3TAOA

Structure of mycobacterium tuberculosis triosephosphate isomerase bound to phosphoglycolohydroxamate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
256
structure length
256
Chain Sequence
SRKPLIAGNWKMNLNHYEAIALVQKIAFSLPDKYYDRVDVAVIPPFTDLRSVQTLVDGDKLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAATALKHGLTPIVCIGEHLDVREAGNHVAHNIEQLRGSLAGLLAEQIGSVVIAYEPVWAIGTGRVASAADAQEVCAAIRKELASLASPRIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGGASLDGEHFATLAAIAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of Mycobacterium tuberculosis triosephosphate isomerase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 99
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3taoA00
2GQAA 1J4EA 3GYEA 4WY0F 4Y90A 2WOQA 4E2DA 1GZGA 3W70A 4LUIA 2EF9A 5D04C 3KRZA 2A0NA 1OFAA 5TQLA 2ZRWA 4FNPA 2Q8LA 2RKXA 1TREA 4K8HA 4ZVJA 5C2XA 4QM1A 4IUOA 4O1DA 1DHPA 4ICNA 5F4XA 4PC8A 1IXQA 5AHNA 4P61A 3BLFA 5CPLA 4UTKA 2X1UA 2ZYFA 1WYIA 4IQLA 1BTMA 1ONRA 4UFJA 3TW7A 5I3IA 4MZYA 4ONVA 1W8SA 3STFA 4WX2A 2VFFA 4FHAA 2GQ9A 4MLRA 2V81A 1UUOA 1YXCA 4X9SA 4RR4A 4MUZA 4MVAA 2BXVA 5CKSA 5E1QA 4LRSA 1PVNA 1XBYA 2EKCA 3D0CA 3QMRA 2WSRA 4Y9AA 4LVDA 1WQ5A 4M5PA 3HMJG 1ZAHA 5AOUA 3W74A 3O1NA 2XFWA 4QNWA 2YZRA 1F74A 2A85A 2Y6ZA 2GVGA 3M44A 3O6YX 4MKNA 1X6UA 3W7OA 4DBEA 3LI1A 4TIMA 5HINA 3GIYA 3TROA 1OK4A 1TPH1 1P1XA 5K4XA 2ATSA 3GDLA 2A7RA 3UPBA 2WJZA 3EWZA 3MO7A 4UC5A 2DJLA 1TCDA 3VNDA 3TSBA 4CCEA 1MO0A 4EWND 1L2UA 4K8EA 1FCVA 3L5MA 5D38A 4Z1DA 4E0CA 2E5BA 8TIMA 1H62A 2VOMA 1FWSA 1NF7A 3IIOA 3G3MA 4UFIA 1S5TA 1VJIA 3NPXA 1DV7A 4FNQA 4O1CA 1K7XA 2C19A 3FJLA 1XBXA 4RZ4A 2OCZA 1VZWA 1NEYA 5D2WA 5D02A 2QEZA 2CZEA 2W0UA 5FEPA 2BLEA 3BW4A 3HOJA 3QEZA 3ABRA 5CPMA 3M7WA 1KFLA 3GDKA 3W2NA 3FYOA 5C54A 3Q94A 4L4LA 3WFAA 1EWEA 1O95A 3TQ0A 3P61A 2DZTA 2IQTA 1SPQA 3KAOA 3N19B 3GAKA 3O8AA 3DH7A 2EGZA 1CW2A 3W7QA 3A21A 3N73A 4RV8A 3HGRA 3LCFA 3U2OA 4DF0A 3G3DA 4O1BA 4JYEA 1AW5A 4WOQA 2HTMA 4YCPA 4IOTA 5LGZA 1Q6OA 1K8YA 4L4MA 4H3DA 4KWWA 1DJNA 3NQCA 1LDCA 3P80A 3BG5A 1GYNA 2ZZ5A 4RLIA 4I7VA 2DZUA 3R89A 1L6WA 1FCUA 4LVFA 1YXYA 2RDTA 5HNRA 3P62A 2ZRXA 1TIMA 2X2GA 3C3NA 1VYRA 5LHFA 3IEBA 3HG2A 2I9EA 3UXAA 3ZFHA 2X1TA 1XI3A 1A53A 3M6YA 3B05A 3NQ7A 4ALDA 3NZ1A 3WJZA 3RF9A 3TKFA 1FDJA 2YW4A 5DBUA 3R12A 3QFEA 3LHWA 1LOSA 4LV4A 5D2VA 4BI6A 4OU1A 4AEOA 2Y7GA 3BGJA 4O52A 1G69A 3B0VC 2DZVA 4DO4A 4LS2A 3L0KA 2GOUA 1GVSA 5FEZA 2YDAA 4QIUA 1TQXA 2QDHA 3UWVA 2ZBTA 1OVDA 2C15A 2B7NA 3MP4A 1RPXA 4RZ5A 5K7JA 3KRSA 1SFJA 3ZS4A 5AC6A 3IIZA 3KHJA 1GG0A 1G67A 1W3TA 1HUVA 3FLUA 3MHGA 3LI0A 5LNVA 5IBXC 3H54A 2F84A 2QAPA 4PH6A 2VEKA 1DVJA 4GUFA 4O1AA 3W1LA 3TW6A 4LS0A 3L0GA 1X8FA 3O07A 3TCEA 2ZZ3A 1W56A 5HUPA 1C29A 2TYSA 1H7OA 3HG3A 4PCFA 1FWRA 1ZAJA 3O05A 2X16A 1R46A 4N6EA 4UFLA 3RLUA 1LCOA 3B06A 4IPIA 2G95A 1JRCA 3W76A 5K9XA 3H53A 4AXKA 1M7OA 1FDYA 3LCGA 3SY5A 3IIVA 2EHHA 1XL9A 4BWLA 3QYQA 3F4WA 1PHQA 3WJWA 1XDLA 1R30A 3THAA 3S8HA 5DBTA 5HWJA 5K3VA 3UNDA 1YTEA 4UFHA 1TJPA 4MLJA 3LTSA 3C6CA 2VFDA 1XC4A 4JTHA 5DCBA 3GXTA 2VELA 2QR6A 4JTTA 3DKJA 3VE7A 2E5DA 3CIXA 5I3FA 2QCHA 2FLIA 4O0KA 2DORA 3CQ0A 2W6RA 1KTBA 2YXGA 4N9CA 1I4NA 5HR6A 3DXIA 1H5YA 3M9YA 3NPUA 1YPIA 3HF3A 1AL8A 4JTJA 3EEGA 3CWNA 4CNNA 3DFPA 1W5PA 5FF4A 4K7VA 4N02A 1F7BA 4GWEA 3P67A 4FXRA 3L65A 1SO4A 1KFEA 4UTIA 4DPPA 1OHLA 4KKXA 3UYCA 1I45A 1TV5A 1H63A 2JKEA 3L66A 1IXOA 1D3GA 4LS1A 5DCEA 1SW3A 1PS9A 1TPVA 3DFNA 4JTIA 2H90A 3GNNA 4HSNA 4I9AA 4MYXA 1MEIA 4GFSA 4BWLC 3R8RA 4AWUA 2V5LA 5AHEA 1GVQA 1XUUA 2C3ZA 4IPJA 3LLDA 2JKPA 4ZQPA 4PA8A 3M43A 1OYCA 2Z6JA 3PB0A 3MWAA 5C55A 3MI2A 3RU6A 2CZFA 4ZMGA 3IVUA 4AWSA 4OE7A 1L6YA 1NSJA 5F2GA 1XDMA 1U5JA 1XFBA 3EX3A 4R34A 3NA8A 1K7EA 3TJXA 1JR1A 1K03A 3TJLA 1H7NA 3M5ZA 2GJLA 3PSWA 5AN7A 4A21A 4JTSA 3TH6A 5DLCA 4YMZA 2I1OA 4PODA 3THQA 3O15A 4LY8A 4E38A 3E02A 5J5DA 3T4CA 4NXSA 2J6XA 3A22A 5LGXA 1XBVA 4UTTC 3TC6A 2TMDA 1XBZA 3P7YA 3UWUA 1IXNA 1OYAA 1F05A 1GWJA 3A5FA 1V7YA 3KVMA 1JUKA 1LBLA 2NZLA 1QO5A 4DO5A 5G5IA 1N55A 5A8GA 2TRSA 5DXYA 2NWSA 3TAKA 3B0UX 4O57A 1VHNA 2R8WA 4DF2A 3NQGA 1W5NA 3MW7A 4R53A 1EP1A 3TSDA 5HULA 1L6SA 4FIQA 2QKFA 3PVFA 3KX6A 1SU5A 4LTSA 5LNWA 1FWNA 4DELA 1XUZA 3FJ6A 1OFQA 1OJXA 1AL7A 5KZEA 1F76A 4JGDA 3NL5A 3E0IA 1WXJA 2WV8A 5FEXA 4HT3A 3ABOA 1QPNA 4RXFA 4FO4A 3P5YA 3TNOA 4IXXA 3A24A 1SUXA 4ORIA 4IMGA 3HG4A 4Y6GA 3QZEA 1RQHA 4N9DA 4LC6A 5DY2A 3WJXA 5CPNA 3W7KA 2E6YA 4DQWA 1VCVA 4LVBA 2C16A 1YDVA 1LROA 3C0JA 3O16A 2JKAA 2CFFA 1CI1A 1J2WA 4UTUA 1H50A 1ZALA 3W7LA 5LNRA 5I3HA 3PBYA 1R2RA 2JGQA 1TPDA 1KM5A 2GPTA 2RDWA 4K6AA 4MZ8A 3HGJA 1FWTA 2Y63A 4CNPA 1KM3A 2QCLA 2PCQA 3S0CA 4YL2A 4DO6A 3SW6A 3LHZA 4MIMA 2A6LA 1T0OA 2CW6A 4JN6A 3UWWA 3BK0A 3UY7A 4GUGA 3NQDA 4MY8A 2WNQA 2WKJA 3Q58A 3GR8A 1RR2A 3W2MA 5F4WA 3ZWTA 1YPFA 1S3HA 1LRQA 3S6DA 3U6WA 3NQVA 1H51A 3Q37A 5L6UA 1I8JA 3G0XA 3B4UA 2OT0A 4O14A 1PIIA 1P0KA 2E5CA 5AHIA 1LP6A 2NWRA 3PAJA 1P4CA 3TU9A 1VCFA 3E12A 3FKKA 4Z08A 4QNEA 3W23A 5CSSA 4PL1A 1Z48A 3GKAA 1TTJA 4QISA 4GC4A 1EX5A 2V2CA 4FIRA 5LKYA 2ISSA 2PC4A 5AHMA 4O15A 2YFNA 2FIQA 3S5OA 4CLMA 1EA0A 4YWIA 3W22A 3O6DA 1ICSA 3G8EA 5TIMA 3T40A 3DBPA 5HWMA 1I2RA 5EYWA 1CX9A 3G1SA 2EPHA 3MHFA 4LVGA 4FX8A 3W2LA 3FKRA 2CLLA 3STCA 5KZMA 2CLEA 3G1XA 3LTPA 4N4QA 2GJNA 5F1VA 3B03A 1WA3A 3P82A 1H7WA 1IF2A 1BKSA 3OVRA 4LUJA 1LRNA 1GOXA 4U4MA 3W7HA 1QOPA 1FX6A 4ADTA 2B0MA 4LW7A 2FDSA 3EWYA 1ICQA 3UWQA 2ZZ7A 2A7NA 4NJJA 3DAQA 2ZZ4A 4JXCA 1B3OA 4PFMA 5LHEA 4JEQA 3LV5A 2LLEA 3S5YA 3GLCA 4MOZA 3TMLA 3M5XA 4HNTA 2GVJA 3L5LA 4IWWA 1EUNA 4OV9A 4S2CA 3CIWA 2G96A 3NOEA 1O60A 4O17A 5KTLA 2FFCA 4C1LA 3PUDA 2NX9A 4NJGA 3TXZA 4HNNA 3L2IA 3K30A 4O8RA 2FPYA 4RXGA 3UPWA 1ZHAA 4NVTA 3SSJA 3W1MA 2B7PA 4DEFA 3W1RA 4W9TA 2TPSA 1K8XA 4IJBA 3S1WA 4O10A 2CU0A 5IM51 5K4ZA 4NXKA 5CZJA 1QDSA 1TPB1 6TIMA 4N4PA 3I6RA 1MXSA 5D30A 1BWLA 2H8XA 4UNKA 4JTUA 1AW2A 4RZ6A 5CZTA 1BEUA 3M1ZA 2ISWA 3G18A 2ZRVA 1TV7A 1EP2A 2NUYA 4ZQOA 1RQBA 1K7FA 2NXHA 4M6QA 4WXYA 3NGJA 4GUJA 5D2YA 3W7DA 2DJXA 3BLEA 1HG3A 3U8GA 2ZQ0A 2QJIA 2PRHA 3W88A 4HNUA 2ZZ2A 3DKLA 1LTDA 4RCXA 3MP3A 3CPRA 2NUXA 4LNYA 1G4TA 4ZQNA 4Y8FA 2A1YA 2YYTA 1D9EA 3YPIA 5HR7A 2VEIA 5F1UA 3NVTA 2Y62A 1KM4A 2CLMA 1TPEA 2YCEA 4X3ZA 1MZHA 2R14A 4WQ6A 2WNNA 2FPTA 1GVOA 2E68A 4K7YA 1SSGA 5CZ0A 1K3UA 4TR9A 4MY1A 1DQWA 2H3BA 4JR5A 1LYXA 2QUTA 3OEXA 4POCA 2E77A 4UCGA 3VI2A 4JYFA 1W1ZA 3IIXA 1A5CA 3VFLA 1EPXA 4GUHA 1HTIA 3M16A 3W2KA 3LRMA 4MPQA 1EWDA 1FDZA 4Z0JA 3PB2A 5EMUA 4GBUA 2VEPA 1HFBA 1JQXA 4WY0B 3MI3A 4S1FA 4OT7A 1TQJA 2QCEA 3DFTA 4C1KA 1LLZA 4FX6M 2H8ZA 4JTFA 3N14A 1UBSA 4UTWA 3WK3A 1OFBA 2C6QA 3FYPA 3LXAA 2WNZA 1ZCOA 4N2YA 3NM3A 3TE9A 2B7OA 3M41A 5HMSA 2J9XA 1SW7A 1F6PA 3W7CA 1DORA 1VPXA 1Q6QA 2ZFAA 5K9CA 1TPC1 2WSYA 3W3OA 3HPXA 4UNLA 4MFDA 3G1DA 2BWGA 3G0SA 3MMTA 3R2GA 3EX1A 4ZQMA 1IIGA 2E1DA 1A5SA 4OWGA 3PBVA 2FPVA 3P5ZA 4LC8A 3HGSA 3V75A 4CQAA 1WBJA 3TUUA 2ABAA 3NZRA 5AB3A 1VC4A 1TTQA 4I7WA 2WQPA 2OMAA 5J5RA 5G2HA 3WK2A 5DXXA 3P84A 3W2UA 1ADOA 4M7SA 4IMDA 3ELFA 4QJ1A 1RV8A 5CSRA 1LOLA 1W3IA 4M19A 1JRBA 2QAFA 4XBSA 3JR2A 1SW0A 1SZFA 4JX4A 4XKYA 2UV8G 1VS1A 4HPXA 4ADUA 1QNVA 3PG8A 1OFOA 1JUEA 3W07A 1KFCA 4KFPA 2WO5A 3GXPA 3TIMA 1KLZA 1LOQA 4QITA 3LXBA 5E93A 1ALDA 4IMFA 3W1QA 5K2ZA 4LV9A 2QJGA 1GTEA 4TX9A 5F4SA 3NL3A 3C2FA 4AB4A 1QCWA 1H60A 4Z1AA 3BARA 4O54A 3SJ3A 5D33A 3A9IA 4FB7A 1U83A 3AO0A 1OFRA 3G24A 3T55A 4IGHA 5KMYA 3NQ6A 3W75A 1LORA 3S1UA 3I7QA 2CLFA 3PSVA 2VXNA 2H6RA 2OJPA 1W5QA 3DFSA 4N6FA 1ICPA 5FEWA 5DY3A 2PE4A 1OK6A 4LVAA 5D05A 4UTMA 5BOOA 1WX0A 4CCCA 1QFEA 1MEWA 1OX4A 2V9DA 3G0UA 5EBUA 1VCGA 1FXQA 1LM1A 1KM0A 1WOBA 2BTMA 3RNDA 1SQ7A 3C52A 2BSLA 4K38A 5D03A 3NDOA 3EWUA 2OZ0A 4BFAA 1EIXA 5I3JA 2VEMA 1EP3A 2CLOA 4A2RA 5BMXA 1TRDA 4FNUA 2DZWA 2YYUA 3AJXA 3W7NA 2GVLA 3W7GA 1JVNA 2DP3A 1O94A 3HB9A 5FI8A 3S1VA 1G6CA 2DZPA 3QQ1A 4OV4A 5E0KA 1X7FA 3CLMA 1NVMA 1DBTA 4JICA 1KFKA 3WJSA 1SR9A 4G1KA 4Q32A 4ZQCA 5HQEA 4Y96A 4UTHA 2V2HA 4WD0A 1KW1A 3GAYA 1YADA 1KV5A 2V5BA 2V8ZA 2YSWA 3TA6A 1K02A 2A2IA 2AAMA 4JNMA 3FEMA 3VCRA 3KFTA 1N8FA 3W9ZA 4AHQA 2ALDA 1ZAIA 4UR8A 1JUBA 3NL2A 3S5NA 3B0PA 2CZDA 2VC6A 5EY5A 2G97A 4MZ1A 4MYAA 1Y0EA 1I2PA 1QPRA 5HJLA 1H7RA 2NXGA 1NFBA 4A2SA 2F7FA 3GDRA 2Z2UA 2E6AA 4TMCA 3NQAA 1TPWA 5DCDA 3FS2A 2CZ5A 2OX1A 3KVLA 1F2JA 1I2NA 3GXNA 4AF0B 2V2DA 2VFGA 3W6YA 7TIMA 1PV8A 4JD4A 1E51A 4PEKA 3W1AA 1PE1A 2Y70A 5KINA 3I65A 1L9WA 1VLWA 2Y88A 3IRDA 4GXMA 3W86A 4H4IA 1EB3A 1TJRA 5KZDA 2RFGA 3MBFA 2NXIA 1ZFJA 3GR7A 1DQXA 4AVFA 2O7SA 4RK8A 1RD5A 1KFJA 3PY2A 3UXDA 1O5KA 1PHWA 1RQEA 2DZSA 3W7MA 3G1VA 4ORMA 1OYBA 2O7QA 4UR7A 3S42A 2B4GA 1KM2A 4FNTA 4AMAA 1YTDA 3BW2A 1KFBA 3CTLA 3MBDA 1X1ZA 1I2OA 2HSAA 1H1YA 2PRLA 4LRTA 3DHDA 2ZRYA 4XZ9A 1QR7A 3WJYA 1WBHA 5SWUA 3OIXA 4O13A 1LBMA 3LCWA 4NNBA 2Y7EA 1JULA 2XN0A 4TO8A 4KFOA 1VQTA 4UMCA 3W1UA 3MJYA 4XTDA 4OGZA 3O06A 1IXPA 2P10A 3N34A 2QJHA 3SECA 2YGYA 1R47A 4IX0A 1V5XA 3LCLA 1KLYA 3INPA 1VLIA 1XM3A 1OX4B 5LNSA 3NR0A 1W31A 4R7JA 4JTGA 1WOAA 1EUAA 3LX9A 3PUOA 3S9YA 1B9BA 3SZ8A 3UWZA 2FB2A 1KTNA 1Q6LA 5H91A 3GK0A 1S5VA 5G4WA 4GE8A 3L5AA 1JCJA 1DL3A 5F2MA 2QCMA 2X30A 4UMBA 4JTKA 1TYGA 4A22A 2ZA2A 5FF7A 3EXTA 4Q33A 1XCFA 4YLWA 5G1TA 4XTIA 3LDVA 3ABSA 5MHBA 4GRSA 1H7PA 2W79A 2Z1BA 4EIVA 3T78A 1JQVA 3F1QA 4BK9A 3PF3A 2VFIA 5I3KA 4BF9A 1Q45A 1H7XA 3R13A 3QQ0A 2QDGA 3E96A 3LLFA 4JIQA 3C8FA 2HMCA 3UQNA 4JS3A 1JJKA 3QW4B 1DOSA 4HKPA 1H61A 2Q8ZA 3LHTA 2BZNA 5F2IA 2ZA3A 1ZJIA 1OG0A 2FQIA 4FF7A 1UJPA 2FJKA 3C2RA 1VHCA 5L9FA 3NYZA 3PR2A 1ZNNA 1JCNA 1AW1A 3HO8A 3EX6A 1T96A 1OABA 1R2TA 3G8RA 5U4NA 2A7PA 5CZSA 2P1FA 3N9RA 4AH7A 5KITA 3HGOA 3N3MA 3QMTA 1LLWA 5FF0A 2ZRZA 3IIPA 3QM3A 2C18A 3TQKA 1KV8A 3NNTA 4O4VA 3LRKA 4TMBA 2YFOA 2A6NA 1W3NA 2A21A 1G4SA 4O4WA 1GT8A 3O6CA 1O4UA 5G2WA 3ZWSA 3RMJA 3P74A 1ME9A 3WK0A 4NQ1A 2X1RA 1YXDA 2ZTKA 3HIJA 1T99A 3VE9A 3C4UA 3EXRA 2CLKA 3M5VA 3DENA 3A5VA 1HL2A 1AMKA 4OBTA 5BRBA 1UCWA 6ALDA 4NX5A 1GJPA 3NPVA 2YW3A 1VYPX 2FTPA 1DKWA 1ML1A 3C56A 4WZHA 5LNUA 3NG3A 2J9ZA 1SZEA 3LM7A 4O12A 3MYOA 3QSTA 3RLVA 3LBCA 4UFKA 4WY0A 3W7IA 1QWGA 4UUIA 3LCHA 5EL1A 2I14A 1B4EA 4NJKA 2Q3OA 3LBMA 3M5YA 1LBFA 1RZMA 1IIHA 3L68A 4XUGA 2A4AA 1FWWA 3OA3A 1QOQA 2QCFA 3RK8A 4O0ZA 1G7VA 1Q6RA 4NX0A 3HJZA 3W2JA 1A5AA 3MHUA 2E6DA 1GQNA 4UXDA 5I3GA 1W5MA 2ZDRA 4PTNA 3QH2A 1H1ZA 2ZZ1A 1FUYA 5CPOA 4AAJA 1GVFA 5C5YA 1JCLA 1PL9A 2WPBA 3NL6A 4NUWA 4BI7A 2ATMA 2ZTJA 5D32A 2C14A 4GJ1A 1XXXA 3NO5A 3SGUA 4CNOA 1Q3NA 3EWXA 3HQ1A 3ATYA 3W72A 2ZA1A 5A5WA 4GUIA 1OFDA 4AHOA 4DF1A 3EKLA 4M6VA 3PM6A 4O11A 2JBMA 4UTLA 1AK5A 2X1SA 3QRHA 3UY8A 1A5BA 4IXHA 5AYXA 4FNRA 5DN1A 1S5WA 4EOUA 1QAPA 5AHLA 2VFEA 4Q4KA 3EWWA 2V30A 3TFCA 1FY6A 2QF7A 2Z6IA 1FQ0A 2XN1A 1GVRA 2YPIA 1PCKA 3HPSA 3PG9A 4IX2A 3NQEA 3IV3A 4MJZA 1VR6A 1SO5A 1UASA 4Z1BA 3HPZA 5AYZA 3BG3A 1QMLA 3FIGA 3E9AA 3STEA 2JK2A 3CEPA 3RFAA 3PBUA 3I68A 3NQ2A 2ZCGA 1TPFA 3QJAA 5LZLA 5EPDA 1W37A 1M7PA 4O28A 3IVSA 1P5BA 3BW3A 1KA9F 3LCXA 4HIBA 5T26A 3CU2A 3BGGA 1O5XA 3F4NA 5FF3A 2DZXA 1MSSA 4LT9A 1TB3A 3GB6A 2ABBA 4B5NA 1EEPA 5D2TA 5KSWA 1KTCA 4YCOA 2R94A 3PWAA 1UUMA 4R33A 3QPYA 1OX5A 3LGEA 2NLIA 3M47A 2PRMA 2WSQA 4M6PA 2G5WA 3W71A 2VKZG 1PCWA 4O50A 4DPQA 4EF8A 5H2ZA 3OHIA 4UTJA 3IVTA 3L67A 4WXZA 2E09A 3W7EA 1IGSA 3DGRA 3V1PA 4UTWC 1FCBA 5LSMA 1YYAA 1SFLA 3DU0A 4U28A 2VFHA 4HNVA 3W1XA 3CWOX 1M5WA 4HSOA 3EX4A 4FNSA 5D09A 1WAUA 4FXSA 3DFQA 5U7SA 3W7PA 5EKYA 3TXVA 5K9DA 1Z42A 1ME7A 2Y89A 3MI6A 3SGZA 4X2RA 5GVJA 1TPUA 1B4KA 4NZJA 2RH9A 1GTHA 3O63A 3LTYA 4UTTA 1LRTA 3EX2A 4JY8A 1W5OA 4JYDA 3EKZA 2H3DA 2NUWA 5ABTA 3IGXA 3GX9A 4ZQRA 3BV4A 5F2LA 3EB2A 3TK7A 2FB3A 3CT7A 2NX3A 3C2VA 3QC3A 3DI1A 3W83A 5FF2A 3JS3A 5AC8A 2CLIA 3SR7A 3GDTA 5CGQA 3ZR4A 4Z1CA 1VRDA 3CC1A 4NT0A 1AG1O 2J88A 1DJQA 4JX6A 3G1FA 3QSRA 3GVGA 5BMWA 3LV6A 3PC0A 3C2OA 3UWYA 1YDOA 3TQVA 4UIOA 4UFMA 3G1YA 3SFKA 3PULA 3UZ5A 3UZJA 4LU0A 3NQ8A 3W87A 2R91A 1OX6A 4ML9A 1W54A 2QCDB 3TV8A 3TAOA 1NAL1 3R5EA 1OFEA 3BPWA 4IMEA 4IMCA 4AF0A 2KZHA 3B8DA 1GG1A 1P0NA 1GEQA 3VKJA 2HS6A 3GKFA 3IGSA 5G1YA 3FA5A 3OVPA 3TMQA 1ZY9A 1GPWA 3TSMA 4KFNA 1R2SA 1VGAA 3KVKA 4QSHA 1HO1A 2V82A 2RDUA 3P8JA 3P81A 2QCDA 1QO2A 4JIPA 4FX7A 4LOCA 4RX0A 5BW6A 4O53A 3GZ3A 3HG5A 3QW3A 5G4EA 4O16A 3EWBX 2PURA 4MY9A 5AC7A 1W0MA 5AHFA 2J24A 2GQ8A 1M6JA 2QCCA 2Y61A 5EA9A 3ABQA 2D73A 5CG7A 3UD6A 1B57A 3QPZA 2Y7DA 4LWWA 1Z41A 4RJEA 1Z44A 4FEZA 4XKYB 4WUIA 2ZZ6A 3DFOA 1VYSX 1I2QA 1J5TA 1JCXA 3M0ZA 5C6MA 3PUEA 3N2MA 4JTLA 5BNKA 4N9BA 3BG9A 3C2EA 3W1TA 2QCGA 4RKAA 2C1HA 1TO3A 2QUUA 3GDMA 5HUOA 3DI0A 3LERA 5TBOA 3OVQA 4A29A 3L9CA 3KOFA 4I7UA 4CQ8A 3KRUA 4MJMA 3MP5A 2JGYA 3ANYA 4HPJA 2J9YA 1WV2A 1HO4A 1TRIA 4M7TA 2C0AA 4NNCA 2A5HA 4N9EA 1KM6A 5FESA 3P8IA 2BX7A 4XWUA 1SO6A 3B04A 2NX1A 1SSDA 4HN4A 4QQ3A 3SIZA 2QCNA 2Y85A 4CCDA 3F03K 1QPOA 3ATZA 2VENA 4TU1A 4H6KA 5IBXA 1THFD 2HS8A 1MEHA 5AFDA 4O18A 4PL2A 4K39A 4KWVA 3BLIA 4NJIA 4ZL1A 3H55A 5D37A 3G22A 2AGKA 2E6FA 1FCQA 5DELA 1NF0A 4D2JA 4ZZ9A 4AWTA 4DXVA 3L0NA 3T7VA 3W1NA 1F5ZA 3FOKA 4JDBA 4AHPA 3W73A 3L21A 3LHVA 1VH7A 4EVZA 3BO9A 3KVJA 1JCYA 3GNDA 1SZGA 1KBJA 4NU7A 2YR1A 4A3UA 1RVGA 2AQWA 3I7SA 1G4EA 2P0OA 4WOZA 4P2VA 4JX5A 5AYYA 4NJHA 1F73A 3S1XA 3G1HA 3LXCA 4X22A 3DHFA 3QF0A 2J27A 4JDYA 2NV1A 2TSYA 1C9DA 1YTKA 2CLHA 3EXSA 4YXGA 5HWNA 4EF9A 2EAWA 4JY9A 2GUUA 1FXPA 3A23A 3FFSA 4DBDA 4NNAA 1OFPA 2V0TA 3NEVA 2RHGA 4K37A 3W85A 2Z0IA 1D3HA 3SI9A 1C8VA 1K8ZA 3CM4A 3QMSA 2B7QA 3G1AA 1OF8A 3OG3A 3W1PA 2XN2A 1BWKA 1F6KA 3CHVA 1JCMP 1OF6A 2NV2A 2C13A 4O19A 4GNJA 1YLVA 3CB8A 3WK1A 4BI5A 4BR1A 5D2XA 4CQ9A 3IGUA 3OBKA 3PS7A 1FBAA 1TV8A 4NZFA 1G7UA 1LZOA 1UB3A 2CWNA 1SO3A 3W84A 3LHUA 3BVJA 3MUXA 3USBA 1TTIA 3LCIA 1X1OA 3MYPA 2DU2A 3NXFA 1SZNA 3C61A 3S5ZA 1TSIA 4OQVA 4K36A 4MFEA 4JTEA 3LHYA 2Q3RA 1G4PA 1A50A 2OT1A 3TC7A 1GYLA 3TFXA 3JRKA 2ISVA 4OHQA 1TTPA 3N9SA 4S2BA 4E2BA 4Z0SA 3NM1A 3CEUA 3STGA 1XKYA 1TMHA 2Y7FA 4ADSA 3T44A 4WJEA 3P60A 3LB0A 1T8XA 3TDFA 4XBKA 3W7RA 3LOTA 5G2IA 2ZRUA 2QUVA 3NAVA 4J9JA 1N7KA 3NQMA 3E49A 3TX9A 2YX0A 3LRLA 3PBWA 1ZENA 1QPQA 1WDWA 4HHPA 4QAIA 3W7JA 3DZ1A 1YDNA 4XQ6A 1KM1A 3I7RA 3NQFA 3TR2A 1KBIA 1ME8A 3Q2DA 3HBLA 3N2XA 4UMAA 3KXQA 3NPWA
chains in the Genus database with same CATH superfamily
1P0BA 3PZNA 4V2XA 5I2UA 5TQLA 2RKXA 1ISXA 1TREA 1L6FA 3AI0A 4QM1A 1DHPA 4PC8A 5AHNA 3BLFA 1FKWA 5CPLA 3SCRA 1IQ8A 1W17A 4HTBA 1BTMA 3DECA 3TW7A 2IXUA 5I3IA 1W8SA 3STFA 5AZ0A 2VFFA 2PA6A 4FHAA 4QCEA 4MLRA 1QTWA 4P5UA 1UUOA 4GNKB 3MUY1 4HA3A 4MUZA 4AG0A 4INFA 2BXVA 2ZX9A 4LVDA 3IJLA 1TA3B 4JKKA 3LLXA 3HMJG 1ZAHA 3W74A 3AZTA 3U57A 1JXKA 4YN5A 1XLGA 1F74A 2OYLA 2A85A 2Q6ZA 3Q65A 3O6YX 2BXYA 4DBEA 3DDMA 1WB0A 3LI1A 4HP5A 4TIMA 1XLAA 4AX6A 3BAXA 3WD3A 2HVNA 3GRIA 2WJZA 1XINA 5E9XA 1S2AA 5T91A 3TN6A 4P7OA 2DJLA 3TSBA 4PULA 4E3VA 1E4NA 1FCVA 1RJPA 3J7HA 3S2LA 1ESWA 8TIMA 2VOMA 1KXTA 4GJIA 4UFIA 1S5TA 3O3RA 1VJIA 5CJ5A 4HK6A 2Y8VA 4MWAC 2YLLA 1S2CA 2C19A 1XBXA 1Q7QA 2OCZA 4LAOA 4TQTA 2DT0A 2QEZA 1U1JA 2W0UA 5FEPA 1A5OC 3QEZA 2FVLA 5LIYX 5CPMA 3IJDA 3GDKA 4U33A 3FYOA 5C8BB 1O95A 5HATA 4R7OA 3GAKA 2EGZA 2QT3A 1CW2A 3SUVA 1H1NA 2Q8XA 2ASHA 3CYVA 3A21A 3WLOA 3LUTA 4ZB2A 3AZSA 4WSJA 3U2OA 1QHZA 1HKJA 1XPGA 2X2YA 4GQQA 1AW5A 3GTXA 2EXOA 4JIEA 1T41A 3E5BA 1K8YA 4H3DA 2BASA 1J6PA 3C8NA 4HN8A 2DZUA 3R89A 1L6WA 2OYKA 2RDTA 1R6WA 1DXFA 2ZUUA 1TIMA 2X2GA 1VYRA 1R38A 2CYGA 5LHFA 4MWAA 3IJ8A 1G9HA 1A53A 3M6YA 2EPOA 1RHCA 3NQ7A 3NZ1A 2YW4A 1M1BA 1LOSA 4LV4A 2VX7A 3F7JA 3TOPA 1J12A 5AC5A 1OGSA 5AZ1A 4LS2A 4XUYA 3ARVA 3BMVA 3RAOA 1DJWA 2NSOA 4I9MA 1RPXA 4NIRA 3CV2A 3ORWA 1UR8A 4EPBC 1OM0A 3NO3A 3ZS4A 1D8CA 1ISWA 3ZQ9A 4DHGA 2VR5A 3EWDA 3CHFA 2QAPA 5C9XA 3AUJA 4V1XA 4PMOA 1GOOA 1UH3A 3L0GA 4KGJA 4H8UA 3GG7A 5E9AA 3B97A 3VOFA 3BSGA 3TCEA 2ZZ3A 2VZSA 4WCJA 5HUPA 3ERPA 1J6OA 1P7TB 3HG3A 4GY7A 1FWRA 4S3FA 3OLEA 1OGGA 3RLUA 4IPIA 2W62A 2OQLA 3W76A 4C1NB 4ZXLA 4AXKA 2NQ5A 1JDFA 1FDYA 4ZSUA 2CERA 4JTCA 1CXEA 3WF0A 3UA3A 3IIVA 3WQCA 3SCVA 4OOZA 2D22A 3GE7A 1WDSA 2DIJA 4IFOA 4UFHA 3QY6A 1DWAM 5EMKA 4H8HA 1PKMA 2VFDA 4JTHA 2DSUA 2AL1A 5DCBA 2VELA 1UWRA 3PZGA 3VE7A 2E5DA 1UR4A 2QCHA 2P8BA 1E9YB 2DORA 2W6RA 4GZIA 3DXIA 1R85A 3EEGA 3MANA 2VC9A 1F7BA 2PWEA 3WEZA 9CGTA 2ZUWA 1AH0A 1Z8AA 4DPPA 4HK7A 4L7ZA 3CMJA 1I45A 1MXDA 1TV5A 4A8NA 4XZLX 2EG7A 3L66A 1IXOA 3V0UA 5I23A 1TPVA 3DFNA 2H90A 4JTDA 1MEIA 4GFSA 4Q8MA 4RDYA 3R8RA 4AWUA 1R86A 2I17A 5AHEA 1GVQA 2DT3A 1RLCL 3QQWA 4L6HA 3OODA 4ZB5A 1HJSA 4MHBA 4HNCA 4PCNA 1XLLA 2WWDA 4J27A 3IVUA 3Q67A 4OE7A 1L6YA 5C9UA 1NSJA 4R34A 4AD1A 2ALRA 1K03A 3E74A 3HFTA 3R0UA 3M5ZA 1OADA 4EKJA 5A6LA 2UY5A 3PSWA 3UJEA 1EYWA 4YMZA 2I1OA 4B5XA 2JE8A 4PODA 3THQA 4IIFA 2Z1SA 1EA9C 3ZR5A 3GQYA 2WM1A 1ONEA 4HK5A 1J93A 2QPXA 2D2GA 3N2CA 1C7TA 4JCLA 1QNRA 3OBAA 1CGXA 1OYAA 3LNMA 1GWJA 3KVMA 2WLYA 1E6QM 1B90A 4Q8OA 4IJCA 1ZZMA 4J4KA 1QO5A 4DO5A 3G6MA 2I5QA 4GKLA 1U33A 3P6LA 2TRSA 4L1GA 1JYXA 2XSXA 4I8YA 3UNTA 1VHNA 3PZVA 3GU1A 3U7BA 1HIZA 1E1EA 5HULA 2QKFA 3BOLA 5LNWA 4N42A 3FJ6A 1OFQA 3MA8A 4L4OA 2HBVA 4DI9A 1LT7A 3E0IA 1JEZA 4XD3A 3QLDA 2VDGA 4CEUC 4HT3A 2DZAA 3TNOA 3A24A 1OT2A 4IMGA 3HG4A 1MFVA 4AZ5A 4K1WA 4N9DA 2VUYA 4IZGA 3T42A 3W7KA 5M2FX 3A47A 4F2TA 1XIGA 1PWLA 2JKAA 1ZRQA 2Z1XA 3W7LA 1RJRA 1R2RA 4XAFA 4M1RA 3NZPA 3UJRA 3D3FA 3RDKA 3NCOA 3REQB 1OWQA 3I4EA 2Z29A 4CNPA 1UWQA 5LA1A 4D6HA 4UQ9A 3WBXA 4IP7A 3L12A 4JN6A 4MY8A 2R1MA 2WNQA 2BOFX 3W2MA 5CBJA 3ZWTA 4QLLA 4J2PA 1YPFA 2R1LA 4ATLA 3G0XA 3B4UA 1ZU8A 2OT0A 3OIHA 4GVFA 5AHIA 3E1F1 4DVOA 1F3TA 2V6AA 1FP8A 1P4CA 3TU9A 3E12A 3FKKA 4Z08A 2V3EA 1GGOA 4AD2A 3VM5A 4IIBA 4WHBA 4TVDA 1TTJA 4QISA 5XIAA 3KWXA 2V2CA 3AFBA 4QLKA 3AHZA 1Y5VA 2ISSA 2PC4A 5AHMA 4CLMA 1G01A 1TKKA 1GCYA 3W22A 3O6DA 3G8EA 4IG2A 2EG6A 2EPHA 2GVEA 4IPNB 3QY7A 3W2LA 3KRBA 2XVNA 3MMWA 4GQ0A 5KZMA 2PU0A 2WVVA 4N4QA 1JIBA 5D9MA 4KIRA 4LUJA 1GOXA 4U4MA 2PCEA 4RZBA 1O7AA 3R10A 3HJEA 1XQKA 3UWQA 3DAQA 4MGGA 1H0IA 4JXCA 3VFCA 3VUSA 3WQVA 4JFWA 4FAMA 2PF8A 3CAVA 3H2OA 1TFVA 5CC6A 3PJUA 1BGAA 4AW7A 1LWIA 1B30A 4O8AA 3TXZA 2FPYA 3UPWA 3ZOAA 3IAPA 2TPSA 1K8XA 1UQYA 4Y9MA 4KT2A 5CZJA 6TIMA 4GOAA 3APTA 1BWLA 4JTUA 1PKLA 4S3EA 3NYDA 3M0HA 4JNZA 3K8KA 3M1ZA 1NP0A 5C9RA 4ZQOA 3U9IA 4FXJA 1XRFA 3E3HA 3NDZA 3LS9A 2PRHA 4HNUA 4RCXA 3F2BA 1QW9A 5HNTA 1W1VA 2NUXA 2AMGA 4LNYA 2J78A 4WGXA 1XYBA 4LB4A 2YYTA 3N17A 3GHUA 3UVAA 1ZBKA 1ZL1A 1VPQA 3DC0A 2HXTA 1OZMA 5TAOA 1YHTA 2Y24A 1MZHA 2WNNA 2FGLA 1C3FA 4LSBA 4WK9A 4I5RA 1GVOA 1QBBA 4K7YA 1BVNP 1TVPA 3WD2A 2QUMA 1DQWA 2H3BA 2QUTA 2INFA 1HKWA 4NI8A 4UCGA 4CN6A 4JYFA 4FI4A 1E70M 3MWCA 1A5CA 4LF1A 3TTYA 1R9XA 3IPWA 1EPXA 1JDDA 3NFUA 4J3VA 1VIZA 3AXHA 4HOWA 4MPQA 4DJDA 2E40A 4GI6A 5EMUA 2VEPA 1EJTC 5A8QA 4AD3A 3EB4A 4GYPA 4WY0B 5G4HC 1X8CA 1P6CA 4NL1A 1IWBA 4FX6M 1M03A 4JTFA 1KNWA 1M41A 5A2BA 4ZEPA 3HFYA 3LXAA 2WNZA 4GXWA 2ZX5A 3BLLA 3NM3A 4QGCA 3DUGA 1NDYA 1UH4A 3NIYA 3W7CA 3D47A 1DORA 4BHYA 1TPC1 2WSYA 3HPXA 3G1DA 2BWGA 3G0SA 2CIPA 6TAAA 1IIGA 3C86A 4L9YA 1WO2A 1A5SA 4OWGA 4IFRA 5A95A 1AH3A 3HGSA 1C90A 1E0XA 4KCTA 2J4GA 2ABAA 2R82A 4E8DA 2WQPA 2OMAA 1KXHA 2PDKA 3V36A 3WK2A 2BOEX 5CJMA 3T09A 4IMDA 3H4XA 2BFGA 1E0VA 5CZKA 2Y8UA 4CQBA 1LOLA 3ZZ1A 3EDFA 2PSNA 5E5CA 2WAGA 1JD9A 1SW0A 2WVVB 4HPXA 4ADUA 1QNVA 3PG8A 3W07A 1CLKA 1KLZA 3SM0A 5F4SA 1IWPA 3NL3A 4AB4A 5A6BD 1LL7A 1H60A 3ZT6A 1OFRA 5HMDA 2XPKA 3PZTA 3CH9A 2FMNA 3G24A 4B4FA 2Y8KA 4OTKA 4IGHA 2YXXA 2QZRA 2QUNA 3OVGA 5A6SA 2H6RA 1F8IA 6XIAA 4LVAA 4UTMA 1QFEA 1MEWA 1FKXA 3G0UA 1RD6A 3ENLA 1UD4A 4HU0A 5EFDA 3ZYZA 2BMBA 5ABFB 4PSPA 2ZADA 1KM0A 4KBXA 3V4BA 4LNCA 3NSXA 3RNDA 4YJ5A 2BSLA 5HMEA 1DTUA 1BAGA 2VEMA 2VWTA 2XWDA 1U1HA 2DZWA 3AJXA 3W7NA 2YL8A 2DP3A 2MNRA 1XLDA 4PR4A 3WNLA 4BY3A 3CLMA 4US5D 1BYCA 1DBTA 4XIMA 3WJSA 1SR9A 1V3KA 3UP8A 1TMLA 3CPUA 4ZQCA 1KQZA 5HQEA 3MV01 4UTHA 1OBAA 3L2LA 2YXOA 2VGBA 4WD0A 2R1PA 2PDXA 2V5BA 1GOWA 1K02A 2A2IA 3F4VA 4X2PA 3VCRA 3KFTA 1N8FA 1GJWA 1RY0A 1OC7A 4Q8WA 3AHVA 5MKGA 1ENUA 2AKZA 2CZDA 4LY4A 1B31A 3UG3A 3GM8A 4OJYA 2RGLA 1KCLA 4PUJA 1NFBA 3MJMA 4L1XA 3ZLGA 3IWPA 4A2SA 2FH6A 2Z2UA 3IACA 2E6AA 2D0HA 4TMCA 3NQAA 3VD9A 3GY1A 1HKVA 1J96A 3E2QA 5EB8A 2OG9A 1WZAA 4UTFA 3FS2A 3GHTA 2CZ5A 2OX1A 3HN3A 3KVLA 4ZENA 3VIFA 4ZGYA 3GXNA 5FSDC 3W6YA 3MKCA 4EXBA 4GGHA 1KCZA 3PPFA 4JD4A 1XV8A 2Y70A 3CGTA 1QHOA 4H4IA 1EB3A 2PWHA 2RFGA 4E6MA 1ZFJA 3LBOA 1O5KA 5B7YA 1PHWA 3T0DA 4QEHA 3EDKA 4ORMA 2W3ZA 4Q4OA 1E56A 4UR7A 3TZNA 2BVDA 3MBDA 4JPGA 4F40A 1X1ZA 2XIBA 2HSAA 2PRLA 1WP6A 2ZRYA 2FH8A 2D20A 3OIXA 3A13A 3GZAA 4TX6A 4TO8A 4KFOA 1NOUA 2XH7A 5LXXA 3WF2A 2BHUA 5CPTA 4OGZA 1IYXA 1V0KA 2MUCA 2P88A 5A6JA 2YGYA 1R47A 1FHDA 1J2BA 4ZSTA 3NOYA 3INPA 4H6RA 4AFYA 3CHCA 1W31A 1XR2A 3ARTA 4R7JA 4A8RA 1EUAA 4WGHA 4OUIA 2PLJA 1RH9A 2YLAA 4IHCA 3W29A 3WDQA 1DL3A 3VOGA 3I3BA 1PZ1A 3GG0A 1JZ5A 1MW0A 2X30A 1WDPA 1TYGA 1UROA 2ZA2A 2D2HA 4Y8EA 3LDVA 5MHBA 1FHVA 4JFVA 1JQVA 4IIHA 2IQ0A 5I3KA 5GNZA 4BF9A 3HPFA 1N82A 1PX3A 3R13A 2QDGA 3UQNA 2ESCA 1UPMB 4IPLA 3TCSA 3EAUA 3QW4B 2PLMA 3WUGA 3PK7A 1H61A 2Q8ZA 3LHTA 2YOCA 1MDRA 2VL4A 1ZJIA 4QFUA 3D5HA 2XZ7A 1OSEA 3PR2A 1ZNNA 1JCNA 3BSHA 3CYJA 2HVMA 1NJJA 3OGVA 1T96A 2AMXA 1CXHA 3V35A 2A7PA 3QMTA 4Z42C 3IGHX 3TLLA 3IIPA 5IFPA 4C6DA 3TQKA 3NNTA 4O4VA 3BURA 1CZ1A 2JF6A 5GQBA 4MDOA 2YFOA 1V6WA 2A6NA 3V18A 4C6CA 2A21A 4XD4A 5CC5A 3L4ZA 3RMJA 3P74A 1HKIA 1F6YA 3QVQA 2V68A 1YXDA 3HIJA 1T99A 3VE9A 3EXRA 1EDTA 5JBDA 4IMAA 4LUTA 3GD6A 4BCEA 1ML1A 5JBEA 4WZHA 3SUWA 4O12A 4LQ1A 3UCQA 5I03A 4UFKA 2WANA 2VVSA 4Q7IA 2J47A 3LBMA 3M5YA 1MVYA 1E0WA 3L68A 2A4AA 3OA3A 3WIJA 3VC5A 2QCFA 1VEMA 4O0ZA 4NX0A 4H00A 2WHMA 1PIGA 4UXDA 3UXIA 3M4HA 1EXBA 3QH2A 5JIWA 4YYFA 3OJGA 5C5YA 1EJRC 5EFFA 4PBFA 4BI7A 2ATMA 5EMLA 3TC3A 2WC4A 2C8NA 2WMGA 3XISA 1XXXA 3CT2A 3TP4A 3PPGA 2FJUB 1G5AA 4YU1A 3GUGA 2ZA1A 3RLHA 1OFDA 4AHOA 2HE8A 3BAWA 5AYXA 2Y5SA 3CQIA 3UXLA 1O12A 3LPFA 2Y5EA 2V30A 3OTRA 4OVXA 2Z6IA 1XLJA 4CNTA 3GTIA 1UKTA 3HPSA 4DZ5A 3JW7A 1NOWA 5LXEA 1SO5A 5AYZA 2Z1KA 4MB4A 3VOHA 4C1NA 5EPDA 4O28A 2ODOA 3LCXA 3CU2A 1PTDA 4L1WA 1O5XA 1XX1A 2P53A 1MSSA 4LT9A 3WLPA 1TB3A 3AIUA 2HCVA 4MWAB 4AZHA 2J8FA 3PP7A 3ZR6A 1F9CA 2DQWA 2PS2A 1IHIA 4JIHA 4YCOA 4DZHA 4EACA 3DIPA 6CGTA 1OX5A 3UEQA 4KQNA 1BD0A 2Z7KA 1Q8JA 3A12A 3W71A 1BYAA 2IXVA 1PCWA 3T81A 3K46A 4EF8A 1U5HA 2CKSA 4WXZA 4QTGA 4J3TA 1CCWB 1IGSA 3DGRA 1MW1A 4W86A 2CHOA 1UBPC 1SFLA 4U28A 2VFHA 3H26A 3W1XA 3S2MA 4XX6A 3CWOX 1M5WA 1QI2A 1WAUA 2R24A 4AZ7A 3DFQA 1LUCB 4HCDA 2IQDA 5K9DA 4I3GA 5D9OA 3SGZA 5GVJA 3AU2A 3MC5A 4XZHA 2XWEA 1DIKA 4B16A 1W3KA 3O0KA 5ABTA 3MMDA 1NQKA 4DUWA 4HVXA 2G50A 1O5RA 3KDNA 3CT7A 3C2VA 4F0RA 1Z6KA 3JS3A 3ARXA 3OG2A 1I9CB 2CLIA 1ZUAX 5CGQA 3ZR4A 1AVAA 4R9XA 4NT0A 2QV5A 3G1FA 2VZTA 4ILSA 3BICA 3GVGA 3WH8A 4NZ3A 2OKTA 1M3UA 3TQVA 3NDYA 4UFMA 2XIJA 1J18A 1W91A 3O0FA 4W7WA 1Q2SA 2VR4A 3NQ8A 3URBA 1OD0A 4HNLA 1CBGA 1GOMA 4ML9A 2ZUMA 4D9PA 1W54A 1YBQA 4DI8A 3R5EA 4I90A 4IMEA 4AF0A 4MNJA 2KZHA 1PDYA 2PTWA 1EIBA 1RY8A 4D72A 1P0NA 3IGSA 2HDJA 3TMQA 1ZY9A 2HNHA 4HMDA 5I77A 3RGTA 1HO1A 4HPNA 1H0GA 2V82A 3CK5A 3LYEA 1MRAA 1QO2A 4RX0A 4LOCA 4O53A 2OEMA 3QW3A 3SURA 3L23A 2FZDA 5CPQA 1G1YA 4XZBA 3ARQA 3F5KA 2OZ3A 2GQ8A 1WXZA 5B80A 4W87A 4WSKA 2CWXA 2D73A 1HKMA 4LWWA 1JAKA 1YW1A 4FEZA 4XKYB 3PTQA 3WD4A 1XRSA 1VYSX 1I2QA 3ITXA 1JCXA 5DRIA 3C0SA 5BNKA 3BG9A 4GI8A 4PUNA 4RKAA 1XIBA 3EOOA 5HUOA 1PPIA 3LERA 4ZR8A 3WG6A 5BZAA 1XYCA 3TYAA 3ITLA 7A3HA 2HPMA 1OD8A 2XIMA 3L4TA 4K8GA 4HPJA 1V6TA 1EDGA 2GFTA 1TRIA 4PMZA 2GWNA 3ZVHA 1KM6A 2POTA 3H4GA 4UB9A 1O1ZA 2NX1A 4HN4A 1OC5A 4S3CA 3F03K 3ATZA 3K13A 4XIAA 2HS8A 2XJ7A 2GJRA 1H4PA 4J3XA 3AIRA 1Y5WA 4O18A 4PL2A 3T8LA 4W8BA 2FVKA 2E28A 3H55A 3K4DA 3G22A 2AGKA 3KTCA 1NF0A 4ZZ9A 1K8CA 2RDXA 3KBJA 5BU9A 3FOKA 4JDBA 4YTRA 3W73A 3L21A 4EVZA 1IT8A 1JCYA 3GNDA 1EGZA 2GGIA 9XIAA 1P7TA 3SCQA 4A3UA 1RVGA 3FXGA 1G4EA 5AYYA 4ENLA 1F73A 4XKMA 4EPEC 3LXCA 4X22A 3DHFA 4NAEA 4MKSA 5ABHA 4JQAA 3ARZA 3EXSA 2AL2B 4EF9A 3BZGA 2GUUA 2AOSA 1D7KA 1W1YA 4CEXC 4NNAA 2DSVA 3E2SA 5HQMA 1Q66A 3BWWA 3WLKX 3QV9A 1XICA 4KESA 4B92A 1Z9AA 3W1PA 4AIOA 1WKYA 2XN2A 2VR2A 4DLFA 1OF6A 3E0WA 4O19A 4RPQA 1YLVA 4BR1A 4WJ8A 3PTMA 4ZOBA 3S2JA 3OBKA 1FBAA 1LZOA 1UB3A 1VPYA 4GACA 1L0PA 3ID7A 3BVJA 2IPWA 3MUXA 3LCIA 3EZ4A 3C61A 3VVGA 4K36A 4MFEA 3EWCA 2O4QA 3LHYA 2GDUA 2BV9A 2Q3RA 1TZ9A 1A50A 2OT1A 2HK0A 1C8XA 3TFXA 4JBRA 2NVAA 3TWAA 2FDMA 2UWFA 3CV1A 1TTPA 1K1DA 3N9SA 3VO0A 4E2BA 4Q4QA 3KZPA 3QHOA 3VD3A 3NM1A 1JZ8A 3STGA 1E72M 2Y7FA 3ZVHB 4C5ZA 2CXEA 2JALA 4AC7C 3T2PA 1EHAA 1T8XA 1KKOA 3TDFA 3W7RA 3RO8A 4GZ7A 1WXYA 3IUIA 3ITYA 3VNIA 5DF0A 1YEYA 3GC2A 4ML4A 3E49A 3UG4A 1SFSA 2R1NA 1PWMA 4HHPA 3DZ1A 4LBRA 1CENA 4XQ6A 4A8IA 4C6FA 1XGZA 1PYFA 1BF6A 1VENA 3HBLA 3SO7A 2BB0A 2GQAA 1J4EA 2V3GA 3HTWA 3GYEA 1XIFA 3SBFA 2WOQA 4HNOA 4XAZA 1H11A 3KDOA 4LUIA 1EXPA 2A0NA 1J0IA 1OFAA 2XM1A 2DEPA 4FNPA 3GNRA 4K8HA 3EPNA 5C2XA 4ICNA 1WPCA 4KWOA 2ZYFA 1WYIA 4UFJA 4MZYA 1OZQA 4ONVA 1PAMA 3GXDA 3T8QA 2PGWA 3FAXA 4RR4A 1XH2A 3R0KA 5BWAA 1L8NA 4C6PA 1PVNA 5JU6A 3JU2A 3PWIA 2EKCA 3VNMA 3QMRA 4Y9AA 1A3HA 4FP1A 3SCPA 3P2VA 2PGEA 4XB3A 1BQCA 4YIWA 5TNVA 5CSUA 2QXWA 4QNWA 2YB4A 1FHUA 2Y6ZA 3AOFA 1W3JA 1X6UA 4DJFC 3WLIA 3BQ6A 3TROA 1OK4A 1P1XA 3GDLA 4DUOA 2FZMA 2EJ1A 1MO0A 2VEFA 4EWND 1K9EA 3AMGA 5D38A 4I6KA 4E0CA 1V3MA 4F8XA 1JI1A 4UOQA 4Q8UA 1JYWA 1NF7A 4C6OA 4MM1A 1K70A 4IUGA 2CC0A 1DV7A 2DT1A 1XYFA 1K7XA 3N2BA 5DT7A 4XD5A 4NAFB 1YDYA 4WF7A 3TYDA 4HB7A 4C7FA 4XD6A 4DB7A 2BLEA 3BW4A 3ABRA 3M0JA 1BVWA 3W2NA 3WSUA 4R9OA 1EWEA 3TQ0A 2O9RA 1UZ4A 2PDBA 1V02A 2IQTA 4Q3MA 3M0LA 3N19B 2TAAA 1ELSA 2WMIA 3O8AA 4TVCA 3W7QA 2PP1A 4NAFA 3ARWA 3HGRA 2W66A 2CZVA 5D8ZA 1ISVA 4G7FA 4JYEA 3S2CA 4PRWA 1JGIA 2HTMA 1Y65A 5LGZA 4US5A 1Q2RA 4ERAA 3ZLHA 1AQ0A 4KWWA 4GY1A 3NQCA 3P80A 3BG5A 2ZZ5A 3GFZA 4I7VA 4P8XA 4REQA 1M7JA 3ZT5A 4BS0A 4XAPA 2G41A 1FCUA 3KS5A 5JQ9A 5JH1A 3IEBA 4Z1YA 5E0FA 3HG2A 1JF5A 3WQEA 4PMNA 2YJQA 1BYBA 2FZ9A 4ALDA 6XIMA 3TKFA 1FDJA 3R12A 4MF4A 5D2VA 2DIKA 4BI6A 3KHDA 5BOFA 4OU1A 4AEOA 2Y7GA 3AQUA 3MS8A 3B0VC 4DO4A 2GOUA 1BXNA 5JIPA 2RJHA 2YDAA 2G3FA 2CHNA 1OVDA 2C15A 4PTXA 1RP9A 3MP4A 4RZ5A 2F9RA 2E9BA 3KP0A 3LA4A 2J8TA 4L9ZA 5C2CA 4CD4A 4LX4A 4E4PA 5AC6A 4GPNA 1GG0A 4IPPA 1W3TA 3MHGA 3LPGA 5IBXC 3H54A 2F84A 3WDPP 2VEKA 1DVJA 3U0HA 3KEHA 4QHRA 4GUFA 4ZB0A 3W1LA 4LS0A 4AYGA 2VOTA 1XDJA 3B40A 5FJRA 3O07A 3MKKA 3KLLA 4OECA 2DSWA 3LGGA 4HCHA 1C29A 2RAGA 1Q4WA 1C91A 4QG9A 4DWSC 3O05A 1LWJA 1E4MM 4KCWA 4N6EA 1HX0A 1R5YA 3B06A 1E3XA 2IKGA 4GYJA 1O68A 4G7EB 4W5UA 1CPUA 4W7UA 1XIEA 3IJ7A 1VFHA 4AY1A 1FP9A 1M7OA 3A4AA 1YKWA 4MB5A 2VD8A 4Q6JA 4C6BA 3F4WA 4B9ZA 2VO5A 2Z26A 4A3QA 3WJWA 1R30A 3THAA 5HWJA 2B31A 3VZXA 1TJPA 3VIIA 3UW6A 1R9ZA 4HOZA 3AS1A 5IDZA 2UY2A 2FFIA 1RK6A 4HD5A 2V69A 2FLIA 3GU9A 4O0KA 3LZ5A 2PI6A 4RL3A 1RALA 1I4NA 1H5YA 1YPIA 1B3ZA 3HF3A 5LIUX 1AL8A 3EMCA 4QE1A 2BBFA 5FF4A 4GBDA 4N02A 3T2QA 3BQ5A 3L65A 4QXIA 4UTIA 1E1CA 4EXQA 1KWKA 1OHLA 4B9YA 3UYCA 4ZOAA 3ABXA 5HJXA 2QVHA 2JKEA 1UD3A 2A3HA 1SW3A 4MPKA 4PUKA 3GNNA 1Q8AA 4MYXA 5EGRA 3K4AA 1PTAA 3VIOA 1C7SA 4IPJA 4JTAA 1QT1A 1CIUA 1I0BA 2HROA 3H2EA 1CXKA 1YRRA 2JKPA 4L80A 5J04A 1S1PA 4LF2A 1A5MC 3MI2A 3WDIA 1J01A 2CZFA 4YYCA 2WJDA 4JCMA 1XFBA 4MTVA 3SADA 3MT1A 3TJXA 5DMYA 1H7NA 2GOKA 4HHMA 1J79A 4C90A 2GLKA 1N8IA 3O15A 4E38A 5I02A 5J5DA 4NXSA 4MDPA 2J6XA 2I5GA 5LGXA 1XH1A 3EMQA 3VD7A 1XBVA 1S2UA 3TC6A 4F9DA 1PTGA 2X41A 3P7YA 3ZT7A 5CC7A 4JOMA 1F05A 4L61A 4KEZA 2INEA 3MPGA 3V3WA 2RUSA 2NZLA 1KC7A 4TUFA 1D3CA 3UXKA 3H7UA 3LENA 5A3HA 2PP0A 5G5IA 3L4UA 1XRTA 1J5SA 3WLNA 2J75A 5DXYA 2NWSA 3BTNA 2FGBA 2ZXDA 3NQGA 4D6FA 3N9KA 2J7HA 2ZX6A 3KX6A 1FWNA 1E0UA 3W6LA 3WYZA 3KOXA 2IPJA 1F76A 4JGDA 2E4TA 1I1XA 4ZCWA 2WV8A 5FEXA 3ABOA 1QPNA 3MO4A 4RXFA 1ZP3A 4ZOCA 2PDJA 3DYOA 4IXXA 4Y6GA 3QZEA 5DY2A 3WJXA 3CMFA 5CPNA 4D6DA 4GLEA 1YDVA 5CPSA 1HGWA 3O16A 2WVTA 4AC1X 1UOZA 1S38A 2ZKMX 1XG3A 2BS9A 4UTUA 1ZALA 5I3HA 4DRSA 2PC8A 2JGQA 4BQ5A 2FKPA 1EJVC 1KRMA 1UZDA 1KM5A 2GPTA 4DZAA 4MZ8A 3USZA 4EXAA 4M29A 4WVXA 2FYMA 4GNVA 1AD4A 4PMVA 1P6BA 2XG9A 1BGGA 4DJED 3N6JA 2A6LA 2QNEA 3BK0A 3QXBA 3UY7A 2YA1A 2OX4A 2Y4SA 3MCMA 3GU2A 3GR8A 2F2KA 4Q8TA 2NT0A 5CEWA 5L6UA 2VJXA 1S2VA 3ZMRA 4GIYA 3VCCA 1PIIA 4U5IA 1UYQA 3V1HA 5REQA 5HNUA 4QNEA 4AVNA 4GFIA 3VUPA 1YBQB 3PZOA 3DC8A 3GKAA 4P7RA 3W53A 2ZOXA 5LKYA 2YL6A 5C7HA 1TV2A 3S5OA 3B8TA 1EA0A 3GH4A 3KBSA 3ZJ8A 2GDVA 1Q6DA 3T40A 4F0SA 2F6KA 2TODA 1E4LA 5EYWA 5A2AA 4G1NA 4EANA 3MHFA 4LVGA 4QDMA 4FX8A 1DP0A 3UG5A 3VU2A 1V6UA 2CLLA 1UWIA 1OCBA 4R85A 3DX5A 4QJ5B 3B03A 1BFNA 2HNEA 3ZSSA 4PUDA 3OVRA 1QOPA 3VIMA 2B0MA 2CEQA 4IP5A 4KCUA 1I1WA 4NILA 3IS4A 3OLDA 4KEUA 1R7OA 3KL0A 3K8LA 1DE5A 3LV5A 4G56A 2PD5A 4HQVA 3FGCB 1L8PA 1R3WA 2CBUA 4MOZA 1F3XA 4HNTA 2W67A 2VEGA 3KOZA 1FWGC 2ADAA 3AXXA 4XSMA 4O17A 1O60A 2FFCA 4C1LA 2ZUNA 3PUDA 1L2QA 1XLEA 3L2IA 3K30A 4NVTA 4DEFA 2B7PA 6REQA 3W1RA 1QW8A 1R87A 3LSCA 2EO7A 4IJBA 2W27A 1HP5A 3TR9A 5IM51 1S39A 3R11A 5CQ1A 1QDSA 1EEXA 4N4PA 3I6RA 1MXSA 1O1HA 3IJQA 5D30A 2H8XA 1R9YA 4L5ZA 2YCIX 3GVVA 1GZJA 4Z2LA 5CZTA 1BEUA 2ZRVA 5HANA 1K7FA 1TWWA 3CAQA 3NGJA 2YCLB 5D2YA 3MQTA 2NQHA 1Q6EA 3U8GA 2D3LA 5FKYA 3DKLA 4FLOA 4C5YA 2CITA 1ZP4A 4ZQNA 5RUBA 1GHSA 4ZTXA 5HR7A 5ABFA 4MWAE 2Y62A 1KM4A 5HJYA 3QR1A 2FPTA 1RLDA 4Z2JA 5CZ0A 4TR9A 1J0ZA 1ZBVA 5FJTA 2E77A 2Y5JA 1W1ZA 3H21A 3B8VA 2GYIA 7REQA 4ZTYA 1Q4NX 4AISA 5H1WA 4GBUA 1ZS2A 5HK4A 5FCZA 1EDQA 7ENLA 1HJXA 1KR1A 3DFTA 1LLZA 4ZO8A 2H8ZA 3CTTA 2EG8A 4DAFA 1UBSA 1C9WA 1F8MA 4UQAA 3T6CA 2C6QA 3FYPA 1ZCOA 4N2YA 3S47A 4YVPA 3GIQA 4BEQA 3AU6A 1W1IE 1S46A 3M41A 3AMKA 3GR4A 4FALA 4Q7BA 4D6EA 3CAWA 5C9ZA 1JPDX 1PZ0A 2ZFAA 3WDJA 1X6NA 3R2GA 1OQFA 1IV8A 4Z2IA 2A3LA 1HL8A 1B0IA 4GX9A 4CNSA 3PBVA 1QWKA 1R3QA 3P5ZA 1E9IA 1ZGDA 3V75A 2BY3A 3TUUA 5FJJA 5J5RA 5G2HA 5DXXA 3W25A 3K4WA 1GKPA 3COTA 1ITXA 3T9PA 4G7EA 4DWDA 2E67A 3WKZA 4IL2A 3AYSA 2QAFA 1TJ1A 5H8UA 3WMSA 1SZFA 1BG9A 4XKYA 1VS1A 4GG9A 1JUEA 1KFCA 2YCLA 1ONWA 2GWGA 3NWRA 1ZJAA 1ALDA 3R6IA 3W1QA 5K2ZA 4LV9A 2QJGA 1GTEA 3ZLFA 3KTSA 4Q22A 2D0GA 3BARA 3SJ3A 4C65A 3A9IA 1U83A 3AO0A 1WDRA 1KKRA 1CB2A 5KMYA 4HYVA 1NY1A 4H2CA 4OBSA 3H8AA 4V28A 3S1UA 3I7QA 2VXNA 3CPGA 4GIAA 3DFSA 3F2DA 5FEWA 3U2EA 4H1ZA 3R1ZA 5D05A 4ECLA 1EGVA 7XIMA 5EBUA 3SEPA 3SN0A 1VCGA 1LM1A 1GW1A 4HHLA 2DSZA 2BTMA 2OQHA 3EYPA 3ITCA 1RBOB 3DYMA 3GYCA 4G9PA 4QRNA 5I3JA 4H9VA 4QS6A 3PBGA 1C92A 1ZTVA 3FJNA 4ZO6A 3THDA 2UZ9A 3TTOA 3GNXA 1CXIA 1TRDA 4FNUA 2GVLA 4W88A 3RJYA 4LAZA 1JVNA 1O94A 1V3HA 3S1VA 5AECA 4F0KA 1BPLB 3P3BA 1G6CA 3QQ1A 4KF1A 3RPTA 2W5FA 4ZBCA 1J10A 1UD6A 1KFKA 3MY9A 4G1KA 2GGJA 4Q32A 4YWSA 3NSMA 1XD1A 4X60A 2V2HA 3VGEA 1AZ2A 3VNJA 3WLSA 3AS3A 3GAYA 1V3LA 1W9XA 2V8ZA 5HPOA 2GGEA 3FEMA 2VQUA 4L56A 3S2NA 1JUBA 4UWMA 1VJZA 2VC6A 2G97A 4MZ1A 1PZ2A 1Y0EA 4D1JA 4AZGA 5HJLA 1UR0A 4WDWA 2OGYA 1TE1A 1O5QA 5FJUA 2WMIB 1EC8A 4FOJA 3NJ3A 1GQKA 3RX2A 2E25A 2D23A 4H8NA 4XZIA 3RCMA 4AF0B 5CG0A 2OFJA 2OGJA 4N7QA 5B7ZA 4IQJA 7TIMA 3AIBA 5F7UA 1PV8A 1E51A 2IKHA 2WZEA 4DJDD 3UZYA 2Y88A 4PB3A 3BOFA 3RM9A 2EEXA 2BG5A 3A4JA 4M80A 4FS9A 3GR7A 1RD5A 2GSJA 3HQNA 3PY2A 2UY3A 3RPMA 1W2VA 2O7QA 3W82A 4AMAA 3WLQA 4AX7A 3WMBA 1R3YA 2OZTA 3SRKA 3TJIA 2ZXAA 1E15A 2R1KA 1I2OA 4XZ9A 2I16A 3H2FA 3AXKA 4B3ZA 3SQMA 3NEHA 3OLIA 3LCWA 4NNBA 4LAMA 5GNYA 1J0KA 4MKVA 4UMCA 3W1UA 3DG3A 3R58A 4JN7A 3UT0A 5JVLA 3O06A 1A5KC 1IXPA 3D6NA 3N34A 2QJHA 3WZ0E 1GQJA 3MZ2A 3DHPA 4IX0A 1V5XA 3LCLA 3HZ3A 4HTYA 2INZA 1OX4B 5LNSA 4WDTA 1S5NA 4F2BA 3PUOA 3M0YA 4QEEA 4AYSA 3ZVIA 1XLIA 2FB2A 1TJ2A 3CXOA 2VRQA 3GK0A 1PEZA 4GE8A 1JCJA 3RN6A 2OLHA 3JZUA 2QJJA 4JTKA 1T6MA 5G1TA 4XTIA 4DXXA 3ABSA 4GRSA 5C2GA 5IFTA 2OPJA 2Z1BA 4EIVA 4ZFCA 4BK9A 3PF3A 2VFIA 2VQTA 3WF4A 2D0FA 2VRKA 1BWVA 1SR0A 4FLSA 1X7IA 4WDUA 4X9YA 3TN5A 2P8CA 1B9ZA 3ISIX 3ARRA 2BZNA 3FVDA 2FQIA 5CLTA 2FJKA 5L9FA 1KCXA 3M0VA 4BZYA 1V93A 3QR3A 2G3JA 3EX6A 5G1MA 3KCJA 5C71A 1OABA 4YPJA 2PTZA 3RCNA 5CZSA 2P1FA 1GNXA 3N3MA 1QJWA 5FF0A 3KOWA 4R5EA 3QM3A 4GVHA 4RNHA 1GUVA 5LA2A 4ZODA 3VK5A 3LRKA 4GX8A 1W3NA 2RJGA 3VINA 1TG7A 1Y5XA 4S3DA 3ZWSA 2PB1A 3NURA 3UJSA 3WK0A 1G94A 4WKFA 2J25A 3ITGA 1GVYA 2J8GA 2X1RA 2ZTKA 3ES8A 3MUZ1 4IGMA 3M5VA 4YNGA 3DENA 1JL8A 2XFRA 4Y9PA 3A6OA 3WUFA 5M1TA 6ALDA 1QXLA 2QIIA 4NX5A 2DUXA 4PGLA 2YW3A 1VYPX 2FTPA 1DKWA 1OT1A 3WBEA 3N2OA 1SZEA 3MYOA 3N6QA 3GO2A 3W7IA 2DH2A 1TV4A 1QWGA 3OO2A 3LCHA 2AL2A 2GDQA 1B4EA 1RUSA 1LBFA 1RZMA 1TV3A 4GVIA 1FWWA 1XIHA 7CGTA 2VGFA 3S83A 1XQLA 3HJZA 4DAIA 3W2JA 1XYLA 3MTWA 5H6HA 1V0NA 2ZDRA 4LUYA 5I3GA 4BQ3A 1GW9A 4JIRA 1H1ZA 2ZZ1A 4Z2GA 2XTKA 1GVFA 2FTWA 3IJIA 1JCLA 3L4VA 3NL6A 2QGHA 2YA2A 5T8GA 2ZTJA 3R79A 3N6HA 2C14A 4GJ1A 1DIDA 3M7SA 3WH7A 4H41A 1VAHA 3NO5A 3SGUA 3N15A 4CNOA 1TVNA 3CV7A 4NP7A 3ANUA 3W72A 2ZC1A 5A5WA 1V6VA 2OO0A 3MSDA 3PM6A 4O11A 3QRHA 1E71M 2O9OA 1A5BA 4IXHA 5DN1A 4FNRA 2O55A 1BXCA 1S5WA 4EOUA 3QGKC 1QAPA 1ZJBA 1PSCA 2HBXA 4Q4KA 4F79A 1TWIA 3KL5A 1UP0A 4E3TA 4FR1A 3TFCA 2QF7A 1GVRA 2ACRA 3CZKA 4AEEA 2NQ9A 4IX2A 5A6AA 3NQEA 3VX0A 1KCKA 4Z1BA 1ADSA 3DFHA 3TJ4A 1WAWA 5CBIA 3FIGA 3E9AA 3STEA 2JK2A 3CEPA 1JZ7A 1KRCC 4K2SA 1MRQA 1FA2A 3I68A 3N25A 1IT0A 2ZXBA 4JZ5A 2V3FA 4HU3A 4REQB 1IWAA 3MSYA 3BW3A 4HIBA 1UKOA 3F4NA 1K77A 4TX8A 1VBGA 2E8ZA 1WUEA 3GB6A 5GJNA 1RA5A 1GQIA 2ABBA 2FZNA 1EEPA 4GVGA 3BLKA 4GINA 4R33A 4PTWA 1XP3A 4CD8A 1R8LA 3QZ6A 2NLIA 4BEUA 2X7VA 4LANA 2WSQA 4M6PA 2BODX 4EPDC 3PPHA 4XG1A 3FX4A 2X0HA 5H2ZA 3OHIA 1BRLB 3PZQA 3HU7A 4KIEA 3IVTA 2NLYA 1XHGA 3AJ7A 1QI4A 5LSMA 1JPKA 2JF7A 4NG3A 3OQ8A 3DU0A 4HNVA 1HVXA 1G0CA 2L5HA 1MWOA 4U2ZA 4FNSA 1NU5A 4FXFA 4WEVX 3JZEA 5U7SA 2Z1WA 4B5UA 1JZ3A 2E9LA 1Z42A 2XGBA 4X2RA 3ITTA 1TPUA 1V51A 4NZJA 2QVNA 1CNVA 5EMMA 1W5OA 3MCOA 2NUWA 1WKEA 5EMYA 3GX9A 3UGRA 4ZQRA 3BV4A 3EB2A 2FB3A 3QC3A 2BGNE 3W83A 2DUAA 1Y8BA 4KEVA 1VIWA 1JD7A 2D1ZA 1VRDA 1UA3A 4AZ6A 1M04A 3CC1A 4GK8A 1V6YA 2V5KA 4QSFA 1V03A 3M46A 4F0MA 1QNPA 3PC0A 3C2OA 3UWYA 4DBSA 2Y0FA 1IR2A 3G1YA 3RIKA 3SFKA 3M0IA 4M81A 3RR1A 2PDQA 1MUCA 1NM9A 3W87A 3WQ5A 4GQGA 4CD7A 1UZHA 1ITCA 1HL9A 3TAOA 1OFEA 3BPWA 3I3EA 4IGNA 4EWJA 4Q8PA 4C6NA 3KUMA 4H7VA 4LYQA 2PWFA 3FV9A 3AIWA 1DPMA 3N29A 2HS6A 3GKFA 5G1YA 6ENLA 2QQ6A 4QQUA 3KCOA 4W5ZA 2OYMA 4QSHA 1TUFA 3P8JA 3P81A 2QCDA 4FX7A 3AISA 1UHVA 4HZ7A 3EMZA 1VB9A 4AD5A 4O16A 1GORA 4HHHA 1E9ZB 1ISZA 1QVBA 4O0QA 5GNXA 4HOXA 3ABQA 3H4WA 5CG7A 2PFHA 3UD6A 2V63A 3W02A 1Z41A 4WUIA 1J5TA 3PUEA 3N2MA 4JTLA 3QPEA 3DFYA 3VKKA 2SFPA 3BJFA 1UZ1A 2QCGA 1K4HA 1TO3A 3GDMA 5TBOA 4A29A 4GI4A 4I7UA 3KRUA 3B4YA 4AY7A 3MP5A 3ANYA 3AIQA 1WV2A 4TTUA 1HO4A 4M7TA 3F4DA 2C0AA 5M03A 4JL1A 5FESA 3VOJA 3BAJA 4EK7A 3PTDA 5FA5A 2BX7A 2QIWA 2KAUC 4I5UA 3GS6A 1MI3A 2PDGA 2QCNA 2VENA 4TU1A 4C6EA 1GVEA 1MEHA 3TQPA 3NSNA 5M17A 3GVRA 3PUGA 4D6GA 2VX6A 2OODA 5A6KA 1LLOA 3V5CA 5D37A 4MNKA 1ECEA 4RV3A 3L0NA 2YDSA 1F5ZA 4AHPA 3LHVA 1VH7A 3PJTA 4V1YA 1R0MA 3KVJA 2WHKA 1SZGA 5A1AA 1T40A 4HJWA 1W9BM 4PN2A 2YR1A 3PNZA 4WOZA 2P0OA 3VDCA 1DJHA 1X97A 1XFCA 3OYZA 5CGTA 5BROA 5BXTA 3OLGA 4I5XA 1C93A 1KGUA 1Q85A 2WVSA 3P93A 2F6UA 1C9DA 4AQLA 2NW0A 4YXGA 1KBBA 2XHYA 2EAWA 1UQZA 4JY9A 4DBDA 1XWYA 2V0TA 3NEVA 1QI3A 2W61A 3SQSA 3XINA 3CM4A 2B7QA 3G1AA 4MB3A 1J0YA 2WJFA 3VGHA 2HPIA 3JVAA 1BWKA 3CHVA 4MJ2A 2D2JA 2QJMA 1JCMP 2NQJA 2C13A 2BNJA 1ZPTA 1AQHA 4F66A 3BJSA 3W01A 3CB8A 4J40A 1FWEC 5D2XA 3VAVA 4CQ9A 3IGUA 3KL3A 3OP2A 4JTRA 1G7UA 2PPGA 3M6DA 2CWNA 1SO3A 2BVTA 3USBA 4Q8QA 3BSMA 1FH7A 2HV5A 3PZMA 4H9UA 1B54A 2DU2A 2WSKA 2WVUA 4Q7NA 3AXMA 1MDLA 1EF3A 3TN4A 3DCPA 1U1UA 3AS2A 1G4PA 3B9EA 3TZFA 4WIWA 3VXGA 3JRKA 5C7VA 4OHQA 3V7PA 4Z0SA 3CJPA 1YNYA 3T44A 5HQLA 4OZOA 3E5PA 4OKDA 1SZRA 4KERA 2Z7GA 3LOTA 1GYMA 3ONCA 5A69A 4KPLA 3RM4A 1ODZA 4PMXA 3CL7A 1N7KA 3NQMA 1EC7A 4NAEB 3UA4A 4D6CA 3MB9A 1EJSC 3PHAA 1ZSXA 4PTMA 1U2YA 3W7JA 3PAOA 5AY7A 1JAEA 1OCJA 1RK5A 1AJZA 2CNCA 1A47A 2VMFA 3T0CA 3FSTA 1GKQA 1RCXB 2NT1A 1UUQA 3FHAA 3B9OA 3PZUA 5KEZA 4E2DA 1W9PA 1JPHA 1DJYA 1GZGA 3W70A 5D04C 2EF9A 3KRZA 5AC4A 2W91A 3A3XA 4ZVJA 4IUOA 4O1DA 2C7FA 3N4EA 4UTKA 3AXIA 2X1UA 3E2RA 1ONRA 2Q09A 3GC4A 4IIEA 4WX2A 4WKAA 4RNFA 4CQCA 4X9SA 2VCCA 4P7QA 3QV8A 2G3MA 5CKSA 1XD0A 4LRSA 1XBYA 1XLMA 4IFKB 3D0CA 4UZUA 4WR3A 1E5JA 2HVOA 5AOUA 1BHGA 3WQ8A 3G6LA 3ZXWA 2G4FA 2YZRA 1CXFA 2O92A 3RU8X 3M44A 3KOYA 3W7OA 2YL9A 3SSZA 3LZ3A 3P0WA 5HINA 3GIYA 1TPH1 3WQDA 2ATSA 4PMJA 2G3IA 3UPBA 4AU0A 3EWZA 1K9TA 4UC5A 4DWSD 4B4HA 1JDEA 3E38A 4JFUA 1L2UA 2B81A 4K8EA 3TNBA 3L5MA 4Z1DA 1RA0A 2E5BA 2O56A 1JPMA 4D1IA 1H62A 3HQOA 3IIOA 4JEJA 3G3MA 3NPXA 4O1CA 2QDDA 2FTYA 2C1GA 4L64A 3SUUA 1DWGM 4CU8A 5D2WA 5D02A 1EO5A 3HOJA 1WKDA 2PGRA 3V0TA 1SM9A 3WD0A 5C54A 3PJXA 3Q94A 5HXMA 3WFAA 4PCPA 4LUTB 1XLKA 4H19A 3P61A 2DZTA 2J7EA 4DBWA 4GI9A 2ZWYA 1SPQA 3KAOA 2IW0A 3EDJA 1EPVA 1HJWA 1R3RA 1JYVA 4H83A 3LCFA 1JNDA 3BGAA 4JNYA 5BXRA 3CZGA 4DF0A 1Q7ZA 3G3DA 4B15A 3CUIA 1FWHC 3G5EA 4L4MA 2F8QA 1DJNA 1A0DA 4RLIA 2VP8A 2E1WA 3MMUA 4DLMA 1YXYA 5HNRA 3P62A 5LYRA 2ZRXA 3VMOA 2QS8A 1QNOA 2ON3A 2OLSA 4MB1A 3UXAA 3QTPA 3ZFHA 4A6GA 3SRFA 3VDBA 4H9TA 3B05A 4W84A 3WQFA 3RF9A 3TA9A 3QFEA 1N2VA 2PODA 2E9MA 4CVWA 1RSCA 4H01A 1BSIA 1G69A 1FVPA 1XIIA 4NYYA 3L0KA 1GVSA 1C8QA 4QIUA 2QDHA 3UWVA 7ODCA 3L4WA 1KBKA 2JIEA 2EKGA 3WQ4A 2OOFA 1JF6A 2VTFA 4PUMA 2WWCA 5DX7A 4OIFA 3OYXA 4M6UA 1SFJA 2CETA 3IIZA 1MQPA 3KHJA 1JGMA 1G67A 4PMQA 3FLUA 5LNVA 4JKLA 1US0A 3WMCA 4Q4MA 3VD4A 4PH6A 4J3UA 1EOKA 1VBHA 4OFCA 3NVDA 3F4CA 1EC9A 4O1AA 4A3HA 3TW6A 3RG6A 4KWUA 4E8GA 4Q4PA 1EZ2A 1TMQA 2PWDA 3R94A 3BDKA 3H2CA 4U31A 1W56A 2ZUVA 5DANA 1EJ7L 3UR5A 1E0TA 1NFGA 2J7BA 3RHGA 1WCGA 4A3RA 3LCGA 2XISA 2EHHA 1XGEA 1VFTA 1XL9A 1E6NA 4BWLA 3QYQA 4J28A 3U5YA 1MUMA 4J3WA 1PHQA 4W7VA 4H7ZA 5DBTA 1E43A 3HMCA 1KB3A 1H2JA 1KD0A 1AFSA 3LTSA 2G37A 1CECA 3GXTA 4TOQA 2QR6A 4JTTA 1B1YA 5I3FA 2CBIA 1GJUA 2YXGA 1KTBA 3GTNA 1REQB 4GA8A 3NPUA 4LFYA 3AUOA 3F2CA 2WLZA 3CNYA 4JTJA 3NUKA 4CNNA 3CWNA 3BC9A 1I75A 1XCWA 3DFPA 4H6QA 4XVEA 3SQLA 4GWEA 3P67A 2QPSA 4FXRA 4GC3A 2BY2A 1KFEA 2DY3A 3BMWA 4KKXA 2C1IA 4C91A 3G2GA 1D3GA 1J11A 5DCEA 1NIUA 1PS9A 2GJXA 2XVPA 1A4LA 3IUHA 4GGBA 5DT5A 1XGDA 4BWLC 3NZQA 4D8ZA 3LLDA 2F38A 2NQZA 3M43A 4E4FA 1OYCA 2Z6JA 3MWAA 3PB0A 3KBVA 4PMRA 1LL4A 3RU6A 1XRVA 4ZMGA 1GEHA 1H5VA 4AWSA 3B8SA 1HJQA 4ZOEA 1S2TA 4JIIX 5F2GA 1U5JA 3NA8A 1K7EA 1WNOA 1JR1A 4S23A 4LPCA 2F61A 3U4FA 1CGWA 1EBGA 5BXPA 2V5DA 5AN7A 4GQRA 4A05A 3U2CA 4LY8A 3UJFA 3E02A 1SJCA 3T4CA 3AHYA 3SRDA 2UBPC 4HYWA 2Q01A 1IZKA 4PCTA 4IG2B 4UTTC 2AQVA 2O4MA 1ODUA 4LYPA 4Z2HA 1XBZA 3G1RA 2VHLA 3A5FA 1JUKA 3OU8A 2DVXA 3LG3A 4R7WA 5DQPA 1OC6A 5DRCA 5EU9A 1J0HA 1XS2A 3CV6A 1A5UA 1N55A 2XM2A 2Y1HA 2WXDM 5A8GA 4D8LA 1NWUA 3TAKA 4CU7A 3B0UX 4O57A 1AQFA 4DF2A 1W5NA 5M5DA 3MW7A 1EP1A 1UG6A 1HP4A 4FIQA 3XIMA 4AXNA 1MQRA 4LYKA 1XUZA 1FH8A 1W3HA 4X0NA 3QHMA 4ZA0A 3UESA 4HPHA 4PCSA 2WNWA 1AL7A 3NL5A 4ZO9A 3T0BA 2PDLA 1WXJA 2BGSA 2YDRA 4FO4A 1SUXA 1I60A 4ORIA 2XSAA 1RQHA 4IIGA 3H7VA 1BTCA 4E2OA 4OOUA 3I3DA 1LROA 2BVWA 3C0JA 4P8VA 2CFFA 3R8GA 1HJUA 1CI1A 1J2WA 1FWIC 3HV9A 1H50A 4XISA 5LNRA 2JEQA 3C0LA 1TPDA 2ZVIA 3U3HA 3BUVA 4QS5A 4M24A 3VDAA 4FK9A 2YBTA 3HGJA 4CUCA 2F6XA 3AHTA 1KM3A 1DHKA 2X40A 3KE0A 2R6OA 4JHZA 2G8ZA 4DO6A 3LHZA 4ASTA 4MIMA 4S3JA 2PZNA 4U3AA 1SGJA 1JNEA 1P1MA 3NQDA 1LG1A 2WKJA 1RR2A 1XISA 2XFYA 5F4WA 4AMCA 1S3HA 2VDIA 2D24A 3U6WA 3NQVA 1H51A 3Q37A 4DYJA 2J6VA 1DWFM 4LB3A 3S9IA 5I00A 4O14A 2E5CA 1LP6A 2NWRA 3VM7A 4HSHA 2QMKA 5CCZA 5DMLA 4RE4A 3WUEA 1VCFA 1K9DA 5CSSA 3GIPA 2OQYA 8RUCA 1Z48A 5CBBA 1U5VA 1M53A 4FIRA 3URNA 4EAYA 3VZZA 2ZC8A 2FIQA 3EOUA 4KWSA 4YWIA 3EA1A 2P3EA 1ICSA 3R8HA 3LMYA 5TIMA 3DBPA 5HWMA 1FWFC 1I2RA 1CX9A 3RJXA 4QROA 4IF2A 3SB0A 3VKCA 3GW3A 1E1FA 2QV4A 1VBRA 3LTPA 5BWFA 2PDPA 3H12A 1WA3A 5FJPA 3P82A 1RP8A 1BKSA 4TV6A 3LU2A 4RDVA 1MUWA 4KRUA 1HN1A 3AC0A 2FDSA 4LW7A 3EWYA 3B0XA 2ZZ7A 2ZZ4A 4PFMA 4JEQA 1SJDA 3LQLA 3SN1A 3TMLA 4A3YA 2GVJA 1EUNA 1QUMA 4OV9A 3W27A 4P8WA 4AZBA 4S2CA 3CIWA 3FW6A 5KTLA 3SCSA 3K1GA 2NX9A 4HNNA 4O8RA 4RXGA 3RUBL 2ICSA 3SSJA 3W1MA 4W9TA 1QOXA 3TONA 4O10A 2QULA 2X42A 1VFFA 2CU0A 4GD0A 1TWZA 1GK8A 3CO4A 3TYCA 4UNKA 1AW2A 1GOQA 1DE6A 2A3AA 3WEMA 3SCOA 3CZEA 1TWSA 3G18A 1X98A 1TV7A 1EP2A 2NUYA 4U5KA 1RQBA 1OB0A 4K68A 4GUJA 3OZYA 1FRBA 1XKJA 3BLEA 3MSGA 3LNPA 4EX4A 2QJIA 3W88A 4JFTA 2ZZ2A 1VKFA 2NSXA 1YPXA 1CGUA 4UBPC 4GY0A 3CPRA 2FHFA 4J1OA 3U7VA 4Y8FA 3TW9A 2WM0A 2IKJA 3YPIA 2WZIA 5F1UA 3VNZA 2CLMA 2YCEA 1UPPA 4WQ6A 2R14A 4X3ZA 1DWHM 2E68A 1SSGA 3BXWA 4MY1A 1XSJA 3GBEA 1LYXA 4S39A 3IIXA 2GJPA 3NZGA 4GUHA 1HTIA 2FZBA 2OWCA 3W2KA 3LRMA 3WO8A 1FDZA 1HFBA 1XYMA 1MXGA 3DESA 3Q4DA 4OT7A 4JHOA 3MVTA 1DWJM 4C1KA 5HBFA 1DWIM 3N14A 4DYEA 3WK3A 1OFBA 5HMFA 5LIXX 1XF0A 2CBJA 1Q65A 3TE9A 3EA3A 5HMSA 2J9XA 2Q02A 1TE6A 3REQA 5A6TC 1Q6QA 4M56A 2X8RA 2DZBA 5K9CA 3WQOA 3KBNA 3W3OA 4UNLA 4MFDA 1PX4A 3EX1A 5GPRA 4CQDA 4AIUA 2E1DA 3WQWA 3EEZA 2XGIA 5GJPA 2FPVA 2Z1VA 3VIJA 1VC4A 1TTQA 3BV7A 5FL1A 3PZ9A 3P84A 4IFKA 4W4QA 3W81A 3ELFA 1EOMA 1PKNA 2JQXA 4FZIA 4TVUA 2BVYA 5XIMA 3CL6A