3TAOA

Structure of mycobacterium tuberculosis triosephosphate isomerase bound to phosphoglycolohydroxamate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
256
structure length
256
Chain Sequence
SRKPLIAGNWKMNLNHYEAIALVQKIAFSLPDKYYDRVDVAVIPPFTDLRSVQTLVDGDKLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAATALKHGLTPIVCIGEHLDVREAGNHVAHNIEQLRGSLAGLLAEQIGSVVIAYEPVWAIGTGRVASAADAQEVCAAIRKELASLASPRIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGGASLDGEHFATLAAIAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of Mycobacterium tuberculosis triosephosphate isomerase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 99
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3taoA00
4MVAA 2X2GA 1RQBA 1OX5A 1QFEA 2WNZA 3DI0A 3L65A 2UV8G 3V1PA 3S8HA 5F4XA 4N4PA 3IVTA 1SSGA 3P80A 4R33A 1F7BA 3LTSA 1FWRA 2J24A 5HJLA 4LRSA 2NX1A 4ADSA 3VNDA 5D32A 1TRIA 4M6PA 1ZJIA 1SR9A 4EIVA 1HG3A 4IJBA 1Z42A 4FNPA 1WX0A 2TSYA 4GWEA 4RKAA 4MZ8A 3LCXA 3O1NA 4BFAA 1FDZA 1OFBA 3CIWA 3B06A 1TSIA 1FWWA 2YFNA 3NOEA 4AVFA 3PSWA 1R2RA 2B7QA 3HOJA 1DKWA 5FEZA 2ZZ4A 4YCPA 3EXTA 1XCFA 2ISWA 2GUUA 3EX3A 3W73A 3AJXA 1LOLA 3IRDA 5FEPA 4MUZA 2Y7DA 1G7VA 3MP3A 5D38A 4CNOA 2GQAA 4I9AA 3DENA 4JTJA 3GDMA 3LLFA 4NJHA 2VFFA 3S1XA 3NNTA 4K8HA 1RVGA 1HL2A 5E0KA 2QUTA 4O1DA 3M5XA 4L4LA 2QJGA 1F74A 3PWAA 1MEHA 2FJKA 4O57A 3SI9A 5G4EA 5T26A 1AG1O 1G4SA 3L68A 5L9FA 3MBFA 1PV8A 1M6JA 3ZWTA 4HSOA 1MEIA 5G2HA 3HJZA 1WXJA 5KZEA 1KA9F 1R47A 2NX9A 1B3OA 3DHFA 1QPRA 4QNWA 3WJYA 2YDAA 1YDVA 3W7LA 1S5TA 5AHFA 1JR1A 3OA3A 2PC4A 4O1AA 1R46A 1OJXA 3BW3A 3EWUA 3NQVA 3OG3A 4X3ZA 4ZZ9A 5F4WA 2J27A 2NV2A 2QCFA 5CGQA 1QCWA 3DFNA 3C2VA 1SFLA 2QF7A 3HF3A 4H6KA 1GG0A 1SZEA 3MI6A 4FX7A 3TU9A 3B04A 4MZ1A 4LT9A 3C61A 3N9SA 4N9CA 3NQDA 5DBTA 4UTTC 1OVDA 3PUDA 2FTPA 5BNKA 1K7XA 1CW2A 3O06A 3DBPA 3EX4A 4OBTA 1LCOA 2NZLA 2WQPA 1H7PA 4UXDA 4AEOA 4ZQOA 2BX7A 3DKLA 3HGSA 4O16A 5G1TA 2QDGA 2Z6JA 5K7JA 2LLEA 5IBXC 3CEPA 3TJXA 1TO3A 4YCOA 4ZQNA 2WSQA 3RF9A 1TPUA 3W1AA 4UFJA 4NJIA 5F2MA 1RQHA 5DCEA 4FIQA 4Z1CA 1B4KA 1H50A 4LTSA 1H7RA 1VH7A 2WOQA 3QJAA 5CZSA 5AFDA 4TIMA 3IIZA 3W7CA 3S1WA 3KOFA 1K8XA 1VRDA 3GR7A 1LDCA 2R94A 3C0JA 3BW4A 3P81A 4OGZA 1SW0A 3ABRA 3FEMA 2ABBA 3Q37A 2RHGA 3W7IA 4NNBA 4TR9A 1YDOA 1N8FA 3C56A 4PODA 3NVTA 1Q6LA 1TPDA 3W2KA 2CZFA 3NL6A 4UR8A 2ZYFA 4AMAA 1LOQA 2VEIA 5DXXA 1VYSX 3BK0A 1DHPA 2WSRA 1O5KA 1X1OA 3CTLA 2QCGA 1JUKA 2RDTA 1JRCA 1RZMA 2TPSA 5AHLA 2ISSA 2ZRZA 3G0XA 3MP4A 2J9YA 3T55A 1ME7A 3WJXA 4R7JA 3UPBA 4Q4KA 5BOOA 4QJ1A 3KRSA 2C16A 4Y6GA 5E93A 3GK0A 4M6VA 4ADTA 2WPBA 3UWZA 3AO0A 5DY3A 5AYYA 1HO1A 2CU0A 3M7WA 4OV4A 1QMLA 1F76A 1EUNA 3O16A 5G2IA 1AMKA 4K38A 1TPH1 3SSJA 5TBOA 4EWND 3PBUA 3W7QA 3MMTA 2ZBTA 4O13A 4YL2A 4Z1BA 5HUOA 3F4NA 3S1VA 1SZGA 2EKCA 1FX6A 1O94A 5LHEA 1XC4A 1KM3A 4FHAA 1NEYA 2B7NA 4N4QA 4XKYB 4GUFA 5K9CA 1MSSA 3NO5A 4WOZA 4MY8A 1PL9A 3G3MA 3HIJA 3QSTA 4WUIA 3W1XA 1LROA 4M6QA 2QCCA 3U8GA 1DJNA 3TNOA 3W84A 3CLMA 4LS0A 1TCDA 3DFQA 2EF9A 1MXSA 1O4UA 2C1HA 4K37A 5C2XA 4PFMA 4LVDA 4AWSA 3MI2A 1KLYA 3G1HA 4GJ1A 1YDNA 3G24A 3KVLA 1TPWA 1VLIA 4JXCA 3ZWSA 4N02A 3W2JA 2PURA 2PRHA 3QF0A 4UTMA 1ZNNA 4BI6A 5F1VA 3BG3A 5HQEA 4CQAA 3GNDA 5AC6A 4LS1A 3FKRA 3QMTA 1X8FA 1UUMA 1EB3A 5FEXA 3TR2A 3N2XA 4O19A 4MLJA 3HG2A 1G4EA 5CPNA 3HPZA 2ZTJA 1D3GA 4EF9A 4O12A 3W1NA 2EPHA 3MUXA 3LRLA 2BSLA 1HFBA 1RPXA 3OVRA 3FS2A 3O6DA 1F2JA 5AC8A 5F2LA 4WY0F 2I14A 1MEWA 4UMCA 5AHNA 3M47A 4NZJA 3LGEA 3NL5A 3KHJA 1W31A 4FXSA 4TMCA 4JYEA 5HULA 3A23A 2J9ZA 2QEZA 3MJYA 5C5YA 2ZFAA 2GQ8A 5IM51 4RX0A 3RLVA 3H55A 2DZWA 4IMEA 4OHQA 4HT3A 1A5AA 3IV3A 2NWRA 2QAPA 5EY5A 1LM1A 4PTNA 2VOMA 2YSWA 4M5PA 4X22A 3GXTA 2JGQA 3L21A 2TMDA 2OZ0A 3LV6A 1O95A 4XZ9A 4K39A 3W88A 3RU6A 4A21A 1SFJA 1GYNA 2VFDA 1JCMP 3IIOA 5AYXA 3QM3A 3E0IA 5GVJA 3BGJA 2NXIA 2DORA 2XN0A 4JS3A 1Y0EA 5KMYA 4MYAA 4K6AA 3T7VA 3LXBA 4IMGA 1VLWA 3TC7A 3INPA 4J9JA 3GKAA 2KZHA 3M5VA 2YZRA 2A1YA 2H3BA 2NUYA 4GUGA 5CZ0A 3C8FA 3TC6A 1TV8A 1H1ZA 1FCBA 5I3KA 3QC3A 4RZ4A 2ZRUA 3S5NA 4KKXA 3SZ8A 5D2VA 2V9DA 3W7RA 5C6MA 1JQVA 3UWVA 1D9EA 4NJKA 3BO9A 5G2WA 3KAOA 2GQ9A 3ABSA 1W56A 3TXVA 1KV5A 1WYIA 4JN6A 4BI7A 2C3ZA 2ZQ0A 4JDBA 1QOQA 3I65A 1SZNA 4EOUA 4RZ6A 3LTPA 4PA8A 1TPEA 4TO8A 2YW3A 1WOAA 1QDSA 4I7UA 2NUWA 1DOSA 1BKSA 4LVBA 4WJEA 2GJNA 4PEKA 2Y70A 5SWUA 4RXFA 4D2JA 4IMCA 3NQ8A 3BW2A 2C6QA 5G5IA 3W1PA 4LC6A 3A22A 3MO7A 4JTEA 5DY2A 5HWNA 1JCLA 5AYZA 4IXXA 1HTIA 4K7YA 2ZRVA 3VFLA 1E51A 4AF0B 1KM2A 3ZS4A 2CLKA 3UZ5A 3P61A 5KINA 3BLFA 3OIXA 4NJGA 4MIMA 1GJPA 4OU1A 3UWWA 2G97A 2F84A 5FF0A 2YGYA 3O05A 4WY0B 3E12A 1H7XA 1P4CA 3OVQA 1M7OA 4UTHA 4LY8A 3W6YA 1FWNA 4FNQA 5KZDA 1L2UA 3MW7A 4Z08A 5EA9A 1K3UA 4CQ9A 1I2NA 4CLMA 1X6UA 3I7QA 3TH6A 4WOQA 3NPUA 1ICPA 3NQMA 5HINA 2FB2A 3GLCA 1HUVA 2DZSA 3G18A 4MZYA 5KZMA 3TSBA 4FNTA 1OX4B 4Q33A 1LRQA 1G6CA 2H8ZA 4E2DA 4RLIA 2DZVA 3EX2A 3GDLA 4QM1A 4N6EA 3IGUA 3LHWA 4NX0A 1OFOA 1F6KA 4MY9A 1UCWA 3LI0A 3LOTA 3TCEA 1KLZA 3TX9A 4O8RA 1TREA 3RFAA 4LVAA 5AHEA 3W1LA 3W1QA 3KFTA 3NQ7A 4MJZA 4E38A 1QAPA 1T0OA 1FBAA 2HS6A 3VKJA 4LUIA 4DXVA 2A6NA 3LHVA 3FA5A 3G1VA 3RLUA 5CSSA 5DCDA 1A5BA 2CLFA 1IXNA 1DV7A 3NQCA 4QITA 4BR1A 2X1RA 2DZTA 3OHIA 3TQ0A 1FWSA 4UTTA 3GIYA 1OFQA 1H51A 3UXAA 1NSJA 3UNDA 3HO8A 3S5ZA 3R89A 3TW6A 3G0UA 3L5AA 2VEMA 2Y62A 4C1KA 3FIGA 2ALDA 4XTIA 1YPIA 1VS1A 3HQ1A 2A7RA 3P5ZA 5EBUA 1K8ZA 3FJ6A 2HMCA 1W1ZA 4U4MA 3NAVA 3PY2A 5K9DA 4RZ5A 4Z0JA 3I68A 1OFPA 1TRDA 3TMLA 1YXDA 4QIUA 3LLDA 3NQAA 3STEA 2ZZ6A 1VGAA 3IIPA 1N7KA 4UTLA 3CWNA 1I2RA 2NUXA 3RK8A 3A5FA 3TKFA 4JNMA 3IGXA 3P62A 2R91A 1TQXA 2CLHA 1FXPA 1LP6A 2ZZ5A 3HPSA 1NAL1 2IQTA 1LRTA 3SJ3A 3EEGA 4LWWA 4GFSA 5CPMA 1C8VA 3QPYA 4CNPA 4ZMGA 2NXGA 1AW2A 2QCEA 3GXPA 1FQ0A 4ICNA 1ADOA 5LHFA 1KM1A 1LORA 3S6DA 3TW7A 2V5LA 4JX6A 1WV2A 5CG7A 5CSRA 3UY7A 3DH7A 2GOUA 4UTKA 3N2MA 3L0NA 3PS7A 1V5XA 4AWTA 1LYXA 3B0VC 1XXXA 5HWMA 3DFPA 4NX5A 1KBJA 4LU0A 2OT0A 3GR8A 3CT7A 3W76A 4JY9A 3NXFA 5KSWA 4JYFA 5D09A 2ZA3A 5U7SA 2H6RA 3HGRA 1Q3NA 2GVJA 3TA6A 2P0OA 1TTJA 1EA0A 3WJWA 3VI2A 1T8XA 4O1BA 4XTDA 5AHIA 1LBLA 1YXYA 1NF0A 2A6LA 1OF8A 4UIOA 1XBZA 3KVKA 1GEQA 1KBIA 4DQWA 1TIMA 2VFHA 1H7NA 4BF9A 1DJQA 2ZRYA 4DEFA 3PVFA 1LLZA 1KFJA 2OX1A 1KM4A 4M19A 2GJLA 4ZL1A 5LZLA 3U2OA 2OJPA 3L67A 1ME9A 1O5XA 1SU5A 3JR2A 4ZQRA 3P8IA 1I45A 2RDUA 1G67A 3FJLA 2G96A 4JDYA 3LBCA 1KTCA 3W2MA 3B05A 1LTDA 3O6YX 1EP2A 3BLEA 1WA3A 2ZZ7A 2H3DA 3TXZA 4QAIA 1A5SA 3DZ1A 4GBUA 2ZRWA 4HNVA 2Y7EA 3FKKA 3W7DA 1SO4A 3N19B 3FOKA 2WNNA 1SSDA 2DJLA 5H2ZA 2FQIA 3DU0A 3QQ1A 3H54A 3T78A 3UZJA 3LI1A 4HKPA 4RJEA 1IXQA 2HS8A 3MWAA 1IF2A 3BVJA 3OVPA 5LGZA 4UR7A 2X16A 2R14A 3MYPA 3PUEA 3NZ1A 4HHPA 2CLIA 2J6XA 2C14A 2FLIA 3N14A 1XBVA 2QJIA 3SR7A 4FO4A 2EHHA 1JCJA 2Y7FA 3BV4A 4I7WA 2EAWA 1BWLA 5K4XA 2CLLA 2QCLA 4FX8A 1KFEA 1OHLA 1TPC1 5F4SA 4QQ3A 5A5WA 3W87A 4Y8FA 2A4AA 1XBYA 5AN7A 1Q6RA 5BW6A 4JD4A 3LERA 1CI1A 3SY5A 3NM3A 1W3IA 2WV8A 1D3HA 3W83A 4CNNA 5DXYA 3M0ZA 1WQ5A 5D05A 3W70A 3TUUA 3EWXA 5KITA 1TB3A 4JTLA 3QMRA 5D03A 5G1YA 3OBKA 3N73A 3S42A 1ZAHA 1XL9A 4FNSA 1ZAJA 2FPTA 1XI3A 5MHBA 3SW6A 4CCCA 5LKYA 1B57A 1S5VA 1DVJA 2W6RA 3UD6A 3NDOA 1PIIA 2Q8LA 1W5NA 4BI5A 4LRTA 8TIMA 1VR6A 1PS9A 4ONVA 4WQ6A 2VXNA 2ATMA 2CWNA 2I1OA 3W7KA 2P1FA 4DO6A 1EIXA 1SZFA 2E5CA 1KTNA 3LCWA 5TQLA 4N2YA 5I3FA 4AXKA 3G1SA 5DELA 3KXQA 5ABTA 4A3UA 1O60A 4KFPA 4RCXA 2YXGA 3G1DA 1F6PA 5F2IA 4ORIA 3P60A 4JGDA 4CCDA 4I7VA 3L9CA 4N9BA 2QUUA 4TMBA 3G3DA 3E96A 1PCKA 3G8EA 7TIMA 4LS2A 5J5RA 1U5JA 3W3OA 3O6CA 5D33A 4EVZA 2ABAA 4X2RA 4JTUA 5TIMA 1Q6QA 1P0KA 4FXRA 1VZWA 5K9XA 1OABA 3S9YA 4CQ8A 1KFBA 3LCHA 4GC4A 5AHMA 1SPQA 1J4EA 1JUEA 4JICA 1SUXA 4HSNA 1VHNA 1THFD 1VPXA 3G8RA 4BWLA 3C2OA 3UY8A 4LV9A 2RDWA 1Z48A 2NX3A 3TK7A 3LCIA 4G1KA 3EWBX 3E49A 3K30A 4JTSA 2F7FA 1GG1A 4PL2A 1W54A 3HG3A 3W75A 1JVNA 3EX6A 4C1LA 5D02A 3FYOA 5DBUA 3EWZA 4FNUA 2OMAA 3CWOX 1F5ZA 3L2IA 3W7NA 3WFAA 3TDFA 4PC8A 1FUYA 5D2WA 3LRKA 1IIHA 3ELFA 2V30A 4UTWC 1OFRA 3QW3A 2YYTA 4WXYA 2QJHA 3LCFA 1QOPA 1NF7A 4YLWA 3PG9A 3WJZA 1PHQA 4GXMA 2X1TA 3Q94A 3STGA 3L0GA 4JTGA 5A8GA 2Y6ZA 1H7WA 3KRZA 3DI1A 1H63A 4YMZA 1GOXA 1OYAA 2FDSA 2BTMA 4XBSA 5HR7A 2ZDRA 2JKAA 2Z0IA 2QCMA 1DL3A 5FESA 1FWTA 1W5QA 2ISVA 3G22A 5FF2A 4O15A 1RR2A 4PH6A 4JTFA 4NJJA 1CX9A 2ZRXA 2R8WA 4DBDA 5J5DA 3QQ0A 4NU7A 3VCRA 3W7HA 3GDKA 3W22A 3TQVA 2EGZA 2E6FA 5AOUA 4UTIA 1TV5A 1VCGA 2V5BA 3F4WA 4IOTA 1QPNA 3LB0A 4HIBA 3R8RA 1GVSA 3Q58A 1YLVA 2WO5A 4Z0SA 1GWJA 2FIQA 3CHVA 5CZJA 1XM3A 2V2HA 3GB6A 4GE8A 2O7SA 4MFDA 3CB8A 2AAMA 1WBJA 3NZRA 2G95A 2E6YA 5EYWA 3C2RA 4JTTA 2FFCA 5D30A 1FDJA 2E6DA 1PHWA 4OWGA 4AHQA 1L9WA 5K2ZA 3C4UA 1P1XA 4AWUA 1H5YA 3HGJA 4UMAA 3LX9A 4POCA 3UXDA 1ZY9A 4H4IA 4AAJA 1KV8A 1EWEA 2YFOA 1SW3A 3BARA 4Y96A 3TE9A 3W1TA 3DFSA 1L6YA 3S1UA 1T99A 3QYQA 3T4CA 3O8AA 2ZCGA 2CZEA 5LNUA 2B4GA 4GUJA 4NXKA 4LV4A 4O17A 5F1UA 5FF7A 2ZA2A 3TSMA 3E9AA 3QZEA 1QR7A 3STFA 1S5WA 4IUOA 1YPFA 2QR6A 4R53A 4ALDA 1WAUA 2JK2A 3WJSA 2HTMA 3M5ZA 3PBYA 4N9EA 1JUBA 4UMBA 4BWLC 1OG0A 3TMQA 3TSDA 4O53A 4WZHA 2V81A 1JQXA 3L5MA 3W9ZA 1SO6A 1TJPA 3R5EA 2FPVA 3I6RA 1EEPA 1GVOA 2QCHA 3EXRA 4IGHA 4AHOA 2OCZA 3ABQA 2RFGA 4AF0A 2J9XA 2BLEA 2NV1A 5H91A 1I8JA 3M5YA 4Q32A 3B4UA 4E0CA 4WD0A 5LNSA 4UFIA 2G5WA 4LOCA 1KFKA 4O50A 3ZR4A 3VE7A 4UC5A 1DBTA 2E6AA 1NFBA 1H62A 2B7OA 5FEWA 2A21A 1K8YA 4MOZA 3W07A 3NA8A 3L66A 1OYBA 3IIVA 1P5BA 4JIPA 3LCLA 2J88A 2E68A 5D37A 3N9RA 3CIXA 3GYEA 1PCWA 2C13A 3RMJA 3W1UA 4NNCA 1H1YA 3DXIA 1VYRA 3TFXA 3BGGA 1OX4A 4TU1A 1I2PA 1C29A 3EXSA 5FF4A 3D0CA 2A2IA 3M6YA 5CKSA 1VCVA 3IVUA 1I4NA 1KFCA 3R12A 4O4WA 1N55A 1ZALA 2WKJA 3BLIA 1AL7A 3M16A 2BXVA 4IXHA 4CCEA 1ONRA 4DF2A 1Q6OA 3DGRA 2QCDA 1KW1A 1YTDA 1JCXA 5C55A 2WSYA 2ZZ3A 3PAJA 4Z1DA 3MHUA 5I3IA 3B8DA 4JIQA 3CEUA 5D2TA 3P84A 1OYCA 3GDRA 3EX1A 3LXAA 1AK5A 1TYGA 1LZOA 3A21A 5LNVA 1Z44A 4K7VA 3NYZA 2C19A 3NPXA 2X30A 3LM7A 2E5BA 1KM5A 1QPQA 1KM6A 5EKYA 3LRMA 4Z1AA 4UCGA 3P8JA 1S3HA 3T40A 1AL8A 4JEQA 5DLCA 3BG9A 3LHTA 2QUVA 4O52A 3I7SA 5EL1A 2TRSA 3L5LA 2Y89A 1W3TA 2CLMA 3G1AA 1BEUA 1EPXA 1ME8A 2DZPA 5K4ZA 1H60A 1ZFJA 1W0MA 3P7YA 3LHZA 4HNTA 5BMWA 4ZQCA 3S0CA 3O63A 2V8ZA 5IBXA 1JULA 2Z6IA 1ML1A 1SO3A 2PRMA 1VHCA 1YTKA 1K02A 2Q3OA 4JX4A 4O10A 3W2LA 3TFCA 4NUWA 2CZ5A 5D2YA 4XKYA 1TPFA 2VKZG 3GX9A 1KTBA 4MLRA 3W7OA 4DPQA 2I9EA 2Y88A 3W7GA 4UNKA 2VENA 3PC0A 3NQEA 2ZZ2A 3GKFA 1OF6A 3W74A 4JYDA 5HUPA 2Y85A 3YPIA 3MP5A 2OT1A 4O0KA 4ADUA 3O15A 1TTPA 1GTHA 2DP3A 3O07A 4DF1A 3DFOA 4S1FA 1VYPX 1G4PA 1ZENA 2B0MA 5EMUA 2NXHA 1JCYA 4NXSA 3G1XA 4B5NA 3UYCA 3USBA 4O28A 4LVFA 3WK1A 4O0ZA 1JRBA 5BRBA 3M41A 2Z1BA 3NR0A 3MI3A 2PE4A 3CU2A 1TV7A 4FX6M 1FY6A 3F03K 3JRKA 3W85A 3EKLA 3S5OA 3QMSA 5D2XA 1KM0A 3LCGA 4LNYA 2A85A 2C0AA 3GDTA 3MYOA 2JGYA 4QISA 6ALDA 2NLIA 4IPIA 3F1QA 4S2BA 2XFWA 3PSVA 1VC4A 1FCVA 3I7RA 2AGKA 2GVGA 2Q3RA 4GUHA 4DELA 2YPIA 2ZZ1A 4KWWA 1PVNA 2YCEA 2H8XA 4WX2A 4FNRA 1YYAA 2DJXA 4ORMA 4MKNA 4KWVA 1VJIA 2QKFA 3W1MA 2YR1A 1FCQA 3PB2A 1T96A 1XDMA 3FLUA 3M1ZA 2ZTKA 5LNWA 3H53A 3UPWA 2E5DA 4DO4A 3CC1A 4GNJA 4LW7A 5HMSA 4DBEA 4IMFA 1SQ7A 2E1DA 2YYUA 5KTLA 4XUGA 1I2QA 3PB0A 4LVGA 4AB4A 4KFOA 2P10A 3NQFA 4O11A 1TTQA 1R2SA 4N6FA 3W7EA 4XQ6A 1RQEA 2QAFA 3GZ3A 1UB3A 1YADA 4DO5A 2BZNA 4JTHA 1WBHA 1EP1A 1K03A 3VE9A 3KVMA 1GPWA 3UWUA 4FB7A 1OX6A 3KRUA 3LHYA 3R13A 4EF8A 1H61A 3GAKA 4JX5A 5U4NA 4IQLA 1XKYA 5I3GA 1XUUA 2XN2A 5LNRA 1R30A 4NZFA 1LOSA 4LC8A 3Q2DA 3C2EA 1ALDA 3GXNA 3NL2A 1IXOA 3UWYA 1OFEA 1F73A 4K36A 3PG8A 4UFHA 2HSAA 3GNNA 4UNLA 1LBFA 4FEZA 5DCBA 2Y7GA 1FXQA 4IMDA 1J2WA 5LSMA 2C18A 3CPRA 5K3VA 3JS3A 3WK0A 3RNDA 5BMXA 3QPZA 3UQNA 3W71A 3W2UA 1M5WA 2V82A 2D73A 3NQ6A 3SECA 1DQWA 2GVLA 1KFLA 5AC7A 3IEBA 5HNRA 1V7YA 2Y63A 1GT8A 4LUJA 1GZGA 1UBSA 1IIGA 1EUAA 1QWGA 2X1UA 3PF3A 2BWGA 4JTIA 2DZUA 4DPPA 3U6WA 3IGSA 1PE1A 1AW1A 4S2CA 1P0NA 3WK3A 1G7UA 2JBMA 1W5MA 1H7OA 2H90A 4A29A 5FF3A 5LGXA 4IPJA 3KX6A 1ZCOA 4YXGA 3LBMA 3HMJG 2CZDA 3C6CA 5G4WA 4OQVA 4ZQMA 3LTYA 2A7PA 1AW5A 4PCFA 2VEKA 3MBDA 5E1QA 1GVQA 3G1YA 3FFSA 4UTWA 1X1ZA 1K7FA 3THAA 3A9IA 1G4TA 1TTIA 4RR4A 3DKJA 4UFMA 4DF0A 3EWWA 2CLOA 3SIZA 4NVTA 1OFDA 3W7PA 3DAQA 2Q8ZA 2FB3A 3QRHA 4JTKA 4MPQA 4OT7A 1Q45A 4BK9A 5HR6A 1B9BA 2TYSA 3PR2A 3G0SA 4A2SA 1TPB1 2QCDB 3ANYA 3NG3A 1QNVA 1TJRA 2V2DA 3DFTA 4XBKA 5CZTA 1JCNA 2YW4A 4HPJA 1GQNA 3EB2A 2NWSA 2ZA1A 4RV8A 4FIRA 2O7QA 2PRLA 4UFKA 3EWYA 4HN4A 3L0KA 4HNUA 3NPVA 3E02A 3N3MA 5D04C 4Y90A 1ICQA 4WY0A 1LBMA 2RH9A 1SO5A 3NGJA 3UWQA 2DU2A 4IWWA 1JJKA 3HBLA 2RKXA 3TAKA 4UFLA 4A22A 3TV8A 1B4EA 4RXGA 1WDWA 1J5TA 2W0UA 3HGOA 4QSHA 1OK4A 3R2GA 4X9SA 2A7NA 4MY1A 3M43A 1MO0A 3SFKA 3NEVA 3WK2A 4O4VA 3N34A 2PCQA 3C3NA 4NT0A 4OE7A 4NQ1A 3B0UX 4TX9A 1I2OA 1ZAIA 4U28A 3P82A 3MHFA 4YWIA 2QDHA 4IX0A 3NQGA 3TQKA 2VFGA 2VFEA 4AH7A 3PM6A 2GPTA 4M7SA 3TAOA 6TIMA 3B0PA 2V2CA 2CLEA 1QO2A 2CFFA 1TMHA 1XBXA 4P2VA 3W23A 4XWUA 1ICSA 2Z2UA 4OV9A 4RK8A 3TIMA 2X1SA 2V0TA 1GYLA 5HWJA 3QEZA 3HG5A 3QFEA 4AHPA 1OK6A 3W72A 3C2FA 3P74A 3W7JA 3GVGA 3BG5A 1SW7A 3C52A 2AQWA 4JR5A 4QNEA 1W5OA 4M7TA 3W2NA 1EP3A 1XUZA 3QH2A 2XN1A 1OFAA 5EPDA 3PUOA 1RD5A 1U83A 2VC6A 1EWDA 3NL3A 4UTUA 1FCUA 5CPOA 4E2BA 3A5VA 1L6SA 3P5YA 3T44A 2QCNA 3M44A 4O54A 4L4MA 3PBVA 3ATZA 1W5PA 1X7FA 4O14A 2B7PA 5FI8A 1W8SA 4MYXA 5I3JA 2Y61A 3ZFHA 4A2RA 3PULA 4P61A 3A24A 4UTJA 1EX5A 1A5CA 1QO5A 4NNAA 1XDLA 2CW6A 5I3HA 1A53A 1W3NA 4FF7A 4ZQPA 3IIXA 1GTEA 2C15A 4IX2A 3IVSA 3P67A 1DORA 5C54A 4JY8A 4O18A 2VELA 2JKEA 1HO4A 4ZVJA 1GVRA 1G69A 4HNNA 3BPWA 2E77A 4PL1A 3NQ2A 1DQXA 1IXPA 1UUOA 3W86A 1LLWA 4GRSA 4N9DA 1BWKA 1UJPA 3M9YA 1K7EA 1RV8A 4GUIA 3PBWA 1YXCA 3NM1A 3W7MA 2W79A 1A50A 4MFEA 4W9TA 1GVFA 1C9DA 4ML9A 3SGZA 3EKZA 1F05A 1ZHAA 1R2TA 1W37A 3S5YA 1L6WA 3G1FA 3STCA 3ATYA 2ATSA 4O1CA 5AB3A 1NVMA 1FDYA 4MJMA 4HPXA 2FPYA 2DZXA 2YX0A 3QSRA 3FYPA 3MHGA 1VCFA 4R34A 1XFBA 3OEXA 3GAYA 2WJZA 3HG4A 5DN1A 3HPXA 1MZHA 2VEPA 4K8EA 1TQJA 2VFIA 3LHUA 3KVJA 5L6UA 1BTMA 3LXCA 4WXZA 3HB9A 3NPWA 5F2GA 3LDVA 1IGSA 3CM4A 3QW4B 1TPVA 1LRNA 2JKPA 2A5HA 4UUIA 1QPOA 2E09A 4KFNA 5CPLA 1WOBA 1YTEA 3V75A 1UASA 3DHDA 3TJLA 3THQA 1Z41A 3CQ0A 4H3DA 1M7PA 3ABOA 3LV5A 2WNQA 3B03A 1VQTA 3TROA 4Y9AA 3W1RA 2A0NA 3SGUA
chains in the Genus database with same CATH superfamily
5EBAA 3WLMA 3NZQA 4B5XA 1FFQA 2WNZA 3DI0A 3UWEA 1V51A 1XLAA 1UKQA 1OCBA 4JN8A 4KIEA 4R33A 3LTSA 5HJLA 2J24A 2HK0A 7A3HA 3RO6A 4PULA 4EIVA 3H4WA 2C79A 2PSNA 1Z42A 3K8MA 3GHUA 4QE1A 4RKAA 4BFAA 3TWBA 1FWWA 5I5RA 2OPJA 3W01A 1DKWA 4HPGA 5CAKA 4JTCA 2VGBA 4C1NB 3ZMRA 1G7VA 3MP3A 1PX4A 4GX9A 4L5ZA 3LLFA 4QGCA 1HL2A 4H00A 4PB5A 1QOXA 3M5XA 3LPGA 1F74A 3AISA 4G7EB 4LB4A 1TJ1A 1ZJHA 3SI9A 4PMDA 1AG1O 2XIBA 5DO8A 4WR3A 4IZGA 4HSOA 1MEIA 5PTDA 1GGOA 4AZGA 2PTXA 1BYDA 4A3YA 1TJ2A 1W1PA 2F2HA 4C6DA 5FJIA 2ZC8A 3W7LA 4H7VA 5AHFA 3OA3A 2V5CA 4NAEB 2C7FA 4O1AA 1R46A 4W8BA 4IJCA 1E9LA 3BW3A 3ZVHB 3SCNA 1OC7A 1JG9A 3OG3A 5F4WA 2NV2A 3QC0A 5CGQA 3DFNA 2ACUA 1R5YA 4C1NA 3PPGA 1MXDA 4FX7A 1D7KA 4C6QA 3C61A 3TN6A 2VC7A 4NF7A 4IP7A 3PUDA 3DBPA 3QR1A 2WQPA 3KOWA 3VGHA 1H7PA 4AEOA 4C6JA 3HTWA 5BU6A 1EDTA 2BX7A 1F3EA 1TV4A 3WMCA 2DSWA 3CEPA 3AUOA 3OBEA 1WDRA 3RF9A 1TPUA 4UFJA 3UXKA 1RQHA 1BVWA 4Z1CA 3V3WA 1UROA 1WUFA 2WVUA 1VH7A 4TIMA 3IIZA 4LALA 3KOFA 1NQ6A 3ZO9A 3C0JA 3BW4A 2WB5A 3K4AA 4XD5A 4Z1YA 3WUEA 1S2WA 3W7IA 5C9RA 1DJGA 4PMRA 1E9IA 2YLLA 3NVTA 1J79A 3P0WA 3NL6A 4UR8A 1VBGA 4LEFA 1LOQA 4AYSA 1YE4A 3UNTA 1SFTA 5JH1A 2RDTA 3SCSA 4NRRA 2ZRZA 3IJDA 1S39A 3RRAA 9XIMA 3W82A 3H8AA 3WJXA 4H2HA 4Y6GA 1B5TA 5CGTA 4M6VA 1GZ1A 3RG6A 9RUBA 2WVTA 4R27A 4K38A 1RY0A 1OSEA 2D1ZA 1DWFM 2ASHA 5E0FA 3MMTA 2HE5A 2ZBTA 4YL2A 1G01A 2OKTA 4Z1BA 4XSMA 5FJOA 3OHMB 1LWJA 3S1VA 1T6MA 3H2FA 3CS2A 1TUXA 5DF0A 5FD0A 3OZYA 1ISVA 1NEYA 3WQ8A 2QPSA 2WAGA 3TCSA 5K9CA 4L61A 2I57A 4NY2A 1F4AA 4GO8A 1NWUA 3EDFA 1XFCA 1XLMA 1P0EA 3TNOA 1EGVA 3CLMA 3V5CA 3WBEA 4S3EA 3DFQA 3GH5A 1O4UA 2PU1A 4MKSA 2C1HA 1C92A 2VDHA 4LVDA 4B5WA 2J8GA 2FVLA 3CL6A 3MI2A 1WCGA 4GJ1A 2IPJA 1YDNA 3G24A 1TPWA 1VLIA 4ZGYA 2PURA 3VGGA 3QF0A 4ZSUA 4GVGA 1W3KA 5EFFA 3PJUA 5GNYA 4CEUC 4C6FA 1UD6A 5CSYA 3HV9A 1A3XA 2QW5A 4LS1A 5DFAA 5BZAA 1Z8AA 4MLJA 1DXFA 1G4EA 1H0GA 3F5JA 5CPNA 2ZTJA 1D3GA 3LY0A 4HOWA 3LRLA 2BSLA 1RPXA 1E71M 1QNPA 3IUIA 3OVRA 3FS2A 3ITTA 2OYMA 2WCGA 4QLJA 4RDVA 1FVPA 2XFYA 2Z4GA 5C2CA 3LGEA 1W31A 7REQB 3CH9A 2QEZA 3BLDA 5C5YA 3APYA 3MUCA 2POTA 1KFWA 2GQ8A 5IM51 2VMFA 3RLVA 3H55A 2PTZA 4OHQA 4Q7NA 1QK2A 1SMAA 1A5AA 4P8WA 3IV3A 3T8QA 4XVDA 4FOKA 4KF1A 2YSWA 4M5PA 4PRTA 3SSZA 2UY4A 1O95A 3OA5A 5CC7A 3KS5A 3E0IA 2CPUA 4S3AA 2NT1A 4WVXA 3T7VA 1VF8A 3SAZA 3SY8A 1BLIA 1UH4A 1RBAA 3C8FA 4BY3A 1H1ZA 1C8QA 1J12A 5I3KA 1AUSL 2I5GA 5D2VA 3ARVA 4XB3A 2PF0A 3UWVA 1BD0A 1GONA 4J3TA 5G2WA 1F07A 3NQBA 4JN6A 3C3UA 5GPRA 1Q8JA 3I65A 4EOUA 1JYVA 3DGBA 2F6KA 3VIGA 3ZIZA 2AL2A 1NH6A 4UOQA 2ISFA 1EF3A 4I5XA 2GWGA 4FK9A 1JI1A 4PEKA 2VD8A 4RXFA 3NQ8A 3MCNA 5G5IA 4LC6A 4JTEA 3BAWA 1TZZA 1R87A 1HTIA 3W37A 3TTYA 5GJNA 1KM2A 3P61A 4C6IA 3A47A 8XIMA 1GOOA 1GJPA 3VKAA 4OU1A 3UWWA 3U48A 3E12A 3M0IA 4DZAA 3L4TA 4RW5A 3W6YA 4U3AA 2PI6A 4FNQA 3LZ5A 2ZWYA 1XSJA 2DVUA 1ZLPA 3NQMA 1XPYA 1DWIM 4PB3A 3NGFA 1EJ7L 2PEVA 3VUSA 1HT6A 5A8QA 4QAWA 2BY2A 1LRQA 1UQYA 2DPEA 1EC9A 3GDLA 4N6EA 3IGUA 3S6OA 2BOFX 5D4YA 4ZB0A 1KLZA 3SADA 3B0YA 1TREA 2D0HA 1IT8A 4GXPA 2QGHA 4RPPA 3SN1A 2WVVA 3KBJA 1FBAA 3QV7A 3VKJA 1KCXA 4DXVA 3LHVA 1KKRA 3FA5A 2PDIA 3G1VA 4D1JA 3RLUA 5DCDA 2CLFA 1IXNA 5T9CE 4PB4A 4EPBC 1XISA 3TQ0A 3D3FA 1QK0A 1OFQA 1H51A 2R82A 3M6DA 3R89A 2ZWZA 5CLWA 1JYNA 3L5AA 5C2GA 1Q7MA 4XAYA 1TVLA 2PWHA 4XTIA 3KCLA 1VS1A 4HZ6A 1CGWA 4RE2A 5FCZA 3P5ZA 3FJ6A 1J2BA 4U4MA 5HA7A 1U1JA 4Z0JA 2AMGA 1TRDA 3K8LA 3STEA 2PU0A 2VVNA 2F9RA 2DGAA 1A3WA 2GJXB 3LA4A 3PTDA 3WF0A 3TKFA 2ZIDA 4DJEC 3R1ZA 4F0KA 3W81A 2R91A 2CLHA 1UMLA 4A3RA 1WKEA 1FXPA 4S3FA 2NQ5A 3S83A 3EEGA 3KLLA 5IOBA 1B54A 2WMIB 3QPYA 2NXGA 5BXPA 4I3GA 1FH8A 4XX6A 3A4XA 1FQ0A 3ES7A 5LHFA 3B40A 2INFA 2PDQA 2ZX6A 2OEMA 3FVMA 4U2ZA 1WV2A 3IPWA 4D8ZA 3SN4A 1SJDA 3LBOA 2GOUA 1J8VA 1ZSXA 3GC5A 2G4FA 1WNOA 1LYXA 4CQDA 3BZGA 2Y5SA 4WK9A 5HAOA 5A94A 3N9KA 3GBEA 4LU0A 3U9IA 2VL4A 3VCNA 1XD1A 3ERPA 4JYFA 4H9MA 5U7SA 1OC5A 2H6RA 1Q3NA 2GVJA 4ACZB 2IXVA 3QQWA 1X6NA 4C6KA 3FCPA 5HXMA 3VI2A 4Q4RA 3QOKA 4XTDA 1OF8A 3AXKA 1XBZA 4U2YA 3TW9A 3ARRA 1CNVA 4FSAA 3HQNA 1H7NA 5BWFA 4BF9A 3THDA 1L8NA 2BP1A 3PVFA 4M19A 1UR8A 3ZVHA 1U1UA 5A69A 1E4NA 3ANUA 4KS0A 3L67A 4Q8UA 1SU5A 2WVSA 3P8IA 1QNQA 2RDUA 2ACQA 4I8DA 2BGNE 3FJLA 2G96A 5FKYA 3W2MA 3B05A 1LTDA 3CO4A 3O6YX 3PPCA 4G8TA 2PWDA 4QAIA 1J6PA 1J01A 3GTNA 3BAJA 3U3HA 2DQXA 2QVNA 4WDUA 1JDFA 3UGVA 5JXQA 2WMJA 3FOKA 4G7FA 1LLOA 3ZR6A 2G37A 3WNMA 2BASA 1BSIA 3H54A 3WSUA 2IQ0A 1W6TA 4HKPA 1IF2A 1BHGA 4GJJA 1P0DA 4HOXA 2ZXDA 5AC4A 3MYPA 4Q8NA 2QT3A 4E6MA 3PUEA 4J3VA 1OY0A 1TWDA 3NZ1A 3SR7A 1XBVA 2EHHA 2FTYA 4PUDA 5K4XA 2FMNA 2CLLA 3CMJA 3BLKA 5F4SA 5A6LA 3AXIA 2O4MA 3W87A 1GKRA 4Y8FA 3UCQA 1FWBC 2X2YA 2PTWA 4AD2A 3JVAA 3NM3A 2WV8A 3M0ZA 1RP8A 1UWUA 3WF2A 1LWHA 4WLCA 4JTLA 4GVIA 4K1GA 1AH4A 4QG8A 1V77A 1CLXA 5MHBA 1S2VA 1IEIA 4W87A 3VDBA 3B9AA 3MY9A 4LPCA 4GVFA 1O6IA 1PS9A 1P6CA 2P1FA 4FP1A 4DO6A 1F8IA 1QHPA 1SZFA 3S5SA 3GNPA 3MPGA 1JDDA 4FR6A 3EEZA 4QS5A 2VOTA 1BFNA 3R11A 3ORWA 4L9ZA 1KXVA 1R3VA 5I3FA 1F3XA 3WFZA 4GQBA 3ZLGA 1XRTA 4I7VA 3L9CA 4ERIA 3GD6A 4LQ1A 2J7BA 4QX4A 3G3DA 5I3DA 1PCKA 4XAGA 3T2OA 1VJZA 1OT2A 7TIMA 5J5RA 4MTVA 1U5JA 4LCQA 4DAFA 1Q6QA 4JKLA 3S9YA 3WQDA 1OABA 4CQ8A 1SPQA 1TA3B 1XH0A 4JICA 3ES8A 3ABXA 4M1BA 1VHNA 3FJNA 2YA2A 2DT2A 1FHVA 5M17A 5CJ5A 3C2OA 3HMCA 2RDWA 1Z48A 1RALA 3TK7A 4JFVA 3CAKA 3GIQA 4G1KA 3EWBX 3K30A 8CGTA 1GG1A 3ALGA 4PL2A 2MANA 1JVNA 1PO9A 4LAMA 3FYOA 2CCRA 2Z2AA 3EDEA 4DZIA 4S38A 3WFAA 3TDFA 1Q7QA 4QDPA 2QPXA 1FWEC 1IIHA 3ELFA 3MO4A 1EJTC 1OFRA 2QJHA 3VNYA 2BV9A 2Z7GA 1YIXA 2QPUA 4PTVA 3CHEA 1KB3A 3WJZA 3QOMA 2WMFA 3L0GA 4D6JA 2HXTA 3S9ZA 4MADA 1YNPA 4H6RA 3GU9A 1R7AA 3CLWA 1H63A 1GOXA 4KWUA 1OYAA 4URIA 2XZ9A 2BTMA 4FLOA 2JKAA 3U2CA 2QCMA 3M0YA 4N42A 2ISVA 2X7VA 1S1PA 4PH6A 3VKCA 4JTFA 2ZRXA 4IFRA 2R8WA 4WGHA 3R79A 4Z17A 5J5DA 3W7HA 4AD3A 3ZLHA 1T7LA 2V5DA 2POZA 3TQVA 4YTTA 5AOUA 4GIEA 3ITGA 1E40A 3I4KA 3UJ2A 2WO5A 4RW3A 4W86A 4NKCA 1XM3A 1KBBA 1RLCL 4GE8A 5F7UA 2AAMA 3NZRA 2OYLA 1H3GA 2D3NA 3PZ9A 2E6YA 4MWAB 5EYWA 3C2RA 3QHOA 4JTTA 5XINA 2FZMA 5D30A 1FDJA 1PHWA 1XYFA 4OWGA 4FALA 5AC5A 5K2ZA 3C4UA 1J96A 5CXPA 3G2GA 3WBWA 1BXCA 3UZXA 3LX9A 4POCA 5FJPA 1ZY9A 2D0GA 4FR1A 1EWEA 3SQLA 2IQDA 1L6YA 3WL0A 2E9LA 5BXRA 2CZEA 5ECVA 4X9YA 5D9MA 3AICA 2JIWA 2VZVA 3E9AA 2XTKA 1CCWB 5IFPA 1S5WA 1KRMA 3VIMA 4DI8A 3RPDA 3AHZA 4HYRA 4M3PA 3OOQA 3AIWA 4JQAA 3THCA 1JUBA 1CECA 4P7RA 3TMQA 2CBUA 5H8PA 2YCLA 4I6VA 2V81A 4Q8OA 2EPKX 2W66A 3W9ZA 1KWGA 1EEPA 3GTHA 4BHYA 2ZUSA 1GVOA 3L4UA 2QCHA 4RNIA 3BDKA 1E6QM 5GQBA 4XZHA 4B2DD 4AF0A 2J9XA 2AL2B 2MUCA 1HJWA 1V08A 2NV1A 5LIKX 5A6KA 4IF2A 1KQYA 1W2PA 2G5WA 2X0YA 3PWGA 1DBTA 1PDZA 2B7OA 4I9TA 3WNOA 1OZMA 2XVPA 1DJZA 3WNLA 3NA8A 4ZSTA 2G8ZA 2FGBA 1OYBA 3IIVA 3ZM8A 3QKEA 2BVDA 1ADDA 4JIPA 3LU2A 4Q8MA 2E68A 4JTAA 3HU7A 2HPMA 2QIWA 2X09A 3RMJA 2UY3A 3AYVA 4HNLA 4XZNX 3UVAA 3TFXA 3BGGA 3QZ6A 5C9XA 4CU8A 7TAAA 5CKSA 3GFXA 2QQ6A 5AZ1A 3TNBA 4WKHA 3PTMA 4JTRA 1VFTA 2EG7A 1MQPA 3R12A 4C91A 4QXIA 4E3VA 3SGGA 5T8GA 2VR5A 3ME3A 2QHAA 1YTDA 1JCXA 1GNXA 3MV11 5I3IA 3B8DA 1KQZA 3BSHA 5D2TA 1V8EA 1OM0A 4G9PA 2VUYA 4ERAA 1OYCA 1ZJBA 3PZQA 1UW9A 3GVWA 1LZOA 1Z44A 4H8UA 2REQA 1K9TA 4K7VA 4ZTYA 1X96A 2WM0A 3UBPC 2E5BA 4EAMA 2SFPA 3EPOA 4JFSA 3COTA 1QPQA 2PCEA 5EKYA 3RDKA 2J77A 4F2BA 2GGHA 4JEQA 1V3KA 3BG9A 3LHTA 3I7SA 5EL1A 3G1AA 2DZPA 5K4ZA 1GUVA 4GIAA 3LHZA 3KBSA 2O0TA 3S0CA 2V8ZA 4EXAA 3TA9A 1OCJA 3PTQA 3W2LA 1K02A 2Q3OA 3RU8X 4MDOA 4E4UA 1Z32X 1ONEA 4NUWA 1XIDA 4XKYA 3B9EA 1VPYA 4DJDC 4MLRA 3K8KA 1LL6A 3VOCA 3H2OA 7ENLA 4IP4A 2WZTA 5CPQA 3CNYA 2ZZ2A 2PLMA 1CGYA 2XWDA 1FHUA 5HUPA 2Y85A 3YPIA 3LLXA 1ZBVA 2OT1A 4O0KA 4ADUA 1TMLA 4B2DA 3O07A 1L6GA 3DFOA 2PGFA 4LBSA 4GIYA 2B0MA 2NXHA 2PDKA 4OTKA 3N13A 4H2CA 2PWUA 2VO5A 5TF0A 4PCTA 4AU0A 4WEVX 2E7FA 1QHZA 3P93A 1POJA 2IPFA 3D3AA 2VZOA 4O0ZA 5BRBA 3M41A 1KR0A 4LAOA 3NR0A 4GNVA 1K9EA 2YL8A 1JEZA 2D0FA 4IFKB 3NURA 3CZ8A 4V1XA 4E3TA 1R3YA 3N3TA 3URBA 3ARQA 3MC5A 3KTXA 4PCPA 4B5TA 2JGYA 2V5KA 2CLPA 2NLIA 1LL4A 2WMGA 4GACA 2AQVA 1VC4A 3S4TA 3I7RA 1JXJA 3VABA 3HZ3A 2GVGA 2BGQA 2V5JA 3WLIA 5JMUA 1NP2A 7REQA 4FNRA 2DJXA 1JPIA 4RDYA 4AX7A 3EOSA 1R9XA 4RNJA 4A8IA 2D3LA 3N6HA 3H53A 1JF5A 2DUXA 4GNJA 4LYKA 4IT1A 4DBEA 2OWXA 2WHKA 2E1DA 1AQMA 1UR2A 3TYEA 4XUGA 2IKIA 4RDZA 3H22A 6TAAA 3W7EA 1RQEA 1IZKA 2H9AA 3IUDA 1PB0A 1UPPA 2BZNA 1EZWA 4JTHA 2YCJA 1WBHA 4HA3A 4FB7A 5CCZA 1NFGA 1OX6A 3KRUA 3LHYA 3S47A 1XKYA 1XP3A 5LNRA 1R30A 4NZFA 2QMJA 1IXOA 3WH7A 5A6AA 1OFEA 3AXHA 1F73A 1JYXA 1C7TA 3VO0A 5CJMA 1BGGA 1V3HA 3CPRA 5K3VA 2ZX9A 3LGGA 5CBIA 3NQ6A 2V68A 2GVLA 5REQA 5AC7A 3IEBA 2VZTA 4NZCA 3BAXA 4PUJA 1W2VA 2PDLA 4L1GA 4E2VA 2W63A 1EUAA 4S3CA 4K68A 2P76A 2ZUMA 4Z2JA 2XWEA 4DLFA 3FGCB 2J7FA 2Z1VA 3IRSA 2DZUA 4GK8A 3GY1A 4DPPA 3VVGA 3N4AA 4XD6A 1AW1A 3WK3A 2JBMA 3ARTA 1QATA 4A29A 1RCXB 1EF2A 4YXGA 3IAPA 1H4PA 3HMJG 2HE8A 4WF7A 2J75A 3C6CA 3LPPA 2A7PA 4MMWA 3VU2A 1AW5A 4G7EA 3MBDA 4BQ4A 2VQUA 4Z2KA 1V6YA 3DKJA 4B4FA 4V27A 1UBPC 3SIZA 1QJWA 1FHLA 2MNRA 3FDGA 3QRHA 4OT7A 5C0QA 2VGFA 2BHYA 2TYSA 2ADAA 3T0DA 1QNVA 2J13A 1TJRA 4XBKA 2V2DA 3QPEA 4LUSA 1Q2RA 3AU2A 5IXEA 4NAFA 4FIRA 3RXZA 1CEOA 2PRLA 4AZ5A 2QJJA 5CPSA 4V1YA 4HN4A 4OZOA 3L0KA 1W3HA 4Y90A 1LBMA 3V5FA 5EFDA 5JH2A 1ECQA 2RKXA 3TV8A 1WDWA 4TTGA 4QSHA 2YB1A 1MO0A 4DX3A 4HZMA 2PDWA 5I09A 2DQWA 3WK2A 2PCQA 3E6EA 4TX9A 3GBDA 3IWPA 1ZAIA 1U30A 3OLIA 4U28A 1UR1A 2HDJA 9XIAA 5E9XA 4YWIA 2QDHA 4IX0A 4JTDA 3NQGA 2VFGA 2RAGA 4AG0A 4A4AA 4M7SA 4MAZA 3CV7A 2CFFA 4K2SA 1ICSA 1R7OA 4KH2A 3QFEA 2BHZA 4AHPA 1O66A 3TEVA 5HATA 1YMYA 3GVGA 1TWZA 2X1IA 3BG5A 4S39A 3NUKA 2AQWA 3USZA 1W5OA 2XN1A 2VWSA 1JZ2A 1JDAA 3PUOA 5ABFA 4UTUA 1FCUA 3RN6A 5CPOA 1L6SA 3VZZA 3T44A 2QCNA 1ZZMA 4GOAA 4O54A 3P6LA 3PBVA 4XZLX 4OFCA 3VGBA 5FI8A 4MYXA 4XG1A 4P61A 3OO2A 3VD3A 2FJUB 1XDLA 3GTFA 2CW6A 5I3HA 4H7CA 5I03A 3VOGA 2Y5JA 8RUCA 2C1IA 1RJRA 2GYIA 2P0IA 3B8WA 5C54A 4JY8A 3VMNA 1G9HA 2JKEA 1HO4A 4BS0A 2XPKA 4ZVJA 4DN1A 2RDXA 4PL1A 4F79A 3RGTA 3PK7A 4QRNA 2O4QA 1BWKA 1UJPA 1VFFA 4IQJA 4GUIA 4ZODA 2O9RA 4XO6A 2WC4A 2W79A 3HQPA 3BJSA 4UQEA 1F05A 1ZHAA 2GJXA 1L6WA 1CIUA 4O1CA 4MJMA 3MCOA 4CNSA 1R85A 1WDSA 2CXEA 1VCFA 1QNOA 1PSCA 1XFBA 3RPTA 2D2JA 3GXIA 1E0XA 2WJZA 2GDQA 3K2GA 1U5VA 4K8EA 5AVNA 3LHUA 4DLMA 2G3JA 5L6UA 1J11A 2D2HA 1Q4WA 3NPWA 3U7VA 3CM4A 2PWGA 2JKPA 2A5HA 3KTSA 4G1NA 5A8PA 3OGVA 4KFNA 3UR7A 1WOBA 4BZYA 3V75A 4PMYA 3NDYA 1G0CA 1BF2A 1M7PA 3M0HA 2VM8A 4YS1A 4XZBA 4DJEA 3RILA 2A0NA 2XGBA 7PTDA 1HKWA 1EYWA 4NAFB 4MVAA 3PFMA 3B8IA 3S8HA 2YBVA 3ALFA 3IVTA 4L9YA 1SSGA 3W4RA 5I78A 4TQTA 2WHJA 1LWIA 3QTPA 4PSRA 3VNDA 1M53A 4M6PA 1ZJIA 4IJBA 5CH9A 2DEPA 1BG4A 4FNPA 3L12A 2X0HA 4GWEA 3V36A 3AMLA 3LCXA 3O1NA 4UZSA 4DHGA 5JBDA 1FDZA 3CIWA 3LSCA 3HURA 4MB3A 3B06A 4AVFA 4AZBA 2B7QA 3HOJA 3TJ4A 2ZZ4A 3EXTA 3CUZA 2ISWA 5C8BB 4J27A 4JQ3A 4MUZA 2Y7DA 5CBJA 2GQAA 1UR3M 4JTJA 3VDGA 2VEFA 3NCOA 3N2BA 3EKGA 4L4LA 2QJGA 1C93A 1MEHA 1BWVA 4O0QA 5HNUA 4O57A 4LNCA 2J74A 1UKPA 2FDMA 5A2AA 2QULA 3HJZA 5T91A 1WXJA 5KZEA 1KA9F 4B5VA 1B3OA 5I06A 4U31A 4QNWA 2FZ8A 4KEVA 2YBUA 1YDVA 1S5TA 2OXNA 1JR1A 3D46A 3CL8A 2GVYA 2YXXA 4WSKA 1EBHA 3I3DA 1GW9A 3WQ6A 1EJSC 2YXOA 1CXFA 1QCWA 3FA3A 3TVAA 4AZCB 3V16A 1XYBA 2QF7A 3HF3A 1GG0A 3KL3A 4M81A 5DT5A 4GC3A 2PA6A 1Z69A 4LT9A 1OCQA 3VILA 5DBTA 4JIHA 2D2GA 1B3VA 1LCOA 4EWJA 4H01A 3KBNA 4L1XA 2OTDA 2PC8A 5CAHA 4GZ7A 4BEQA 3GG1A 4HGXA 3MJMA 5IBXC 3E3HA 5FIPA 4YCOA 4E8GA 4NJIA 1IR1A 3DG7A 5DCEA 1X8CA 1CLVA 2F38A 3ITVA 5D9OA 2GFTA 3QJAA 2VQTA 4YPJA 4G2DA 3V35A 2WVVB 1TV2A 2PWFA 2QXWA 2JALA 1W91A 4OGZA 3ABRA 3NSNA 2PFHA 3FEMA 2ABBA 2RHGA 4NNBA 2QV5A 2QIIA 1WB0A 3NTYA 5BXSA 4Y7EA 1BRLA 3C56A 1KCZA 5CLTA 2ZYFA 4AMAA 1GOMA 2Y4SA 2YLAA 3WUGA 3BK0A 3PZMA 2WSRA 1X1OA 4ATWA 3MMWA 2PUZA 4IH3A 2ZICA 3T55A 4PE8A 3BV7A 3KRSA 5BYWA 3GK0A 4H83A 5AYYA 4UQAA 4QE4A 1PZ1A 1GVEA 1F76A 4PTDA 5EB8A 3U4AA 4GKTA 2VCCA 3GVVA 2O56A 4MPKA 4HSHA 4L1WA 4O13A 1DQUA 1XLLA 4HCHA 4H8VA 2CHNA 3TLLA 2Y2WA 3VD7A 4TX8A 4MKVA 5LHEA 4D1IA 3EA1A 4HQVA 4HJFA 3D6NA 3VD4A 4MY8A 5E09A 1E43A 1PL9A 4KWOA 4B3LA 1RHCA 5EMLA 2VC9A 1V6TA 4WUIA 3W1XA 4CD8A 1LROA 2QCCA 1SMDA 4I6KA 2DDXA 1DJNA 1GQKA 3UEQA 4LS0A 1GQIA 3ONCA 3UT0A 1REQA 1BVNP 3OG2A 2ACRA 3KCJA 5H8MA 4WKAA 4AWSA 3CIVA 4D8LA 4KQNA 4H6EA 2XSXA 5IRPA 5HMDA 1UR9A 1V93A 4PUUA 1BVZA 3ZOAA 4PBGA 4BI6A 1WXZA 4JIIX 2PZ0A 4CQAA 5AC6A 3K46A 4QP0A 3ARZA 5FEXA 4O19A 2BGSA 3HG2A 4L7ZA 1RK6A 4EF9A 4O12A 3W1NA 4GQGA 2GDUA 3O6DA 1OQFA 4GMEA 3GS6A 4DJED 4M51A 3PWIA 4WY0F 2I14A 4MB1A 2QUNA 2OGJA 2XYLA 4CKQA 2PGEA 4REQB 4TMCA 2XJ7A 4GGHA 2WNWA 1V3MA 3A23A 1QT1A 4WKFA 1IEVA 2ZFAA 2OU4A 4RX0A 4LUTA 2QZRA 2DZWA 4ILSA 1RUSA 2QAPA 4GY7A 5EY5A 4MM1A 4PTNA 2IPGA 3UA3A 4X22A 1Q13A 1PKLA 2JGQA 4FF5A 1S38A 3LV6A 1JZ4A 1P6WA 4AUBA 1GYNA 2UZ9A 3M64A 1JCMP 5GVJA 1LQAA 4JS3A 3DHPA 4K6AA 5LA1A 4MNMA 3LXBA 3WLSA 1VLWA 3TC7A 1NWTA 4J9JA 3GKAA 2A1YA 2NUYA 4GUGA 5E0CA 5CZ0A 2XH7A 4LGXA 3EPNA 4FAMA 3TC6A 1E9ZB 2ZVRA 4F4RA 4RZ4A 2ZRUA 4AZCA 3S5NA 4KKXA 3VKKA 5C7HA 3IACA 4IUGA 4ML4A 1MFVA 4QE5A 2GQ9A 3ABSA 5FJTA 3WX7A 1KV5A 2OYKA 3BZJA 2IXUA 2C3ZA 3LPFA 3QGVA 2I7GA 3WY1A 4JDBA 1QOQA 1FH7A 1XLHA 4V33A 2PDCA 3H7VA 3LTPA 4TO8A 3GE7A 3GHTA 2NUWA 2OQYA 1BKSA 1E55A 5AY7A 1BAGA 2ZXAA 3BOXA 5SWUA 1YKWA 3BW2A 1HJXA 3W1PA 4AD4A 5DY2A 4REQA 5AYZA 4IXXA 3C2YA 3N2CA 1RSCA 3TZNA 3SEPA 3WLJA 2CERA 3GSMA 3WEOA 1RCQA 3ZS4A 1HP5A 3MB9A 5CJNA 1XIEA 2XG9A 2G97A 2YGYA 4TUFA 4HD5A 3PPFA 5IFTA 3OVQA 4UTHA 1JF6A 1L2UA 1LUCB 4JHMA 3BLPX 1I2NA 1X6UA 2H9AB 1ZJAA 2FB2A 3GLCA 1HVXA 1Y5XA 2DZSA 4UWMA 4QCEA 5IHRA 1XGDA 4GKLA 3FHQA 4W7WA 1G6CA 2H8ZA 4E2DA 1EHNA 3CUXA 4B90A 1ITXA 1Q65A 1J0KA 1U2YA 1UCWA 3LOTA 3TCEA 3ENLA 3TX9A 4O8RA 3BLLA 5AHEA 1GKQA 1JPDX 3KFTA 4MJZA 3ZXWA 1E72M 1FWCC 2R1LA 5BOFA 3MT1A 4US5D 2YB4A 4IIBA 3JZEA 3GH4A 3O0KA 3LUTA 4BR1A 3Q65A 2EJAA 4AIBA 1JDCA 3TWAA 4XIAA 4NZ3A 4HMCA 4DB7A 5FA5A 1NSJA 2Y5EA 2GSJA 4DXKA 4C1KA 4F40A 3FIGA 3GC2A 2ALDA 4LUTB 2GSHA 5DMNA 4GYPA 4UZUA 2FZ9A 1K8ZA 2HMCA 1U5HA 3V18A 4PBEA 3NAVA 1FWGC 4R3UA 3C0LA 2YL5A 4RZ5A 1WZLA 4QIUA 3NQAA 1I2RA 2HQAA 2ZX8A 2PDFA 4RUBA 4KETA 1TVNA 4GBDA 1MYRA 4W84A 2FH6A 8XIAA 2PDGA 1A4LA 3BAIA 2IKGA 3KS6A 5I6SA 4BA0A 2P3ZA 1RCOB 1PPIA 3K4WA 3ZT5A 3PBMA 2A3EA 1E0WA 3SJ3A 2OELA 3DIPA 2DV0A 5A8NA 2EPMX 2V3GA 1W3JA 1IHIA 2XIMA 4LANA 4LH8A 4A8RA 2V5LA 2HNHA 4JKMA 2J47A 2AKZA 3DH7A 1FKXA 3OZPA 1KKOA 2PF8A 4CQCA 4DYJA 1Y8BA 3OBAA 2IKHA 5HWMA 3N04A 1RJPA 3VNIA 3DFPA 3U7BA 3UGRA 2CYGA 2OT0A 1R86A 2OGYA 3GO2A 3OP2A 4JOMA 1A5OC 4XBJA 5D09A 3N25A 1V0KA 3HGRA 2YCLB 2CKSA 1E5NA 2P0OA 4LB3A 4I5UA 1NELA 2VX7A 5I02A 1UA3A 1NF0A 2A6LA 2X7WA 3KVKA 2R1KA 1A5LC 4DQWA 2X41A 1TIMA 1MW3A 3GHSA 3BURA 1RJQA 1TE1A 2E0PA 4MWAC 4DEFA 2YBTA 1KFJA 3WEZA 3R8GA 3WUFA 1E15A 3DYMA 1Q5MA 2BOEX 5A1AA 2FFIA 3U5UA 1RAKA 2HBVA 4H7ZA 1ME9A 3IJQA 2BHUA 1J0IA 2QJNA 2HVMA 5HBFA 4L9XA 3AS3A 4JDYA 3LBCA 1KTCA 3ZSTA 4WDWA 2XFRA 3BLEA 1E6NA 1WA3A 1A5SA 1XWYA 4HZ7A 4GBUA 2AAAA 2ZRWA 4HNVA 4HHLA 2Y7EA 3MCMA 3IJ7A 3N19B 4YWSA 2FQIA 3N12A 3GXDA 3LI1A 3SUWA 1Q6CA 4TV6A 1IXQA 2HS8A 4KEMA 1AZ1A 3MWAA 3KW3A 3W24A 4L6DA 3BVJA 2Z28A 3N15A 3C0SA 2X16A 2R14A 4DVOA 4AEFA 1MUWA 1ZTVA 2HVNA 2CLIA 3LENA 1VD6A 3T0TA 3SM0A 2QGYA 1XR2A 3A4WA 3L2MA 1GHSA 4KEUA 4Q7IA 4UQBA 3I4EA 4K1WA 1BWLA 3UG5A 1GJUA 2QCLA 1PZ2A 4GZJA 5B7YA 2PDHA 2ZUVA 2DW7A 1QW8A 4LYRA 1IT7A 3MDWA 5A5WA 3CQHA 3LD5A 1XBYA 2E1WA 5AN7A 1Q6RA 3F4VA 4PMNA 2FVMA 1W9PA 3LERA 1CI1A 4IM4A 3AU6A 4CNNA 3AHYA 3O3RA 2WJEA 4GZIA 1LF1A 3WO8A 1RA0A 3WH6A 3S42A 3TYUA 3EDKA 1HVQA 4FNSA 2DIEA 1ZAJA 2EPLX 2FPTA 3J7HA 1ELSA 4UCFA 5LKYA 5LIUX 3TONA 1V0LA 1UMYA 4EPDC 1W5NA 3WQ4A 5J8LA 3IV8A 4ONVA 3OGSA 3UJRA 2DVXA 3W7KA 5EMKA 1EIXA 1KTNA 5TQLA 2ICSA 2UY5A 3RAOA 1JCTA 1VFUA 3W27A 1R8LA 1O60A 1LQ0A 4KFPA 1B3YA 4ORIA 4JGDA 3NSXA 2WLZA 2PGWA 3P14A 4TMBA 3REQB 3AFBA 1W1YA 3GVRA 5G1MA 3KZSA 4KCVA 4X60A 3ZQ9A 3W3OA 2OSXA 3B9OA 3SURA 4C6BA 4X2RA 4JKKA 4W5UA 1VZWA 5D8WA 3GTXA 3UF9A 4EACA 3CO8A 3R25A 2XIQA 3GNRA 1JUEA 4F48A 1ZCCA 3DBNA 4WRHA 4J2PA 1THFD 2WCSA 4HYVA 5DQPA 2BOGX 4ZB2A 3MSDA 2NX3A 2DY3A 4UNIA 3E74A 3FAWA 4RE3A 3VDHA 1V6VA 2Z1XA 4C1LA 3RR4A 1UWTA 5DBUA 3EWZA 1BSLA 4FNUA 1H49A 3CWOX 3L2IA 4PC8A 5D2WA 3LRKA 4UTWC 3QW3A 2YYTA 4GISA 1J0YA 4CUCA 5ABGA 2NQLA 3AIQA 3UPMA 3NXLA 4H9UA 1PHQA 1H09A 1F8MA 3PUGA 4AY1A 2ONEA 3STGA 4QQUA 3WBAA 1GKPA 1H7WA 2WBGA 4AQLA 1UA7A 4NYUA 3DC8A 4DYEA 1DL3A 5FESA 5FF2A 2Q8XA 3WLHA 4GD0A 2NSXA 2PMQA 1K1DA 4PZVA 4IHCA 1EH9A 2E6FA 3GUWA 1RD6A 4UTIA 1VCGA 3F4WA 4IOTA 3LB0A 4XSLA 3G6MA 3R8RA 3Q58A 1GVIA 3WQCA 5CZJA 1R3TA 1EDQA 1FWFC 2D23A 2V2HA 2O7SA 1AVAA 2IS7A 2G95A 4X0VA 2Q6ZA 2WKGA 4GI9A 1XX1A 4UBPC 1VB9A 2E6DA 4ZO6A 1L9WA 3NO3A 4JCLA 2V3FA 1P1XA 4AWUA 4BF7A 5A8OA 1HKVA 2PPGA 1T40A 4AAJA 1KV8A 1GPFA 2FGZA 3QGAC 1SW3A 3W1TA 3TYAA 3T4CA 2YOCA 4J5NA 5BRQA 4GUJA 3PJXA 2DSUA 1JGMA 1MFUA 2O55A 1UD3A 3TSMA 3STFA 1JZ3A 1V02E 3I6TA 3WL1A 3VXGA 3VIHA 3M5ZA 3PBYA 3H7UA 2PWVA 2V6AA 1O7AA 3TSDA 3L5MA 1EGZA 4KCWA 3FW6A 1N2VA 1N82A 3EXRA 3VCCA 2O9PA 3GH7A 3FN9A 1EC8A 4PTMA 3HA1A 2W9MA 3ARYA 5H91A 1S2AA 3VIKA 4Q32A 3UR5A 3ZLFA 2NQHA 4WD0A 4UFIA 4LOCA 3VE7A 4GABA 1NFBA 1DIKA 4MDPA 2DZBA 1OD0A 3L4YA 3W07A 4UQ9A 3L66A 3AYRA 5EU9A 3FSTA 1SR0A 4ZFCA 2DUZA 5D37A 4GINA 4U5KA 4L4PA 4RPQA 4OBSA 3VK5A 1EO7A 3JU2A 3GW3A 2C13A 3W1UA 3DXIA 3VOHA 1I2PA 4OUIA 1C29A 5DX7A 2OOGA 5FF4A 5CZKA 1UQZA 1LL7A 3PZIA 1KGXA 3SN0A 1KFCA 2VRKA 4H6QA 2KAUC 1FOBA 1ZALA 4WHBA 1TZ9A 2J7CA 1AL7A 3PHAA 1EGMA 3AIEA 3WNPA 4CCEA 4DF2A 1Q6OA 3DGRA 1Z6KA 4GQQA 3APTA 4EX4A 5C55A 4V28A 4Z1DA 1AODA 4MSSA 4NZ1A 2E67A 4D6GA 3OLEA 4US5A 3P84A 4QBXA 4QJ4B 2X40A 1AK5A 3P2VA 1TYGA 1RH9A 3WN6A 3A21A 3MKVA 1J10A 2C19A 3WDPP 3NPXA 3LZ3A 2X30A 1MQRA 4B5UA 3LM7A 4AZIA 4AC1X 3CB3A 1KM5A 3OZOA 1PZ3A 4LAKA 1KM6A 1Z89A 4A3QA 1XC6A 1I0DA 2OSWA 2P88A 2QUVA 4I9JA 4O52A 4TVDA 2GUYA 1UOZA 2Y89A 4GX8A 1V03A 2CESA 1R3SA 1H60A 1W0MA 3P7YA 2CNCA 2VRJA 4I90A 1EOMA 2B81A 2Z6IA 1QRQA 1SO3A 5CPTA 4S3BA 1C90A 5FACA 3OYZA 2CZ5A 3I6EA 4FLRA 1XIIA 1V6WA 2DVTA 3SY1A 3SCUA 2Y88A 1QI2A 1G1YA 2HV5A 3NQEA 3K1GA 3GKFA 1KC7A 1VYPX 3CMFA 1SYTA 4AVOA 1NWRA 4NXSA 3G1XA 3UYCA 4E8DA 1EA9C 3WK1A 1KR1A 1NDYA 4ZXOA 1AZ2A 1H11A 4FX6M 3F03K 3W85A 2NVCA 3EKLA 1KCLA 3S5OA 2G41A 5D2XA 3LCGA 3R43A 4MNJA 5JBEA 1UKTA 2PB1A 6ALDA 1X97A 1OC6A 3SQMA 4CD7A 2XFWA 3PSVA 4NL1A 1FCVA 2VUNA 3B8UA 2OOFA 4GUHA 1EL3A 1CXLA 1N8IA 5CEWA 4WX2A 4KRZA 1K9DA 1YHTA 3APGA 5FSEC 3CPGA 3FV9A 4KWVA 1VJIA 4S23A 1Z9AA 2R6OA 3W1MA 1T96A 3EZ4A 2ZTKA 4KERA 4JNZA 2E5DA 4IMFA 3EYPA 2YYUA 1TIWA 3EBVA 4HA0A 4A8NA 3VD5A 4P7NA 2P10A 4O11A 4C60A 2WHMA 3AIVA 1A47A 2QAFA 2JE8A 1P6BA 2XH0A 1YQ2A 4DO5A 1XYMA 2FYMA 3MQTA 4IPPA 3VE9A 3UWUA 5FJJA 1WDPA 3B8TA 4EF8A 3WLTA 4R9OA 1E56A 1RA5A 5U4NA 3NVDA 2NT0A 5I3GA 1XUUA 1UPMB 2XVNA 3ANVA 4DUOA 1X1NA 1V6XA 5I07A 2V3DA 4YN5A 4QG9A 1CBGA 1RP9A 4K36A 4Q4PA 4EP8C 1PKYA 2HSAA 3LPOA 4UNLA 4ASTA 2QS8A 2OWCA 4DWSB 3W38A 2D20A 4GA8A 3WK0A 4QHRA 3RM4A 3W2UA 1FWAC 3N2OA 1M5WA 4PMQA 4GYKA 1KFLA 3VTRA 4JFWA 4N0RA 1G94A 1V7YA 3DCPA 3VNMA 1GT8A 4M8UA 4OVXA 4C6LA 2OLSA 1W1IE 1WZAA 1IIGA 3RM8A 1W1TA 4NG3A 1B3XA 4JTIA 2ISDA 4IQDA 1XYCA 2DT0A 4S2CA 4EK7A 3G1RA 1ZL1A 4Q6JA 3CHFA 2UBPC 4IPJA 4AVNA 4FI4A 3LBMA 4HA4A 1TA3A 4OQVA 4C7DA 1KGWA 1XLIA 3VPLA 2I16A 4S3DA 4UOZA 1GVQA 1NJJA 2XM1A 1X1ZA 3THAA 3B0XA 4EPKA 4HK7A 4UFMA 2XIOA 2HEJA 4AIUA 4NVTA 4OECA 5A3HA 3DC0A 1C8YA 5E5CA 1TCMA 2FB3A 4OIFA 1Q66A 2XGIA 1B9BA 3BQ6A 3ABZA 2YCIX 3G0SA 3LNMA 3ANYA 3RRXA 3C5QA 4NHVA 3DFTA 1JCNA 2YW4A 5E6ZA 1GQNA 3H21A 1DJHA 3EB2A 3G5EA 3A12A 2NWSA 3GXFA 1IEWA 3ZJ7A 4Q6XA 4EANA 4C6CA 3IARA 1U1HA 3NPVA 1DJWA 5CQ1A 5D04C 3UZZA 1A5UA 1ICQA 3STPA 2L5HA 2RH9A 2KX9A 3T0AA 4IWWA 1VJSA 3B8VA 4PUWA 3S2LA 2WYSA 4UFLA 4A22A 1B4EA 4RXGA 1NY1A 1IYXA 2W0UA 4GFIA 1X38A 2A7NA 1BF6A 4MY1A 3M43A 3F4CA 1CB7B 2FHBA 1JZ8A 1W9DM 4JFUA 4NT0A 4C6NA 7XIMA 5H6HA 1XINA 3TQKA 3V5OA 1RK5A 5HPCA 6TIMA 3GU1A 1E6RA 3N11A 3MMDA 4YTQA 1CGXA 2WC3A 3BTNA 5BWAA 3ARSA 2X1SA 1GYLA 4CD4A 5HWJA 3QEZA 2J7GA 1GQLA 3W72A 2VTFA 3OJGA 4C7FA 3P74A 3I10A 3W7JA 1SW7A 2FVKA 4Q8PA 4QNEA 1EP3A 1XUZA 1XGZA 3ONBA 4P8XA 4J4KA 1I6NA 3SRDA 1RD5A 4IG2B 3HJEA 3NL3A 3S3GA 1F3TA 2XUCA 4E2BA 1BPLB 3A5VA 4C6MA 2GJRA 4DBUA 1M41A 2WZEA 3FVDA 3ATZA 3SBFA 1X7FA 2B7PA 1Q85A 1ZPTA 4YHGA 1CGTA 4PMZA 5AECA 1CXIA 4A2RA 4LCSA 3MVIA 4LAZA 4NNAA 1A53A 1HW6A 4EKJA 1F61A 1VBRA 3IIXA 1DIEA 4IX2A 3IVSA 2A3LA 1P1MA 4O18A 4CN1A 4IISA 1A80A 2E9BA 4E5TA 1G69A 4HNNA 2E77A 4B16A 3W86A 2FZNA 3WF4A 2HRWA 4N9DA 3M9YA 3SCOA 1JNDA 3PBWA 1JZ6A 4ZA0A 4ZO7A 3BGAA 4W9TA 4YNGA 3SGZA 1ODUA 1T8QA 3SIMA 4OBRA 1R2TA 3S5YA 3G1FA 1EJRC 2ATSA 1NVMA 1FDYA 4F2TA 2VX4A 3WD1A 4HPXA 2FPYA 4UR9A 2YX0A 3FYPA 3U2EA 2JIEA 4AFYA 3OEXA 1GYMA 3KWSA 4HA1A 3HPXA 1V3LA 1TQJA 3H6OA 4DWSD 2OWWA 3IS4A 4LJ3A 1BTMA 3LXCA 3T0BA 3HB9A 1ITCA 4D9PA 3LDVA 1IGSA 3QW4B 1TPVA 6CGTA 4IL2A 1E4LA 2VDGA 3DHDA 1QTWA 3TJLA 3CQ0A 3H2NA 4UOJA 2WNQA 4Y9AA 3E1F1 3DYPA 4WGXA 1HL9A 3S46A 4B5SA 3O7UA 4L80A 1OX5A 3FXGA 4HOZA 3WQPA 3V1PA 1PTAA 4LXFA 5F4XA 3P80A 1ZS2A 4H8NA 1FWRA 1S5MA 4EXBA 4HNCA 1UJQA 4LRSA 5BOEA 5D32A 1TRIA 3MS8A 2CC0A 2PP1A 1T41A 1SR9A 3AYTA 4Q4SA 1WKDA 2PP3A 1WX0A 2TSYA 1IWAA 3KOYA 4JQ4A 5HNTA 1R38A 1OFBA 3GNXA 1W32A 3PSWA 5E9AA 4P8VA 3WBYA 5FEZA 3AMCA 1XCFA 3PZUA 1A49A 4CEXC 5T9BG 3W73A 4DXXA 3AJXA 1LOLA 4QJ5B 5FEPA 5D38A 4CNOA 1KO0A 3DENA 3NNTA 4K8HA 1RVGA 5E0KA 4M6UA 2QUTA 4O1DA 4ZO8A 1AQ0A 3PWAA 2FJKA 4HU0A 4MNKA 1PTDA 1G4SA 5L9FA 1PV8A 2WSPA 1LT8A 5G2HA 2OO0A 2YKKA 1R47A 1ISXA 1NOUA 2YDAA 3K4DA 5RUBA 4IPLA 4CN4A 3Q67A 5A6BD 3B9NA 1O12A 1OJXA 3EWUA 4ZOEA 4H04A 3NQVA 4ZZ9A 3BCJA 3NDZA 1SFLA 2QV4A 4J3WA 3WNKA 3UFYA 3MI6A 1MNZA 3T1GA 5LA0A 3E0VA 3N9SA 3ZJKA 4UTTC 3TYCA 1K70A 2FTPA 5BNKA 1K7XA 2ZADA 4JBRA 1CW2A 1HX0A 3TC3A 3O06A 3EX4A 3QVQA 4UXDA 3DKLA 5FJUA 3L4WA 2OLHA 3HGSA 3S2JA 1ISYA 4KW2A 4Q4QA 2LLEA 4AWEA 5K7JA 1O5RA 4DUWA 2GGEA 1TO3A 1TG7A 1R6WA 4MWAD 2Z1WA 3CZJA 4CCZA 6XIMA 2WOQA 5CZSA 3KDOA 5AFDA 4LF2A 3W7CA 3NEHA 3VIPA 1K8XA 3BUVA 3GR7A 3CXOA 2R94A 1D8CA 1UP3A 4Z2HA 4PMOA 4BKNA 4L6OA 1DWHM 1TE6A 4GI8A 4L64A 3S2NA 5ABHA 3CL7A 4PODA 1XLDA 1Q6LA 3W2KA 1UHVA 3EPMA 2EEXA 2VEIA 4IGNA 5DXXA 1VYSX 4DY1A 1O5KA 2REQB 3CTLA 2QCGA 3W28A 3E0LA 4K8GA 1JRCA 3VZXA 1RZMA 2TPSA 5AHLA 3R0KA 4F0SA 2C16A 5E93A 1O5QA 5B7ZA 2WZMA 4ADTA 5TD4A 2WPBA 3ITCA 3AO0A 5DY3A 4EXQA 1HO1A 2CU0A 3M7WA 1VEMA 1QMLA 4OV4A 2QYGA 1UUQA 1EUNA 2PDBA 3O16A 1AMKA 2VDIA 1TPH1 3U0HA 3SSJA 4F0MA 3CAVA 3M0VA 3DN5A 3W7QA 3L4ZA 1JAEA 3UA4A 1SZGA 2EKCA 3L4VA 3QV6A 1O94A 4LX4A 1KM3A 1UP2A 2HZGA 1KRCC 2GJPA 2GLKA 2B7NA 4NZ5A 4Q8WA 4XKYB 4GUFA 3GFYA 4D6CA 1MSSA 1FTXA 1PIFA 4WOZA 1EJVC 1CPUA 1JD7A 1SJBA 2PLKA 3HIJA 2PTYA 4NI3A 3QSTA 2GUBA 1TCDA 2ESCA 2EF9A 1MXSA 3OQEA 3AOFA 4CU7A 3RJYA 1GOQA 4J3ZA 1V3JA 1KLYA 1UWSA 3KVLA 1ODZA 4HVXA 4JXCA 3ZWSA 1ZQ5A 3BANA 2DIKA 4AZHA 4UTMA 1FA2A 1QI0A 5F1VA 3BG3A 1ISWA 1S2UA 2EKGA 4LAUA 1X8FA 1M1BA 2Y8VA 2PZNA 3TR2A 3N2XA 5MKGB 3QY7A 4AEEA 3OYXA 1HP4A 4XZWA 5JUVA 1MRQA 1JZ5A 1B9ZA 3GW0A 4JL1A 3NOYA 3WLOA 3PNUA 2WMIA 2ZKMX 2GL5A 4HCDA 1EO5A 1SJCA 2BY3A 3B4YA 5AHNA 3M47A 4AXNA 2DFAA 2VR4A 4NZJA 3NL5A 3KHJA 2D22A 1KWKA 1NIUA 2WC7A 4FXSA 4JYEA 4YVPA 1NWSA 2J9ZA 4S3KA 3V0SA 1KRBC 3PP7A 1CYGA 1ECEA 2CETA 4HT3A 4QG6A 2QVHA 2NWRA 4M56A 3BAYA 4XVEA 3BMVA 2VOMA 2XZ7A 1HIZA 3GXTA 1J0HA 1EJWC 2XHYA 1YBQB 4K39A 4XKMA 3ZT6A 1SFJA 4D6DA 4F0RA 2O9OA 5A6SA 4ZO9A 1AQFA 3RIKA 2NXIA 2DORA 2XN0A 2WWCA 4ACZA 3AIBA 1V02A 3GM8A 4GLEA 2OVLA 3INPA 2YZRA 5BXTA 3TN3A 4JZ5A 1TV8A 4YU1A 1FCBA 3QC3A 3KLKA 3SZ8A 2GGGA 1AJZA 4QSFA 2V9DA 3T08A 3W7RA 5C6MA 1E0TA 1HJVA 4NJKA 4FXJA 3WNNA 3CJPA 1OBAA 3KAOA 2OZ8A 5LXEA 4BI7A 4W85A 1JZ7A 3AHTA 3OW1A 4F0HA 4RZ6A 1ADSA 4YVXA 2WZIA 3OQ8A 2YW3A 1WOAA 3BL3A 4MNLA 4LVBA 3ZZ1A 3WQOA 1LUCA 4D2JA 2PD9A 1GOKA 2QMKA 2BG5A 1YNQA 4JN7A 3MTWA 2Y24A 3VFLA 1E51A 4LBUA 3UZ5A 3EOUA 1EEXA 2VURA 5KINA 3BLFA 1JXKA 4NJGA 4WJ8A 2WCAA 2P8BA 3T6CA 2AQOA 2F84A 2GOKA 2ZVIA 2YDSA 1H7XA 1P4CA 4DJFC 1M7OA 1FWNA 3BMWA 3MW7A 4Z08A 5EA9A 1K3UA 4CQ9A 4CLMA 1X98A 3CGTA 4JHOA 5HINA 1HUVA 1J18A 1GEHA 2F61A 3G18A 1A0DA 3HFYA 4C6OA 1W9BM 5KZMA 4Q33A 5EMJA 1QHOA 3W53A 3EX2A 4QM1A 4DM2A 2PDYA 3LHWA 4A35A 1F6KA 1M3UA 1XKJA 3LI0A 4H9VA 4XUYA 1P43A 2I17A 4TV5A 3RFAA 3RM9A 3AS1A 2C91A 3W1QA 3NQ7A 4E38A 1A4MA 1QAPA 2J4GA 1EXBA 1T0OA 1XGEA 4KPLA 4AISA 2A6NA 5I00A 2OO6A 2OZ3A 4H9ZA 1ZGDA 4XAZA 5CSSA 4KRUA 4QITA 2HWGA 1MRAA 1J0ZA 3OHIA 2NQ9A 1FWSA 4UTTA 3UXAA 3RJXA 2XISA 5A6TC 3G0UA 5FL1A 2Y62A 1OIFA 3WLKX 5EBUA 2NLYA 4XIMA 3ZJ6A 1W1ZA 4E8CA 2NQJA 2BBFA 3PY2A 5K9DA 3AAMA 3QZAA 1K6WA 1XRSA 1YXDA 1CDGA 3MSGA 4OOZA 1DHKA 1CGUA 2Y8UA 2ZZ6A 3IIPA 2NV9A 3RX4A 3CWNA 1BRLB 2PLJA 2NUXA 3RK8A 3A5FA 4JNMA 3IGXA 1DWAM 4LUYA 4BQ3A 3P62A 1TQXA 1MW0A 1IWBA 3L2LA 3KHDA 4PR4A 1LP6A 3HPSA 5LYRA 1E3XA 3WH8A 3QHNA 5CPMA 1C8VA 3WMLA 1D7FA 4CNPA 4ZMGA 1AW2A 3B8SA 3GXPA 4ICNA 3VIOA 4Q8VA 1ADOA 4C6EA 1KM1A 1LORA 3S6DA 3TW7A 1MDRA 2QJMA 3EGJA 1MQQA 3UETA 3II1A 4MAVA 5GNZA 4J3SA 4ZB5A 5CSRA 2HROA 4UTKA 3N2MA 3L0NA 2C8NA 4LSBA 3CASA 1V5XA 3PS7A 4Q8QA 4UTFA 3B0VC 1R0MA 2C0HA 1CXKA 1XXXA 4Y9OA 2JQXA 1M65A 2EBNA 2CBIA 1NDVA 1KBJA 4ZR8A 3K5XA 3ZSSA 3CT7A 1RXOB 3W76A 1EHAA 1MUCA 2BODX 4QLLA 1K6AA 1PWMA 3BICA 2DZAA 3B97A 3ITOA 1E0VA 1B2YA 3WJWA 1T8XA 4PCNA 2ON3A 4UIOA 4B4HA 1GEQA 5A8MA 4ICCX 2AMXA 4LF1A 1ESWA 1DJQA 1SM9A 2ZRYA 4CVWA 2CZVA 5AYBA 4MB5A 2YCKX 5IDZA 1GHRA 4ZL1A 1XIBA 5LZLA 3M0MA 4IIFA 3M7SA 3W02A 3U2OA 2HCVA 3NIYA 1O5XA 3JR2A 4ZQRA 3L7RA 2OB3A 1D8WA 2RJGA 1I45A 3R10A 1ENUA 5DRIA 4J28A 2ZZ7A 2H3DA 2CHOA 2I9UA 3VNKA 4J2MA 3UESA 3BSMA 1R3RA 2P5NA 3W7DA 1SO4A 1SSDA 3DU0A 3QQ1A 3T78A 3UZJA 1PX3A 1N8WA 4C6PA 4Z2IA 3FGCA 3OVPA 1QASA 1VP5A 1XIMA 3TTOA 4HHPA 2QJIA 2ZXBA 3E2QA 1JCJA 3HPFA 3BV4A 2EAWA 1R3QA 2XSAA 4FX8A 1EKOA 1KFEA 1OHLA 5C9ZA 5HJYA 2A4AA 1US0A 1Q6FA 4B9YA 4F0LA 3H2CA 3SY5A 1D3HA 3UJEA 1XJBA 3E2RA 5D05A 1ITUA 3TUUA 3EWXA 1TB3A 5D03A 3OBKA 3N73A 4P5UA 3F7JA 1XL9A 1XI3A 2WSKA 4QEEA 4AY8A 3SUTA 4HCLA 2W6RA 3UD6A 3D47A 3NDOA 3IJIA 4LRTA 3KOZA 4JTQA 4WQ6A 2ATMA 2CWNA 2I1OA 3T8LA 1JAKA 2E5CA 3LCWA 4NI8A 2EPOA 2WKLA 4GHRA 5JVLA 5DELA 3KXQA 5ABTA 4A05A 4A3UA 3BWWA 4RCXA 2G3NA 2YXGA 2OQHA 2GGIA 5F2IA 3SCPA 3AXXA 3PFRA 3WZ0E 2QLYA 3WDQA 1A0EA 3PPHA 2PS2A 3BOFA 3E96A 1UZDA 1W9VA 3G8EA 4LS2A 2VI0A 2R9RA 3BC9A 3O6CA 3TN4A 2ABAA 4EVZA 3MSYA 3F2DA 5K9XA 5HJXA 5HMEA 5AHMA 3RCYA 2CBJA 4LEQA 1J4EA 3AIUA 3UJFA 2PDUA 2R24A 1HXJA 1B1YA 2XVKA 1V6UA 2VRQA 2BY0A 1XRVA 3UY8A 4LV9A 2R1PA 4MJ2A 3BCDA 3E49A 4MB4A 3C86A 4JHZA 2F7FA 1W54A 3HG3A 3W75A 4IGMA 3EX6A 5D02A 4IL0A 2OMAA 4PMXA 3W7NA 1FUYA 1PJ9A 3I3EA 2VZSA 1XH2A 1IWPA 4WXYA 1GOWA 3LCFA