3TAOA

Structure of mycobacterium tuberculosis triosephosphate isomerase bound to phosphoglycolohydroxamate
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
256
structure length
256
Chain Sequence
SRKPLIAGNWKMNLNHYEAIALVQKIAFSLPDKYYDRVDVAVIPPFTDLRSVQTLVDGDKLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAATALKHGLTPIVCIGEHLDVREAGNHVAHNIEQLRGSLAGLLAEQIGSVVIAYEPVWAIGTGRVASAADAQEVCAAIRKELASLASPRIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGGASLDGEHFATLAAIAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Structural and functional characterization of Mycobacterium tuberculosis triosephosphate isomerase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
total genus 99
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3taoA00
1ONRA 2A85A 4E2DA 4XQ6A 1YADA 1K8YA 2E6YA 3HGRA 1KTBA 5IBXA 4Z0SA 4IUOA 4IWWA 2WO5A 4R34A 3R8RA 1FCVA 4MFEA 4Y6GA 4AH7A 4JS3A 1SW3A 1P5BA 2QF7A 3NQ6A 3IIZA 3P82A 2E77A 1CX9A 2ABAA 4HNVA 1XC4A 2WNQA 4DF0A 1LRTA 2Q3RA 1TTJA 1FWSA 3L21A 4O12A 1Z44A 3O16A 5D30A 3BG9A 3EKZA 3DZ1A 3MI6A 2Y61A 3OBKA 3K30A 2RH9A 2A5HA 2TPSA 1UB3A 2ZZ7A 3G18A 3HJZA 4DF1A 4XZ9A 1TQJA 3TH6A 1K8ZA 2BXVA 3UQNA 3W7PA 1AL8A 5KSWA 4QM1A 3W86A 3I7SA 3H55A 3LHUA 4YL2A 2C1HA 1HUVA 3L68A 4PA8A 4QSHA 2YGYA 1LORA 2VELA 5A8GA 4BI7A 3CM4A 4MIMA 2GQ9A 4DPQA 1G4EA 1Z41A 3LCXA 3GDLA 1VLWA 5K9XA 2A4AA 4OV4A 4AWSA 3TKFA 3C2FA 5ABTA 4O14A 1XUZA 4IMDA 1HL2A 3DBPA 3EX2A 1FDJA 2PE4A 1AG1O 3T7VA 2Y7DA 1NFBA 1WBJA 1CI1A 3LCGA 1R46A 4UR7A 2P0OA 5DXYA 1OFPA 4GJ1A 3S0CA 1A50A 1LP6A 3B4UA 3TJLA 1OHLA 4R33A 5CPMA 2OCZA 2QDGA 4EOUA 1MEWA 1O5XA 4UC5A 1AK5A 4HPXA 3FFSA 3QJAA 4HN4A 3HGJA 3P84A 2TYSA 5KZEA 2ZTKA 3S1XA 1XL9A 1EP1A 3W3OA 3TAOA 3WJYA 2ZA2A 3DFOA 2Y6ZA 3AO0A 3GDMA 3CQ0A 1R2RA 2Y62A 1GVOA 2V5LA 4O28A 2OZ0A 2A6LA 1JCXA 1ME8A 2Y7FA 2QR6A 3ABQA 5D03A 1JUKA 2AAMA 3L0GA 3UZ5A 4D2JA 3EWWA 3M7WA 5G1YA 4WY0F 1LLZA 3IIXA 2V2DA 1SFLA 3CHVA 3MO7A 3WJXA 3TXZA 1C29A 1LBMA 2BTMA 2ZBTA 1F6KA 1XBYA 4PL2A 3ZS4A 3TK7A 4CQAA 3S1WA 4UTWC 5HR7A 3EB2A 3W6YA 3RFAA 5K3VA 1TPDA 3ANYA 4Y90A 3R12A 1C9DA 4C1KA 3G1XA 3QW4B 4UFLA 1Q6QA 2V2CA 3BLEA 1LBLA 5K2ZA 4UFJA 3RNDA 3CIXA 4E38A 5BMXA 3FOKA 1F6PA 1LRNA 1LRQA 1VQTA 3DHDA 3OVQA 3B03A 3N19B 4LUJA 4QISA 3UNDA 4IX0A 3V75A 3WK3A 4AXKA 1I2QA 4NNAA 4CCDA 2NX9A 5HUPA 3TX9A 3W88A 1TQXA 2JGQA 4NZJA 1QO5A 1WQ5A 2B7OA 3KFTA 1QDSA 2TSYA 1QAPA 3DKLA 4GE8A 3NQVA 3EKLA 2BLEA 3DFTA 4LOCA 1J5TA 5HR6A 2E1DA 5AYXA 3NPUA 1R2TA 3NA8A 3G24A 3A9IA 4CQ8A 3W74A 3SIZA 3PSVA 1HFBA 1EP3A 5AFDA 5I3IA 4JTSA 1M6JA 4XBSA 3DFSA 3W7KA 4IMCA 3W7MA 1JUBA 3PBVA 3W1AA 3W7EA 3TFCA 2Y7GA 1I8JA 1JQVA 2QCDA 1OFDA 4IMFA 1B4KA 1Q6LA 1OFQA 3IGSA 4RV8A 3C2OA 2F84A 5I3HA 4QAIA 3M43A 2GJLA 2B7QA 1L2UA 3NPXA 2NZLA 1K7XA 2ZRYA 4K38A 4Q4KA 5CZJA 3EWYA 1A5BA 2HS6A 1TPB1 2NXGA 2I1OA 5AC7A 2A7PA 5AOUA 3QRHA 4ICNA 4K7VA 3TCEA 4HIBA 1DL3A 5CSSA 3RLUA 1WXJA 1E51A 1P0KA 3EWZA 4LVDA 5HNRA 1P4CA 4LS2A 5LNWA 3T40A 2J88A 1BEUA 3GAYA 3Q2DA 3GKAA 4WX2A 1MXSA 3O1NA 3QMRA 5F2MA 1GG1A 3NXFA 5TIMA 3F03K 4LU0A 4X3ZA 1QPNA 5G2IA 1Z42A 2B4GA 2H6RA 1ZY9A 3N14A 1VCVA 5E1QA 2G5WA 3W7RA 1R2SA 4LV9A 3I7RA 3P61A 3CWOX 4YMZA 4UTMA 1SZFA 2CWNA 3O15A 4JTUA 4I7WA 4WD0A 1LYXA 3GNNA 3M0ZA 3OG3A 4TMBA 5EA9A 1YPIA 3E02A 3QF0A 3MJYA 3P60A 1S5TA 3GR7A 3RU6A 3DENA 5G2WA 2V81A 1KV5A 4UMCA 1XBZA 3W1QA 5D2XA 1KTCA 4IGHA 4AF0B 3UYCA 3C61A 3S9YA 2QUTA 4RLIA 1PV8A 2R14A 1SO5A 3GIYA 4PL1A 3DXIA 5F4SA 5CGQA 4NX0A 1R47A 1SQ7A 3FJ6A 3R89A 1TPFA 3W1MA 3KVMA 3MI3A 2DZWA 4ZQCA 4GUFA 5FEXA 3W7IA 1EUNA 2FPTA 1H63A 1GQNA 1H1ZA 3W1UA 1J4EA 1HO4A 1S3HA 4LVFA 1VRDA 5AYYA 4LW7A 5MHBA 1GVSA 4NJHA 5FF3A 5G1TA 1UCWA 1KFJA 1IGSA 4Q33A 3MP4A 1EEPA 2ZRUA 1WOAA 5C6MA 2HTMA 2WSRA 3NL2A 2FDSA 5BOOA 1TSIA 1LCOA 1UASA 4FIQA 3BPWA 5SWUA 2X1UA 3VCRA 5EKYA 2YFNA 3CIWA 4AEOA 4N4PA 1UUMA 1JVNA 3G1VA 1TJPA 3TMQA 1N8FA 1FCBA 1T96A 2YSWA 1XDMA 3RMJA 2QKFA 1D9EA 3H54A 2ALDA 3PULA 5DLCA 4IXHA 3BG3A 2VFDA 3I65A 2WNZA 2I14A 5HULA 1DQXA 3LHVA 3PVFA 4NXKA 4AB4A 1KFBA 4UNLA 2JBMA 4NJKA 4WY0A 5G4EA 4K36A 3LGEA 5C54A 1TYGA 3MYPA 5DBTA 4JTFA 2GVLA 1J2WA 2FPYA 2X1RA 1M7OA 3LCFA 2CLKA 1DKWA 4ZZ9A 1LDCA 1PVNA 4O4VA 1NF7A 3SW6A 3BLFA 4NX5A 1JCLA 3U2OA 4UIOA 1KM3A 4JTIA 4OV9A 5AHNA 3W73A 5HINA 3GDTA 3UY7A 3W72A 4QNEA 1FUYA 4XTDA 4BR1A 4C1LA 1H7PA 2PRLA 3IRDA 2H90A 2E6AA 3Q94A 1SW0A 3S6DA 2W6RA 1KM5A 1VJIA 1TIMA 1G4TA 4O17A 1H7RA 4WQ6A 2FQIA 3KRSA 2V0TA 3MUXA 2JGYA 4A21A 2NXIA 1G69A 4A2RA 4FX7A 2E09A 5KZMA 3NQDA 3S5YA 4A2SA 4O57A 1BTMA 3W9ZA 3N73A 1GWJA 3MHUA 4WZHA 3GKFA 3W2LA 4PEKA 1KFKA 2QJIA 2QCDB 3BG5A 3M1ZA 5EBUA 4GFSA 2ZRXA 3M5XA 4FNQA 1Q6RA 5LNRA 3FYOA 2W79A 3S1UA 2CLFA 2J9ZA 3DKJA 4LVBA 2ZA1A 3CTLA 2Y70A 5FF2A 1ALDA 2CLMA 5D2VA 4CCEA 2QJGA 3LV5A 2H3DA 4NQ1A 3MHGA 5G5IA 4EIVA 1LLWA 2TRSA 5FF7A 2YFOA 2NX1A 3EXRA 1HO1A 4UMAA 3U6WA 1WOBA 3TR2A 3JS3A 3DH7A 4DQWA 1DHPA 1H7OA 3BARA 4JY8A 1UJPA 2AGKA 3IV3A 3LTPA 3IIPA 2EPHA 3W7OA 4O1DA 2GPTA 3L65A 5J5DA 4S2BA 2Y88A 1SPQA 4ML9A 4MZ8A 4DXVA 2CU0A 5AC6A 4UTTC 3W2UA 1KFLA 2QEZA 2XFWA 3SFKA 3P5YA 1SFJA 4JX4A 4M19A 4GXMA 1JQXA 3UWQA 5D02A 3O6YX 3B04A 4A3UA 1IIHA 1KM1A 2GVGA 1W31A 3TA6A 2J9XA 1DV7A 2JK2A 3LTSA 3QPYA 2CZFA 2BWGA 1TMHA 3NQ2A 4FHAA 2J24A 2WQPA 2OMAA 1RR2A 2E5DA 2R94A 4NJIA 3E12A 5C2XA 4O1CA 1H62A 2NV2A 3U8GA 3T44A 3LHTA 4MPQA 4PODA 4OBTA 1DORA 3N9RA 1JJKA 3G8RA 3G0UA 3NPWA 5FEPA 4N9EA 3PSWA 3W7JA 1NVMA 1VGAA 1W5MA 3FJLA 1GEQA 4FO4A 3GXTA 3GK0A 1JCJA 3Q37A 1FX6A 3OVPA 4DPPA 4PH6A 5BNKA 1SZEA 2KZHA 2X1TA 1FDYA 3TSDA 1OF6A 4WXYA 1CW2A 1YTKA 2AQWA 2P10A 4BI5A 1TPVA 4AMAA 2A0NA 3P67A 1OG0A 4L4MA 1DBTA 3MP3A 4RJEA 3WJWA 1S5WA 1SR9A 3G1YA 4MZYA 3OA3A 1F05A 4P61A 3UWVA 3NAVA 1YDNA 4ZQMA 4YCOA 3TU9A 3TSMA 1OFAA 3A24A 3L2IA 5DY2A 1OVDA 3NO5A 4KFPA 4MY8A 1B9BA 4K6AA 2CLLA 1JULA 1WA3A 4JYEA 3H53A 1W5NA 2YR1A 3KXQA 4QNWA 3ELFA 5FEWA 3OVRA 5D05A 1O5KA 3KRZA 3TC7A 2C19A 3BO9A 2ZZ5A 5CZSA 1O95A 3STEA 3W1PA 1OABA 2PC4A 4RZ5A 3MBDA 3E0IA 4HSOA 3A22A 2WSQA 4KFNA 4I7UA 1OYBA 3C8FA 3FS2A 4JTKA 4K7YA 3ZR4A 4RX0A 4WY0B 2Q8LA 3GYEA 2EHHA 4O13A 4HNUA 3W2JA 3NQCA 3P80A 4LVGA 1VYRA 2BX7A 3HPXA 1ZFJA 1N55A 1FCUA 2JKEA 1PE1A 3W7HA 1GTHA 3UD6A 4Z1BA 4ADSA 1F76A 1FWNA 4N9DA 3W1LA 2YX0A 4DO5A 1O60A 5AHIA 4O50A 2RFGA 3NQEA 1TV5A 1KM6A 4BWLC 1KA9F 2RHGA 4XWUA 4ZQRA 3W7LA 3A21A 5BW6A 1AW1A 3NQ8A 3TQKA 5EYWA 3LOTA 4G1KA 4TX9A 1K8XA 1KBIA 3CPRA 3UWUA 4M6QA 3MYOA 1THFD 2HSAA 1NF0A 3RK8A 3HG3A 4FNSA 1TTPA 2EKCA 1YTEA 1I2PA 4AHQA 2ZQ0A 1B3OA 4BI6A 2GQ8A 1VR6A 2CLOA 3TMLA 4AAJA 4LC8A 1A53A 2IQTA 5CPNA 4XBKA 1MSSA 5AHEA 5D37A 6ALDA 3G1AA 1QOQA 2NX3A 1RVGA 3EXTA 5LNUA 2WNNA 1RD5A 2VFHA 3TC6A 2NWSA 2QJHA 4K37A 3A23A 4LT9A 2RDUA 3C2EA 1TRIA 6TIMA 5EMUA 2DU2A 3LCIA 1ZJIA 4FX8A 4FNPA 1YDVA 4RZ4A 1KFEA 1KFCA 1XKYA 1U5JA 3TFXA 1W3NA 3GZ3A 5IBXC 2Y7EA 1KV8A 4RCXA 2H8XA 4LC6A 2NUYA 4N4QA 4U28A 1W3TA 1NSJA 4RR4A 1GTEA 4Z1CA 5F1VA 1YLVA 2V8ZA 2C15A 3MHFA 2DZUA 3TV8A 1I4NA 4FNUA 1VLIA 1KLYA 1P0NA 1JRCA 5AB3A 2ZDRA 3DAQA 3E9AA 4DBDA 4MY1A 3G1HA 2OJPA 3UXDA 5G4WA 1EA0A 3PB2A 1VYSX 3W7DA 4H3DA 1H51A 4A22A 3L5LA 5H2ZA 1TPC1 4GUGA 5K4XA 2LLEA 3A5VA 3W2KA 1M7PA 3E96A 2G97A 4PC8A 3T55A 3USBA 3NL3A 3FEMA 1ZAJA 4I9AA 1SW7A 4RK8A 3QM3A 3E49A 1OFOA 3FIGA 4CNPA 1X1OA 1TJRA 5KTLA 3QSRA 1TB3A 3W2MA 3QW3A 3N2MA 4AVFA 4NNCA 1DVJA 5FEZA 2C18A 3MWAA 1OYCA 4O54A 2CLIA 3WJZA 4NZFA 4MLJA 3M6YA 4L4LA 4HNTA 1SZGA 3I7QA 2QAFA 1P1XA 4LVAA 5DXXA 1ZHAA 3NQMA 4JX6A 1JR1A 1ZAHA 5D2TA 5F4WA 2J27A 2V5BA 2VFFA 1F2JA 1I2NA 3MW7A 4I7VA 4JTJA 3NEVA 4ONVA 1X6UA 3LI1A 4UTLA 3P74A 1B57A 3S5OA 2R8WA 3FLUA 3B8DA 1KBJA 1EUAA 2FIQA 1HTIA 1XBVA 4GWEA 4EWND 2D73A 2Z0IA 3W1XA 1G4PA 4GC4A 4PFMA 2X30A 3MBFA 2VXNA 1OX6A 1YYAA 3SR7A 3C0JA 4IXXA 3RLVA 3NNTA 1MO0A 4WXZA 3W87A 1ICQA 3EX1A 3TQVA 3S1VA 1AW2A 3O07A 1IXOA 4IMEA 1M5WA 5I3GA 5J5RA 2GOUA 4W9TA 2ABBA 3Q58A 4LUIA 1IXPA 3TJXA 3PG9A 1ZENA 4HSNA 3IVTA 3LI0A 3QMSA 3GDRA 1K7FA 2XN0A 3KVJA 3TE9A 4Q32A 1K3UA 4MKNA 3NQAA 1OFBA 2RDTA 1QPOA 2DP3A 3C2VA 4O18A 3TIMA 4UFIA 2YZRA 1BKSA 4LS0A 4UR8A 2QCGA 4TO8A 3HF3A 3SJ3A 3QSTA 3PUOA 3NR0A 4Z1AA 4JGDA 3WFAA 3O6DA 1PS9A 1XFBA 3NVTA 4RZ6A 3N9SA 1H7XA 3KVLA 1TPUA 3MMTA 4O4WA 1QR7A 1ZCOA 3GLCA 4NT0A 3CEUA 3G8EA 1SSGA 3PB0A 1L9WA 5EPDA 4XUGA 4FB7A 1W37A 3ABRA 4X22A 2W0UA 2QCCA 1GJPA 3S5ZA 3CLMA 3GVGA 2ZZ2A 3LXAA 4IPIA 3KVKA 4UFMA 4CCCA 1ZALA 3JR2A 5AHLA 3NOEA 4AWTA 1VH7A 4KFOA 1W0MA 3BW3A 4KKXA 5BRBA 4UTJA 2A7RA 3HMJG 4JICA 2CLEA 2QDHA 2I9EA 4Z08A 1GOXA 2C16A 2JKPA 1TREA 4ORIA 1L6WA 2VFEA 1FQ0A 2BZNA 3QQ1A 4NJJA 4Z1DA 1QOPA 4UTUA 5F4XA 3BGJA 3L0KA 4JTLA 3RF9A 1O94A 3LB0A 4Y8FA 2RDWA 5F2IA 4RKAA 5CZ0A 2NLIA 3DU0A 2ZRWA 3P8JA 3PM6A 4MFDA 4K39A 4N9BA 5LNSA 3W2NA 3PBWA 1WDWA 4LS1A 4MLRA 3TDFA 1XBXA 1RZMA 1OFRA 4MUZA 2QUUA 3GX9A 2VENA 3P81A 4UCGA 1TV8A 1GPWA 5D2YA 3F4WA 5LHFA 4M5PA 1PHQA 3B0PA 4GUHA 3LHWA 7TIMA 3G1DA 2CLHA 3C6CA 1TTQA 1W54A 2FTPA 2V30A 3IGUA 2ZRVA 4JTTA 3LHYA 2R91A 2O7SA 2QAPA 1SO6A 3LCLA 2ISWA 4EF8A 3G1SA 4YLWA 2RKXA 4FF7A 3QH2A 3W23A 3ATYA 5BMWA 3GNDA 1X1ZA 3EEGA 3M5VA 3NM3A 1S5VA 3LV6A 1EX5A 2OT0A 3G0SA 4O1BA 3SZ8A 1G7UA 1VZWA 1FY6A 1V7YA 3ABSA 1TO3A 4WOZA 2ISSA 5TBOA 2G96A 4IOTA 4UTWA 1U83A 2C6QA 3LRLA 1AMKA 1F7BA 3PY2A 4LY8A 4YXGA 3CC1A 4JN6A 3HO8A 5AN7A 3BV4A 2EF9A 2A7NA 4AHPA 1K03A 3WK2A 2X1SA 3F4NA 3STFA 2WOQA 1WBHA 4JTGA 1I2RA 4FX6M 1PCKA 2V9DA 5EY5A 5LNVA 2HMCA 5KINA 4BF9A 2QCLA 2ZCGA 1KTNA 3N2XA 2E6FA 1V5XA 4OHQA 3LTYA 2E68A 3PS7A 4OGZA 2EAWA 5CG7A 2CFFA 3B06A 1SUXA 1MEIA 1W3IA 3TROA 3W1RA 4NXSA 2EGZA 2DZSA 2PURA 1ME9A 1B4EA 3PAJA 5DELA 1ME7A 3LERA 5LKYA 4ADUA 1TRDA 2ZZ1A 4O0KA 2VFIA 3O63A 3UY8A 3QQ0A 4NU7A 3LCWA 5CZTA 1VHCA 3T4CA 1IXQA 1FDZA 5HUOA 3W71A 3ATZA 3LX9A 4JX5A 3KRUA 4KWVA 4AWUA 1KM4A 4Z0JA 1MEHA 2WJZA 5LGXA 3NL5A 4U4MA 5DY3A 3LLDA 4M7TA 1G7VA 1DQWA 3UPBA 3W1TA 4RXFA 4CQ9A 4UFHA 1IF2A 1QNVA 2VKZG 2YPIA 5LSMA 4E0CA 4PTNA 3LCHA 1GYNA 1RQHA 4JR5A 2A6NA 3NQFA 3C56A 5HQEA 3UZJA 4AHOA 2P1FA 3ZFHA 4MJMA 3B0UX 1HG3A 1PCWA 5C55A 3P8IA 4CNOA 1WAUA 5AHMA 2VEIA 2Q8ZA 1BWLA 4GUJA 1D3GA 3EWXA 1FXPA 2PCQA 3VE9A 3C52A 3GXNA 3W1NA 3O06A 1YXCA 3PC0A 3NQ7A 3N34A 3QEZA 2WSYA 2A1YA 3HBLA 4JEQA 3HPZA 4BFAA 1UBSA 2DZTA 2Z1BA 5HMSA 1UUOA 1LM1A 4JDYA 3ZWSA 3TUUA 3M47A 4PCFA 2GVJA 4ZL1A 1OJXA 3VKJA 1FWTA 4ADTA 4TIMA 1QPRA 4AF0A 1W5QA 2CZDA 3C4UA 2Y63A 3EX4A 4O10A 2WKJA 2J6XA 2B7NA 4NNBA 3PF3A 2ATMA 5L6UA 1TV7A 4O53A 1XDLA 3B0VC 3LBCA 1FXQA 2H8ZA 1RQBA 4QIUA 3C2RA 2PRMA 3EX6A 4XKYA 3S5NA 2NUWA 2FLIA 5I3KA 3VI2A 1ZAIA 4KWWA 1ZNNA 1PIIA 5TQLA 5D33A 1GVFA 3CT7A 4LRSA 2DJXA 4DO4A 3C3NA 3HOJA 3WK0A 1VC4A 5CKSA 1W1ZA 2C0AA 1IXNA 1JRBA 4LV4A 3W7GA 5CSRA 3NDOA 3N3MA 3PBUA 5HWJA 1OK4A 1MZHA 1EWDA 1H7WA 2YW4A 4X2RA 4HHPA 1KLZA 4N02A 1A5SA 1H61A 1TPEA 3SGZA 3LHZA 1YTDA 1L6YA 4JYFA 4OT7A 4O0ZA 2NV1A 3INPA 1DJQA 1X8FA 1FCQA 1QMLA 3LRKA 4TR9A 4DEFA 1TTIA 5AHFA 4JXCA 5F2GA 3ABOA 3PUEA 5K7JA 4ZQPA 2J9YA 1T0OA 3UWWA 2ZRZA 4P2VA 4LRTA 1KW1A 4HNNA 1YXDA 4M6VA 4GUIA 3STCA 3IVUA 3THQA 1ML1A 3M41A 3IIVA 4CLMA 4E2BA 3O6CA 4GNJA 3QPZA 4DO6A 5KMYA 2TMDA 5FESA 4JD4A 4FNRA 1H50A 3G22A 1H60A 3LXBA 3UPWA 4DF2A 3PWAA 3W70A 3BGGA 3CB8A 2B7PA 4DELA 3L5AA 2YXGA 2XN2A 2QCNA 3IIOA 4GRSA 2E6DA 3NZRA 4MYXA 4Y9AA 4H6KA 3W7QA 1XCFA 5LGZA 3IGXA 3NZ1A 4J9JA 4O8RA 3HG5A 4O1AA 1VS1A 3MP5A 3BLIA 2A21A 3QYQA 4OU1A 3A5FA 3T78A 1OX4A 5KITA 3L0NA 3LXCA 1TPWA 3TW6A 4LWWA 2YW3A 3DHFA 4OQVA 3SECA 3BK0A 3O8AA 3D0CA 3M5YA 5E0KA 5HJLA 4UTIA 4K8HA 5DBUA 1EB3A 5CPOA 4O15A 1VHNA 1JCYA 3NL6A 3CWNA 4JDBA 2GJNA 3I6RA 1QO2A 1Z48A 3R13A 1ICPA 3FYPA 3M16A 1A5AA 3G3MA 1I2OA 3PR2A 4M6PA 4ZVJA 1D3HA 1LOLA 3G1FA 2QUVA 1YDOA 4O19A 1WX0A 3KOFA 5AYZA 5K9DA 1LZOA 5T26A 1QPQA 4FXSA 5HWMA 4MY9A 3GDKA 1GYLA 4IMGA 4OE7A 5D04C 2ATSA 2GQAA 3HG2A 3MI2A 4IQLA 4N6FA 3P62A 2FB3A 3SGUA 2CW6A 4NVTA 1ADOA 1JUEA 1SU5A 5EL1A 3W75A 5LZLA 4NJGA 4O16A 3STGA 3UWYA 1X7FA 4CNNA 2XN1A 1OX5A 4UTKA 1XI3A 3W83A 4TU1A 2NWRA 5I3JA 2DZXA 4N6EA 1W5PA 3PG8A 3B05A 3NYZA 3W76A 3SSJA 8TIMA 3JRKA 3DFPA 1OK6A 5HWNA 1N7KA 1F74A 3FKRA 2Y89A 4UUIA 4UXDA 4B5NA 2ZTJA 2ZZ3A 5F2LA 2C14A 2C13A 4Y96A 3TNOA 3CU2A 5GVJA 2DJLA 1K7EA 4ZQNA 1GT8A 5DN1A 3F1QA 1F5ZA 2VFGA 3TQ0A 1EPXA 4FNTA 3LM7A 4O52A 3GB6A 2GUUA 4XTIA 4R7JA 3IEBA 3IVSA 1EIXA 1OF8A 3DGRA 3O05A 2Z6JA 3TSBA 3R5EA 1LROA 1T8XA 2Z2UA 4M7SA 2YCEA 3ZWTA 3W07A 4UNKA 2ZFAA 4N2YA 1G6CA 4UTHA 1Q6OA 2VEKA 3VFLA 2H3BA 2FFCA 3HQ1A 4MZ1A 3BW4A 1QWGA 4UTTA 3QC3A 4JTEA 2Y85A 1IIGA 2BSLA 3NQGA 4ALDA 1FBAA 1GZGA 1NEYA 2QCHA 3I68A 1JCNA 4IX2A 4K8EA 3HGSA 3KX6A 5KZDA 2VC6A 2HS8A 1F73A 2C3ZA 1YXYA 2FB2A 3TAKA 2VOMA 1R30A 1VPXA 3FA5A 3PBYA 2VEMA 3L66A 2ZYFA 4ZQOA 1RPXA 1GG0A 1LOSA 3LLFA 4TMCA 3LRMA 3NPVA 1G4SA 1FWRA 3G3DA 1VCGA 1SZNA 4XKYB 1H1YA 1O4UA 1PL9A 3AJXA 5D32A 1L6SA 1JCMP 2DORA 3EWUA 5D09A 3QFEA 4LTSA 3GR8A 2X2GA 1RV8A 3SI9A 1G67A 4H4IA 2FPVA 4BK9A 3FKKA 2E5CA 3WJSA 1K02A 4HKPA 4RXGA 3DFQA 1OFEA 2Q3OA 4JY9A 1KM2A 4MYAA 3L9CA 1AW5A 2B0MA 5L9FA 2V2HA 4FXRA 1I45A 1RQEA 1C8VA 5E93A 5U7SA 3P7YA 2NXHA 1LOQA 1SO4A 2WV8A 3OIXA 5D2WA 1EP2A 4QITA 4EF9A 3W85A 5DCDA 4MOZA 4N9CA 2NUXA 1W8SA 2CZEA 3G0XA 3QZEA 3W22A 3V1PA 2UV8G 4GBUA 4WUIA 3QMTA 3M5ZA 4OWGA 1W56A 2ZZ6A 5FF4A 2A2IA 3GXPA 1Q45A 3EWBX 4YCPA 1YPFA 2G95A 4YWIA 1ICSA 3EX3A 4X9SA 3NGJA 4QQ3A 2V82A 5DCEA 3NG3A 5K9CA 1DOSA 4MJZA 1TPH1 4O11A 3TW7A 5H91A 2E5BA 3W84A 2FJKA 3SY5A 1DJNA 1WV2A 4IPJA 2YDAA 5AC8A 5G2HA 3OEXA 3VE7A 4ORMA 3L5MA 2QCMA 3YPIA 1EWEA 4QJ1A 1Q3NA 4POCA 3BVJA 1OYAA 5FI8A 1AL7A 1BWKA 4HPJA 4JIPA 1A5CA 3GAKA 2DZVA 4JTHA 1PHWA 4NUWA 2YYTA 3UXAA 1GVQA 3EXSA 2F7FA 1H5YA 4FIRA 1LBFA 1WYIA 3THAA 1OX4B 2O7QA 1FWWA 2DZPA 3UWZA 3M44A 4WJEA 2CZ5A 3HG4A 4JIQA 4UFKA 3HGOA 4S2CA 5CPLA 1XM3A 5U4NA 3DI0A 1SO3A 3S8HA 3HIJA 3HB9A 2OT1A 1SSDA 3W7NA 4A29A 1GVRA 4EVZA 4BWLA 5A5WA 3VNDA 1NAL1 4FEZA 5LHEA 5K4ZA 3PUDA 3KAOA 4HT3A 2QCFA 2PRHA 2VEPA 1QCWA 3KHJA 1Y0EA 3L67A 4LNYA 2QCEA 4JNMA 4ZMGA 1XXXA 5I3FA 1LTDA 3LBMA 5F1UA 3W7CA 2YYUA 1T99A 3LDVA 3NM1A 5DCBA 2ISVA 1XUUA 3TXVA 2JKAA 1VYPX 1QFEA 5FF0A 1VCFA 3OHIA 4S1FA 3WK1A 2X16A 4DBEA 1TCDA 5IM51 3P5ZA 1KM0A 2ZZ4A 3R2GA 3M9YA 4IJBA 4WOQA 1H7NA 4UMBA 2WPBA 5C5YA 5D38A 1W5OA 3DI1A 3HPSA 3S42A 3BW2A 2OX1A 2Z6IA 4JYDA 4MVAA 3CEPA 4R53A 2ZA3A 3DFNA
chains in the Genus database with same CATH superfamily
2A3BA 1ONRA 2A85A 4GY1A 3ECQA 1V3IA 1MRAA 1TMQA 4XQ6A 4DLMA 1BF2A 1VPYA 1KTBA 1JIBA 3MUIA 4IUOA 4IWWA 3F5KA 3AZRA 4GFIA 2D69A 4JQAA 1CNVA 1KQZA 2V5DA 2QF7A 2EBNA 3CUGA 5BRQA 3EA3A 2GSJA 4ECLA 1GVEA 2O92A 3G1RA 1CIUA 3F4DA 4ZO9A 4KF1A 5D30A 3DZ1A 2GQ3A 4WVXA 2Y61A 3OBKA 2PTWA 2V67A 4F0KA 2DUXA 4F0LA 3MKKA 1TQJA 2ZUSA 2PGFA 3REQB 3W7PA 4QM1A 2DUAA 4CQBA 4AY1A 1E1FA 2F8QA 2ZUVA 3WELA 3HV8A 2A79A 5D8WA 1G4EA 3LCXA 1RAKA 3WQFA 3PN8A 4OV4A 1XLAA 4IMDA 3O9NA 5IFTA 4MB1A 1AG1O 2EG8A 2AOSA 3CV2A 3MUZ1 5A6JA 3WDQA 4Z17A 4RNJA 3SQLA 1R46A 5DXYA 1OFPA 2QYGA 5CG0A 4HZ6A 3T0AA 5CPQA 1A50A 7A3HA 3UR5A 1ZU8A 3S2LA 4R33A 1JYVA 2OCZA 4EOUA 2DEPA 2WMFA 1R5YA 1Z7AA 2ON3A 4UC5A 1PYMA 4GX8A 4QFUA 5KZEA 2ZTKA 4NZ5A 1EP1A 3WJYA 3W28A 2X7VA 2Y6ZA 2ICSA 4PUJA 2D20A 4ZOBA 1R2RA 3UJRA 2A6LA 4AZ5A 1V6TA 3GD6A 2VL4A 1E56A 5A6MA 2QR6A 2YCIX 4ZSUA 2Y8UA 2FGLA 3ABQA 5D03A 3U5YA 4LFYA 4FZIA 3WH6A 3G5EA 3UZ5A 4M82A 4D2JA 1Z8AA 4L4OA 4UWMA 4AYSA 3M7WA 4FAMA 3APTA 1LLZA 4IIDA 4TV6A 1W1VA 3N12A 5HATA 5B80A 2BTMA 4H9YA 2CBVA 1BQCA 3ARUA 3S1WA 5HR7A 3EB2A 3IARA 3ANYA 3R12A 1E1CB 1C9DA 4C1KA 4AD5A 3G1XA 3BWWA 4Y9OA 3Q45A 3T2QA 3OTRA 3BLEA 8XIAA 5BMXA 1QNSA 1LRNA 5HK4A 3OVQA 3DHDA 2E9BA 2YOCA 3WK3A 4W4QA 3W88A 4AIBA 2R1PA 4HB7A 3SEPA 2G3NA 5D9NA 2HXTA 1QAPA 3MB9A 4LB4A 1V0KA 3RR4A 2IPJA 5ABGA 4R7OA 2G8ZA 1BFNA 4PTMA 3TYDA 4CQ8A 3W74A 1HFBA 1KO0A 1A0CA 1EP3A 3WFZA 5I3IA 1BLIA 1LF1A 4XBSA 1FWJC 4DNHA 1JUBA 3CL6A 3H4XA 1L0PA 3I4KA 4Q8MA 3W7EA 3CO8A 2ZIDA 5TAOA 1B4KA 1TIWA 5C0QA 1TUFA 3BSMA 4QLJA 2YLLA 2VRQA 4YVXA 5I3HA 1OCBA 3FCPA 1L2UA 4CGTA 3TWBA 3FYYA 5DQPA 2DW7A 3B3DA 5KETA 3AOFA 1B90A 4HK5A 4PMUA 2HS6A 5AOUA 3QRHA 1TV2A 4JTAA 3TCEA 4HIBA 1V08A 5CSSA 3ZM8A 1WXJA 4IGMA 1O68A 2OX4A 3UGVA 3WQ8A 5LNWA 1XLGA 3ANVA 1XR2A 3RM4A 2RGMA 3NQBA 2EJAA 1REQB 1PIGA 2BY3A 3Q2DA 4L4PA 1MXSA 3U5UA 3EB3A 4HNLA 3URAA 1V4YA 2DH3A 3L7RA 5TIMA 3F03K 2PD9A 4X3ZA 3U2EA 5I06A 1Z42A 5LA2A 1WKYA 1E9ZB 1MI3A 2B81A 2L5HA 1QK0A 3I7RA 1S2AA 4RL3A 1SZFA 2ZUUA 4B5XA 3QGKC 4WD0A 1LYXA 4HA4A 3OO2A 3GNNA 3OG3A 4TMBA 1YPIA 1DWGM 4DBSA 3VOJA 4N42A 3GR7A 2GL5A 4PUKA 3DENA 1W9PA 4UMCA 2PWVA 3SUTA 2GSHA 3E2VA 1OD8A 2POTA 3KBSA 3B9EA 4AF0B 3FHQA 3S9YA 1PV8A 1L6FA 3NO1A 4XX6A 3MV11 3GWQA 3FJ6A 3CASA 3F4CA 3W1MA 1FVPA 3MI3A 1EJWC 4ZQCA 4EXBA 1DXEA 1NDWA 1EUNA 2FPTA 1Y8BA 1J4EA 3VIKA 3VOHA 4LSBA 1S3HA 4NJHA 2DSUA 5G1TA 4Q33A 1EEPA 4C5YA 5I6SA 2WSRA 3CUXA 3MCOA 1RVKA 3R58A 4M1BA 3CIWA 1XIBA 1E15A 4DYEA 3H2EA 1UUMA 3U2CA 1TFVA 5DMLA 2JEQA 1T96A 1A5LC 2YJQA 2YSWA 3WH7A 4W84A 2I5GA 2GJXA 3CH9A 1DWIM 2Z27A 3BG3A 1IGWA 2CBJA 1UP2A 2WNZA 4KRUA 1TJ0A 4DBWA 4NXKA 2JEPA 3TWAA 1FP9A 4WF7A 4UNLA 4EPDC 4NJKA 3O0FA 4GYFA 4YS1A 1UYQA 2I57A 4ROQA 4GVIA 3WX7A 1XPYA 1J2WA 2X1RA 3P3BA 3AMGA 3AALA 3LCFA 3K1DA 3WDPP 5M2FX 1LDCA 1OC5A 4PUNA 2WPGA 4O4VA 1NF7A 1CLKA 1M7XA 2XVLA 3MDWA 4U5KA 1XH0A 4OV9A 5AHNA 4BCEA 3GDTA 4QNEA 1FUYA 4AC7C 1H7PA 4CUCA 5E09A 3PJUA 4H7CA 4QJ5B 5CGTA 1J0IA 3CT2A 1VJIA 5I00A 4HYRA 3V0UA 2VT0A 1QHOA 3KRSA 3CAVA 4I9JA 3MUXA 2NXIA 1G69A 1N8IA 2R24A 4A2RA 1CPUA 2UWFA 4Q4PA 4LAKA 2ZWYA 3MS8A 5KEZA 5KZMA 3NQDA 4O57A 1YNQA 1TX0A 2VUNA 4WZHA 1LG1A 1HL8A 5DRCA 3SUUA 4D6IA 3NDZA 3M1ZA 3WBEA 1A80A 4YHEA 5LNRA 1Q6RA 5A95A 3V1HA 2W79A 2CLFA 2J9ZA 9RUBA 3D5HA 2PWFA 1XIJA 3EOUA 5FF2A 2QJGA 1LLWA 3BAXA 1D8CA 4QE4A 1J0KA 2R9RA 4UMAA 3U6WA 5CXPA 3TR2A 2CKSA 3JS3A 4CNUA 5BXTA 1DHPA 3LTPA 3GXIA 3IIPA 3W7OA 2INFA 1SFTA 3WNNA 5A3HA 5J5DA 1UR9A 2CU0A 4NG3A 3DEQA 4UTTC 1KFLA 3SFKA 4GXMA 5D02A 3UWQA 4OIFA 2E8YA 3N18A 2VVNA 3B04A 2GVEA 1UD5A 2HVMA 1ENUA 3QHMA 4PZVA 3TA6A 2JK2A 3QPYA 1OCJA 3I4EA 4FHAA 5IHSA 4G7FA 2E5DA 2WBGA 1FWHC 5C2XA 1XLFA 4O1CA 1X1NA 2FGZA 5AYBA 4DJED 1JZ7A 4Y9MA 3LEPA 3WBXA 1MXGA 3T8LA 1H0GA 3N9RA 1NWTA 1LL4A 3G8RA 3E74A 3MV01 3NPWA 4UCFA 4N9EA 5C9UA 2J7HA 1MW1A 1ZCCA 2J75A 1VGAA 1W5MA 4MB3A 1EBGA 4UQCA 5FL1A 3GXTA 4B5SA 3WF0A 2J6VA 1AMYA 1JCJA 1FX6A 4YVPA 1OEPA 2XGZA 4DPPA 4Q8TA 5AY7A 3C0SA 4PH6A 1J11A 3FY1A 4H19A 1OF6A 1CW2A 3DHUA 3VUSA 1TPVA 4AMAA 1GW1A 2A0NA 3P67A 1OG0A 3TYUA 4XAYA 3WJWA 5HMFA 1SR9A 3G1YA 3PWIA 4PMYA 1S1PA 1F05A 3SADA 1ZB5A 2FTWA 3II1A 3TU9A 4S3GA 1W9XA 1FWFC 4XB3A 5DY2A 1JFHA 3NO5A 3MZ2A 1EFZA 4K6AA 2CLLA 1WA3A 4JYEA 3LZ5A 3MCNA 4QNWA 1K9EA 3ELFA 4GH3A 3NXLA 5FEWA 2X40A 5HAOA 2C19A 1WKEA 4Z2HA 3BO9A 3VO0A 3EWDA 5CZSA 1O95A 3RRXA 3MBDA 4HSOA 2Y1HA 2YL5A 5HPCA 3A22A 4KFNA 4IGNA 4I9TA 4XBJA 5IDZA 1XLEA 1MQQA 1OYBA 3OGVA 4PEEA 1VJSA 3GW0A 4O13A 4GK8A 1VYRA 3GH4A 1PE1A 2UBPC 1PO9A 1M7JA 3W7HA 1XLJA 3UD6A 3BGAA 1AH3A 4N9DA 3FVDA 3W1LA 3TA9A 2YX0A 1O60A 3UJ2A 4JNYA 2OR2A 2RFGA 2ZE0A 1W8GA 3NQEA 4BWLC 1KA9F 4XWUA 2O56A 4L64A 1J10A 3A21A 4N0RA 5BW6A 3VD9A 3AXHA 1HZYA 4Q22A 3F2CA 3KLKA 4QEHA 1AZ2A 1Z32X 3A9BA 3UWUA 1H5VA 3ITYA 3J7HA 3GC2A 2HSAA 4IF2A 4FNSA 4DO7A 1YTEA 1I2PA 3R25A 2WVUA 2W3ZA 4BI6A 5HJYA 2CLOA 4XIAA 2JIWA 1A53A 4MHBA 5EMMA 3IUDA 2Z00A 2WQDA 6ALDA 1QOQA 3TTEA 1V0NA 4W5UA 1RD5A 2NWSA 3ICJA 2X0HA 4LT9A 1FHVA 1LQ2A 1TRIA 4US5D 6TIMA 3WDRA 2PDLA 4O8AA 4H8VA 1XKYA 1V6XA 5AVHA 3AHXA 2H8XA 4U28A 1XS2A 1W3TA 4MPKA 2QNEA 1O66A 4HTBA 5F1VA 4OECA 4PR4A 2V8ZA 2C15A 3MHFA 1EXPA 1I4NA 1JAKA 1KLYA 1P0NA 2PDNA 1VFLA 5AB3A 3E9AA 2I7GA 3WUEA 4AC1X 4OZOA 3G1HA 1JDCA 3UXDA 1AQHA 1EA0A 1CCWB 5CGMA 3H4GA 4H3DA 1ITQA 3AUJA 4MKVA 1OSEA 6TAAA 1OD0A 5K4XA 3V3WA 3A5VA 3WLLA 3W2KA 2X09A 3USBA 3LZ3A 1OFOA 4C6QA 3GVVA 2NQ9A 1EH9A 5KTLA 3WQWA 1TB3A 1VKFA 5FEZA 1RBLA 2CLIA 3WJZA 4MLJA 4ATWA 2FVMA 3VDCA 3IAQA 1VEOA 4HNTA 1WE5A 4CD4A 3B0XA 1B54A 2PDQA 1P1XA 1XGDA 1F2JA 1I2NA 4I7VA 4JTJA 4I5UA 3NEVA 1WB0A 4ONVA 3LI1A 4LCQA 1B57A 4C6IA 3S5OA 1KWKA 1YEYA 3FLUA 3ZT6A 2FIQA 3MCMA 5CEWA 5JIPA 5AECA 3ID7A 5H6HA 2G3JA 1M04A 1EIBA 2D73A 1G4PA 4L6OA 1V93A 3POCA 2VXNA 3VINA 5CAKA 3RLVA 4BQ2A 4LQ1A 4B3ZA 3CH0A 3TQVA 1C8QA 1AW2A 3CL7A 3VCCA 3UT0A 5J5RA 2YDQA 1OT2A 1PSCA 4IG2B 1W3HA 4JN7A 4LUIA 1UUQA 3LU2A 4HSNA 4AXNA 3GDRA 4AIOA 3HTWA 1EYEA 4Y9NA 4A3RA 3TE9A 2RDTA 1W9VA 5B7ZA 1QPOA 2DP3A 3C2VA 2HE8A 1VFTA 4UFIA 4AZIA 3NVDA 3WNOA 2REQB 3TYZA 1EC9A 5HNTA 3GFZA 1DWAM 3QSTA 4Z1AA 4JGDA 2VGBA 3RX4A 3O6DA 1UIOA 3GUWA 4F9DA 1H7XA 3KVLA 4PGLA 3UESA 1EEXA 3BZJA 2DPEA 4LCSA 1B3ZA 1VIWA 1SSGA 3PB0A 4H1ZA 3N15A 3ABRA 4X22A 2E7FA 2ZZ2A 4DWDA 1UP0A 1P43A 5C9RA 3NOEA 2OEKA 4DLFA 5BRBA 2VR4A 3WQPA 4M24A 4UTJA 2A7RA 4JICA 3KCLA 2CLEA 2QDHA 2I9EA 4Z08A 1XLMA 4ORIA 1R3TA 2P53A 2P8CA 4AZGA 4F8XA 2EEXA 4Z1DA 4AQLA 4ZOEA 1ECQA 4EACA 1O94A 1YKWA 2WZIA 3LB0A 1XINA 4G1NA 1J0JA 4Y8FA 1EQCA 1BYAA 2PU0A 3GHUA 1R9YA 2NLIA 2PP0A 1JFXA 1ADDA 3BSHA 3PM6A 4IISA 1A4MA 3L4WA 3W2NA 1WDWA 1Q8JA 3M7SA 4L56A 4MLRA 3PJWA 3TDFA 1XBXA 4LUTB 4GHRA 2QUUA 3GX9A 3P81A 3RIKA 5D2YA 1A3WA 3NZGA 4LYPA 1QNQA 1PHQA 1T5AA 2D0GA 3AIBA 5HNNA 4GUHA 3CTTA 4FXJA 1UPMB 7TIMA 2GFTA 3TVAA 1EO5A 4C6FA 2V30A 3IUIA 4JTTA 3LHYA 2DIKA 2WCGA 2W92A 2QAPA 1SO6A 3LCLA 1YIXA 2ISWA 3G1SA 1D7FA 2HBXA 4U10A 4YLWA 5EMKA 4H8UA 1Q6EA 2GSEA 4FF7A 3QH2A 3W23A 3ATYA 1S1RA 5CCZA 1DJYA 3NM3A 5DMMA 2OT0A 2PA6A 2WHMA 3GNOA 3V0TA 5CC6A 3VNJA 3W27A 3WLTA 1FY6A 4HHHA 1TO3A 3FK4A 3RR1A 1XQKA 3TW9A 4IOTA 2F9RA 4UTWA 1BPLB 3HMCA 4HQVA 5LA1A 1AMKA 1FH8A 1TR1A 2P8BA 1GPFA 2EF9A 1A0EA 3LY0A 1PX4A 4BQ3A 3WK2A 1HL9A 3F4NA 5C7HA 1EYWA 1J18A 2WWDA 1PCKA 3DBNA 4AIEA 2E6FA 1V5XA 4C6OA 4MB5A 2EQDA 2E68A 5FAJA 2EAWA 3WBAA 5CG7A 1IE7C 1TVNA 1LWJA 3CB3A 2W5FA 4DM2A 3W1RA 4NRSA 6XIAA 2RAGA 2VCAA 2XTKA 1Z6KA 1AA1B 1B4EA 1CGYA 4E5TA 2ZZ1A 3TOYA 4KCTA 1E4IA 3O63A 3UY8A 1JGIA 5AZ0A 1VHCA 3GHTA 4BHYA 5HUOA 3T05A 2FGBA 1RP8A 4MDPA 4KWVA 4Z0JA 1GOKA 4W7VA 3UXIA 1MW3A 5LGXA 3NL5A 3LLDA 2PTZA 2BHZA 3OHMB 9XIMA 3GC4A 4ERIA 1DXFA 4XD4A 3TCSA 1QNVA 2VKZG 5BU6A 5LSMA 3VC5A 4PTNA 1QI4A 4XAGA 3VIOA 2HVOA 3NQFA 1XPGA 3M0IA 3GBEA 3UZJA 3B0UX 1HG3A 1PCWA 3M07A 2Q8ZA 2CIPA 2PCQA 3C52A 1B1YA 3GXNA 3W1NA 4D8LA 4QXIA 3WLQA 1U5HA 3QEZA 2WSYA 3HBLA 4BFAA 2DZTA 3U4FA 3TUUA 4JDYA 4PCFA 1NWSA 5XIAA 3NYDA 3VKJA 1FWTA 4TIMA 5E6ZA 1W5QA 2Y63A 1EO7A 2OWCA 4B91A 4ZEPA 2D2OA 1GNXA 3TZFA 4KEVA 1RJQA 3MMDA 3ARWA 4RNIA 3S5NA 3UXKA 2OB3A 3OLGA 3VI2A 4GQGA 3V4BA 4EPEC 1ZBVA 3VOGA 4LRSA 3IJLA 4Q7IA 2XH0A 1EJXC 1VC4A 1RJRA 1IXNA 3HM7A 1VBGA 4EXAA 4GXPA 3NDOA 2IPFA 4W88A 2NQJA 1T7LA 5T8GA 2BOFX 4GO8A 1YTDA 3QC0A 1VBRA 1P7TA 5A6BD 3KE0A 1FCQA 3G6LA 4DUOA 5FOOA 2PTYA 3WO8A 2WMJA 1EZ2A 2VGIA 4I6VA 3ABOA 4MAVA 2IPGA 2J9YA 4FR6A 2DFAA 1TX2A 4KT2A 3UWWA 5IOBA 2ZRZA 1KW1A 1L8NA 1YXDA 4M6VA 4B5WA 4Q4SA 1QBAA 2OGJA 3VGEA 3THQA 1ML1A 3IIVA 4JAWA 2EPOA 1TWSA 1V3KA 4XAFA 1H50A 4LUSB 2R82A 1O12A 1H60A 5D9MA 3VZYA 2Z1XA 2FMOA 2QT3A 3ZO9A 1IEQA 1W9DM 4E3TA 1ZJHA 2GK1B 3BAKA 3NZRA 4DJFC 1XCFA 2EKGA 5LGZA 2PDYA 4E2VA 2W63A 5HNUA 3BC9A 4J9JA 1M03A 4IJRA 1XYFA 2RJGA 4OU1A 3LXCA 4OQVA 3BK0A 3O8AA 1YBQA 3FGCB 4K8HA 1KRMA 1EB3A 4O15A 4KPLA 2X42A 4RE3A 2DVUA 4M56A 4ES4A 3VKCA 1JCYA 4U3CA 3NL6A 4R9OA 1E1EA 3I6RA 1QO2A 1Z48A 2NV9A 3R13A 4TTUA 1E0TA 1QXLA 1I2OA 3BDKA 2MANA 3KZSA 1PEZA 2CHRA 3G1FA 8CGTA 2NQ5A 3CQKA 1YNYA 3AHVA 2I56A 5K9DA 3U7VA 3WQDA 1QPQA 4ZFMA 1V8EA 1GYLA 4IMGA 1UD3A 4OE7A 5C7VA 3RJYA 2IKGA 5D04C 4P8XA 1CXLA 1TE1A 5LZLA 3UWYA 1X7FA 4F3HA 2V3GA 1RUSA 1ONWA 4Q4QA 4TU1A 2NWRA 3WLRA 3PG8A 3MUAA 4MWAE 5DO8A 1ISZA 1KRBC 2GVYA 1FH9A 2Y24A 3OW1A 2OO6A 4B5NA 4UXDA 2ZTJA 5F2LA 3CU2A 4KH2A 1XJBA 3W4RA 4HA3A 2DT0A 3WMCA 4FNTA 3MANA 3GVRA 3LM7A 4JL2A 4Q8QA 2GUUA 2F6XA 2H9AA 4IP7A 2ACUA 4B5TA 3IEBA 3DGRA 4HCDA 1GJWA 3R5EA 4DXXA 1T8XA 1JCTA 4UNKA 4N2YA 2XVNA 1HX0A 1Q6OA 3FW6A 4WDTA 5A1AA 1YHTA 2V63A 1FP8A 1K77A 3NQGA 3I68A 3WIJA 1WKFA 1LT7A 2PPGA 3VGHA 1V6UA 3HGSA 3KX6A 5KZDA 5IXEA 2VC6A 4IIGA 2C3ZA 3I3DA 1S39A 3EBVA 2VOMA 2DSKA 3BCJA 3W02A 1XCWA 3PPHA 1VPXA 3PBYA 4P7QA 2VEMA 4KIRA 3L66A 2J62A 2ZYFA 2V68A 4NIRA 3U7BA 3PP7A 1IT7A 4TMCA 5HOSA 1Q85A 1H1YA 5A94A 2DORA 3QFEA 1NFGA 4H4IA 3FKKA 4DZIA 4K1GA 5ECUA 4HKPA 4RXGA 1GW9A 2J8FA 2A3EA 4IJCA 4JY9A 3L9CA 2XUCA 2D2JA 4FXRA 5FJUA 1FKWA 1I45A 1C8VA 3P7YA 3B8VA 4A8IA 3C5QA 4QITA 3W85A 5CLWA 1R3SA 4XK2A 4XSLA 4JTQA 4ZO8A 5I24A 3ERPA 2UV8G 3M5ZA 1UWAA 2XSBA 1CWYA 1VFFA 1CGUA 3OZPA 3EEZA 1JAEA 3EWBX 1DJHA 2G95A 3GHSA 2JALA 2D2GA 5K9CA 4MJZA 2FH6A 3HPFA 3RO6A 3TW7A 4MMWA 2Z7GA 1J6OA 2QIIA 1WV2A 4GZ7A 1S2CA 5GNYA 2R1KA 1QWKA 3EDDA 3OEXA 1MW0A 3BOLA 1TV3A 3N2OA 1OQFA 4POCA 3BVJA 1OYAA 4D72A 4IFOA 4H9MA 4MF4A 4KCWA 1E73M 4NUWA 1UBPC 3EXSA 3EDJA 1VD6A 5HQMA 4GNKB 3WLHA 5CJNA 1H5YA 1LBFA 1WYIA 3HN3A 1FWWA 3UWZA 3GG1A 2CZ5A 1OC7A 4HPGA 4JKKA 5BROA 3P93A 4BQ4A 3DI0A 4NAFA 1SO3A 2D2HA 3GO2A 1GGOA 1M1BA 3T2OA 1SSDA 1QRQA 2ALRA 1GVRA 3GXMA 1C9WA 5GNZA 4GVGA 2OLSA 4DN1A 3CQHA 1I0DA 4U2YA 5K4ZA 3PUDA 4GQ0A 4N7QA 5AKQA 1O1HA 4IICA 2VEPA 3PZNA 3VM5A 4LNYA 1VRXA 4V33A 4L6HA 3BCDA 3HURA 5M03A 1OT1A 5F1UA 2FDMA 2YYUA 1T99A 3LQGA 3NM1A 5H8UA 2JKAA 3QBUA 4MWAB 5FF0A 3OHIA 3TJIA 1HP4A 1X8CA 3KCOA 2BVDA 5GNXA 5CSYA 4WOQA 1H7NA 3AXMA 1B3VA 1XSKA 3QKEA 2PDJA 4KW2A 1W5OA 5FSDC 5ABFA 2OX1A 8A3HA 3EMCA 3DESA 4AX7A 1KGWA 3LNPA 4WEVX 4XD6A 2J74A 2BY0A 3CMGA 2EPKX 3HGRA 5IBXA 4Z2LA 4Z0SA 4AZHA 2ZUWA 1P6WA 4MFEA 3VX1A 2VZTA 2E9LA 4AH7A 3NQ6A 4Q8VA 3RDKA 1RCOB 3GQYA 5DF0A 2YXXA 4WKHA 4HNVA 1D7KA 4DF0A 3AC0A 1J12A 3ZQ9A 1J2BA 4GNVA 3CUIA 3EKZA 1MQPA 4JN8A 3RCNA 1BHGA 4EPKA 5LIWX 3LSBA 3K30A 3H70A 2A5HA 1UB3A 3WLJA 5BWFA 3HJZA 4DF1A 3ZMRA 3LSCA 1F07A 3TH6A 3QV7A 2D22A 3UQNA 4ILSA 1AL8A 3A12A 4PTWA 4QE5A 4YL2A 4AEFA 2G41A 3L68A 2QULA 4C7DA 1HJQA 4MIMA 4DPQA 1WO2A 2XZ9A 4HHLA 3GDLA 4AZ7A 2YA1A 6REQA 4C91A 4PSRA 2PBGA 4W86A 3TKFA 1FA2A 2P76A 3CBWA 4IUGA 4XZBA 2I16A 1FTXA 1FDJA 1PX8A 1NFBA 4A05A 1V3LA 1KB3A 1WBJA 2DSVA 2D24A 3E5BA 4CD5A 5CC7A 1CXEA 4B9YA 3S0CA 1BG9A 1LP6A 3TJLA 4XD3A 1PKLA 1Q65A 5CZKA 3B9AA 1H4PA 1MEWA 5T9CE 2J7FA 4M6UA 3WUBA 1B31A 2OWXA 2DVTA 4HN4A 2BFGA 4BS0A 1S3TC 3HGJA 3QHNA 2TYSA 1EX1A 1KC7A 3S1XA 3W3OA 4GCAA 3TAOA 2WC4A 2ZA2A 3DFOA 4UZUA 1RPKA 3S6TA 1KKRA 3CQ0A 2Y62A 1AFSA 1R3QA 2Z7KA 1J6PA 4QRNA 1HJSA 1UWUA 4DX3A 1ME8A 2OO0A 1P1MA 1IZKA 2HZGA 5E5CA 3VNIA 2P5NA 2C8NA 1UWSA 1JUKA 2AAMA 1E3XA 4GMEA 4FXFA 1U5VA 1ISVA 2IW0A 1LJYA 2A3LA 4NRRA 3IIXA 4K3ZA 4P5UA 1SFLA 3CHVA 3WJXA 1C29A 1SR0A 1SVDA 2ZBTA 3TYAA 1F6KA 3A64A 5CBJA 1XG3A 3TK7A 4UTWC 2C0HA 3GY1A 1TPDA 3U3HA 3I10A 3VDHA 3E0VA 3WD1A 1Q6QA 5EMYA 3CIXA 4HCHA 3HFTA 4GI4A 2Y8KA 1VFSA 3H23A 4NHVA 2G3FA 1OB0A 2AKZA 3RCMA 3B03A 3N19B 1XDJA 1EDTA 3H4WA 1E9LA 3ABXA 4H6EA 1LWIA 4W87A 1TQXA 3T2PA 1BVWA 1QO5A 1QDSA 1XH2A 3SCUA 1S2TA 2YL6A 3EKLA 4ZE4A 3T0TA 1HKWA 2BLEA 5AYXA 2WHLA 4YTQA 4NZ3A 1W17A 5I23A 5I2UA 5LIYX 3N6JA 3WF2A 1R2TA 4HNCA 3AS0A 3NA8A 2YCLB 2EPMX 1V0MA 3N4FA 1R6WA 3SIZA 3UETA 5AFDA 4MNMA 3DFSA 3W7KA 1GKRA 4IMCA 3WN6A 1JQVA 1XIGA 2WBKA 3ITLA 2D23A 1SJBA 2QCDA 4EP8C 2R1MA 3PNZA 4LBUA 4IMFA 6XIMA 1UD4A 2QMJA 1E4MM 3IGSA 2ZVRA 3VABA 1JYNA 1PTDA 3C2OA 1KFWA 2B7QA 2P88A 3NPXA 2NZLA 2ZRYA 4Q4KA 4B4HA 1W3LA 3OJGA 3V35A 4K7VA 1E0UA 2AQVA 4DXKA 1P0KA 3MMUA 5HNRA 4W8BA 1P4CA 3T40A 3GAYA 3UBPC 1EKOA 3H2FA 2AMGA 3WUFA 1M41A 3GKAA 1PIFA 2XVPA 3O1NA 3QMRA 5F2MA 1PZ1A 4HSHA 4PRWA 1UH2A 2CITA 1DQUA 3AIUA 5G2IA 1NWUA 2B4GA 2H6RA 1M01A 4NSBA 1UPPA 5E1QA 4W7WA 2F6KA 3W7RA 3P61A 4YMZA 1DYSA 1CTNA 2OEJA 1H3GA 2GDVA 4I7WA 4LH8A 3RO8A 3E02A 3QF0A 2PDFA 3P60A 4A3HA 1S5TA 3RU6A 3RXZA 2VEFA 3SN0A 1KV5A 1OY0A 2PWHA 3VILA 4PUUA 2OZTA 1KTCA 4GYPA 2PS2A 3UYCA 1BRLB 2NT1A 1XWYA 2QUTA 3ZR5A 3CZJA 1SO5A 3SRKA 3DXIA 4NX0A 1R47A 2XSXA 3IRSA 4M29A 3R89A 3QR1A 1TPFA 1HJVA 3SGGA 2AAAA 4GUFA 5FEXA 3W7IA 1XIDA 3ZLGA 1EPVA 1R38A 3OQ8A 4LVFA 4PRRA 4INFA 2WVVA 1UCWA 2PDWA 1RD6A 1D8WA 1IGSA 1WOAA 4IGSA 4P7RA 3WQGA 3SBFA 4L65A 1E9IA 1TKKA 3C86A 4W8AA 4G5DA 5SWUA 2X1UA 5REQA 4DAFA 3W53A 5C9XA 3G1VA 5A6TC 2XISA 1IR2A 2PZNA 2WZHA 3CHFA 4ZSTA 4D8ZA 2QKFA 3VTRA 3H54A 4GA8A 4IXHA 3QV6A 2YCKX 2QVHA 3I65A 1X38A 2VMFA 1DIOA 5D4YA 3IAPA 4GPNA 3OBEA 2XH2A 4IZGA 5G4EA 4K36A 5C54A 2GVLA 1J79A 2FPYA 2X41A 1PWLA 2CLKA 1QI5A 4WK9A 1DKWA 4ZZ9A 2UZ9A 3JZUA 2V38A 3TC3A 3CZKA 1JCLA 1GOOA 5ENLA 2ACRA 4NYYA 1WDDA 2HRWA 1NU5A 4OVXA 4BR1A 3F5LA 4C1LA 3IRDA 2H90A 3Q94A 1SW0A 2DW6A 4KETA 2B31A 2XSAA 1AJZA 1TIMA 2AL2A 4DNMA 2JFEX 1K8CA 2V0TA 4X63A 1MNZA 1XLBA 2E09A 5I09A 2UY2A 4A2SA 5MKGB 3UA4A 1BTMA 4E4FA 4ERGA 1TZ7A 1I60A 4WCJA 2DH2A 3N73A 1GWJA 3W2LA 4WRHA 2QJIA 3SCOA 3UZWA 1K9TA 4GFSA 3CQIA 3M5XA 1A47A 3DGBA 3WG6A 3H7VA 3S1UA 1F3TA 3DKJA 4L5ZA 4DI8A 4ZB2A 3CTLA 4RE2A 2Y70A 1XCXA 3CZGA 1ALDA 2FHCA 4CCEA 5A8QA 2OG9A 2H3DA 4NQ1A 4EIVA 2PWEA 3A6OA 2NX1A 1HO1A 1BG4A 2QPUA 3NIYA 3DH7A 3DX5A 4DQWA 5DX7A 4U2ZA 1R85A 2BGNE 4XZLX 4NAEA 5CAHA 2EPHA 4GOAA 3ZJ6A 1LQAA 3MA8A 3CK5A 3B9DA 2GPTA 1LQ0A 3L65A 3WD2A 4ML9A 1BSLA 3KDOA 3ENLA 4FALA 3LK6A 4GJIA 1SFJA 3B9NA 1E55A 5I0DA 1C91A 1JZ8A 3GE7A 3W00A 4ZOCA 2CZFA 2BWGA 4FSAA 1TMHA 4KCUA 3TNBA 3S9ZA 2J24A 4GACA 2OMAA 2R94A 3LUTA 1H62A 1A49A 1ZGDA 3ITOA 3W37A 1EXBA 3U8GA 4KCVA 3BANA 1DIDA 3LHTA 2PDGA 1DORA 3AHZA 1JJKA 4LCRA 1R7OA 2PP3A 3G0UA 3QZ6A 5FEPA 1NVMA 1X96A 1TMLA 4ZR8A 1GEQA 1VBJA 4FO4A 2OYKA 3UVAA 4HD5A 3GK0A 2VDIA 3OVPA 2TODA 5A8PA 3QZAA 1FDYA 1WZAA 4XISA 4WXYA 1XD0A 3SCRA 2PSNA 4XO7A 1JPMA 4MUPA 2IPWA 4EPBC 1E0VA 3MP3A 1DHKA 4XO6A 4MZYA 2YKKA 3BAIA 4LF1A 3IJ9A 3UWVA 3NAVA 1YDNA 3BV7A 2QW5A 1UKQA 2PUZA 4MWAD 3TSMA 3A24A 4PB4A 4PCPA 4QBXA 2I17A 2ANUA 4FS9A 3S1GA 3T1GA 2VWTA 1WNOA 1JULA 7PTDA 3EDFA 1W5NA 3M0XA 1DIKA 4PYSA 1KQYA 3KXQA 4JTCA 1G1YA 3CAKA 4H9XA 4HMDA 1SZRA 5HPOA 1JZ2A 3IJ7A 4I7UA 3ZR4A 4X9YA 3PTDA 4WY0B 4D6HA 3BSGA 2Q8LA 4Z42C 3P80A 3Q65A 4H83A 2BX7A 3SY8A 3XINA 4IQJA 1FCUA 1HN1A 1GTHA 3PHAA 4ZTXA 2VUYA 4ADSA 3FX4A 1H1NA 1PXGA 4JFTA 4XSMA 1G01A 4O50A 4DWSA 1XG4A 2VDHA 1QJWA 1FKXA 2RHGA 3IJ8A 1CEOA 4XAZA 3TQKA 5EYWA 1QHPA 3LOTA 3CXOA 4G1KA 1K8XA 1KBIA 3R94A 3B9OA 4M6QA 1N82A 1SGJA 1THFD 4RV3A 3WENA 1W2VA 3UNTA 3BUVA 4TXEA 1TTPA 4AHQA 3R4IA 3WD0A 1VR6A 4IPNB 2WMIA 4AAJA 4K1WA 5FL0A 2IQTA 3VNMA 4XBKA 3SM0A 3VKBA 4F0RA 4H9ZA 1MSSA 3G1AA 1J96A 4S39A 3BAJA 4IIHA 1RVGA 3ZVHB 2DIEA 2VFHA 2QJHA 3A23A 2RDUA 1JF5A 3H21A 1EZWA 2DU2A 4FP1A 4Q4RA 4FNPA 4RZ4A 3LGGA 1U5JA 3RCYA 3TFXA 1W3NA 3PZVA 5IBXC 2V5JA 5JH1A 2NUYA 2ZC8A 4UNIA 1QNPA 3ZIZA 4Y9PA 4D6EA 1NSJA 4RR4A 1GTEA 4Z1CA 4HMNA 2DSWA 3MTWA 2DZUA 2PEVA 3MDUA 1VLIA 1GZJA 1XH1A 3BICA 2OYLA 4MY1A 4CU6A 1A5KC 3AIQA 3PB2A 1HVXA 2WCAA 6ENLA 2AMXA 2NSOA 4QR6A 4NL1A 4RE4A 4UB9A 4A22A 1TPC1 5HDRA 1VBUA 2LLEA 1M7PA 4HU0A 4PC8A 3WQOA 3NL3A 3FEMA 4I9AA 5HQLA 1KD0A 3OGSA 4L1WA 3KOZA 4CNPA 4EXQA 1TJRA 2ONEA 3N2MA 4EAYA 2X0YA 2C18A 3MWAA 1JPKA 3ITVA 5E6YA 4E2OA 2CXEA 2AQOA 2QAFA 1K6AA 4YWSA 1ZHAA 1TG7A 3NQMA 4JX6A 1ZAHA 4NI3A 4EWJA 4U31A 4MADA 2V5BA 2EPNA 4F0MA 3VNYA 2DZBA 2XINA 4FLOA 5DT5A 2E28A 1KBJA 1EUAA 4JFUA 2J7BA 1E3ZA 1EJ7L 2Z0IA 4DVOA 4GC4A 3ARVA 1Q66A 5A69A 3N29A 3MBFA 4HMCA 5EBAA 3M0HA 2UY4A 4WXZA 1ICQA 3F5JA 3QR0A 3O07A 1E71M 5I3GA 4JPGA 4W9TA 3WNLA 1HGYA 1HT6A 2YL8A 3MZNA 3TJXA 5HA7A 1K9FA 1K7FA 4I5RA 2BV9A 2CCRA 5AZ1A 4Q32A 1K3UA 4EKJA 4DYJA 3N25A 4MB4A 3UYIA 1PPIA 1PX3A 1BKSA 4PB3A 4UR8A 1SM9A 2G0WA 3PUOA 2XIQA 3NR0A 2PTXA 1E0XA 1JZ6A 4A8NA 1TPUA 1QR7A 3FV9A 5AC4A 1KXVA 3DG6A 5IRPA 4CCZA 1L9WA 3QN3A 1XRVA 2W0UA 2QCCA 4J27A 3S5ZA 3GVGA 4CCCA 1ZALA 1ZZMA 3QOKA 2G37A 4AWTA 1VH7A 2GDQA 3VDBA 1W1A1 2WMHA 3HMJG 3AYTA 3MU7A 2C7FA 1GOIA 5FD0A 1L2QA 1TREA 1Y65A 2VFEA 4IHCA 4I9MA 3CWHA 4NJJA 4FF5A 2VGFA 1QOPA 1OM0A 4JTDA 3BH4A 4JTLA 3Q67A 4HU4A 3H26A 4ACZA 4ZOAA 3KCJA 2RDWA 2VRJA 5F2IA 2BXYA 5CZ0A 2J4GA 1QBBA 3CYJA 3VM7A 1KGXA 3P8JA 2OU4A 2XIMA 2PWDA 2ZICA 1R7AA 2NT0A 4N9BA 3PZTA 2Y5JA 1W3KA 1CENA 3VMNA 1JPDX 1OFRA 1CGVA 1Q7MA 5FAGA 4UCGA 3F4WA 5LHFA 4PMXA 3ZLHA 3B0PA 1UQZA 3DOPA 4S3BA 2CZVA 3G1DA 3XIMA 1RALA 4Y7EA 3AU6A 2FTPA 3IGUA 2HBVA 2J7GA 2HJPA 3AJ7A 4EF8A 3LNMA 4Z2IA 2RKXA 2HK1A 2Y0FA 3TTYA 3N11A 3M64A 2V3FA 3MQTA 3H12A 3M5VA 3MSRA 1S5VA 4ZE5A 4BEQA 3BE7A 4O1BA 3BQ6A 5JQ9A 6A3HA 3ABSA 4R5EA 2DT3A 2ISSA 2MUCA 2J25A 3LRLA 4YXGA 3PY2A 3T0DA 3R11A 3HO8A 3CHEA 2A7NA 1K03A 3VIMA 3KBWA 3WLIA 2WOQA 5A2AA 4AW7A 4C6KA 4DWSD 4JTGA 4ENLA 2OYMA 5BOEA 3CZEA 1RA5A 2V9DA 5EY5A 5LNVA 2HMCA 5KINA 3N2XA 3MSDA 3PZ9A 3VIJA 1GOWA 1Z89A 3LTYA 3VNZA 1K70A 2CFFA 4GYPC 3R0DA 1W1PA 4WKFA 1MEIA 1W3IA 2ESCA 3WFLA 1LUCA 1AVAA 4NXSA 2EGZA 1ME9A 3T09A 4HU8A 3EOLA 3PAJA 1GCYA 2AGTA 3FSTA 2VHLA 3LERA 5LKYA 4ADUA 2PDIA 3QY8A 4S3CA 3QQ0A 3LCWA 5CZTA 2VR5A 1FDZA 4CU7A 1IYXA 4Q8PA 3W71A 2XIOA 3QV9A 4EE9A 4F0HA 1KM4A 2WJZA 2BMBA 1DQWA 1S2VA 1XLHA 3QKZA 4CQ9A 2QUNA 3BMWA 4IFKA 4S23A 3NGFA 4URIA 5JXQA 1BSIA 3AIVA 4JR5A 2A6NA 4I5XA 5A6KA 3C56A 3PTQA 2PGWA 3CIVA 3WL1A 1E6XM 1Q7ZA 2QS8A 3IANA 4MJMA 3ZFHA 1ESWA 5C55A 3P8IA 4CNOA 2VEIA 1V6VA 3BXWA 1D3GA 3VE9A 1Z3NA 4B5UA 5I3DA 1EHAA 3NQ7A 4KRTA 4XZWA 3KL5A 4JEQA 4KQNA 1H11A 2QJJA 5GJMA 3H22A 2Z1BA 1UUOA 3M47A 3R0UA 2GVJA 4HOWA 1BVNP 1OJXA 5JH2A 4PSPA 3C4UA 4FLSA 5REQB 4MNKA 1E0WA 2WKJA 4O10A 3PF3A 3ZJ8A 1TV7A 1XDLA 2XWEA 3LBCA 4LPCA 1FXQA 2H8ZA 4GYKA 3KL3A 3HPAA 4QIUA 3C2RA 2PF0A 4XKYA 5I02A 3B4YA 2HCVA 3U4AA 2FLIA 7REQB 2X1IA 4ZO7A 4GXWA 1ZAIA 4KWWA 1PIIA 5TQLA 1BXCA 3LA4A 2ZXQA 5BOFA 1GVFA 2DJXA 4DO4A 3C3NA 3ALFA 1Q6CA 1AODA 1XF0A 1CB2A 1UIPA 5ABEA 1JRBA 5CSRA 4CVUA 4LANA 2O9OA 3ZLFA 3PBUA 1OK4A 1EWDA 1FWAC 4N02A 1H61A 4DM1A 2CESA 3BLDA 1L6YA 1OBAA 3WYZA 2NV1A 3INPA 1DJQA 1X8FA 1QI2A 1XLKA 4REQB 1R8LA 4DEFA 1TTIA 4JXCA 4OKDA 3MKVA 3SSZA 2J8TA 3PUEA 4AZCB 4HTYA 2VX7A 2PDBA 2XVKA 1NM9A 4LRTA 3UJSA 4HNNA 2XM1A 4GUIA 1NOUA 4LYKA 1XRFA 5GJNA 3M41A 1SJCA 3BCFA 2BOGX 1UA7A 4GNJA 4DO6A 2TMDA 4PBEA 4FNRA 1DJWA 4H8HA 3HA1A 3BGGA 4DELA 4GQRA 2YXGA 2QCNA 3IIOA 4GRSA 1I1XA 2E6DA 4UQAA 4Y9AA 1TCMA 4H6KA 3PZQA 4NZ4A 3VD7A 4PMJA 3DHPA 4DJEA 4O8RA 3HG5A 2PF8A 4C5ZA 1UR4A 3V5OA 2ZKMX 5KITA 1PZ0A 3L0NA 1GVIA 4J3SA 3SECA 1ITUA 3PJXA 3D0CA 1E72M 2OQHA 1G5AA 4UTIA 2G3IA 4GI8A 4HHMA 5CPOA 1VHNA 2F38A 4RNHA 4J3VA 4YVVA 1E70M 1W1YA 4NI8A 2HPMA 3IGHX 2ISFA 2Y2WA 2YBTA 3PR2A 3AIRA 3OODA 4ZVJA 4YYFA 1LZOA 5FJJA 1NP2A 3H2OA 4A6GA 3FHAA 2ATSA 4IQLA 4MTVA 3RM8A 1R9ZA 1KCXA 4NJGA 2XDFA 4CNNA 2GGIA 4KWOA 4I90A 2VQUA 3M6DA 3S5SA 4N6EA 3G2GA 4W85A 1LG2A 3NYZA 1FWEC 3CPUA 3SSJA 1IEVA 3VCNA 5GPRA 1C93A 1TA3B 2ZZ3A 3MMWA 2C14A 4Y96A 3TNOA 1XKJA 4G6CA 1ZUAX 2DJLA 1CBGA 1K7EA 4A3YA 5HXMA 1EPXA 1GOMA 4IQEA 1F8IA 3TTQA 2OLHA 3VX0A 1WDRA 4XTIA 4XZMX 6CGTA 3ITCA 3IVSA 1OF8A 1DWFM 3UJFA 1KKOA 5CJMA 4UTHA 2VEKA 3VFLA 1DIEA 1XHGA 2FFCA 3HQ1A 4GD0A 3GR4A 2CYGA 4MZ1A 4NYUA 3BW4A 1QWGA 1A0DA 5EU9A 3QC3A 3HJEA 3HQOA 4J35A 2BSLA 4GIRA 3E0FA 1GZGA 2QDDA 4XZHA 2FYMA 2QCHA 1JCNA 3REQA 2DDXA 4JKMA 1CLXA 2HS8A 4MNJA 1YXYA 2FMNA 2FB2A 1HP5A 3FA5A 3EA2A 3TOPA 5EMLA 1LOSA 3FVMA 3GM8A 3G3DA 3UZYA 1VCGA 5JUVA 1VIZA 3FAWA 5HMDA 4CD8A 5D09A 3N17A 5EFFA 1I75A 1JG9A 2C79A 3GR8A 2FZDA 1BF6A 1EJUC 1G67A 3KZPA 4KESA 1K02A 1OIFA 5CBIA 2X0SA 1EGVA 2FZNA 1NTHA 1OFEA 4H6QA 2Q3OA 2XIBA 1AW5A 1WZLA 2B0MA 2CBUA 2D0HA 4JZ5A 3UG5A 2ZXBA 5L9FA 4US5A 4B2DD 2ZX6A 1D2KA 5TNVA 3MC5A 3VC6A 1TV4A 1XYBA 5JU6A 3WQ4A 2HK0A 4GI6A 1V79A 3I3EA 3OU8A 5DCDA 4MOZA 2GYIA 4CN4A 2NUXA 4UQEA 3QZEA 3W22A 3V1PA 4GBUA 2HWGA 4K68A 4OWGA 1WUFA 1W56A 1DJGA 2ZZ6A 3WQVA 1QVBA 1NY1A 5FF4A 1Q45A 2VQTA 3EDEA 5A6LA 3EX3A 4JL1A 8RUCA 4X9SA 4QQ3A 1WUEA 4WSJA 1AJ2A 1DOSA 4FI4A 1UWRA 4O11A 3W84A 2FJKA 1DE6A 3SY5A 1IHIA 2YDAA 3W25A 5G2HA 1ZLPA 4GIYA 1AL7A 1BWKA 4Q8WA 1US0A 3UXAA 1E1CA 2YYTA 1ELSA 3WMBA 1RK5A 1B5TA 5C9ZA 3AMLA 2NQHA 3S2CA 3THAA 1OX4B 2MNRA 2O7QA 3RN6A 3H8AA 3ZZ1A 3HG4A 1POJA 4E4UA 3UFYA 3K13A 5JBFA 1XM3A 3E0WA 3GFXA 5E0FA 1XIIA 3B8SA 3HIJA 3HB9A 2WJEA 5JMUA 2OT1A 5ABHA 3W7NA 4A29A 1QW9A 3OBAA 4BJHA 3CL8A 2O4MA 4C7GA 1US3A 3KAOA 2WCSA 3N6QA 4G7EB 1Y0EA 4DUVA 4C1NB 1WDPA 2QCEA 4ZMGA 3P6LA 1LTDA 1EGMA 3LBMA 4B5VA 4DUXA 1JDFA 5DCBA 1XUUA 2OQLA 1VYPX 2IQ0A 4S1FA 2X16A 4C7FA 1UROA 3P5ZA 3P14A 3M9YA 3VGFA 4UMBA 2WPBA 3EMZA 5D38A 1E5NA 3DI1A 3HPSA 3S42A 1TWWA 1DXIA 3A4AA 3BW2A 1B30A 4MVAA 4DJDD 4CN6A 3DFNA 4I6KA 4Q6JA 1AD4A 3H6OA 1UR8A 4R34A 4W93A 3NZQA 2EXOA 4Y6GA 3U57A 4JS3A 1SW3A 1P5BA 3IIZA 4Y8EA 3P82A 4LX4A 1O6IA 1REQA 2XH4A 2ABAA 1XC4A 2C1IA 2CNCA 3WF3A 4HVXA 1LRTA 1OZMA 2Q3RA 1V3JA 4D6FA 3L21A 4O12A 3O16A 3DERA 1C3FA 3MI6A 2Q71A 4BZYA 2RH9A 3EOOA 2ZZ7A 2PCEA 1UR1A 1MYRA 4WGXA 4LXFA 2BXVA 3W86A 1XYMA 2PODA 3I7SA 3UERA 3H55A 5H8MA 4YTRA 3LHUA 4JNZA 1HUVA 4PA8A 3TEVA 4QSHA 2YGYA 3VD4A 3TTSA 3AYSA 2VELA 3AROA 4LUYA 4CD7A 3PK7A 4CEUC 5K9XA 2A4AA 3PZUA 4O14A 2Z1VA 1HL2A 2PE4A 3T7VA 3VMOA 2P0OA 1BYCA 3E5PA 3QHOA 3WF1A 2BXZA 1H49A 3B4UA 4A8LA 2F6UA 4ROPA 5CPMA 4H04A 1XRSA 4WJ8A 2WC7A 2BHUA 1M3UA 4JTRA 3U9IA 2PDPA 7TAAA 1UOZA 4HPXA 2PTDA 2XHYA 1HKVA 4KBXA 3AI0A 4OBSA 1V6WA 1C7SA 3UEQA 3GXDA 4M51A 1J9YA 1UD6A 4DRSA 4WSKA 4GLEA 1JXKA 5C2GA 2ACQA 3GDMA 2YIHA 1GVOA 1ZBKA 3K2GA 2V5LA 4O28A 2OZ0A 1NDVA 4QQUA 4V27A 2YXOA 3ALGA 5C2CA 3CMJA 1UG6A 3L0GA 3SCSA 4ZA0A 2HEJA 4H7ZA 2E3ZA 5G1YA 1TJ1A 4WY0F 3NSNA 3I3BA 4WLCA 2V2DA 3A4JA 3JUGA 4QX4A 3MO7A 3TXZA 4HJFA 1IEIA 2ZX5A 1EJTC 1YNPA 1HKMA 1XBYA 3ZS4A 4CQAA 3OYZA 1QW7A 3MVIA 3FSUA 5FKYA 3VU2A 4PTDA 5C71A 2DUZA 3KOYA 2RUSA 3QW4B 2V2CA 3U0HA 3NFUA 1JNDA 4UFJA 3FOKA 3SDOA 1F6PA 4OOUA 1CGTA 3LGDA 2EG7A 2J79A 4LUJA 4QISA 1W9UA 4IX0A 4AXKA 1I2QA 4NNAA 2NX9A 4LEQA 5HUPA 3R8HA 1H09A 1V02E 4NZJA 1WQ5A 2B7OA 2TSYA 3DKLA 3NQVA 2WZEA 4PCNA 4XZIA 3OG2A 4PB5A 1Q6GA 4LOCA 1J5TA 7CGTA 2D0FA 4J7RA 1FHDA 2XIIA 4JQ4A 3SN4A 4RW5A 2BOEX 4ZXLA 1V03A 1WAWA 4Q6XA 1JXJA 1QHZA 3ME3A 2WK2A 3VD5A 2AL1A 2JE8A 4IIEA 3W1AA 1M53A 2VD9A 3TFCA 2YB1A 1VAHA 2J78A 2GUYA 1OFDA 3NEHA 2XZ7A 4ML4A 1Q6LA 1OFQA 3L4TA 4DBUA 4QAIA 3M43A 4QDMA 3IS4A 1JYWA 2GJLA 3C3UA 2V5CA 4QS6A 1SMAA 4TV5A 3EWYA 1A5BA 4A4AA 2Q09A 1UJQA 2I1OA 3THDA 3KS5A 1VP5A 1KRCC 4E8CA 1DL3A 1E51A 3EWZA 2J88A 1ZSXA 2OGYA 4UQDA 1SFSA 1XD1A 1MFUA 3G77A 3AHYA 4C6JA 3EYPA 3PTKA 4WX2A 4IIBA 1R87A 3HV9A 1S2UA 4LU0A 4RDWA 4C65A 1QPNA 3CUJA 4E4PA 1ZY9A 1HJWA 1VCVA 2WLZA 2PI6A 2G5WA 5HJXA 4W89A 4H2HA 4UTMA 4QG8A 1XC6A 1OCQA 1BYDA 4LEFA 3CLWA 1JZ4A 4JTUA 1Q2SA 2O4QA 3W29A 5EA9A 4LYRA 1IT0A 1TVPA 5A6BA 3IK2A 2V81A 4WSHA 4J2MA 1XBZA 1OGGA 2PBOA 2QJNA 5D2XA 2I5QA 3C61A 2VURA 4ZODA 4JHZA 4PL1A 5F4SA 1VEPA 4GY0A 1SQ7A 4EAMA 1JNEA 2DZWA 1FRBA 1AQFA 3WKZA 1U2YA 1H63A 1H1ZA 3W1UA 4AG0A 2OZ3A 1JPIA 1VRDA 5IDIA 2ASHA 2CHOA 5MHBA 4LYQA 4PTVA 5FF3A 1KFJA 2ZRUA 3MP4A 2HTMA 5BOOA 4GO9A 1TSIA 1LCOA 1U1JA 1P0BA 3KBNA 4E3VA 4AVNA 3VCRA 2YFNA 3UWEA 4AEOA 1AUSL 2QHAA 4N4PA 3HQNA 4PTXA 3K46A 2XVGA 1N8FA 4ZBCA 1XDMA 4LALA 3L2MA 3RMJA 3VIIA 1D9EA 2ALDA 3PULA 5DLCA 5CPTA 3PJTA 1UZ1A 2I14A 5HULA 1CGXA 1DQXA 5T91A 3PVFA 4YU1A 2W27A 4DJEC 2V69A 1HIZA 1D3CA 2JBMA 2QZRA 4HMEA 1TYGA 3MYPA 3ITXA 3COTA 2OVLA 1KR1A 1M7OA 4CQDA 1AJ0A 2W62A 3CJPA 4Q3MA 1PVNA 4NP7A 3BLFA 1ZTVA 1MNSA 4LF2A 4PRTA 3VGBA 1BYBA 4UIOA 1KM3A 3W73A 3A3HA 1YE4A 3WLSA 1DWJM 1K6WA 2GOKA 3W0KA 3UY7A 3W72A 4J3WA 1K1DA 3GU2A 2PRLA 5EFDA 2J7DA 3AIEA 4NZ1A 1AZ1A 4Z2KA 2W6RA 2YB4A 1KM5A 2A3CA 3E2SA 3CZ8A 4O17A 1H7RA 4WQ6A 2FQIA 4M81A 1TVLA 3SUWA 1S5NA 3CUFA 3VVGA 1F4AA 3GIQA 4U3AA 2C71A 3S2NA 3SY1A 3ONCA 3S5YA 4F2UA 3W9ZA 1J5SA 2PLJA 1NFPA 4XIMA 3M0MA 2EJ1A 3MHUA 1MRQA 2BY1A 4UOZA 1KFKA 2IKHA 2O9PA 1UW9A 3VGDA 3ARRA 3GVWA 3V5FA 4FNQA 2PAJA 4H9UA 4F9JA 1TJ2A 2ZA1A 4HZ7A 1BXNA 1JDEA 5D2VA 1MQRA 2TRSA 1AH4A 4WDWA 1Q7QA 4D1JA 2YFOA 2IMRA 3S46A 3EXRA 2HPIA 1WOBA 3BJSA 4IIFA 2WWCA 1QI3A 1EOKA 3BARA 4JY8A 2AGKA 3IV3A 1J0YA 1VENA 1TE6A 3RAOA 5BXPA 2Q02A 1HKJA 3UJEA 2Y88A 1SPQA 4QEEA 4DXVA 3FXGA 1VEMA 4Q8OA 4QROA 2QEZA 2XFWA 2FZMA 1GKPA 2BVYA 5EGRA 4M19A 1SJDA 5DMYA 3CV7A 1PZ3A 4A3UA 1IIHA 2GVGA 1W31A 2J9XA 4UR9A 1DV7A 3EA1A 2GGHA 1OGBA 2Z4GA 4OBRA 1EL3A 4O1EA 3RILA 2ZE3A 4NJIA 4IP5A 3E12A 3WLKX 3OOQA 2PDUA 5DT7A 2BHYA 2F2HA 1B3WA 2FTYA 3T44A 4PODA 4RPPA 1KXTA 3O3RA 4OBTA 1A4LA 3GHRA 3C0QA 2HVNA 2QQ6A 1O5RA 4J28A 3PUGA 3PSWA 1J93A 3FJLA 2QDEA 3T6CA 2YDSA 3Q37A 5FJRA 3ZVIA 5BNKA 2KZHA 1PDYA 2X1TA 3CHDA 3B8UA 3WSUA 1YTKA 2AQWA 1W9BM 4BI5A 1CXIA 2EG6A 1JEZA 3AXKA 4JEJA 1YRRA 3OB8A 4RJEA 1UD2A 1AD1A 4X60A 1GUVA 4IG2A 1H41A 2Y8VA 4P61A 2WJFA 3L2IA 3WLOA 1TWDA 4KFPA 4MY8A 1V3HA 1B9BA 2QMKA 2ZXAA 5LIUX 3ARPA 3SRDA 2YR1A 4GZEA 1WXZA 1UR0A 2REQA 3IV8A 7ODCA 4E8GA 3OVRA 2GJXB 1O5KA 3PZIA 3WEZA 1Q8AA 3STEA 4PULA 1EDGA 1OABA 1GVYA 2PC4A 5A2CA 4IQDA 4JTKA 3FS2A 3C8FA 4K7YA 3CPGA 5PTDA 2QF8A 4HNUA 4Q8UA 3NQCA 4B3KA 7XIMA 3HPXA 1N55A 4M0XA 2JKEA 3NUKA 3DC8A 4AEEA 3AS3A 4BQ5A 3L4VA 4GVHA 2CETA 3RLGA 4AZ6A 3VYLA 1I1WA 1KBLA 2TAAA 3UG4A 1JZ3A 4ZQRA 2EO7A 1AW1A 3NQ8A 4CVWA 4JIHA 2VP8A 3QVQA 3OGRA 3SO7A 4B4FA 3CPRA 3SCTA 4GJJA 3MYOA 1NF0A 1VBHA 3RK8A 4GG9A 3N3TA 2EPLX 2FHBA 3HG3A 4YTUA 4GABA 2YBUA 1V02A 1P0EA 3ZOAA 2ZQ0A 1B3OA 3KS6A 3TMLA 4LC8A 4WDXA 3N9KA 4LUTA 1DWHM 4TOQA 4S3KA 5AHEA 4QE1A 1Q63A 1S46A 2NX3A 4HK6A 3NCOA 2WNNA 1VFMA 4K37A 3KBJA 2WZMA 2VYOA 5EMUA