 4KHMA 5E3QA 3F73A 2E2QA 3QEVA 3VR1A 2U2FA 3F41A 3CC7N 4OYPA 2G4BA 1ZBHA 4ES2A 3TAFA 2O5DA 1BY9A 4QR2A 4J9NA 1LWCB 2IDEA 8ATCB 4LSLB 4JS4A 1BI4B 3SCJE 1T9XA 2BVZA 3CCUS 1UVLA 3CD5A 3DGPA 2Y8WA 2E5GA 3CERA 1BGXT 1T9TA 3P5BP 2HZAA 2P5GA 3QIOA 5M2RA 1FJ7A 4CIOA 3ISZA 3QDKA 1AB8A 4CEEA 5ELZA 2C2OB 4O3SA 1LCUA 1U1RA 3OBWA 4C48A 1K8KA 1DHMA 2KKHA 4DN0A 3H40A 1J2VA 4UOFA 1NM1A 1ATNA 1WAFA 5D6GA 1KLMB 2G8VA 1Y7PA 2HNYB 5J2MA 3G4SN 3WXLA 2XHBA 1HKCA 2UU9K 3SJJA 3SI8A 4ZCIA 2O8CA 3IRXA 2W2MP 1AZSA 2DXEA 3H42A 1HBMB 2AD9A 1N36F 4K7QA 5HRPA 5GMKa 2Z1GA 4DQIA 1C1BA 2A6MA 4NA2A 4FM2A 2WTUA 3U9ZA 2DNMA 3TJAA 3C6HA 3U1NA 4YR3A 3WIUA 3RUBL 1TL1A 3CJKA 3V2UC 1P1TA 3QNNA 4QAGA 1FJCA 3EDRB 3RG6A 4FWNA 1LAVA 2P9CA 3MEEA 3J7Z5 1JNRB 3G96A 1HQEB 1GMUA 5LMNJ 4BVOA 4FVUA 4QOTA 3FC9A 4YY3F 4UT4A 3D6HB 4DTOA 4B1ZA 2H54B 3ZT0A 3NS5A 3NOGA 3I56S 5SWMA 3CIMA 4ZVTB 3KUEA 1IBKF 3WX8A 5KFPA 1BA1A 4L73A 5DG8A 1VQ5N 4IYQA 4BQZA 2XCPA 3DLLQ 3VQ5A 3ZZOA 1L3UA 2IAJA 3G6ES 4E3SA 1YJWN 1M90O 2HIYA 2JWNA 3MXJA 4BS2A 2RH3A 3HZEA 3CPWM 1E6YB 2UXCK 2XZDB 3PY8A 5T7LA 3TUJC 2RIJA 3GPAA 2OYQA 2XLKA 1SJQA 2ZWHA 4KO0B 2NZ4A 3TEHB 4JK9A 4AF1A 1UVIA 3W8PA 1U2CA 3J7ZT 4CTAB 4CJVA 2KG0A 1V4TA 4CK3A 3H2UB 4JKHA 4CO0A 2A42A 3NOCA 1DQ8A 3CJ8A 2DNOA 2P9IB 2ZITA 4UUXA 2FSJA 2JRSA 3PEJA 4FNHA 1KAZA 3AO3A 4DV6J 1Q7LB 5HVFA 1PAUB 2KZMA 2BW2A 3OFEA 2G2OA 2OPSA 2WW8A 4KHRA 3THWA 4URSA 3LDOA 3CDEA 3BZKA 2MXYA 4PKIA 3TVYA 3OYHA 1IBKK 4M3TA 3KHLA 4CJRA 2HNZA 5T14A 4NXNJ 1WBDA 3NMUA 3AXMA 2HHHJ 1RBLA 2E2PA 4HCCA 1JJ2R 2YKQA 4M3RA 4K4TA 1NGCA 3NLCA 3OVSA 1TKTA 4QZVB 5KAKA 3VQBA 1P90A 1Q53A 1ZZNA 1J27A 2EFGA 4E0DA 3T3FA 2P9LA 3JSMB 3AO1A 3M30B 3N4PA 1XNQJ 3R7BB 3M1FA 3M3ZA 1N33K 4MK9A 5I4MA 3NP5A 2HLUA 4DZ6A 1XTZA 3TR5A 3DRXA 2R7VA 5CCMA 4JRPA 4Y3CA 3MEKA 1SQKA 3LGNA 4IG3A 3QSYB 4C3MA 4WYBA 3IN5A 4RTFD 1MNEA 3QMQA 5KFYA 4P7VA 2H5JB 5LL6Z 4WWSA 3ZTOA 1RT1B 1Y64A 1S59A 1ZZFA 3S3MA 2HHHF 1HQUA 3W2VA 3JSRA 2GQ2A 3G6VA 3H25A 3KHHA 4HI1A 4A5AA 3BM7A 3KFWX 5M1QA 5E3AA 2F4FA 3T5JA 5BREA 1WC0A 3I82A 1ZOTA 3OUYB 4WXWA 4CK1A 2GHPA 3PUFA 4NMXA 3J7YU 4B3TJ 3QPIA 2F3JA 2HPUA 1IKYA 2D9OA 4M3UA 1S97A 2OI2A 1Q8KA 2QX0A 3PV8A 4IOCQ 1ESVA 4R5PB 1DKGD 3A12A 1N4LA 4PWUA 2AGOA 1DQAA 2OZMA 1RTJA 1O5JA 4NXMF 3RAXA 1FFGB 1FDAA 4B8AB 3O1WA 2HWHA 1ZPWX 2O01C 1VQNN 2OMOA 1OWXA 1KAYA 3LPUA 5JLHA 3CT9A 3CCVS 5FDLB 1M5HA 4JI1J 4E7JA 2X1AA 1RWOB 3VAFA 1X9SA 4YP3A 2DR8A 1TL7B 1G4CA 4A2BA 2HQCA 3H5XA 2PEHA 2AJ0A 4J9PA 1U6FA 2F8MA 4U7UK 3HKWA 1VBKA 3LDPA 1C0UA 4W90B 5LY3A 2RILA 4NXNF 3ZSQA 4DR4F 3FBCA 2PY5A 4FS1A 5B0DA 2BJ1A 2JVRA 1SZ2A 2DR5A 1VSEA 1VQ9S 2KT5A 2BKNA 3T69A 1NOYA 2R4FA 3J81j 3QNOA 3CPWR 3N4QA 4RUBA 5JVHL 4IKFA 3QEXA 4A8WA 4FJIA 2R2SA 5BN8A 2XCAA 5IZHA 1HNWF 3BO2A 2FVSA 1RT6B 2HVDA 1VRTA 1VQ6S 2PDAA 3AHPA 3GMGA 3BGRB 5LMUK 5AQHA 3TSQA 2G1HA 4IJNA 1ZAWA 4C4WA 3MM9A 4P75A 4AHSA 4WE1B 2G1DA 2O8DA 3AA3A 1FXXA 1RWUA 4F0MA 2CQ2A 2YNFB 3W2WB 3D7SB 7FDRA 4NCBA 4AL7A 1ZTTA 2AP6A 2E1MC 2DXFA 3L9ZA 1VOMA 3QZ8A 1FDBA 3ZEUA 4EHTA 1RT2A 4U7BA 1UFKA 2KG1A 3UR3C 4ZCMA 4PUOA 4Q8FA 3OA9A 1OJ4A 1L3SA 1LKZA 1S9EA 1N5SA 2FC8A 2ITMA 2MZJA 5H9EJ 1S72S 2MY8A 2V2ZA 3DI6B 1X60A 3ZXWA 2IFXA 4F4KA 4IQXA 1U09A 2LFVA 3CJ2A 2NS1B 3CD6N 3OS1A 4C0HA 1LWFB 2O8BA 4OHVA 3MPWA 3U3YA 5IWAK 1WG5A 3DWLA 3D1HA 2VFUA 3CDUA 4XAKA 5HMXA 1GLEG 4CM0A 3MM7A 4CIFA 2C42A 3QMLA 4FNIA 3Q8VA 2E1RA 5KFDA 4QW8A 2VOPA 3LTOA 3CB4A 4PQUB 4JI8F 4QS8A 2IYGA 2UU9F 3QGHA 3I55N 2BE2B 3DN9A 4DFJA 4PQUA 3VQTA 1CJVA 2Z2MA 2W4PA 1IWAA 5M2PA 2XHWA 2BGGA 4DFMA 1Y10A 3HKZD 5FRMA 4XEIA 4RW6B 3TUZC 5B09A 3VZIA 5AQTA 3GL1A 5AE1A 4Y2MA 1OQ6A 4MLHA 2KI2A 3WXMB 3W5XA 2ZM6K 2E5IA 3T5KA 2Q97A 4ZOSA 2Z1IA 1U7LA 3MPDA 4FYYB 3B6BA 2FF3B 4GY2B 4ID5B 3KD5E 4OKJA 1TYQA 3CC7S 4GO5X 3PM9A 2XY6A 4DV5F 2NRHA 4MDAA 4JV5K 3DHXA 2LEBA 5G4DA 3J81U 5F9LA 1TL3B 2P6SA 3MR2A 4NLPA 4JS5A 2IC3A 3I0RB 2Z8QA 4ISGA 4CK2A 3ILLA 3CCQN 3SQGA 2JEGA 1ACMB 1GLCG 3MHYA 2GHVC 3A5MC 3AVMA 2ZH7A 5A6WA 1VLYA 2O66A 2JC0A 2GMLA 1Y3JA 3CCJS 3Q24A 2V51B 4G1QB 1FVQA 3LP1A 4WFZA 1DT9A 2MQMA 3CC4N 4R0JA 1SB6A 3C7NA 4E89A 2IA6A 4OYMA 1FT8A 2CQ1A 4NYOA 1UW4A 2E66A 5KFQA 4DV2F 3R3TA 3JQJA 5B0CA 3OTBA 3VQ8A 5ETOA 3C19A 3BP8A 5AQFA 4FCYA 3M2UB 2DT9A 2LDYA 2KRBA 2D5RA 4ECTA 1I1GA 2AGPA 3G8SA 1UJ6A 4TY8B 2KU7A 1V3RA 1XMOK 1RAFB 4UF4A 4ATNA 5CHIA 3UE2A 2OP5A 2R42A 2NYIA 4ZP6A 1S6OA 2Q6CA 2FHJD 2MB0B 3WQPA 4W98A 4H4OA 2EK6A 2GC8A 4GVLA 3VQ4A 4G3IA 4CH7A 4CO1A 3UN3A 3P49B 3UCGA 1WTFA 2Q0RA 4Q2LA 2KN4A 4X66J 5KPRA 1RAHB 2MZTA 1RWVB 1H38A 4AHVA 4NI2B 3TVZA 4J37A 3BBCA 3RGIA 2Z57B 3CGIA 3MR6A 4DKWA 1RB0A 3VV2B 2GHWA 1UEKA 6AT1B 1RWWB 1LK5A 3PFOA 4R5PA 5C42A 3H2VE 1U02A 2CJYB 5D78A 3D6RA 3W65A 3IG1B 4OYBA 3I4HX 3SMZA 1GTHA 4GVMA 2VD3A 1NGAA 4OV6A 3R8EA 5CYMB 1ZPVA 2O4GA 5A0YA 2ALZA 3UNGC 4HDGA 2NCKL 5I9EB 1S1VA 1ICEB 3PHTA 3DRRB 3BDEA 3KLFA 4DMNA 1FW6A 4I6MA 4CO3A 1F6TA 3NL0A 3EICA 2Q1LA 3ENOA 3AFGA 5DDQC 2VA2A 1D0EA 3MECB 2CQPA 2QLBB 2XSFA 4DV7K 2XY5A 3GYGA 4M5DB 4L3KA 5AE2A 3QIPB 4CEZA 2KXFA 3MR5A 1R0AA 4LRDA 3HHDA 1EQMA 2I5JA 3SMPA 4B3RK 5FIIA 1FEHA 2P9LB 3VQ9A 4I1TA 2DTJA 1U2VB 4HTLA 4CW7B 1PKUA 4Z4CA 1VQ4N 2B9WA 2MZ1A 1VQSA 5D4NA 3RTVA 1X5PA 3PYFA 5JMVA 4NLBA 3BN7A 1U49A 4O5BA 1DURA 2HNZB 1TUYA 3X3UA 3JAMU 1WTBA 4WYLA 4PWWA 3JS9A 2UVWA 1BUPA 3MN6A 4BBYA 1PC5A 1H73A 4K4YA 3SPYA 4L74A 1YI2S 5HVGA 1SS6A 1Q81O 4TY8A 4K25A 4LF2A 1NJYA 3UKUB 1BQMA 5B08A 1QVFR 3JS6A 5K14A 3WNEA 4PXCA 1CS4A 1HWUA 2AQ4A 4LC9B 3DDNA 3G8TA 1FO1A 1NAQA 1NZAA 2I0XA 1T05B 2IRUA 3EPIA 1MW7A 2I2YA 4OGEA 4FWMA 3NGTA 4YOTA 1VC5A 3GR0A 4TYAA 2QWQA 2XC9A 4N8OA 3Q86A 2P9SB 1T05A 5GMEA 5GAEI 4XDCA 1MN7A 5U47A 4FLYA 2BOPA 3DXKB 2QE5A 4DL0C 4NXNK 3O9SA 3LW5C 1NB2A 4QPTA 3PKYA 1KQSR 2VUGA 4JI2K 3HSJA 1CQMA 1E6YA 2YQ1A 3FVYA 2WSEC 4RNOA 1OIAA 3O8MA 4B3SJ 3OLBA 5F8NA 4ICLB 4D3GA 2HFZA 3MCOA 1EWQA 3K5NA 4FN5A 3HVWA 1MMLA 3OL7A 1I51B 2XB2D 2YKNA 4C7QA 2YQ3A 2IDLA 2A0FB 1XI1A 3HZ6A 2WBNA 4O3OA 3TI0A 5JS2A 1KQGB 1BOTO 2ILYA 5K9FA 1K6YA 4DQ8A 1G99A 4F25A 1Y97A 2J7UA 3D2WA 1R59O 2Z30B 3GV5B 1HPZA 4WCEQ 4C97A 2DFHA 3S3NA 5AJ3K 2MZRA 4DLGA 1WOOA 1N5VA 1U0HA 2RDIA 3QIDA 4CGDA 2VFTA 1T9UA 2VL1A 2X7IA 1D9AA 1HD0A 3NHGA 1SIZA 3AQPA 2CJ9A 5H1SV 1RUSA 3DM2B 1ROFA 3UDLA 2QLJB 4UZCA 4C2MA 1J54A 3KKRA 4GKKF 3EY1A 1CBKA 1UZDA 2ZNZA 1RBTA 3SCIE 4LSNA 1NGEA 2HNDB 1GMWA 2R2RA 2G13A 2QL5B 1AZSB 5KFOA 5AR0A 2BE2A 4V19X 4A8SA 4KH6A 1NDLA 2E7WA 5CYQB 4ID1A 2M5YA 1S79A 2ZVIA 3QJLA 4I6MB 1UJ5A 4UY8O 3R2DJ 2B4VA 3ETMA 4FWKA 3DRRA 1EX4A 3CDAA 4DG1B 3THPA 4M5MA 2IM1A 2VG7A 1R89A 3M2VA 4ZVQB 3W9JA 2UVUA 4ZTJA 2EC2A 3P4UB 4B9UA 4C11B 3IR7B 1CJUB 2JLGA 4O4GB 2KO1A 5T7BA 3QQCD 3MWPA 4RU2A 2XMVA 4U9RA 1GLDG 1FRJA 2VWJA 3UDVA 4KR0B 4QYRA 1JLCB 5BPLA 2CUYA 3ZSVA 1N34J 3QT8A 4CJ3A 4O44A 3DMJA 4DV3J 4O8UA 2D1CA 4LSLA 2GS8A 4KIAA 4FL9A 4FVCA 4V19S 4YB5A 2FIUA 5DETA 4CI6A 2GQQA 1HBNB 3LP0B 4CZGA 4DFPA 1CXQA 3CNQP 2O67A 3I8DA 2HQFA 1BDGA 5EGYA 4B9TA 2QRRA 5DLFA 3G9CA 1R0CB 3FCWA 3KLGB 3PR4A 4BRKA 2AT1B 1X5SA 5C10A 2MKJA 3NNCA 5A2QY 2MYFA 2B56A 5CD4A 4CI0B 2PFFB 3Q22A 1NGFA 1UVKA 3A8YA 2NPIA 2QTDA 3HT0A 4NZ0A 1JIHA 4LBIA 3UN2A 1HKGA 3VA3A 1T0TV 1BLUA 1RAGB 1N5QA 4U8YA 1U1QA 2NRTA 1W2IA 2D0OA 4WFBL 1FRIA 2A6AA 1H0HB 5BRDA 4X66F 3SBMA 5KT4A 1TUVA 5J2QB 1IXKA 4DPXA 4ERDA 4YS2A 2NUBA 1K1SA 3GIJA 3WXJA 1LFWA 3KYLA 2HVHA 4KTZA 3LH2S 5A6PA 3BO4A 1P1LA 3ENQA 2VGMA 2HS4A 3ZLJA 1QVFM 2R7RA 4CH0S 5ETKA 1FERA 3RR7A 3AVIA 3H08A 5AQSA 4BE1A 4ETZA 4ELTA 2M2BA 2ZJQQ 2BJ7A 3W66A 3VQ7A 3GYXB 3AOCA 2BANB 5FD1A 3EZWA 4NLSA 4WFAQ 2FZCB 2Y3YA 3FGUA 4RG8A 1J6ZA 4I6YA 1ASVA 1E6VB 3Q8UA 3AJDA 5EX0A 5AQVA 4CZLA 2QI2A 3KLGA 2FSKA 4K5RA 2MSSA 1EJ7L 1DGKN 2XYPB 1JX4A 2CJAA 4PG7A 1WOQA 4Z7CA 3BBFA 1HNXK 5GADI 2DVIA 3CFRA 8AT1B 3CF5Q 3M6UA 1OPIA 2GELA 3PHEA 4X64J 4K50A 4RW4A 3CG7A 3MX2A 4O4GA 1IKYB 1CJUA 4MTPA 4B9MA 2P1JA 3PW7A 2R8JA 3QB0A 2I9SA 3M2VB 4ENOA 2RF2B 4HCBA 3A2FA 3RB3A 4YY3J 3N0VA 4B08A 1GFWB 2VQEF 1WSGA 2BEFA 4R0EA 4RBUA 1AYEA 1PIEA 2MPUA 2W9BA 1H2VZ 5D15A 4KH0B 3BF3A 5IXUA 2D3O1 2J6SA 1NB7A 1GEHA 1VAZA 4GNIA 2DCLA 4QWEA 2UUBF 1HWIA 3AY9A 3R6GB 2J5AA 3V9ZA 4OV1A 4LF9K 2H1YA 2WW4A 4PL8A 3GSDA 3R5DA 5AQIA 1PSDA 4KPYA 2CNKB 4Q7AA 2C2DA 1IV0A 3CO9A 2GVZB 2CJQA 3FKBA 3VGUA 2YNIB 4K4WA 1UL3A 4Y0WA 2F8SA 2J9DA 3W3DA 1YGYA 4DUYJ 1E3MA 2ZD1A 4BC3A 3K8WA 4B3MJ 3QJJA 3VGSA 3PIOL 3OL6A 3TOQA 3MWTA 1SJFA 2UXCF 5KT6A 3M8YA 3US5A 3VGVA 4QIGA 4DHYA 4KV8B 3ET6B 3OTDA 5HQ8A 3H46O 3UFCX 3M6XA 5HP1B 1BCOA 2AKWB 1YQHA 1VSFA 3NMAA 1ZA1B 1OH7A 4ICLA 1CEZA 3M8SA 4B3SF 1MMNA 4OI2A 4H0PA 5ITHA 3KHGA 4G9ZA 2DNHA 2YNHA 3PIPQ 3G4SS 4TSXA 2J9EA 1RZMA 3HJVA 4JV5J 3CJCA 3P3DA 3OYLA 1Z26A 3OYAA 3A8JA 3B8AX 2CPIA 3NG8A 1RDBA 5EUHA 2P9SA 4LIRA 1IR1A 2DNLA 4Q45A 2AHOB 3VAMA 4HLBA 2AJQA 4BGAA 2ZFHA 4RX6A 1VRTB 5KRSA 1NKCA 2F7VA 1HHQA 3A3PB 1CS4B 2ZHBA 2GUPA 1IBKJ 4BRMA 1NCLA 4DR5F 2ZHAA 1B92A 2B4OA 3DLJA 3CYMA 4OLOA 4A47A 1GOBA 4ANDA 2Q3PA 2QYGA 2FVQA 4CJEA 4FJKA 2HAIA 3POTB 2E8AA 2RS2A 2IAJB 3HK2A 5A8WB 4KBIA 2LQBA 4CEFA 3UNYA 1T9WA 4DDFA 1HJOA 1RAAB 4W5QA 1SCJB 2ZGZA 3M9NB 4DS4A 3RW7A 2ASOA 4LF7J 4ILMA 1WC4A 4YR0A 3W62A 3H90A 1U2RA 3VAKA 4TLRA 3C95A 4ZVPB 2BJ8A 2FGCA 1JB0C 1NJXA 1N6QA 4IDKA 5AQXA 3PKMA 2LQ5A 2Q43A 3VEOA 1K44A 2P9UB 4XH5A 3UI3A 2HHSA 4X4RA 4YQWA 4JLHA 1NHUA 1CC8A 3U02A 2P9KA 5JS1A 2YHXA 4KH5A 1SBRA 2DRAA 3QRQA 5CZ2A 5AFUH 4UY8T 5DGAA 5GAEP 1Y11A 4EFAC 4A8FA 2PI4A 4OHYA 1X8DA 5GMDA 4CGJA 4Q0BB 4KGKA 1YJUA 4QPXA 3L2WA 1RKIA 4FZXC 4CH1A 3BO3A 1Q5VA 3QAUA 4M5DA 3Q0AA 2R7XA 3D66A 3ZZRA 4F9OA 2P5OA 5D0RA 3KZBA 2AP1A 1HBMA 2F4VF 4K8XA 3NF7A 3MEDA 1NPKA 3MD3A 4IG0B 3C66A 1R31A 1S57A 4CJWA 2QSFA 3IRWP 3KLIA 3ZTPA 2L3MA 5IS2A 3RAMA 5AJ3J 2QA1A 1F3VA 2W2NP 1L5UA 4PKDB 4GC6A 2HQ3A 2H5IB 1IQZA 2WK4A 4LF4K 1HUXA 1KKHA 3LA0A 3DOKA 4OYAA 1WOSA 5HROB 4J9KA 3TAMA 3JTOA 1Z4UA 2B5JB 2KJWA 2VWKA 3MM6B 3PJXA 3I8BA 4L76A 1ITGA 1RWMB 1WG4A 2MJNA 2UYTA 4DV0F 4EYIB 1FFSB 1VK0A 1AT1B 3BDPA 3PACA 4X64F 2XI3A 2EBEA 4ES1A 2P9GA 1J5EF 2V8VA 4IG3B 1ZTWA 2D3ZA 2OH2A 1VRQC 4DTNA 4C1NI 1WEYA 1F5CA 1QVGM 4YHHF 2DTUA 5IWAF 2QO3A 4OI1A 1LV5A 2QA2A 1TK5A 3TTDA 4O8KA 4M3YA 5KFRA 1VSJA 1AUDA 2LQ9A 4M7YA 3QJPA 2MQNA 5H1SQ 2YH1A 1P9YA 1XNRK 1TKTB 4J9RA 3MMBA 1XUPO 3TQ1A 1VR6A 2IJRA 4M5IA 3DFEA 2XY7A 4J91A 1H1VA 5C25A 3HSGA 2H4WB 1QAJA 4KGMA 3B82A 5HL7L 3ILIA 3IC1A 2PN6A 1NJIO 2CPFA 3O3GA 2ATLA 2FBXA 4EEYA 2IVMA 2I7NA 4JAXA 1S1TA 2AV5A 2UXBK 5KFFA 3PJ9A 5HVHA 2N3OA 4B9LA 1FRMA 5AQMA 4X62J 4DV4F 3O3HA 1FHTA 5EVZA 5FROA 4YOEA 1ZAVA 1UVJA 4I2PA 3ZZUA 1QUVA 3QO9B 3SUOA 5F41A 3ZSRA 2HF4A 5I42A 4B8CA 2GO9A 4R79A 1TKZB 2PT0A 1S4EA 3QNWB 5KG4A 4DSJA 2CJKA 2MGZB 3TAEA 4FJ8A 1MDUB 4RW7B 4FZYA 5IOLA 3D6FB 5AFUA 1OYDA 4M94A 3ZSWA 3HSTB 1GTEA 2AEFA 4DR7J 4G65A 1CZ9A 3R1LA 3WDOA 1WF0A 4USKA 1EXQA 5KG2A 2HZCA 4NXMK 1T44A 1YRXA 4L6V3 1W25A 4CERA 1APSA 2IA0A 3AA5X 4OPAA 3CJTA 1OMSA 4Z4EA 1B0TA 1FKPA 3MM8B 4DU4A 3PYGA 1FXDA 4E2FB 1N32F 3BEXA 1QE1B 4DPOA 4PG5A 1CZAN 2RU3A 4DTXA 3P5TL 3D6TB 3HHLC 4AUKA 5D4OA 1IKXA 4KFBA 3TTCA 2HURA 3QAEA 4JKEA 2VPWB 2PA8D 4M95A 1BMQB 4J9VA 3HM9A 1F2GA 3K57A 3IGNA 4O3NA 1HJRA 3VTHA 3QBWA 4ILLA 2EI5A 4JEPA 3ZNJ1 2M52A 1UWBA 5KG0A 4B3OA 3PX4A 2P9PB 4HHTA 3L7UA 1CLQA 5IWAJ 2HVZA 4LF6F 1HFEL 1RTIB 2VBWA 1C0TB 1QAXA 1WNEA 3TX8A 2FLPA 3L4QA 1UW9A 3QZ7A 4JI6F 4C8LA 3NDKA 2PSZA 4LF4J 3GIIA 4FWSA 3D67A 2HFOA 1V4SA 3KJVA 3F0NA 1YJ7A 3NBPB 1KSPA 3H20A 2D69A 2KKZA 3PRDA 1RT5B 4Y6IA 1EZZB 4ZCKA 4B1XB 4DCJB 4QOZB 2WSCC 3U9DA 1SH2A 3KMQA 1U24A 2BOAA 3PRBA 1WHYA 3ZTQA 4EBCA 2CH6A 4ZPAA 4XPEA 4I7FA 2YWHA 4JI7F 3TSPA 4USIA 4P6QA 2MQQA 2AW0A 4Z4HA 3G25A 2ZHOA 1C4CA 3D45A 4ED8A 4O0IA 2R2UA 4YDXA 4MFBA 1ZAXA 8RUCA 1QS4A 2KYXA 4B9NA 4GVBB 3F5TA 2XRIA 3ENWA 4JN4A 1J53A 1NSAA 1GLLO 2FJEB 4DV6F 4PUOB 1KDNA 2DYAA 4LF5K 5KRTA 4L8RB 5KFLA 3HTVA 2E7VA 4RCHA 1F1BB 5IQ6A 1G6BA 1M90T 3Q8RB 2AGQA 3AY0A 4QWBA 4P72A 4EGLA 4IO9L 4L3QA 4PCQA 4DOZA 2F9DA 4CWBA 4WU2A 1WSJA 1H72C 3HMJG 3MUVP 2FHJA 3HSZA 3WC0A 2P9KB 2HBRB 3LGHA 4FWRA 1HIYA 4OKEA 4EP5A 3CJ5A 3C65A 4LFBF 1XMOF 3B78A 3ZETB 2H48B 3ZTRA 4CLWA 5C7PA 4AH9A 3ENHA 4YDDB 2QWRA 3CJQA 4RBVA 1A9NB 4LMZA 5AQYA 3FBBA 2W4CA 5FPDA 3DLRA 4IH5A 1XMBA 3VAHA 5HAOA 4DTSA 4Y1CA 1RSCA 3HHNB 1W97L 1W9HA 5F8MA 2JDJA 2XYGB 4PPZA 4WKRA 2KZZA 1IBMJ 1HWJA 2C2MB 2NRVA 4ISFA 3OBIA 3UVJA 1C0UB 2W42A 2OEJA 1RAJA 2MSTA 4R8UA 3ZO7A 2RU9A 4BLGA 1YUWA 3NCIA 4LVNP 3AVCA 2YKOA 4MIBA 1HNVB 4PABA 2W2PP 2VHGA 5DDRC 4ZVUB 1VQLS 2PZSA 1SI9A 1LW2A 4DX7A 1Q18A 1JXEA 3G71S 1LXNA 2WCXA 1HD1A 3G82B 3AOBA 1O51A 2ZNYA 3FUYA 3MPVA 1Q81T 3GE1A 1WOPA 4OX9F 2WVCA 3HJFA 4BRHA 3CJAA 4CP5A 2HZVA 5DMRA 1B4SA 3PZPA 3M4XA 3CCWA 2OCEA 3ZZPA 2P9EA 3F56A 1K1QA 4M5LA 2OTJN 4C1NK 1RT5A 2O8EB 3GV7B 4CIEA 1VJWA 1VHXA 1HL6A 4WZQA 5KFWA 4OQJA 4LJMA 4OX9K 2MMYA 1S6PB 3MUTP 3NGYA 1RWXB 2PYJA 3IP0A 3W5YA 1WEXA 5A8RA 4FWPA 3C0BA 2AIRB 1QLNA 2FVPA 2BTFA 1RTIA 2Z4PA 2WRMA 3NAIA 1F9EB 4Y00A 3MPYA 1WF1A 5AQPA 4B3OB 3BSNA 4OMFG 3A5LC 3PX6A 3GDQA 4JI0F 2QMUB 4QW9A 3HXMA 5CD4H 7FD1A 4AFFA 4M3XA 1X0FA 2R7OA 2V2KA 1U1NA 3N4WA 3FQKA 3GFZA 1WHVA 3D3BJ 3ZSOA 2V52B 1BCMA 1K8AT 2YWEA 3C6TB 5DJBA 4MO4A 5HRNA 1MU2A 3BKFA 3R6MA 5BXIA 2E88A 4C23A 2GIFA 3EJMA 1PILA 2UUWA 3GJSB 1M1GA 4ED7A 1S99A 3OTOJ 1NM2A 4CJ7A 1X5TA 3VCDA 1NJIT 4NLCA 4RW8A 2AYMA 2VA3A 2IS3A 3AAWB 5F3ZA 1FKPB 2YTCA 4RNHA 4DSEA 3FEXB 1BHNA 3O1LA 4TLQA 4CF1A 4TU7A 4OLPA 5KI6A 2LU2A 4FK2A 1WF2A 3M05A 3I31A 3O5TB 1JLFB 4K5SA 1TFWA 2ASJA 1NDCA 3NS7B 4YUDA 3IS9A 4KH4A 3NGRA 2OJ3A 2DRDA 2AYEA 2VG5B 4LSZB 1X4HA 4F36A 4NPOA 3CCEN 4OJGA 1GOAA 2RUGA 5HJYA 1QSYA 2M3DA 5KFHA 3ZSXA 5IT9U 3O6WA 2DNRA 3FRYA 5J2PB 2DPNA 1QY7A 2QKKA 3ZT1A 5LJVA 2Q79A