3TB4A

Crystal structure of the isc domain of vibb
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
205
structure length
205
Chain Sequence
b'IPKIASYPLPVSLPTNKVDWRIDASRAVLLIHDMQEYFVHYFDSQAEPIPSLIKHIQQLKAHAKQAGIPVVYTAQPANQDPAERALLSDFWGPGLSEETAIIAPLAPESGDVQLTKWRYSAFKKSPLLDWLRETGRDQLIITGVYAHIGILSTALDAFMFDIQPFVIGDGVADFSLSDHEFSLRYISGRTGAVKSTQQACLEIAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vibriobactin-specific isochorismatase
publication title Structural insight into the ISC domain of VibB from Vibrio cholerae at atomic resolution: a snapshot just before the enzymatic reaction
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
total genus 75
structure length 205
sequence length 205
ec nomenclature ec 3.3.2.1: Isochorismatase.
pdb deposition date 2011-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3tb4A00
3HB7A 1ILWA 3OQPA 2WTAA 4L08A 3R2JA 1NF9A 3O94A 1X9GA 2A67A 1YZVA 3PL1A 4WH0A 2B34A 2FQ1A 3LQYA 4H17A 3IRVA 3R77A 3TXYA 4WGFA 4L07A 1XN4A 3O90A 3V8EA 3S2SA 3OT4A 3O93A 1J2RA 2H0RA 1IM5A 3TB4A 3HU5A 1NBAA 1NF8A 2WT9A 3KL2A 3O92A 1YACA 3TG2A 3EEFA 3MCWA 3O91A 3UAOA
chains in the Genus database with same CATH superfamily
3ER6A 2AFIA 4UBOA 3BUSA 3F9IA 1VSBA 3G2MA 5KDDA 3U09A 1QJCA 3OCUA 4JA0A 5IT5A 4W9MC 1TMOA 4IIUA 4H7PA 5IU6A 4EK9A 5KOHA 2ZYSA 1KH1A 4YGXB 1XRNA 4BNLA 4DJJA 3KQSA 5TVGA 1TGVA 1L5SA 1I30A 1INLA 1B14A 1N6KA 1D0VA 4FD3A 2OYSA 4OUKX 3WGIA 1L5QA 4J90A 1LLFA 1AE1A 3FCYA 3H13A 3R6TA 1EUDA 4I3GA 2EX4A 3EIFA 4JUBA 4X00A 3WQQA 3Q8KA 4MRRA 4Q5IA 4MW5A 3TLJA 3R3YA 4XA8A 2EX1A 2ZYIA 1CNFA 1U0EA 3MCUA 1LS1A 4MJLA 1M2JA 1K3TA 1N0UA 4OJMX 1H65A 1YBMA 3FMVA 4QG3A 1KIMA 1OREA 2IYYA 2AI3A 4II2A 3UHFA 1IZZA 2X4IA 2DWOA 4WLVA 4NHEA 2QVZX 4L22A 3VPSA 2QNIA 1KI6A 3FHLA 4M54A 4YIHA 3EDQA 4N8EA 4YJ3A 4RF3A 1OMOA 2YJ5A 2DR2A 1JSXA 2HLNA 1D4OA 1Z2PX 1W48A 1Z56C 4I5EA 5JAOA 3G0DA 3IT3A 1U7OA 1I9CA 3WGLA 1R0RE 2IUEA 1K7CA 3UKOA 5HFNA 5CVUA 4AIIA 5C80A 4R83A 4LZLA 1YDMA 4A2CA 2GM4A 3GN1A 1W85B 5I9BA 4AJ9A 1PNQA 4DLUA 3V6MA 4OYHA 3DP7A 3K05A 1YB1A 2ZTUA 3P19A 3ZLJA 1R64A 1O3YA 4HF7A 2OMKA 4RQAA 4D9CA 2IY7A 3OU6A 3D2CA 4TOIA 2F3RA 5AJUA 4XUEA 2VPZA 3I92A 4MZXA 1RS0A 2YWHA 3P9PA 3QV2A 3K6KA 4RQBA 4M36A 1FXUA 4N7RA 3C6BA 4LHSA 3T0GA 4IDBA 5EKTA 3CF4A 1BJKA 3PCXA 2ZIGA 1OXSC 4KQJA 3NTLA 4NE9A 3WYNA 3LWNA 2C88A 3VR3A 4FMDF 3ROQA 5BXQC 3T5PA 1Y4DE 2VRCD 4RLHA 2WWVD 1V3TA 4X1YB 2V7WA 2HL6A 4LXGA 3HLKA 2OLKA 3KDPA 4MV6A 2LCFA 4X63A 3S27A 4ACBA 1JR3A 3C6KA 3AYXB 2FLVA 3A4MA 2J4DA 3JWJA 2NU7A 4PXYA 4IIYA 4AZVA 1QYDA 4D45A 2VT2A 1DLJA 1VJCA 1WX1A 2F59A 3TF5A 2XT6A 4JC5A 1Y8QB 1OH5A 1DIRA 1HURA 1MV5A 2PWPA 1PJSA 1T2VA 3L93A 4JB3A 5LP1A 3CKYA 3V1NA 1GKYA 2OHOA 2Z57A 3EGDB 4WKNA 2ZIEA 1MUUA 3GRZA 1QIIA 4PIPA 5LYJF 1E9CA 3ZE6A 5FWXB 3K1YA 2A78A 4NZNA 4RIIA 4RY8A 1NVXQ 1D6JA 1X70A 4D3FA 4JKIA 4N76A 4EYQA 3WS7A 1SCJA 2NYRA 5ICFA 3LY8A 3IXMA 1M6VB 4BJHB 3H5LA 2VJQA 2WJ4A 3DZ8A 3OE4A 4MW0A 4R8LA 4URZR 4HQFA 5AHKA 3DL7A 1T8RA 1W5FA 2WLTA 3PQ2A 5K51A 4HNVA 2ZPUA 1HDEA 3Q1KA 4AO8A 3GCWA 4AVYA 5ITZB 2VTBA 1E94E 2J3IA 1F4VA 1GLNA 2AJDA 4WKOA 1A5BB 2A92A 2AG6A 2WZDA 5JSZB 2BBWA 1REQA 3NALA 1ZX1A 1LRKA 4YDQA 2XE6A 1F48A 4NE2A 5ALHA 3ZIUA 2AQKA 2X19A 2V7XA 4D6XA 2A88A 2IVFA 2XNDD 1QH1B 4B3JA 3KSBC 3WKAA 5KNLA 3IE0A 3LXMA 3ZWQA 1A96A 3D6UA 4KMMA 5EAIA 3BF7A 1V7QA 2YMMA 3EGOA 1PI3A 3GT3A 4G5YA 1K5GA 2Z9BA 1IN1A 3ON5A 5J4HA 1NU6A 5E6SA 3R09A 2YBEA 3QX7A 2A35A 1OBCA 4ZP1A 3LYUA 3NHFA 2JLYA 1R8XA 1W9MA 1SVIA 3EJWA 3TRDA 3LW7A 4CQNA 4JELA 3C48A 1WE2A 4FGUA 5T8KC 3RARA 3RUPA 3V42A 4TRRA 1DS6A 1OLSB 1RM4A 1UOQA 2OXEA 4X8LA 4ZJYA 2R9VA 3D5EA 1FP2A 2W2MA 3DCYA 3LX4A 3QHQA 1KHHA 5IJ9A 4DDHA 1KJ9A 3E8SA 1ZM2A 3ANTA 3K2BA 4MHOA 4MRSA 3UM9A 4RKEA 3W5JA 1B2LA 3GQBA 4N6OA 5KMGA 3NHRA 1JQBA 3BAFA 4Y67A 2GVDC 3JYNA 4U7JA 1JXOA 3RW9A 2WT9A 3I37X 3OIWA 4E4YA 4L9RA 4WK0B 3W4JA 4EZEA 2PL9A 2Z5VA 2VCEA 3HV0A 4XYBA 2V4UA 4RJJA 1DL5A 4ZV7A 2HYDA 1V95A 2BTOA 1X87A 1N5JA 3AR8A 4KX5A 4DT1B 4X6YA 4LZOA 4CMIA 1XNRB 1PVOA 4GECA 1HDIA 2I4RA 2OXCA 2ZREA 3ETDA 4URUR 3U48A 3BSFA 2YIJA 5BN4A 3WJ7A 3PE6A 3R7AA 1QHSA 3BQNB 3DM5A 4PGHA 4GBJA 4HQ0A 4AG5A 3ZCXA 4N12A 5ARDA 1H0RA 1TYDE 4QU5A 3UV7A 1VHTA 5K8UA 1GCOA 4UUAA 3IXQA 2PO7A 2PX2A 4D42A 3SEFA 1G9XA 2GSWA 4YQZA 1J09A 3DEYX 4XDGA 3RANA 4CMEC 4XQGA 1NP7A 2IKSA 2ZJ1A 4P1ZA 1SH7A 5ITWA 3FHJA 4J0GA 2XUGA 2XZLA 5BXYA 1K06A 1IHYA 1RKXA 3GEEA 5ETJA 3DEJA 2REQA 4I6EA 2YQ4A 3O4HA 3G8DA 3C1AA 3IIJA 1LC3A 4RFSA 1JHRA 1G2OA 3QU5A 4MVJG 5DP1A 1UBFA 3N2GA 1F2DA 2R5NA 1ZJ4A 4ZCLA 3UUFA 4MIKA 1W96A 4O4JB 3VSDA 1HLGA 1TQ8A 1W93A 2OP1A 1MT0A 2QSZA 3E23A 4O2LA 1DZIA 4Y2UA 4YQFA 1L7BA 2PBLA 4IMPA 3U13A 1EAYA 5BV8A 3IQGX 4N1AA 4ZQHA 3IYLW 4Z9YA 1LQ2A 1CUJA 4D0SA 4Z0NA 3AIIA 3KOYA 4P22A 5FWDA 3DJYA 2QX8A 4KREA 3DAYA 1BMTA 3TMYA 3VYTB 1U7PA 5T4EA 1V1JA 3L7AA 4H60A 3AVWA 2N9UA 2OFWA 4MR9B 1YI8A 1O03A 4TQAA 5K6AA 1NT2A 4F5DA 5AFSA 3I28A 3GDOA 4OYYA 4EYOA 2V0NA 2XPCA 4YRTA 4DRZA 2IYZA 5GIPE 2WJGA 3ETEA 2O3TA 3EN0A 3M0EA 1J20A 2BUAA 2EBHX 5K8VA 2NV0A 4WSOA 1TD9A 1W0JD 1CQWA 4HG2A 3V9PA 4JVOA 1N3BA 2J7KA 1ODTC 3UAXA 1T3HA 4BRWA 1QFMA 4I14A 3UG6A 3IVGA 5M7EA 4GVXA 2B30A 1P91A 2R6GA 3C7DB 2COEA 2BJWA 1KO1A 1ZU5A 1GOTA 2QM7A 2ZE8A 2O4UX 3MXOA 3OIFA 1T5OA 2W4QA 1N8TA 5CFMA 5HM6A 5IKXA 1Y9AA 1YR7A 2WHPA 4OD0A 2GEFA 3WLAA 1YNSA 4ZKDA 4UD6A 1OBHA 2OXRA 1BMFA 1MC8A 1MQ9A 3U4MA 1EZZA 3DBRB 4MINA 5LZ2A 2GZ1A 2G1KA 2IQIA 3PD0A 4ENUA 3K9BA 2WF6A 3ROEA 5DYGA 3NVKI 1GYRA 5B1SA 1O96A 1KEEB 3ZV4A 1CSEE 1AK1A 2EL7A 5C34B 5IJ0A 1QGED 3KQUA 3NVMB 2WYHA 3E53A 1RW4A 1ZW1A 2WF8A 3K72B 3UA4A 3W5VA 2F8MA 4N6NA 3S99A 1COWD 1QGUB 2DU8A 1PG5A 1YQGA 4BNIA 1Q6ZA 2XE7A 3KTAA 4L6CA 3LCJA 5FR2A 4FQ8A 2C04A 2J59A 2YV3A 4RZ3A 2AK2A 4IIBA 4XIIA 5CCDA 5JYBA 3IQFA 4CUZA 2ZAIA 5EIHA 2CGEA 3NDIA 1VPDA 5ENVA 4WLUA 2X1VA 2YBDA 3E2PA 4RLSA 2HF2A 1AS3A 4LY9A 4QOJA 2EP7A 3BPSA 3PC8C 1HFWA 1LK5A 2A4KA 3RODA 1F0KA 2GLXA 2H51A 2QU7A 3T41A 5HRAA 1MRZA 4R2MA 4UUQA 3RBVA 3ADKA 4MPPA 1A4IA 2YWEA 2ZYHA 4R0MA 1QH8B 1SOAA 3B1YA 5JI3E 2J67A 4WZBE 3IILA 4PWYA 3MTBA 4DC9A 1PGJA 1JHYA 5FUWA 4P8RA 4XVUA 1RYYA 4LW8A 2QN8A 2XYPA 4PHTA 3RIGA 2D7DA 2BAGA 2L19A 3OE7D 3TW8A 1EM8B 1SCUA 4BLUA 1RE1A 4ATNA 4EP1A 4WUVA 1WKBA 2PUDA 4C4AA 3HM2A 1TM5E 3JQFA 3JQ7A 3MOGA 1NUPA 2GB4A 2ICAA 3VKUA 2IYNA 4QFMA 1ZH4A 1XPRA 2Y1CA 1RJ9A 2B99A 3ZU2A 1D1TA 1Q0RA 4OHZA 1E0SA 3KHKA 1ZMOA 5AXDA 4DA9A 4MVYA 1OIVA 1L9KA 4YRNA 1MIHA 2QUAA 2CSUA 4W7HA 1PDVA 3ABSB 4YT8A 1MG5A 3QBDA 3W3ZB 5CCBA 2ODPA 5HRCA 2XE4A 2VZ9A 3RVLA 1J9GA 2WJ6A 2I4NA 5CHYA 3FMFA 4ZKEA 1FQWA 3FNRA 4IUBS 2H8GA 5JRJA 2WJVA 3QX3A 1EFHA 3ZDYB 2VP3A 2EFDB 4UTOA 1JEYA 2HGSA 1KS2A 1D2CA 3FSRA 3GCXA 3QEKA 4KMSA 5C7IO 4TYWA 1F6WA 1JKMA 1Q74A 2WC1A 4EPVA 2XMGA 3D7NA 3G2NA 2NO9A 3O83A 2JLUA 4F1WA 1MRSA 4GDFA 1E92A 1DAOA 5ITVA 3PGA1 3RLIA 1H94A 1NE7A 1X74A 1XJCA 1EINA 3M3DA 2YIVX 1MO2A 3DMTC 4ERXA 1QTIA 2QPOA 5JAQA 5FI0B 4D79A 1MN6A 1R4ZA 5MGBA 1IJKA 4H1TA 1KO5A 2V45A 4X71A 4YQEA 4ARAA 1BXGB 2J9XB 3TXYA 2JGNA 4PQEA 5L3RA 1CRQA 1GZDA 2B8NA 2FFAA 3H4VA 3HG7A 4TS3A 2WYOA 3GOHA 3IOBA 3NHAA 3OF2A 3EVFA 3FYTA 4O2AA 4UQPA 4K8OA 5DBGA 4KTTE 5FB3A 5IFLA 3QHPA 3QVVA 1GHTA 3GAMA 3DC7A 4FMCB 4QBGB 3CX4A 1YONA 3I8OA 1K8YB 1TUBA 4M60A 4EKIA 2WMYA 1V1MB 2BKAA 2OPBA 4LZZA 2UU9B 2AD1A 5HGJA 1W2HA 3IAS1 1PZHA 1M6WA 1A69A 2V59A 4E5NA 5KNCD 2ZUEA 3NYQA 3MTGA 2R65A 5ALWA 3N8KA 1B6TA 4IRXA 4G2NA 3F7OA 2VAVA 5FTJA 3R7DA 3E58A 3T7SA 2ZQZA 2R97A 3UHAA 3OPNA 3UMFA 4DSTA 1FMCA 3WLSA 1FVHA 4P33A 1IQPA 1C30A 2C5AA 1AZSC 2FWNA 4TLBA 1JQKA 1CP2A 4MLCA 1Z18A 5BSEA 2HH9A 3G9TA 4ZVSA 3SBDA 4F8YA 1NI4B 5KPJA 2HAEA 2J7PA 3IMCA 3UQYS 4ROTA 1NLZA 4J0HA 2ETVA 1O97C 2QR2A 1DQYA 2BVNA 3IKMB 3IOMA 1NTOA 4K6HA 5FFNA 2V54A 3WNCA 3U4IA 3FOFC 1BMDA 2QF7A 2YXNA 1HZZC 2QMOA 3KAPA 3OEYA 3O1JC 1E66A 3OM8A 4GX2A 4HH3C 1J07A 2HDWA 2JLBA 3KQMA 4YONB 3A6LA 3O8RA 1WPRA 2A0UA 1IOVA 3I05A 3H5NA 5HIJA 4ARIA 2WG2A 1OFIA 1VIAA 2P8JA 2FFJA 2QKYA 5ADVA 3QY9A 2WJPA 4X6UA 2MSWA 4S12A 1NVVQ 1A7AA 2C03A 4I3HA 3GJYA 4WNYA 3EK2A 5KSPA 1ISJA 2OHJA 1ETUA 1I7PA 2Q2QA 1KVQA 1YBAA 4RF4A 3QFTA 1SCAA 5TRTA 2PX5A 1EXNA 3GEDA 3K6RA 3S8MA 2KE5A 4BOYA 4G65A 4C07A 3OZTA 1V7PC 5AK5A 5CLHA 5SZHB 4F93B 4ZZ1A 4KN5A 5DCWA 4F92B 5JVDF 1QZUA 2AG8A 3GD5A 1V4NA 1MPXA 2QPLA 3NDRA 4MV5A 2AJCA 3TD2A 1JPNA 1J22A 3FUUA 1IEVA 4WK6A 4NYMQ 5EVJA 3SJBA 1A77A 1TMKA 1W5TA 1JN0A 2XKAA 4F60A 2MYNA 2K2WA 5AW7A 5IPFA 1JB1A 2OAP1 1FNNA 3K5PA 1PTJA 3A0RB 3MRTA 4TZ0A 4MV7A 3U3OA 3PT5A 3GJSA 3S8YA 3EZGA 3U3KA 1V96A 2FETA 2VSNA 4WZAB 4G5XA 4LQDA 2I7XA 3VC7A 1X7XB 4E5SA 2GO1A 3R76A 1BH6A 2CXUA 1FTQA 1F0YA 3ZWXA 1KZ7B 4UAVA 2A0WA 4CFYA 4J7AA 1W0KD 4HB3A 1FU7A 3SQMA 3O0TA 1NLMA 1FQJA 1QYRA 3GLHB 3L41A 2V7VA 2JFHA 3VDMA 3W7VA 4ZYLA 2G77B 2WQ6A 5DLYA 1WMSA 2HLDD 3UC9A 1YI0A 4CMBA 3QIAA 3QUAA 4Y3UA 5ELLA 3IDAA 2ONYA 2I2CA 4M1TA 4KQEA 4O25A 4Q47A 2PZFA 5JMPA 3DLTA 5REQB 3RS3A 1LH0A 1V25A 4QJ3A 9LDTA 3RSFA 3F73A 4HPJB 5HZHA 1R2QA 1YB6A 2FPKA 2FUG6 1T5IA 1PU2A 2W71A 1YR6A 2VS1A 4GKBA 4ADSG 4YP0A 3O2QB 1UOPA 1NJ2A 2EGGA 3E7PA 3LP5A 4KN6A 3UCXA 1U28C 3ELDA 4LBWA 4HPWA 4A73A 3KZMA 4ZIRA 1KH2A 3WSWA 4ND7A 1NZFA 5T67A 1BCRA 3OE5A 3KQVA 4A1FA 5J9FA 3LD9A 2H8KA 3DAHA 3FYUC 1ZKMA 3OZSA 4GLJA 4LMRA 4QQFA 3VNSA 3Q3EA 4COKA 1AB6A 1A8HA 1P8JA 4PW0A 4QQ8A 1RPNA 3WZLA 1OGIA 4WXEA 5IS2A 4L2IB 3GZNB 4H17A 3GL9A 1KDTA 2DBZA 2ORIA 2IDMA 3TFWA 3PEVA 1H6DA 3DL2A 3A6EA 1IG3A 1NVUQ 1RJFA 2H65A 3QENA 5TMEA 5EJEA 1UPBA 4AZ0B 5AVWA 2R1VB 5KYUB 4PVCA 4DSZA 3DPUA 4H1HA 3AU9A 3GUZA 2GBLA 2ZT7A 3W05A 1EG7A 3AFMA 4MKRA 2W2QA 5FOTA 2ZJ6A 5CA1F 1QUEA 4DLNA 4CG3A 1T36B 1P2UA 1J9ZA 3IUJA 5CA0B 1PE0A 3L7IA 1IAQA 4P98A 1UWKA 3PQCA 1W5BA 2SKCA 1G55A 3O6VA 3X1WA 4RA9B 1M34E 1OWLA 3FHOA 1CUBA 4UTRA 1MHPA 3IL2A 2CDBA 3QNWA 1FL9A 5J2UB 3GEBA 1RWVA 1GZ5A 1VJ0A 3WZMA 1IM2A 1F38A 3B6JA 3A26A 1KPGA 4F9TA 4RTOA 2AFHB 2JIPA 2ZS8A 3GRFA 1RWNA 2V97A 4X1IB 5TGTA 4J4HA 3RQIA 4BFWA 4BIIA 5CD1A 2X9VA 5E38A 1R8YA 3BFPA 3CZ5A 2Q8QA 1SHTX 4ZVKA 1GPKA 2Z6VA 2HHAA 4F71A 3L5KA 1GUBA 3TLGB 4BHTA 1SBHA 3EVNA 1DHTA 3A04A 3EY9A 1ZVQA 4MO2A 3WKBA 4BIMA 2Q0SA 4KAXA 2VQ3A 1RFLA 1BEZA 2QM0A 3I1FA 4L0QA 3AP2A 4DMFA 1I9GA 3FGNA 721PA 3JWGA 2REOA 3NXKA 2QNRA 3V2IA 1HNXB 1FP1D 1I2BA 2GM5A 3AR9A 4A2QA 2AUMA 1Z7EA 1PQWA 2HIMA 2PRKA 2NP6A 4R8KA 4IBOA 4BNMA 1SZJG 2W2VA 2NSDA 2Y93A 3ANNA 4FMBB 3WNBA 3DT6A 1PK7A 5DM4A 2NQTA 3QVGB 1M5RA 4WBXC 2LGJA 5K09A 1RXSA 1HH4A 1W87A 1XAHA 2ZSFA 3RK4A 4A8JC 4E2ZA 1BVHA 1KDOA 3KVVA 1OAAA 4TTJA 4BP1A 2NO7A 4P3YA 2VBFA 1Q57A 1ZSVA 4G5FA 1TOAA 5CRIA 4YRRA 5E0OA 5DM70 1Z2AA 1DO8A 4PLYA 2O4CA 1QRRA 3MIIA 5BR4A 1D7AA 3CBGA 1SBNE 2B61A 4YCLA 3ORFA 3VHXA 4W1SA 5J63A 3ZDXB 3VUFA 2WT4A 2ECFA 2A86A 2J5BA 3R1IA 1RKQA 3HFRA 3OBIA 3S2EA 3E70C 1GN9A 1BHSA 1MQAA 2PCLA 4UEOA 1YUNA 4HEHA 1G8KA 4HXYA 2W2LA 3FETA 4AKSA 3MBOA 4PGFA 1GLVA 2XB8A 3G1TA 4A0QA 5F73A 1FNBA 3JCZA 4AJJA 2W2TA 1WPGA 2DHCA 1CDDA 2FMUA 4OAQA 3RIYA 4CLRB 3CSSA 5K03A 3B2QA 1E6CA 3VU3A 3ZGNA 1GN8A 1KC1A 4RSGA 4M0DA 3QPWA 3OZWA 3UVEA 3V4OA 1J0DA 3OCWA 4WNAA 4ZTBA 1HA3A 3AEXA 3JQCA 4DMGA 1BA2A 1PAUA 4BQFA 1II8B 1RM0A 1MAWA 1Z47A 3A4NA 1M2HA 1SU6A 2R6FA 4C2TA 1F8XA 4X5OA 3OO1A 1OILA 2FQYA 2XZPA 4PC7A 1SA0A 1QIHA 2R25B 4PF1A 4ZODA 3UKJA 1ULTA 3ZU3A 4CCYA 2O8CA 4ACAA 1LCIA 1JTEA 3R3JA 3OQ1A 3R4VA 3HBMA 2IXEA 2G76A 2OKGA 1P5RA 4L3VA 1WHSB 4JMLA 4K9DA 3HACA 4XW2A 1XYVA 4C6TA 2VNIA 2QK4A 1P7PA 1U1GA 1IMOA 1JQEA 2AQHA 3C70A 1WLSA 2JI7A 3GBSA 4UFOA 2ST1A 2H6EA 3I52A 3OPYA 1MORA 3QMMA 1YZLA 2MIIA 3R75A 4HNAA 4DGQA 1PO7A 4DB4A 3D2BA 4NFYA 1DWPA 5F1OA 1RWPA 2CK3A 4XD7A 1H3NA 1FEZA 1I1OA 3V8PA 2V6FA 4EJSB 2HMAA 2F2TA 3LQKA 1YJQA 3LQ4A 2YY7A 4EW6A 2OORC 4UOZA 4IOJA 4TMXA 1E32A 3LUGA 3PFGA 4EAAA 3THYA 4DNOA 3UWMA 4ZVOA 4DR4B 2CVHA 5CR9A 3PJRA 3E9RA 3ZWKA 1JF8A 4QUDA 1YJCA 1OH8A 1D4ZA 4LDAA 3E9NA 3JX9A 4HN9A 4MQUA 4NYIR 4R69A 5GM1A 3USES 1H66A 3DZHA 1AGNA 2JLXA 4EA8A 5GJBA 4WBSA 4AZ3A 2WIAA 2I1WA 4BPRA 2GN9A 3OZCA 1L8LA 1U8EA 5JCZA 5FPHA 4JJIA 1VRVA 1TT5B 2Z2ZA 3AT1A 3OZRA 4XJTA 3WIDA 5BSGA 2NX2A 2P2YA 1PF7E 1HL7A 1LPOA 1ULAA 4RA6A 2AWNA 4Q3EA 4JI3B 3ZCTA 2EFHB 2ATIA 4TSKA 3OQIB 2H57A 1GNRA 2BEWA 3QW4B 2I3DA 1XTPA 3HKCA 4PG4A 1OJ7A 1DQSA 1NKTA 4FW9A 4NRDA 5EHNA 5EE1A 1QU3A 2BRUA 4GXQA 5JT1A 3LE8A 4YASA 4YYEA 2HY7A 1LK0A 4XEHA 4AM8A 4QXAA 3EC1A 3UENA 3P9ZA 2ISQA 1GKIA 4AZTA 4X0EA 1SVOA 2QLLA 4YIKA 1OLXB 5KC9A 1MHTA 1TT7A 1KQFA 1PEKE 4WFJA 3VR4A 4G4IA 3EAFA 3P9QA 1F3OA 4JP8A 2NYVA 1W35A 2EDAA 2FDCA 1QNLA 3RVQA 3GUHA 5L3QB 2CWWA 4KQCA 1NY5A 3SS7X 1SXJB 3OTWA 1NJ1A 4G0WA 4AK9A 4C9BA 3LLUA 4QEDA 2MSEB 2PJZA 2AI2A 2X42A 1NQWA 3CYFA 4IHJB 4C5AA 1DE0A 1XDDA 2Z4RA 3H1TA 4YCDA 3AL0C 4XR9A 5DHRA 4FR0A 4D99A 4UQLA 5I7WA 4YDSA 1DBPA 3CC8A 2MINB 1IJBA 1SZPA 1J8DA 1TFUA 3D7LA 1N0WA 2J0UA 3ND7A 1ZJWA 3G5AA 3UV3A 4EVSA 1Y6ZA 2EJVA 4TVOA 2ZYTX 1QNFA 5F5NA 4GX0A 2HWKA 1QG6A 5ALOA 4WN9B 4BO9A 4QXRA 3TIFA 3GARA 3FFWA 5IZCC 4W6ZA 5E1BA 1P5ZB 3ZWYA 2PZEA 5IVIA 4WCDA 3SIPA 2QTTA 3EMVA 2Q2NA 4EPYA 4EPRA 1K66A 3ORRA 4I2NA 2Z43A 3DFKA 3HCPA 4L0CA 1KRHA 4UDOA 1DCTA 3HXMA 4QQRA 3LUCA 2AGVA 3SYMA 1E62A 3T1OA 1QGYA 4INPA 4H6VA 4L4XA 1UQRA 1WBJB 1Z5PA 2FPIA 3SZ3A 5A9RA 1IZ0A 3U0VA 2JG3A 3WNDA 1P9NA 2EJCA 3RNLA 1DPFA 1S2GA 3UV6A 5JH7A 2PN1A 4UM9D 1OYOA 3IBFA 3IS3A 3CX3A 1BS9A 3G5TA 4TZTA 1N7HA 1VFPA 2VP4A 2GTHA 2Q5OA 2XODA 4ZCQA 4JT2A 2DWPA 4QJ5A 5HZKA 1T8PA 3DZKA 3UOGA 3UNXA 4LXYA 3OZIA 5CFLA 2YIDA 3N8HA 2ZIAA 3ICOA 4PZCA 4FYMA 5C5EA 4H15A 3PGXA 3ISVA 2Q41A 4RIEA 4N8SA 5JUWA 3OZFA 2P5SA 1P77A 4M55A 3UXMA 4RPGA 1N2IA 1OPXA 2ZM6B 1DOHA 3IP6A 3CNHA 1ISGA 1M8GA 4JWTA 2VYCA 3I5UA 3UMBA 4DM4A 5A6VA 3JZIA 5FPKA 1ZK2A 1KWGA 2R5FA 3H3JA 4W63A 2IEGA 3FOWA 4EHIA 2ISSD 5BRAA 2H1CA 1H1LB 1KAMA 1Y4AE 4UZEA 4GU5A 4YALA 1KAGA 1MO3A 3OFVA 3PEEA 4XFKA 4UM9B 1XWIA 1MOSA 3KKNA 5FYDA 5DW0A 3PLAE 3N7UA 1IQUA 3B1JA 1EXMA 4FGLA 5LQMA 2AMYA 4ZTUB 1UJBA 3HKDA 1RAGA 1VLHA 4H16A 1QZ3A 3AP1A 3L7YA 2X8WA 5IAKA 3WGNA 3NJ8A 2OZPA 5J59A 1DDGA 2C2HA 2JAXA 2P2GA 5EWJA 4B32A 1AA6A 2RK4A 4BMXA 4U6QA 3AL2A 1WXFA 1QE0A 2QE7A 3Q7TA 4ND4A 5LXTB 4QEZA 3EXIB 3R23A 2YV1A 3DTVD 2Y1GA 4G5HA 1SN7A 3PL5A 4O2BA 4Q15A 5FXMA 3KPWA 1T1JA 5L8VA 5K8TA 1IPEA 5B1HA 1BOFA 1XLVA 2HF8A 4MDYA 1Q7CA 4LBVA 2B21A 4LNUA 3SIWA 1KP2A 2Z6QA 4IDNA 5KSWB 1FXWF 3AP3A 3CLRC 1H85A 5FPSA 3SLRA 3EDYA 3ONDA 5BN1A 2I8AA 3C85A 3RIHA 4Q4CA 3VR2D 4BTVA 4Y2QA 1I4DD 4G0MA 1TVMA 3EFOA 2R6ZA 5DT9A 7ADHA 3CV3A 5GINE 3T7TA 4IRMA 2XMSA 4NG5A 3WK6A 7REQA 3VA7A 2C7PA 1RZ3A 1UL1X 3NAMA 1CZHA 4PO3X 4Q9NA 1UBOS 2ZFUA 3SXJA 4Z9FA 4NSNA 1SULA 4X20A 2BELA 2QW8A 4NEGA 4B6GA 1JVSA 5BWMA 5KYTA 3W4IA 1ZIYA 3P96A 3VO8A 2XDQB 3Q0TA 1FYXA 4UHCA 3BD8A 1P4GA 2ZS9A 4WD3A 5F4ZA 3W5UA 1A4XA 2VDWA 4MWTA 5HKBA 3AR7A 1IZ7A 2IP1A 3I1YA 2B1IA 2C99A 5DN6A 1Z07A 2J3LA 1ZESA 5LQCA 2J6HA 4FVTA 4KLAA 1ST3A 2HJHA 4A6XA 5D84A 4NV1A 5KO2A 3H2KA 4KXQA 4C08A 3I9KA 4E12A 2XXJA 1ENOA 4R8MA 2PT7A 3X1DA 1DHRA 4DCUA 5K2MA 1ULSA 3HI4A 3GJ5A 2DHQA 3ZLVA 4CLEA 3LYAA 1EWQA 4ZI2A 1DINA 3ADOA 3F7MA 1R4NA 2A9PA 2RGNA 3F3YA 4RMGA 2FA9A 3NTRA 4OG2A 3ONWA 2PXAA 2HI0A 3L8CA 2D1FA 1ZM4A 2YRWA 5A3SA 1C7JA 2RMKA 4NMXB 3QSYA 3QI7A 3FNQA 5DYWA 1OC2A 3PNBA 1M33A 4YR7A 5ALLA 2F1KA 4I9GA 3LXRA 3NG1A 4OHPA 1KI1A 4PQFA 4AKTA 3CVXA 1CC1S 3LV8A 4RPLA 1RBMA 4FZ3A 3K2QA 1N5OX 1N6PA 2QP4A 1KFKB 1ONPA 2XV1A 1ZRMA 4HI0E 4N5HX 4UJ5A 4Y1RB 5D6OA 2O48X 4NK5A 1VG9B 1F0NA 2ROQA 2WUWE 2WF9A 4TMTA 3HCBA 3LP6A 3BWBA 3KSDO 5H70A 2FEXA 1PWXA 2WA2A 4KK4A 5DWVA 4GBMA 3Q7QA 1KE2A 4JOBA 1FP4B 4TV8B 5KUTA 4RPCA 2VPXA 3OZUA 2FQQA 3V8EA 3LXUX 4FZRA 4GSYA 3Q6NA 1RAAA 1U9IC 4L5JA 5GP1A 3SGLA 5HS4A 2DPGA 4ZVNA 3UHJA 1Y8ZA 1EZ4A 2GCNA 5JZMA 2QM3A 1SVNA 4QDTA 4AIRA 4DJFC 1FDUA 2DUWA 4QBFA 3K9HA 2Q49A 4ASUA 4ED9A 1VI5A 4KZKA 3GWGA 5L51A 3DMNA 1X1DA 5C5CA 4DNQA 4BVKA 1D04A 4LVNA 3WQHA 4EMSA 2XQIA 2Y1LA 5JSYA 1FSZA 3V2UA 2FUG1 1G8GA 5A04A 2CVFA 4FONA 1YHZA 5AJTA 1ZA2A 4EQ6B 3CUYA 5JJCA 5SYNA 2R6DA 4G0PA 3A1DA 1N77A 5FL7D 2YZMA 5E6UB 1WU8A 3SFTA 4DV2B 3QFFA 1LU9A 4ZI7A 3W5AA 1V5FA 3CPSA 1LV8A 2I6GA 2IZOA 4RNCA 3V46A 4HO1X 3WK9A 4AP9A 1ZCJA 2C2OA 2DUMA 4YQYA 3HEBA 3A6ZA 1IOZA 5BVHA 2J6IA 1YBVA 4DRXA 1I01A 3Q3VA 4EA7A 1HYQA 1KPIA 2H1IA 4TLCA 9LDBA 4KR2A 1NYTA 2RHDA 1DBSA 4Z9BA 4FS3A 2V9CA 3IVMA 2VAWA 1BN7A 3N39C 2FK8A 5KJ1A 1JG7A 3MLBA 1RMTA 1L4LA 4XOUA 1FYDA 1M7GA 5KPDA 1X39A 4GT1A 5ELMA 1M9NA 3HUTA 1NBMD 4B0PA 4UTZA 1BOOA 5ALIA 4WXRA 3IO5A 5MHTA 1HE1C 1GCIA 2QD1A 1IM5A 2B25A 5K3FB 3GCZA 3WTCA 1K2WA 4ZQFA 1RAFA 1WCIB 3L0IB 4P4UA 4OQXA 3U7FB 4ALKA 5BQ5A 3SX2A 4N6GA 3T54A 1DC3A 3EISA 5DGTA 1ZH0A 5CLLA 4XVRA 2ZKIA 3K73O 3D6TB 4ECEA 2JGAA 4ZEVA 4L4RA 1MU0A 4TTSA 5DO9A 1FC0A 4IICA 5HUJA 1SIBE 1JX6A 1Y1QA 1HDOA 2GJ4A 4BMYA 2YKGA 4NAUA 1C1DA 3CEMA 4IIJA 4XE5A 5I51A 2R8ZA 3Q9UA 4QHSA 4UATA 4URYR 4B3DA 2DY0A 2ZWVA 1B26A 2HJRA 4YJ2F 2H31A 4J4BA 2KI5A 3WK7A 4W5RA 2XB6A 2QXYA 3LRPA 4TV9F 5JQGA 10MHA 3E61A 4I55F 1T3ZA 3PEWA 2ZJ2A 2VEDA 2H2FA 2CJXA 4MVXA 3PC7A 1B00A 4PNZA 3NPMA 4ARZA 5MN6A 2F1JA 4DQXA 4S1TA 5AI8A 5CGQB 3VZQA 5JROA 3FM9A 4QM6A 2ONKA 1NVWQ 5E7MA 1NUUA 1TD1A 2JGIA 4DUGD 2EWMA 4HKTA 4E22A 1E1MA 1FE8A 2J9FA 1QIKA 1QGDA 2CJFA 3A8TA 3AOEC 2ZZNA 2P6MA 3EPRA 4FFBB 4A1OA 1TUIA 4F12A 4GVLA 4TMYA 2C97A 3BM5A 5EKUA 4ZZ2A 3H1GA 2JAPA 1FFSA 1BW9A 1ZOPA 2EAUA 3IQEA 4GHWA 5GMOA 3O1LA 3LPAA 4M0UA 2HU8A 5C8XA 1DXOA 2R1UA 2ZANA 3AV0B 4F5YA 5JMOA 1CUXA 1M1NA 3N6RA 2B83A 5C9ZA 2OO5C 5TQ2A 4CQLB 1QORA 1PT8A 5CTAA 4KR9A 4D96A 1PL0A 1X0VA 3EASA 4JD5A 4QUKA 5JWRA 5EHQA 4C01A 1ODKA 3CT6A 1KOJA 1G0NA 2BKUA 3G9UA 4TXNA 5KNDH 1B0ZA 1UC4B 3OZEA 1OH7A 1F9EA 2QHXA 1UBTS 4QWMA 1E6LA 1XAGA 3QVLA 4AMGA 1G8PA 5K8IA 2YR0A 4GPD1 2FEMA 4H0NA 4L4YA 2G7MC 2Z2IA 2C4MA 3RUHA 3V4FA 4EGSA 3VH3A 3MINA 3NHYA 2F4VB 2W2NA 1RI1A 1DC6A 1U2DA 2Y71A 4IQ8A 2PQ0A 3E4DA 2AKAB 1HT3A 4NZPA 2QZJA 1FB5A 1CQXA 1YVEI 2IHZA 4QDXA 1I6LA 5AMXA 5F4BA 3A4LA 2QG9A 4G8CA 1DI0A 1OPRA 3L2OB 2YX1A 3I9FA 4MI1A 1DIAA 4FYKA 4RCVA 4Y30A 3VO1A 1SHZA 1RM3A 4E13A 3FRJA 1AXGA 1LTHR 3NXSA 4W9NA 1ZCBA 5HILA 1OXUA 3E15A 1DCKA 3K6JA 2NMVA 1OQAA 4WFIA 2OFFA 5KNDA 5LMNB 1EFUA 2CD7A 2RFLA 3NC0C 2QRJA 4JI7B 2CJWA 4BMOB 3L4KA 2Q0QA 3H9BA 4TWIA 4ZHQF 5LNK6 1PR3A 3PC4A 1PJAA 1Z29A 3GLIE 1ZSYA 4W5HA 2INGX 1XCPA 1GG9A 1PK9A 3I83A 3LA6A 1RC8A 1DDIA 1S2NA 1R16A 4H35A 3KXDA 2PMCA 5IN4A 1T34A 2MSNA 3FCAA 4IDGA 5LR6A 1XVTA 3RYFA 1H8ED 2VK1A 1TQ2A 3TBHA 4CW7A 2PT6A 1U2ZA 5DIFA 5B7GA 4Z4HA 4O4HF 1T1GA 1XZAA 1H5NA 2JCYA 2JGRA 3F8WA 4KIJA 3V32A 4DMMA 3THSA 1L5ZA 2QV0A 1CZRA 3M3PA 3VAYA 2M6KA 2J9YB 3SS8A 3D7KA 3LQFA 1NF3A 4MMYB 4X3CA 1NLFA 1QH0A 3RK1A 5F77A 4BVAA 4YCMA 4TQ9A 4X95A 1YA6A 2QDKA 4PGAA 3TWOA 1F3LA 3A1VA 5EIFA 4NBTA 1K86A 3KYJB 4I6JA 1XTSA 3JASA 4RD3A 1Z8FA 1EWTA 2VWPA 1E3WB 3UMJA 2JS7A 4W5OA 2V7UA 1P19A 2XBUA 4KLRA 5EYPB 1E3JA 2B8EA 1DEOA 3QLTA 5ICGA 5I4IA 3BAZA 2QRUA 3TEJA 1GKUB 3QLEA 3VO2A 4G86A 3U19A 13PKA 3QPVA 5E8JA 3P2JA 3QKRB 4ARUA 3JQEA 1BHO1 3GDHA 4EG3A 5DASA 2G5GX 1RKUA 3BICA 1NVTA 2G9VA 1E79A 2VSQA 4XWKA 3F1LA 1SZCA 3IDOA 1ANKA 3BC1A 1Z5VA 1WV1A 1N2BA 1RXEA 2AYXA 2H1FA 2X0DA 3VR6D 1NJSA 3LCMA 3BFKA 3UAZA 5T41A 1HLDA 1NXPA 2BMVA 2W9XA 2CLKB 3KTFA 3TN7A 4CMJA 5CDYA 3MT9A 1FFBA 4GX1A 4C1NA 2GPSA 2C2XA 2Q4RA 3J7AC 3P26A 1Z5UA 4WGFA 2IS4A 3NBZC 1Z7WA 2PRZA 4L95C 4RHUA 2IF0A 4JLSA 4NPCA 5FQNA 4EA9A 3BA1A 3JZMA 3KZXA 1ZN9A 2ZJFA 3EIOA 4LA4A 3GI1A 1J06A 4ZOLF 3N7AA 2FB9A 2PD3A 4BX8A 2IE8A 4WDQA 4EB6B 4RWEA 3H2SA 2QRLA 3B20A 4U9UA 3KJFA 3I23A 5GTDA 1ZR2A 3QG1A 1JHAA 4M98A 1O94C 4N3CA 1ZRSA 3QSGA 2R00A 3QFCA 3W6ZA 1G8JA 3NGLA 2IC5A 1JAXA 2V0GA 1JJAA 2B98A 2G06A 3VOAA 1CT9A 5J58A 4OFZA 2BHNA 3QU2A 1Z5ZA 5J5CA 4G1MB 5D8DA 2DPHA 1GL9B 1GCUA 3JRXA 4CMKA 1QIDA 2VUSA 3VKWA 2P9BA 1QG0A 4F3KA 4M9UA 4XQCA 3A4VA 4U0JA 3WB1A 1U7TA 4FJ2A 3FDXA 2CL5A 5COAA 1T9CA 1W85A 4RZQA 2HJ9A 4LDNA 2H7VA 2HU7A 3UXHA 1XI2A 5JS1A 4PX9A 4LOKA 1KAHA 4JH0A 3GMDA 2QZSA 4CWAA 2OENG 3DP9A 3R5FA 3DCIA 2D5IA 1A71A 1JAIA 3KDAA 4OHFA 1PD1A 2FK7A 4XCQA 4ZZ3A 5CB4B 1Y9ZA 4NFSA 4UEKA 1E5TA 2JIDA 5A5VA 3HB7A 4A5OA 2VF5X 4NYJR 2OXFA 2BI4A 4JSRA 3U16A 2O8EB 3FUWA 2RBGA 2SKDA 3VM6A 1RD4A 1XQYA 1B6GA 3Q40A 4RMHA 1YOBA 1H6BA 1KZGB 4NWIA 3RSQA 4X1YA 4BZQA 1L6IA 4U7HA 1ODLA 1M6EX 4FSXA 4OLJA 1VBNA 1YULA 3JPYA 1J8FA 4L6IA 5HTOA 4WZBB 1A27A 5KX5B 1FYVA 2QY6A 4R9RA 1A88A 4GUAA 2FPGB 3LO8A 4E5UA 2XKBA 1O97D 2AEEA 4L57A 4LK3A 5C7YA 1Y8QA 1Z6YA 3HR8A 1NW6A 3TCNA 3UMRA 4LFAB 3UWKA 1T9HA 2QVLA 2WTAA 3B1VA 2VHEA 1NOIA 3EGDA 3M6WA 4P5EA 5EHGA 1MVOA 5DHUA 1JEAA 5KC8A 1PNRA 4N9WA 5C46F 4ROSA 4B4DA 1X38A 1PKXA 3MAAC 5FWXA 3I39X 2EYUA 3NHZA 1SVWA 1D0SA 1NU8A 2JFVA 3FBWA 4MV0A 4JBGA 4NCIA 3N3BC 5JO0A 3U2QA 3SHFA 1J0XO 1CUDA 1MNQA 1M6VA 5DNYB 3IULA 1CUEA 4XH9B 2PKQP 2DFLA 4QEKA 4I4TF 2AFRA 2ACKA 2QP9X 5JQGB 2VRCA 1I24A 3JAWB 3PNVA 2H4JA 2UZ4A 3BF8A 3LWZA 2VDKB 5ITZA 5EWMA 1USVA 3IVAA 3R24A 4MRNA 5CP8A 1OD6A 5JSZA 4IKEA 3N2IA 4XWTA 5IC6A 2P4EA 4GGMX 4ZCPA 3RG8A 1XJWA 4OQYA 4YJGB 2QZ9A 1JQJC 3OLVA 3OLWA 1UR5A 1Z4QA 5EGNA 5YASA 5BUSA 1ADJA 4E08A 4JI6B 4PONA 3B1FA 4ALNA 1L7VC 2DUJA 1QH1A 5DWQA 3INTA 3G7UA 2GETA 2QLBA 5ALRA 3REQB 4A7PA 1XA4A 4P34A 4L4ZA 2ORED 2O7VA 2Z8XA 2B7BA 4TLDA 3BB4A 1KDYA 1KEZA 1JPJA 4EB0A 3R3WA 2IH5A 3ASVA 3P9YA 3OIVA 4LX8A 5AO9A 3UUGA 4CMGA 1I1HA 2ODTX 3LQ2A 4QAQA 1QFJA 2H1WA 5E9AA 1CR0A 3A9TA 1KFJB 2IBTA 3HY4A 1EAMA 2OHFA 2GN8A 4OHKA 1IN4A 2ZZMA 4J03A 1RZUA 2ZJ8A 4HX2A 4EKDA 3INNA 4HMOA 3FJ1A 2ZRKA 4ZO4A 1OLSA 4HNQA 3DB1A 1RXUA 1JEDA 2IU3A 1PZNA 4OP3A 3COVA 1MQSA 1MB0A 1N9KA 3KZCA 3TL2A 3QVWA 1UDCA 1U02A 5GADl 2ECPA 4JYMA 1K7XB 2WAMA 3VI3B 3JD4A 4LXUA 5JMTA 4BZXA 1FZTA 1D5CA 4GNRA 3ILVA 3OD5A 4OQZA 2PV0A 1HDCA 2Q62A 4R0NA 1BDHA 1ORDA 1FK8A 2HFKA 2QYTA 1T8TA 3ZJ5A 3VGJA 5GVRA 3O47A 5D7BA 5HW0A 1WU7A 2VDUE 1QE3A 3IKLA 3KCQA 3KYDB 2HLPA 2X41A 4FHCA 5F35A 4DT1A 4PYJA 1Z0ZA 1B0AA 3KFVA 3KLPX 1PR5A 3B9QA 3TPCA 2XLCA 4HDKB 4YT4A 3K8YA 4JYCA 1MVLA 1V43A 4U1RA 3RYTC 1S1CA 3AEQB 1V4BA 2JI6A 1H8HD 1YHNA 2XTMA 3BHMA 3DOIA 3IP5A 4QUHA 2YW2A 1KGDA 1W4RA 4LSMA 3DT8A 2VJKA 2HQOA 4BKQA 2JFBA 5B64A 2MTBA 3RRFA 4OMUA 4WXYB 3VJLA 2XKKA 1L8XA 4URWR 4KQ9A 1U4SA 4CKZA 2HT6A 1MJGM 1VKJA 4N7MA 4CM7A 1OFTA 3QXGA 1HDXA 3CX8A 3M6LA 4F97A 2XADA 3FF4A 3CO5A 1WXHA 5F2KA 4EUEA 2F1IA 2QJFA 3I6BA 3WQRA 5GPBA 2O5CA 3KOUA 1UC9A 1V16B 3PNQA 3UXEA 4KKXB 4KPUB 4O4JA 4MS4B 1QQ5A 3CUKA 1ZQ1A 3GXBA 1A8PA 1K27A 2D5LA 1X2EA 3DTTA 1X3SA 4Q93A 3ZPXA 4A4DA 5EERA 4EDFA 1YQUA 1QHXA 2ODAA 3C1OA 1DUIA 2EIHA 1FVXA 3WHPA 3ZLBA 2DPLA 1PT6A 3FYUB 5LP6F 3FLBA 2LXNA 2ANBA 2GEUA 4FZ5A 5JAIA 2Z1NA 2A9VA 3PDHA 4D4IA 3HSSA 3ESAA 2C7QA 1I3MA 2ZR8A 3PA8A 4MR9A 4G56A 5F7ZA 4ZIRB 3UJ7A 3IEMA 5E9WA 3FPEA 3QF4B 5DM1A 1AUPA 5DNCA 1TZ2A 2GWRA 5UKDA 3VC1A 1PR1A 2O8DB 3QLJA 2EG5A 4KMRA 1N4DA 3F5FA 4WT7A 2ZJ0A 5LQKA 3SG0A 3IP8A 2YASA 1XEFA 2QUKA 3WOVA 1WW2A 2WUEA 3VU8A 4YPOA 1F1JA 4H0CA 4WI1A 2YV2A 5BV1A 3WMWA 1I2CA 2JA2A 1KSJA 1ISIA 4K1XA 1YKFA 1DV2A 2QL9A 4ZVTA 3VBCA 2RK3A 2BFCB 1IYZA 2NXEA 1M2VB 3WQBA 1KORA 3IERA 1E8NA 3B8HA 1BE6A 1T0BA 3DHYA 3N2KB 2X76A 3TMKA 4PS1A 1TE2A 4TUYB 1VSUA 1JKXA 3L4BA 2E7ZA 4J1NA 3X1ZA 2W7TA 1O9HA 4KRFA 3F9RA 1OFUX 5IANA 2R6R1 4NOJA 1J2YA 3LZ6A 2VNJA 3TYXA 1IFXA 5A4FS 2O2HA 1DKPA 1SBYA 1X77A 2WINI 2ID9A 4Q1FA 3PGLA 3A0UA 2PZKA 3ESRA 4AICA 2YN0A 4DCPA 2ZUFA 3THWB 1QF7A 3DBRA 1XRMA 3FI9A 3A06A 3KB2A 3NHJA 4JJ7A 4Q02A 2L0XA 3EVAA 4FDUA 1OV6A 4FYJA 4KWEA 4V03A 1YB7A 4C0AC 4LOHA 3F5MA 5B7QA 1O89A 1EZ1A 1KEEA 3UYLA 2HJWA 1EE2A 4Q19A 1V8ZA 3GRKA 3GZ4A 3PJFA 2C20A 1U0FA 3W2TA 1W0JA 2R7AA 4JI2B 1QGUA 2HN9A 4II7A 4H3KB 1XL0A 3D1LA 5AW4A 1HY3A 2VTKA 3F4KA 3S44A 3R7WB 1QYCA 1J6UA 1K8QA 1ZMTA 4IIGA 4CDNA 1WUHS 2R1ZA 3NNDA 2GLTA 1YZNA 4MIEA 1V8PA 1KU6A 2VNHA 4PG6A 2RH5A 3OKAA 4BVJA 4NCAA 1ZJYA 4LJAA 5IK2D 3VUEA 2WUDA 2JFOA 3GIDA 1J2UA 4FOSA 1U2RA 1EK2A 2KX7A 3OFND 3REGA 5KTSA 3R4CA 4UASA 4WNCA 3LLVA 3I30X 1EXWA 3OIDA 2FZ5A 3AW9A 5CH5A 5EJMA 1EWVA 2FVYA 3M7IA 4TVKA 3SXUB 1DJLA 4PBTA 4A8JB 4DSOA 2FWBA 3BE5A 1QH8A 1YO6A 1DMSA 1QPGA 1CIJA 2XIQA 4TL7A 1CJMA 2H3EA 4IHQA 4NJEB 4U7WA 1P4AA 3R77A 4F5WA 1TC2A 4WPGA 4DWJA 1TU4A 3DD5A 3HS3A 3AM4A 1WNFA 1SQFA 3D2LA 3L92A 1EM8A 1QMGA 3N8GA 4NBWA 1ZOIA 1GU7A 5AKXA 2ZXEA 3FKQA 2XCIA 1COWA 3OZ7A 2SNIE 5JD6A 1U0GA 2O7SA 1Z8NA 2AJ8A 1VL0A 4J29A 2D59A 2P1ZA 2PMBA 1EFTA 4G0YA 5TR9A 4A8PA 1J8VA 1HE5A 1P6QA 2ZGVA 4QDOA 5BSFA 3ACCA 4KR3A 1LLDA 4GE0A 1YMUA 3JYHA 3OO0A 5ALUA 4YT2A 2WRZA 3EH2A 4R1QA 1V47A 1Z0AA 2AC2A 1C3XA 5JSQA 1KJZA 1KY4A 2B5OA 2XOEA 4QYMA 3OPQA 4GPAA 2OQ2A 4FFWA 4YT5A 2VRBA 2PKRA 3AESB 1IVYA 1NVBA 2ODBA 3BXFA 5EWLB 2NQ8A 3FAZA 4QL3A 1SHLA 3L1JA 3UO8B 2HQ1A 5T64A 1KDRA 2WJZB 2YVLA 1QX4A 3KKKA 1FTWA 3BTSA 3F3SA 2CB9A 2HCTA 5IEBA 3JQAB 2ZUVA 1A9YA 4P54A 5FRDA 4EFNA 5HK8A 3OE7A 3AEYA 1MLDA 1C3VA 1Z82A 4CNBA 2QZZA 4M49A 3AM3A 5I48A 4OI4A 2J31A 2WYIA 3EVBA 1XNGA 4LRSB 3DQQA 1NY6A 1WZIA 3PX3A 4Y2VA 3SR0A 3VRHA 1SJ9A 2C8LA 3KXKA 4OXNA 3OESA 5B3AA 4CUKA 1T10A 1YVDA 4PZLA 1BXGA 1GPAA 2Q6VA 3ILXA 4R3NA 1OWPA 4LIPD 2Z3ZA 1R9JA 1U9ZA 2Y0DA 4RH0A 5TDHA 4KXMA 2AV6A 5C8DA 2Y66A 5H3CA 3HXKA 4MWDA 5CFQA 1NW4A 1V1MA 2G70A 3LT4A 3HHEA 1JDUA 2V55B 2Q6TA 3FGZA 1ID1A 1NPDA 4FXOA 2PA3A 4UE2A 4FSHA 5FBHA 5LNK1 2ON6A 2QN6A 4AJLA 4QGSA 4ER0A 4RIFA 1I7QB 4N54A 1I6WA 3MA0A 4PN7A 1A7KA 9ABPA 3HWX1 3RJZA 2HU2A 3W8DA 2ISCA 3O91A 2P3LA 1BWPA 1PKEA 2NPFA 1PYDA 4HS4A 4YJFB 4DNPA 4ZHSA 4L5CA 3LC2O 1VJRA 5FBLB 1EFAA 3GA5A 1E5LA 4HZGA 4J1SA 1VE1A 1IJFA 3JQQA 1NI4A 5IM4A 4M1QA 5CVJA 1NHGA 2O20A 3E5RA 1RBQA 3DKPA 2Q3BA 5LQRA 5IBPA 4AJOA 1BGVA 1U5BB 2UZ0A 5GZ3A 3O7MA 2QTHA 4ETIA 1ISHA 1JVNA 3CJQA 3JQFC 2AH5A 2QQ5A 4ZC1A 1CD5A 1QRTA 2VF8A 1UBKS 1OT3A 1J2EA 2HO4A 3C3WA 4EY3A 1NM5A 3WAGA 3RUCA 1GPH1 1Q83A 3KIPA 3RUEA 1ORRA 4CG2A 2YL2A 2P3SA 1KZ1A 3QYAA 4OKSA 4QDUA 3JWPA 4LGCA 3RYHB 2BSAA 3VJKA 4IDAA 1LDMA 4EHHA 3BXOA 2VEOA 1L1FA 1JQ3A 1YFJA 2GCEA 3VHQA 3HLYA 3V7NA 2OV2A 3NRBA 5F5LA 3DEZA 1UJCA 4NBUA 4Q3NA 3VDXA 2ZAOA 4YBZA 4Y7DA 2V7QD 5A4JA 8GPBA 5KQPA 3FWZA 1Z35A 1RXCA 3WGVA 1O0SA 3KJEA 1ZUD1 2RC5A 3OT4A 5F2EA 2JEOA 1JALA 3ZGYA 4CIDA 4UCXA 4GI7A 1IZYA 1AC5A 4B2PA 3G2HA 3DDCA 4ER3A 1UPFA 3QLUC 1FRNA 1GPDG 4PCVA 2JZNA 3IPAA 2JVIA 4BJ6A 4LCEA 3RBAA 1SUCA 3BX1A 1SBQA 2HSEA 2JI4A 2ETXA 4YI3A 3B53X 3GFGA 3WSTA 3DFMA 5LUAA 1EFKA 1TNDA 1OU4A 4UVIA 5HIMA 3SR4A 4D02A 5ERXA 3BBLA 1FFDA 4NATA 3T6KA 1BX0A 4RS3A 3BD9A 1RAEA 4XEUA 1LJUA 4O3MA 2Z5LA 2Q3CA 4WZAA 5IJAA 3U7QB 2B5VA 2JZCA 1X7XA 3BWCA 4QUAA 2RGUA 2YY5A 4HYQA 1SBTA 2NOAA 3O7WA 4WESB 3WYCA 4CV1A 4KITB 4Q4DA 4ZPXA 4MUAA 5A3VA 5B3KA 3IQIX 3BTOA 1X7DA 5FULA 1OI2A 4FC7A 3G0IA 3KPJA 2YN2A 1P62B 4DZZA 5JDCA 2FZVA 3CPEA 1UP6A 1YQXA 1EXVA 1E5VA 3H17A 2PBZA 3GLHA 2P9JA 3JVVA 4G37A 4UXIA 5E2IA 4ZCMA 5A62A 4BNUA 5LLTA 2AB0A 3WL5A 4JFAA 1RXVA 1J0BA 2ZQ5A 2BISA 1CDOA 3CVOA 1MXHA 2GRAA 3CTMA 4NU8X 1WY7A 5BYJA 5REQA 2WY2D 5IWCA 1PN3A 3KS9A 2V3CC 3BZUA 2Z6AA 2IYTA 3PPIA 2WAXA 5FUYA 2Y92A 4PHHA 3P1JA 1F1BA 2YRXA 5ADWA 5IJZA 4JCOA 2COKA 3EYAA 3OA0A 4FQ7A 4INAA 2UXBB 4LGYA 1OFUA 1KARA 1CJKC 3E9YA 3GROA 2P1DA 5KWJA 3SQDA 2HQBA 2ASEA 1IBMB 4WKGA 3SZUA 4MCAA 3ZI0A 4CM8B 1A5TA 4QGAA 3NCTA 3B3JA 2PZMA 2JA1A 4S2UA 3B78A 1AA9A 1PJ8A 3ZK9A 3S4YA 4B82A 1DAIA 1P2SA 3B7WA 4AY3A 4H7EA 3U44B 4JSYA 3LP8A 3WGYA 1M8JA 3K0CA 5AICA 3I62A 1IB0A 2Z4SA 3F6CA 3L40A 1UZMA 1W0KA 2IL1A 2ZIZA 4OHVA 3HKBB 4M22A 3V7YA 1NLUA 1NMQA 5C5DA 5L40A 4WTOA 2NN3C 1FY2A 2ZUTA 3GZNA 2XCOA 1UXOA 2O2DA 3OA2A 2YJ3A 3O8LA 4PAOA 1E1CB 3K4HA 4LISA 3STVA 4CTKA 1A04A 3V55A 3ZWWA 4J0IA 4BMCA 4E5DA 1SVSA 2DCUA 2VJLA 3NORA 1AD2A 4R68A 2VJCA 3H16A 5NULA 4B84A 6REQB 2QTCA 1U3VA 1ZGHA 1WDMA 4X8HA 4YMUA 2J9RA 5JHGB 2QXTA 2F67A 1FPQA 4NG4A 5KYUA 4AZ0A 3OPVA 1NDUA 1T26A 4N8DA 3S28A 3SCZA 1GNPA 4MNTA 1D6SA 1P1IA 1PWYE 4L1KA 3CR7A 1T36A 4ISCA 2SCUB 5CA0A 2IGTA 1RM5A 3S1AB 3KEQA 5KVQA 3TCXB 3MGBA 4JLWA 4RD2A 2R62A 3LT0A 1CB0A 2YMPA 1G6OA 5AVSA 3VPDA 4RA9A 4KFUA 4CKEB 1IY0A 1PTJC 1JAHA 1XTUA 2A8YA 4GWLA 3CH7A 4D8VA 5HA5A 5H81A 2C57A 2PA0A 3FUVA 3NH6A 5J2UA 2A0XA 1AMNA 1EQAA 3QEAZ 3TXXA 1XKTA 1N5LA 4HFRA 3WLEA 3DO6A 2AFHA 1UFVA 2I4IA 3R3VA 1XAJA 3BXHA 3IE2A 4X1IA 2DGDA 3ZGZA 2DXIA 1P1BA 2NXWA 4BKMA 5EE0A 4YY3B 3PDCA 4OM8A 2ABWA 2BLNA 2BM0A 2FEKA 2AOUB 2PM8A 3AHDA 3G2QA 3NVAA 3QLVC 1VPTA 4G1VA 3TLGA 2V7GA 3BXGA 4BGEA 3ESZA 5LL6P 1PWZA 4N0EA 2C82A 4QJBA 3OURA 5HBRA 1A8IA 2OCIA 2WB2A 5A3RA 1YACA 3U39A 4PLVA 5JFOA 4URFA 2PGLA 5TB5A 4WQMA 4ZO7A 3QA9A 4FN4A 4KE8A 3WGQA 4HUTA 3P9XA 1JDNA 3C97A 1W94A 3ET4A 4EABA 5JXGA 4Y6OA 2B3DA 3CURA 2OYCA 1NQUA 1DP4A 1XUOA 2E5FA 2P2LA 5H9WA 4D57A 1XU7A 3BJMA 1QAQA 1DWQA 2A5GA 1IIRA 1QGAA 1U81A 2WP0A 1SCNE 3F2IA 3IV7A 3QVGA 4RK4A 3WADA 3H5TA 2JIMA 1DFHA 1ZRNA 1TLTA 4C7BA 2ZSIA 2PL1A 1B1AA 4QPDA 4XGIA 4HUQB 1CDZA 3ROXA 1ZGAA 5DOZA 3HRIA 2BC9A 4O02B 1MAUA 1NVDA 4JB2A 1Q16A 2EP8A 2OBYA 5K20A 3K71B 4JQYA 2FSFA 5FUXA 4BX3A 2NSHA 4CT4B 1YUMA 4JSTA 5LJLA 3WIVA 4M3NA 4YDHB 3N86A 2A84A 2YFQA 5AXCA 4IFEA 4JKYA 4K81B 4RD6A 4L6AA 5H59A 3KEOA 5EIEA 2AT1A 4XPZA 4WOKA 1AHHA 4CL8A 3R3XA 1IN8A 2A9OA 4Q82A 3T4UA 1ZM7A 5IVHA 4INZA 3JSXA 4QRIA 2GBLC 1EA7A 3NWEA 1EEHA 1BU8A 5ABPA 3A05A 2VF2A 1YSCA 1Z0IA 2DQZA 3EXEB 3FFAA 1DC4A 3Q7RA 2NIPA 4J91A 3A4IA 4TS9A 4CLRA 4B9AA 3OIYA 3T35A 4IGFA 1PNOA 1GA4A 4CKYA 3NHLA 1WBDA 2OD7A 3D8BA 1PJLA 3IBCA 4B5LA 3SQLA 4QOHA 2CLFB 3TSWA 4HXFB 1P2DA 4DR3B 1LRLA 2RH9B 5EIXA 1NN5A 4X8MA 1II8A 4Q9HA 3RTEA 3T5DA 4DQ0A 2IS2A 3RREA 5EMNA 2GJ8A 2EATA 3RI3A 2ZSUA 2XCRB 4JJKA 2OCLA 4CM5A 4TYNA 2H0QA 2Z9DA 1Z9BA 2PH3A 2OILA 4QYWA 9MHTA 1M0TA 1FVFA 4OU5A 3NJ4A 4RD1A 4OKNA 3O8BA 3RG2A 2WPDD 3HL0A 1KMHB 2R2GA 1NV8A 3UW1A 1WHSA 2G67A 1K9VF 4NBNA 1XPJA 1H6AA 2D5BA 3TQCA 4C4ZA 4DDUA 1T25A 2AN4A 4IXWA 1CQPA 3CZCA 4Q34A 3NW9A 3VISA 2WKRA 3H7IA 3ILHA 4K6KA 3HZOA 4BVEA 2YV5A 2IYEA 3E84A 4E51A 1C5KA 2Y27A 2FWIA 2GH1A 1UMDB 3DXFA 3BD6A 2MWMA 1RT9A 1G7SA 1TM3E 3D4IA 1RFGE 3NT5A 4K03A 5DTEA 3UAGA 4EJSA 4I1UA 4B6SA 5ULLA 2L18A 3FPAA 3U1VA 3WJ1A 2A3NA 2PH7A 4LZWA 3LNCA 2CV2A 3H83A 5CFPA 3LCRA 5F3WB 2HM7A 4DLXA 3L05A 1UFKA 3G89A 3DTYA 3GCGA 2VG8A 3N58A 4TYMA 5E8RA 5AT1A 3TCKA 1J49A 1BFDA 3MTEA 1TU0A 1VSQA 1QBGA 1JT9A 2DZDA 1KOFA 4CUJA 1GPJA 3DR5A 2YZ2A 1XMOB 2PU7A 1C1HA 1VOTA 3I6MA 3IEIA 2Q21A 3RSHA 3AFOA 3G1UA 3LPDA 3V7FA 1VHLA 5JS2A 1X6VA 5TJ9A 3WMXA 2HSDA 4EHNA 1ZWKA 4HB0A 1SFRA 2D1RA 1URPA 1VI6A 2QSYA 3B89A 3H9JA 3KHTA 3VTKA 4YMTA 1W49A 2H1VA 1G2IA 5M04A 1TT5A 3JYLA 5AHOA 2YFYA 2C58A 5DGIA 2Z8ZA 3GA7A 2HA3A 4NZMA 4Z4GA 3ECAA 2PIAA 1UBJS 2RHGB 5GVSA 3H19A 2V65A 3DR3A 4NPAA 4WJZA 3W8EA 5EC8A 3OQIA 1TKCA 2J41A 4MO9A 5LBIA 3VDRA 1E3EA 1LI7A 1CF4A 4Q7MB 4KWCA 4RVHA 4RTMA 3DFFA 1EIWA 5FLXA 2QW0X 2WWXA 4JBLA 1HKHA 4EZBA 5EMHA 1OLXA 3TOSA 5GGXA 4HDNA 4EVQA 1QRDA 2E6UX 2H16A 5JVDB 1IUKA 2HA2A 1CUCA 5AD1A 1G3RA 4DG9A 1Q1NA 1ZK4A 2B94A 2O9JA 4IXMA 1DAMA 4BMSA 1DIOB 5L3QA 3LUHA 1SXJA 4UFNA 5D7NA 3F8SA 4IHJA 5DBFA 2P5UA 4R1NA 2J4FA 1VDZA 3RV3A 3S7TA 4BPBA 1JL3A 2NQ2C 2QS9A 4JLKA 2HMTA 5AM5A 3GDGA 1N78A 5SZIA 1XCLA 2MINA 1N2EA 2OAEA 3IMEA 3O8DA 4MDFA 1OXVA 2UYOA 3UAWA 1A98A 1D09A 5AW6A 1HV8A 3GYBA 2GUGA 3L7CA 4WN9A 3NOOA 2E1PA 4XB2A 1OA0A 2OZLB 1ISMA 3I01M 3GV0A 3JD0A 4HL6A 1XNQB 2PEYA 4GRAA 4OHMA 5AVYA 3LRTA 3GLKA 5IHPA 1ZS9A 2FWPA 1U6JA 4DV4B 1YGPA 5LYYA 4F5EA 2HPAA 2FGJA 2Z2YA 3OZXA 4CDRA 3JAMA 1SK9A 5HHTA 3KOWA 5AVKA 3LSTA 1RAHA 1JEQB 1P9WA 2R11A 2SICE 2IY8A 2WILA 3LO5A 2HMWA 3Q4GA 1T9DA 3TIVA 4BNGA 3U4QB 2BHTA 2QRPA 1CF2O 4RVNA 3ASYA 1KP9A 1XXLA 3BA6A 2HSWA 3LAWA 1TMYA 1NATA 1U8ZA 2P67A 4M99A 4Q9JA 4L75A 2IOHA 5IDYA 1YA4A 4HAVA 1E9FA 5CXXA 5ERGB 4QLBA 4MQEB 5DXJA 2VDPB 4CPDA 2H06A 2B35A 4C06A 4ESOA 4WZ6A 5K45A 4IWYA 1AHIA 2AZXA 3S2IA 1N3LA 1ESMA 1KXZA 1JPVA 4K46A 1N8NA 2I2WA 1CRPA 3FWHA 2VDMB 2LIVA 1G1MA 1FS4A 2QORA 3E1SA 3KBBA 1W4AA 4IV0A 4ABYA 2TMYA 8ABPA 1KQGA 2ZBPA 1USWA 3IV6A 4QC2A 3SBXA 1RQPA 1FU8A 1NUAA 3V7UA 3LYLA 3EEQA 2C9ZA 2CL0X 2E82A 4ALMA 3A1SA 1XDZA 4ZCRA 1AKQA 2IHKA 5SICE 3EQ6A 4E03A 4URXR 5JADA 1DAPA 3DEKA 4AS3A 4HRAA 1AQ6A 4MVJE 3SX0A 4OM7A 4BJ5A 3ANSA 4IP0A 1H1LA 3WKDA 5COBA 4GEGA 2BTQB 1T2NA 1VL1A 1JJIA 4K6OA 3WMGA 2BM1A 1J5EB 1YR9A 2C8VA 4KUEA 3P0HA 1Z4IA 5CA1B 1OJLA 1YZKA 1B76A 1MEJA 2OLJA 3Q8XB 1UFOA 2J5QA 1EM6A 3AGPA 3OEWA 4M1EA 1TA9A 4I4CA 4G8BA 5CIQA 2FFBA 3GFPA 4H7KA 3OQMA 4UMVA 2C1ZA 4LYAA 3NEYA 1XBTA 3ZBTA 2FP4B 5LD2B 2ZUBA 4WJKB 4CL3A 3PUIA 3TZLA 1UPUA 2WAOA 3WWPA 1KGSA 4GLBA 1NKSA 1M2OB 2AN3A 2IYXA 5LXTA 3WVNA 3EXIA 4F8JA 4BQRA 5ALQA 4PSCA 2UZ3A 2X5XA 3D59A 4BE9A 2J0VA 2ZOSA 1IAVA 2H1RA 1JEEA 2ZLBA 4UW9A 2HK9A 3BL6A 2GAOA 3MT0A 2FWJA 4LHWA 4GPIB 3GX1A 4XGNA 4KUGA 4R3WA 4BV3A 1W29A 1C9JA 2WHXA 3HUUA 3QFSA 1U3DA 3AERB 1GTJ1 1Q92A 5JG7A 4B3IA 1O94D 5CG1A 1XTRA 1DBQA 1SG0A 2VH2A 4PC6A 4HDMB 4P80A 4TTVA 3A3OA 4ARBA 1N9ZA 2O5RA 3MUNA 3TR0A 4DV5B 1CUHA 4XUGB 5EJIA 1M6HA 3GLIB 1GRQA 2OCAA 3DCNA 3DA8A 1JHPA 5A0FA 3TLYA 1JH8A 1T4BA 1QRUA 2VXCA 5ANRB 5ALJA 2ZSHA 2ZSBA 1NX9A 1U5CA 4R40A 5JLAA 3LFUA 1ORIA 2HX1A 1Z45A 1ZONA 2XDQA 1TCCA 4WHMA 1LGYA 2WF7A 4YEDA 1NJ8A 2VTVA 1J21A 3IT0A 3QK7A 2UUCB 2P6RA 4FNMA 2Z0MA 4PVDA 4GYKA 1TO2E 3CX6A 3STUA 4GX5A 4OU4A 4BBJA 2IYVA 3EIWA 4P36A 3ZE8A 2VJNA 5AKGA 4GPBA 4JFRA 4Q3AA 3W90A 1C7EA 1EMDA 2IP2A 1XP8A 1J99A 3TGWA 3NHWA 4Y2SA 1K6IA 1WWKA 2C2GA 1HWYA 2DBYA 3H5AA 1L4FA 1P17A 4LZNA 3ZEIA 3DFIA 5B6JA 2C4WA 1L7RA 2R7MA 4P92A 4L5IA 2FR8C 3GT7A 4F96A 1ECBA 2WOOA 5H5JA 4BV2A 3NHSA 2XRFA 5IBCA 3UMVA 3VR2A 1N92A 1W44A 1N6HA 1SNYA 3AUSA 3EAGA 2V6MA 5K0ZA 1AQJA 2JBWA 4Y6SA 1JE0A 1NXSA 5FV4A 2JCGA 2GEDA 1S2OA 3DE7X 1M8PA 4BV9A 3BEDA 4DY6A 1Q1GA 4V0RA 2B92A 2N42A 2ZAGA 4HYEA 4A0HA 2GTPA 1XXHE 1JLHA 3LWBA 2AOVA 4L3OA 4B85A 5LU9A 2V1UA 1RHUA 4X60A 5CT6A 3LPMA 4EHDA 2NXNA 4OLAA 2BPOA 1SC4A 2OP0A 3IDQA 1D2RA 1QCYA 2M6SA 4GYJA 4PHFA 1QHHB 3TFQA 4DA0A 1JZSA 3ET5A 4Y1RA 1E1QD 2F3TA 1N33B 1M7HA 2AWOA 4I9UA 4NZOA 5PNTA 4B3CA 1HTWA 1O4VA 4KX3A 2P2NA 4E07A 4P3NA 4MVCA 4F4CA 2QLMA 1FP4A 4NBLA 1A8SA 2OBLA 3HJRA 1Q15A 2D2IA 4TV8A 3QE4A 4XARA 5AJHA 5G1OA 3WP1B 1TB4A 2XRYA 2O2SA 5G0SA 3IP1A 2VZLA 5TIIA 4EW3A 5EXTA 5C8YF 1L7XA 3L7DA 2AIRA 5A4DA 3PUKA 4EGCB 2NZ8A 3PXCX 5HZMA 2VI5A 4B6JA 5C1OA 4H59A 5JYEA 3L5OA 1SIWA 2XMZA 2PEZA 5L4NA 2W2XA 3DMPA 4PZUA 4TWBA 1O6BA 2HDOA 2ERXA 4JJFA 4MVJM 3VDQA 2GNAA 1E2JA 2WFMA 3GUCA 1WUKS 1DOZA 1CJCA 1DV1A 1VJTA 3DZBA 2C5BA 3NETA 4R98A 4D9IA 5DZSA 1VP9A 5K3SA 4LMAA 4M0CA 4EQ6A 1GWNA 3I2KA 1ZN2A 3WDSA 3KYIB 2DVMA 4Q21A 3Q2IA 2VQEB 1C9KA 1QKIA 5E6UA 4M8LA 1E2IA 3G8BA 1HDYA 5ALMA 5G53C 3KKEA 1H6CA 1W25A 1NC3A 3HN2A 5JATA 2XMPA 4Z9XA 4RIGA 1R37A 1C9DB 3JALB 1CYEA 1L7EA 5BSTA 4KJXA 1YVRA 2D5AA 3GRCA 4DIUA 3HYNA 3KT0A 2OBFA 5CLIA 4GGOA 3IOCA 5HG0A 4J8PA 1O4WA 1NBEA 3PQEA 2O7NA 1AS2A 3ZOKA 2VNAA 4BNYA 2O6LA 2BFDB 4CTOA 2I78A 3WRXA 4TRNA 2HHLA 4CQJA 1EX9A 2O2GA 2Y68A 3K09A 2RGNC 1SZDA 1MTZA 1KBOA 5HTKA 3THOA 2YZ7A 1WMDA 5LLDA 1XNJA 2Q2VA 2ZJ5A 3DSRA 3ZXIA 5SV2A 4JQOA 4LMBA 2V8BA 3LT5A 2VUUA 1RJGA 3GJXC 4UNSA 4EO7A 5HKKD 2YXPX 3CRVA 1ZOOA 4U0KA 5AHWA 1EBFA 3NBUA 4UVEA 1FDWA 1KQOA 5DF1A 1B8UA 5K3FA 4MRAA 2ZEJA 1WCIA 3E3LA 5DYNA 4BB6A 1N5RA 2AOTB 3CSDA 3JTMA 1W30A 2H0RA 5FL7A 1BS1A 1QV7A 1WXIA 2D4AA 2HRBA 3QE0A 5AI0A 2YCBA 4BCDA 4DCCA 5DM2A 2COUA 4M7OA 3OSUA 4PIMA 3IJEB 4MUFA 5EI5A 2O0JA 1UXJA 1M1YB 4ZYVA 4KB5A 2O07A 2OO7A 1YRHA 1Z7YA 1GAXA 1LVHA 2HA4A 3GU3A 5GY7A 4HD8A 2WUGA 1G8AA 3RIEA 1YOVB 4IGAA 4F6LA 2BJVA 3TUZC 2WNHA 3N9IA 4W5JA 1UODA 4QUIA 4TL9A 4Z8YA 2PGJA 1X13A 3OP4A 3QFHA 1CZKA 1Z13A 2GPWA 3KYCB 1FRVA 4H7DA 1V45E 2IS6A 1KYYA 4DCOA 1E1RD 4YO8A 3UJ8A 1NBMA 3PV0A 3P97A 3LVQE 2PZJA 4W1RA 5FORA 4IEFB 5JSUA 4X6XA 3BMQB 1CHDA 3O82A 2CHVA 3ZQKA 5ES4B 5HGXA 1PGQA 3M6AA 1CEXA 4FFBA 4WADA 4Q4HB 5C4MA 1I13A 3PD7A 4PSKA 2VPYA 3PP8A 1A9ZA 1ULHA 1R5BA 2VF4X 2FQWA 4WASA 1DUVG 3LIIA 3OM1A 1Y9EA 5FWAA 2N47A 3DBVO 2CYCA 4CQLA 4NZ9A 3VSCA 4PO8A 1L4BA 4KGXA 4P83A 1R9MA 4HQKA 5J2UF 2DH6A 1H3FA 1Q0SA 3P2MA 4O1HA 4DQKA 3H0CA 3LDFA 4US0R 1LDNA 2HB6A 4MZDA 5CFOA 4DS3A 3MWYW 4BFVA 4IJKA 1M54A 4UDNA 4FQ5A 3RE1A 3A3PA 2W6PA 3ESXA 1B6SA 4XCVA 1Z5WA 5EXPA 2P9ZA 1W59A 3PJGA 1UC8A 1OF1A 5IMBA 1TTPB 3TNJA 1QPBA 4CMEA 2E4YA 2FHSA 2IYWA 5I7SA 3KR2A 3SSNA 2EP5A 3AKYA 3E2IA 4GR5A 1N2CB 2E9SA 1N2JA 2GAFA 4B4WA 5HK9A 2ACVA 1N8KA 2O7RA 3BMNB 1P4RA 5LZ8A 3SAJA 1ZEJA 4GOXA 3D31A 5EIBC 4OQDA 1IK6A 2RKBA 1XWWA 1EGVB 3KK0A 1RWXA 1WQ4A 4G5QA 1W36B 1QQ6A 1Z4OA 1G8FA 2G28A 4KNWA 5J4VA 1GTVA 3HN6A 1GM5A 1ADYA 5DVZA 2HCJB 4EKGA 1LSJA 1XRPA 1WG8A 1BWRA 3O1IC 3TKLA 2JFXA 5HDQA 4MKZA 1DJOA 5J4YA 3R0IA 2HU5A 4PLFA 4FNGA 1US8B 4EVIA 2Z56A 3AO0B 1CVIA 3KL2A 5D1NA 1JAZA 2FPWA 3ZW7A 2F1HA 2G4VA 3NATA 1JIXA 1L7NA 2XYQA 1R5OA 3OOJA 2VQSA 5D6NA 3I5MA 2AYZA 4Q1CA 3T9AA 3SM9A 4ER5A 4N39A 5AI9A 2Y1OA 4F8EA 2PNJA 3TE7A 3FKSD 2NYAA 5LWQA 3QELB 1HTBA 4IRUB 4Q12A 1FUKA 2P1RA 1HE3A 4GWKA 3L02A 4OO3A 4OXRA 2W2OA 1GT91 2Q5JA 3W34A 2H0AA 1KSFX 1UMCB 3M6IA 5HR5A 4NC9A 2TMDA 1SUSA 3FDFA 1K8ZB 4BU0A 5KMGB 1NQAO 3LUKA 2YXLA 1IQ0A 1L4KA 2WB4A 3K9WA 2JFYA 4ZA2A 3SK0A 4HEQA 2ZKLA 3QE9Y 3U37A 4EQZA 4DPLA 3JARB 4QODA 1E3WA 4PHCA 4EG5A 1A95A 3B9BA 2G07A 1A5AB 2CYBA 2HWUA 3LLMA 5EYPA 4OK6A 5EP1A 3LUAA 3W9UA 1GFWA 4CN9A 3T61A 5JI2E 3AY3A 3E2MA 3MJEA 4W1QA 1L4UA 2MJLA 1DG9A 4OHOA 5KYKA 1ZQ9A 4JY7A 3OP1A 3QKRA 2XOKD 4MH0R 2XCUA 2Y4NA 2Z04A 1DQPA 5CX4A 4IDFA 5T3UA 1E2UA 1ZUNB 4MEJA 2QT0A 3TEFA 4BRUA 3BHJA 4KYIB 5E2AA 4IUYA 1ZIXA 1JNXX 2H85A 1U2DC 2IF2A 5D1HA 4AS1A 3EFHA 3IHTA 1EBBA 3UK7A 4MYSA 1QG4A 5E4YA 1L7OA 2WU4A 3GLSA 4L7VA 4GZMA 1N3YA 1XQ9A 4LQ4A 3UQZA 4GXRA 2PKYX 4C2UA 3PR3A 1K3FA 2CL7X 3GEHA 1LBHA 4RVSA 3QBJA 4XUCA 1K4MA 2H59A 1XYGA 1EFRD 1GSIA 4NZZA 2H4WA 2IV7A 3HRKA 2DETA 2E0IA 5D3QA 1IONA 3DOEA 4QO8A 1L4NA 4LYHA 2QYOA 3FVQA 4WV3A 1WTCA 3A2MA 4ZALA 4BLRA 4EB6A 4Q7QA 2VHUA 2ZWMA 2PD6A 3AUJB 3LUBA 1GAJA 3DVRX 3MWEB 3TKYA 3CVYA 3VSAA 4EJMA 3LYHA 5F7XA 4D8XA 1HSOA 3U4GA 1T2UA 2W98A 2QR5A 1GA6A 3PFIA 1GNLA 1XB2A 3QXCA 4PZPA 1EHYA 1BH2A 3G6KA 4JZYA 4LJSA 4MSUA 5A1JA 1QF6A 4FHDA 4GI3A 5G0WA 3HKEB 4DCNA 1NWCA 3HE3A 5J40A 5F2OA 3FZQA 4MYRA 1NXXA 1JYEA 1B8OA 4AXXA 5F64A 1VMIA 5HCNA 1PZGA 1R6XA 3LHIA 4LWPA 4AP6A 5AOCA 2CBZA 1VB5A 3PTZA 5KREA 2I0FA 3BSYA 4TT3D 2QPAA 4EYGA 2FSUA 1BC5A 4JXXA 2IV3A 2K7FA 1JLKA 3COSA 1ZI9A 5EEHA 1YFZA 2ZJ7A 3C3BA 1EH5A 2HEGA 2VCHA 1J70A 3LHFA 5H9VA 4GFDA 4GP9A 1KZYC 3MAJA 5EUQB 3TBKA 4F2WA 5CB4A 3VVMA 4KU4A 4MVJI 2ZYUX 3RT1A 2O8EA 4P7KA 4GR9A 4BNKA 3QOYA 3KXIA 2PMDA 3RTDA 3UT5B 5F9HA 1GY8A 1L1EA 4JYPA 4WAUA 1BU5A 1RE0A 3EGCA 5K0GA 2C4HA 1FFCA 1DU4A 1IK4A 3A27A 3LL4A 2GYUA 2E2WA 5JW6A 1C1YA 4WECA 4PZDA 5LIRA 4JOCA 4CR6A 5JIBA 3IFSA 3L6DA 4LVUA 3L9WA 3E0XA 2OY0A 4Q6BA 4WZBA 1FSGA 3O90A 4ZO9A 1T1RA 1L4GA 3WHKA 3UFXB 5KX5A 1QV6A 1WSDA 2G5CA 2PMKA 3KJGA 3OC6A 2BGGA 1I33A 3WGKA 2FPGA 2G1JA 1JB9A 1DRWA 3AWIA 2BE7A 1OTHA 4R54A 1BXRB 3G2OA 5LQUA 4DCGA 1VPVA 4JUFA 1Z15A 2O1SA 1Z2CA 4O0MA 2FZLA 4KYVA 1DT3A 2WKQA 4OHBA 4N18A 3SN6A 2NO1A 5FFFA 3TAHA 1BE1A 4MULA 1C8VB 3VAAA 3Q5GA 4R7ZA 2PBFA 2CCJA 1CR6A 1QAOA 1U9CA 1BKYA 1BRTA 3KLMX 1UDAA 2ZRLA 1NVAA 4AYTA 1EJ2A 3EGWA 3DE4X 3JAWA 4U2FA 4RMIA 4DBLE 2DLNA 5FLYA 4WLEA 4B9EA 4QDZA 3V3KA 4RADA 2R00C 5A02A 5D3ZA 4QGBA 1SKUA 4FI3F 4YP9A 1NURA 1S3GA 2HFJA 1B93A 1CY2A 1NA5A 4JC4A 4YJGA 2PL3A 2EOAA 4D4KA 4Z2AA 4YO7A 2J8ZA 1JJFA 3GEMA 2NT3A 5I9NA 1EQ2A 5IC5A 3AVPA 1BS2A 1NOKA 3GGGA 4CM1A 3REQA 4IIHA 1HZZA 1RADA 4YJ2B 4CE6A 5JISA 2R0QC 4Z51A 4M9SA 3FYHA 3W2EA 1AMUA 3FXAA 3ADBA 4JR0A 1EK0A 4NU6A 4TV9B 3ADDA 2WHQA 4U4AA 5EOVA 3CFYA 3EFBA 1YRWA 4I55B 4DV6B 3JD1A 4KG7A 1NN0A 4OJQA 3GH1A 1P60A 4HLQB 4TXMA 4EGJA 3JWHA 1S3SA 3SKYA 3WKEA 2Z5FA 1KOLA 4CHGA 4E1VA 1QLJA 3RR2A 4EG6A 2VNSA 4U8HA 2R79A 4LOIA 2FN4A 2A9QA 3WYFA 2CV0A 2CXTA 1IWBB 4O29A 1MOZA 1XRLA 1JAYA 3TRIA 1QTQA 3QNUA 5J43A 4OQMA 3AI1A 3W5HA 4WY8A 3SDBA 2WOJA 4UKDA 5BSKA 3KSUA 421PA 1C80A 1NIPA 3BKXA 3A1EA 1T9BA 2ODQA 2OAGA 1PTKA 3NWPA 2PTGA 4IY1A 5AH0A 3UOWA 1FTYA 3T12A 4C4XA 4D6PA 4BQIA 4U5QA 2HF9A 4NMMA 3AIMA 4GKKB 3CEAA 1A4RA 3MMSA 1OTYA 3EVTA 3H1PA 1R27A 1BN6A 3GFBA 3H4IA 4HN2A 4PC2A 5ARBA 1MJHA 1L6RA 2GPJA 3KYDA 1UJ5A 4AF6A 3C6YA 1CNMA 4B4KA 4YS6A 1P33A 4HDKA 4WKCA 3WMFA 4F9FA 3UWSA 1D03A 1DO0A 2FTKE 1XMJA 1YTLA 1J24A 2ZG6A 2DAPA 3AEQA 4JWKA 4B3XA 3B1WA 3CUVA 1SXGA 4KVGA 5T4HA 1C41A 1KY2A 5ESDA 1NXWA 3GHYA 3K9LA 2CNOA 2QQEA 2F43B 4L73A 3HM9A 3HJCA 1ABBA 1U0LA 3R3SA 4AB1A 2C31A 2AX4A 1U3FA 3HWWA 4C0BA 5AM2A 1EKXA 1CRLA 1X9HA 3F49S 4D92A 5HIAA 1N2SA 2IUSA 2QM8A 1Z25A 5FQOA 4YAGA 3T1HB 1QBKC 2FOXA 3H6GA 4PAQA 4W4TA 2B1QA 3OAAA 1JHQA 1P7YA 1U94A 4BGUA 1I32A 4UXHA 3F8TA 4AG3A 2YMQA 5TQ0A 3GUYA 4GPTA 5EMLA 1IL0A 1V16A 2Y1DA 4KPUA 5AHXA 2ADFA 4MS4A 3HHPA 3LCVB 1WW8A 2PAAA 1VSVA 4LG1A 3EAQA 3ZJ4A 2ZCJA 5LQDA 2PSJA 1OGJA 1ZCFA 1KWKA 4FUTA 1V9LA 1VKHA 4MQ4A 4WOBA 2ZAMA 1OI4A 2XRMA 3FYUA 5K3DA 2OV3A 3EXHB 4C30A 3M34A 5L4SA 2IOFA 2PXXA 3WYEA 4NCKA 3V00A 1XHLA 1H8HA 1NVVR 3T7CA 4O4HB 2ZIXB 3PNYA 2HZBA 3B13B 3FFTA 3QZUA 3QF4A 3ABIA 4MUHA 3FNHA 2O8DA 2RGYA 1UFRA 3EA5A 2JLZA 2QE6A 3KQNA 2Q3MA 4CLHA 2GEVA 3D4OA 3M6FA 4RQUA 2VWHA 2YUTA 3PWSA 4G0NA 5LC1A 3GJ0A 5ELXA 3GRUA 2H2WA 1QLHA 1Q7GA 3DD1A 3GD7A 4KO1S 1O9BA 4MCHA 5EFZA 1P4HA