3TB4A

Crystal structure of the isc domain of vibb
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
205
structure length
205
Chain Sequence
IPKIASYPLPVSLPTNKVDWRIDASRAVLLIHDMQEYFVHYFDSQAEPIPSLIKHIQQLKAHAKQAGIPVVYTAQPANQDPAERALLSDFWGPGLSEETAIIAPLAPESGDVQLTKWRYSAFKKSPLLDWLRETGRDQLIITGVYAHIGILSTALDAFMFDIQPFVIGDGVADFSLSDHEFSLRYISGRTGAVKSTQQACLEIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vibriobactin-specific isochorismatase
publication title Structural insight into the ISC domain of VibB from Vibrio cholerae at atomic resolution: a snapshot just before the enzymatic reaction
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
total genus 75
structure length 205
sequence length 205
ec nomenclature ec 3.3.2.1: Isochorismatase.
pdb deposition date 2011-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3tb4A00
3OQPA 4H17A 2WT9A 3O90A 1X9GA 2WTAA 1ILWA 1NBAA 3O91A 4L08A 1XN4A 3EEFA 3KL2A 3UAOA 3TB4A 3PL1A 2H0RA 4L07A 1IM5A 3TG2A 2B34A 4WH0A 2FQ1A 3V8EA 1NF8A 2A67A 3S2SA 3TXYA 1YACA 3HB7A 4WGFA 3R77A 1J2RA 1YZVA 3LQYA 3O92A 1NF9A 3MCWA 3O93A 3O94A 3HU5A 3OT4A 3IRVA 3R2JA
chains in the Genus database with same CATH superfamily
3RLFA 1R5OA 3A1UA 4PAQA 3JSAA 3KE8A 5BNIA 3O0TA 3OJLA 3PHIA 1R88A 2P6PA 2B94A 1CIVA 5KWEA 1WW8A 1HTBA 1NC3A 2B37A 2FSHA 3L46A 4ZCQA 4F93B 2Y0DA 3QF7A 4O5AA 1S9HA 2VZLA 3WXMA 3I09A 4C0KA 2QLMA 3T9DA 5B1SA 1N0WA 1U0TA 2ZU0C 3C8UA 3NTQA 3NH9A 4F3YA 4ZZ1A 5CB4F 1UT6A 3QSGA 2FN4A 4FYXA 3GLGA 1Z22A 4IWYA 3DXZA 2M1XA 3F7OA 1KIAA 3F9IA 2FK8A 4JJ7A 4DWWA 4YYZA 3NQ41 3AU9A 3AMVA 2OCXA 4YP1A 1POXA 4FLMA 4JL6A 5H82A 2XE6A 3EODA 3H16A 5SZHB 1EI9A 4HZUA 4LECA 3GEEA 5DXJA 3TWOA 2WHQA 3VSCA 2AG8A 2HB6A 2AOUB 3CV3A 2QD2A 1DV2A 2NYRA 4J1TC 4OQNA 5C8YB 3MUEA 1U7PA 1AN9A 1I14A 3UAYA 5KQPA 5CA0F 3S2UA 3V8MA 2G4VA 3HJTA 4C9BA 2E82A 5EP3A 5ITZA 3MWEA 3NC0C 5K0NA 2LKDA 5EE5B 2QP4A 1K2VN 4ZXFA 2CNWA 3T4UA 3I1JA 3H8WA 2O0MA 1R37A 2UZ1A 1ZD9A 4LJLA 4ECEA 1DDOA 4XSHA 5ERGB 2Z6QA 4MQ4A 3EWAA 2ZSHA 4UJ5A 1SVOA 3MQFA 4EHAA 3DTYA 3IT1A 1YZTA 1A88A 1MB2A 3BXZA 4C0BA 2Q5CA 4H4CA 1QP8A 5KC8A 1ZXXA 2NSDA 5IXYA 1FMTA 2JD0A 3PNYA 1GT6A 1H4TA 4OKNA 3D1LA 2E5LB 3KX2A 3IAM1 1FYVA 4JODA 4KE8A 1EDDA 4MVJH 2YJ6A 3TG8A 2RG7A 1VI6A 3QMWA 4KDFA 4X84A 1EX9A 3DPIA 2PCLA 4NBSA 1CUYA 4GQBA 4X1YB 3UHOA 4S04A 4RXMA 2L69A 3QWFA 1VHQA 5L53A 4MUNA 5K3OA 3A2LA 4KLNA 2J33A 4YXWD 2D1QA 1VTKA 5KQGA 3ILYA 1V8PA 5EYPA 1G3UA 2PLWA 4GPAA 3NHBA 1M1ZA 5EXXA 1GU7A 1L5GB 5ADUS 1VDMA 2XWBF 5IAJA 3SSOA 2R6GA 4BXOA 2I4LA 4JFRA 1MC8A 2ZI6A 1KI2A 3K9HA 4WKNA 1C30B 2ZYHA 3EDOA 3UAXA 3H5LA 4ER0A 5A7HA 1BMFA 1U1IA 1Z2AA 2NYVA 4ER3A 1WZEA 3H99A 2Q5EA 3LKZA 4TTJA 5AM1A 1RPAA 4A27A 4FGUA 5K03A 2VSYA 4IS3A 3K0EA 1ZVMA 1OUMA 2HBYA 3Q7RA 2IE8A 3I39X 1H94A 1W1WA 1IJFA 1XJQA 2X1VA 3KTAB 2PE5A 1I1OA 1E4VA 2NU8A 4AQDA 2X0NA 3KT0A 4B4UA 2AC2A 2HIAA 3GARA 4JEMA 2RAVA 4D8UA 4K7JA 5AXCA 4GUAA 1HDEA 4CR7A 2ZZKA 2IZZA 4W5HA 1AO0A 3KUXA 4EY3A 3KQHA 2I0FA 2HH9A 4UBIA 4BWYA 3HC7A 2NSYA 4NU5A 3AVTA 1JE0A 1LDGA 1BWRA 2X76A 4RV5A 3G8AA 4MVJM 3WICA 1IPFA 1VPDA 1GGMA 1Y8RA 1KO4A 2PRIA 2XNDD 3BZBA 2JFXA 5AJYA 5I9SA 1JHYA 1FTQA 1V3QE 5CX4A 1NRWA 4YRFA 1GTL1 2ZP1A 3HO6A 4ZAVA 2L2QA 5LQSA 1P1FA 1B2RA 2OXFA 5B4TA 2C7RA 3Q3VA 3DZKA 4FWIB 4OHZA 1XDZA 3PGXA 3EXAA 5KHAA 2OFWA 2HXGA 3E8SA 3E84A 3ZDCA 2QTMA 3LZ6A 2OFOA 1E7MA 4G3XA 4OTZA 3QY0A 4JUCA 1U4NA 2ERCA 3ZCXA 3ZQJA 1G1MA 3UK2A 3IBSA 3QGMA 3G49A 2XYPA 4EB8A 2GDJA 1RJGA 2RCNA 4DC9A 3AF3A 4R9UC 3ENNA 1JFFA 3JQ9A 2Z08A 3ROGA 2AKYA 3OCUA 2C2ZA 4MV9A 2D06A 1ZOOA 1A2KC 1B8OA 5E9AA 3T3IA 3PKJA 3VOTA 4RTMA 4YUVA 5IKPA 4DV1B 3TQFA 2R7LA 2NIPA 1SVIA 3BTOA 1G291 3AJ9A 3K5HA 2GPJA 3T0FA 4MROA 4OL9A 4JL8A 4RKRA 1U0SY 1WBDA 1YNSA 3DEJA 1PGNA 3O7MA 1DS6A 4P5EA 1GCGA 4QARA 2Y0EA 1HGXA 3AKEA 3COPA 1C9NA 3Q1KA 1YI0A 4YPVA 1ZIYA 4MGZR 3WYFA 2GCPA 4NATA 5FTJA 3STWA 3INRA 5EC8A 3WFIA 2G77B 1CTQA 2CXQA 4Y2JA 4MIYA 3QE9Y 4Y2UA 4WXHA 2YHUA 3F74A 5D8DA 1UKAA 4OY3A 3UOAB 2G71A 2X4LA 3CIOA 2HK8A 4BIMA 1TT5A 2W4QA 4DG5A 1Y81A 4CLOA 4LF7B 1ZM9A 4YMIA 1N6HA 1PJBA 1A9OA 2NUTB 1SM4A 2VF2A 3WO1A 3N7AA 3H1EA 5HX7A 2QRNA 2A67A 2QSYA 3JY6A 3DMPA 4G0QA 1QCZA 3OPYI 3RSOA 3TCKA 4L5AA 5BYBA 4L3OA 2X8WA 3DZBA 1P2GA 3GC6A 5EXDA 4G26A 1W0KD 3QBVA 4INPA 3K9GA 4ZO4A 4PHTA 5BW4A 3SCZA 1KMMA 2BHLA 2ZZMA 1JWLA 2BSQA 3VU9A 4V39A 5CDGA 3G2MA 1TK2A 1X9GA 4TV9F 4B8ZA 2Y05A 3M2TA 2ZRPA 3MN1A 2FMIA 4B0PA 1U02A 2JBWA 1MR3F 4GC5A 2J5QA 1DOZA 1V1RA 1B26A 4AZSA 2ANBA 1M7BA 2XXAA 1EWQA 1BJTA 1J33A 4Q5IA 3CX8A 3BB3A 3KOZA 3OMLA 1XHFA 4PNHA 5CJJA 2EBHX 4L5IA 1U0OC 5P21A 3B36A 1WQ3A 5DHFA 4E5MA 5CIWA 2HJHA 4RSMA 2O2SA 2XKJE 1NXSA 4XYBA 3NHPA 1T6ZA 1T91A 3BHIA 3FLMA 1CR6A 1I94B 3TLGB 2B99A 2XA9A 1JJFA 3ECCA 4C5CA 1EGVB 2XPCA 4W8GA 1TL7C 4F8JA 1QYXA 5K3EA 3EEIA 4YRRA 4LJRA 3ESXA 3ZE0B 5FBWB 1ZH6A 3HKCB 1RRGA 2DPGA 5CB8A 2Y0BA 1PS9A 2PX6A 3DKKA 1JFVA 4TSRA 1NZDA 5BR4A 5LQAA 2YVKA 2COEA 4B3SB 1BA2A 4BJHB 5K0SA 1KAOA 3C3EA 1HOXA 3FROA 4UUPA 1M1NB 2FW9A 3REQA 1C4XA 3C74A 3FGNA 4R7TA 2WSSA 3WNQA 3GN2A 3L7IA 1WSAA 4JLNA 1O6BA 4YT4A 2QX8A 3ELWA 1RIFA 4RZQA 5DDIP 3KV3O 4HB0A 4NCNA 3O74A 4L51A 1H5QA 5KQMA 2X15A 2R66A 3HCAA 2HJRA 1B8VA 4X7BA 4ZT7A 1IUPA 1JAYA 1HL3A 4ZQGA 3ZU2A 3OF5A 5AXBA 2ZJ5A 3T5PA 3MD9A 3A2NA 4A6PA 3DV0B 5CRIA 2NO4A 2QPOA 4NF2A 2Q5IA 2O8CB 1YL5A 1OWPA 1THZA 1VP3A 3TLXA 3TOSA 2GVNA 2IODA 4P3PA 4BFZA 4Z2AA 4ZK6A 2ZRAA 4MXDA 4UUAA 1JQLB 3ANXA 4BMYA 3RASA 4D6PA 2FYTA 3WGYA 1REQB 3RUDA 2C2XA 4L5YA 5HQ3B 4M76B 2XDWA 3CT4A 3K71B 2X5JO 1YK0A 3GGPA 3FTEA 1ZGZA 4MRPA 3GGCA 3VTZA 1KJ9A 4RV4A 3ZWNA 1NHGA 4NULA 1MBZA 5JWHA 3H3JA 3UJBA 2AUMA 1EXWA 4MP8A 4HGYA 4FE7A 1TRKA 5AVSA 3HZRA 3EIHA 1MC1A 2FXVA 1EK0A 2GFQA 3KAQA 3PWKA 5JXIA 4OQZA 1QRAA 4K0RA 1WLYA 2V03A 3WSTA 3CKYA 5I3CA 3MTEA 1FBTA 2BKUA 1E1DA 5LQMA 4GM4A 2P3QA 1BGXT 2YVUA 4ME6A 4YECA 4CDNA 1JAXA 1BKDR 4N0DA 3IKTA 1N7HA 3C87A 3V4VB 3R3HA 4NBTA 4ZANA 1PP4A 1G6Q1 4E13A 4AAYA 5HTKA 3WGKA 5DPMA 4MVWA 1IN7A 5CIYA 1FTGA 1PL0A 2BMVA 2FLKA 5E4TA 4GD3Q 3ZOZA 3KSMA 4DXAA 5TVGA 4X1IA 3R5JA 4AKIA 3U37A 1J0XO 4G9GA 3OT1B 4D43A 3DW3X 5JCZA 1ZD3A 1E96A 2CGEA 2C3PA 1WSBA 4BNFA 5TGZA 4L4UA 5D3QA 4MV8A 4TWZA 2Y1LA 2OV1A 2YV5A 4OAPA 5FPPA 1JDUA 4UHDA 2WF8A 4Q9AA 4ZWNA 3ZW7A 3VR5D 1VSUA 4KK4A 1K06A 1Y89A 1AGYA 5DIZA 4BU0A 4XLZA 1HI9A 1N9GA 3N0VA 1T13A 3HACA 4ONEA 2C8VA 1MV8A 4PWZA 4KYVA 2J3JA 3ZLJA 2XYQA 2POCA 2CUTA 1JWAB 3B3JA 4OBBA 3EA4A 3DHNA 5I8ZA 4EECA 4L28A 4EUFA 3I8XA 3GT4A 1YA4A 3MS4A 4H2DA 5L3RA 3R75A 4JNKA 4U0KA 3UGTA 1ZM3A 2QT1A 3D2BA 4LW8A 2P35A 3M3DA 1QLHA 1YDGA 3SGLA 3C3YA 5F4BA 4QZVA 3TAUA 8MHTA 1VHLA 3TGPA 4EEXA 4OGLA 4A5OA 3V34A 5JS7A 3B6EA 2XMCA 3LECA 3RWBA 3MG9A 2MSCB 5TQ2B 2W8BB 3ZD6A 2GLTA 3KLMX 2DH6A 1Z0SA 3KS9A 2O7NA 3EUFA 3C8ZA 3L6DA 3LBIA 3ABSB 3ZCVA 1ZN7A 3O3NB 3JTMA 5FI0B 3VU8A 4NE7A 4O59O 1PJTA 2J48A 4TPKA 3L01A 3ZKWA 5CDYA 1I3MA 4IR7A 5THQA 4BBJA 5JNSA 4RULA 3KD3A 3PFIA 3HVIA 4HDRA 1JAHA 3GA7A 4CQNA 3WX0A 1RKQA 2Z6UA 1YV9A 2YNMD 2I2WA 4YT2A 1TZKA 5ARCA 4EW1A 2VP2A 3WJ2A 3IP8A 3MPUA 2Z8YA 3FR8A 1UBFA 4GHWA 3W2GA 1RXYA 3E9YA 4GOND 4R8VA 1L5MA 1S01A 3D5EA 3JQ6A 3M7IA 3OLXA 4L72A 4CXMA 4UZFA 2ZE7A 1PTKA 5K0JA 4NDZA 4OBXA 3DQQA 4M1OA 4AN1A 1YKFA 3L07A 1CKEA 3TYXA 4KQFA 5DRYA 1EEXB 4RTSA 4EZEA 3NIWA 4WIAA 2Q21A 2ST1A 3CRZA 4HK4A 4HSEA 5AK0A 2JVIA 3TD9A 1KI8A 4YIKA 4I5EA 3HLTA 5IZCA 3PQ3A 1N8NA 1CDOA 1Z0JA 2VWHA 2IZOA 2YYAA 1QONA 2EFGA 4ZVOA 5D5QA 4WXMA 1JB9A 4AUKA 2IIPA 4RQUA 2FMHA 4KQ9A 1PCXA 3F6YA 4GLOA 1K8YB 4QREA 3L05A 1AK1A 1PYDA 1NFQA 1PJZA 3DTVA 4KZKA 3NVKI 2ZVDA 1XA3A 3E3OA 2MINB 1I30A 4RWEA 1URPA 4GP9A 4INOA 2Q0QA 4YMSA 2PDAA 3NH6A 1YZYA 4MJ7A 5DLYA 5LIPA 1HT3A 2FMUA 4MHTA 3DDWA 3VPAA 1W94A 1H9CA 1HTWA 3S40A 1Y33E 2MR6A 4O3FA 1LDNA 2NU6B 3HXKA 4JJ6A 3BPSA 1J8DA 5FOVA 3EXG2 3C6BA 4MRVA 4C6TB 3N0RA 4A26A 5B12A 1II8A 1YJQA 3Q11A 3HJGA 2CDAA 5CA1B 3OAAD 4M9XA 3U7JA 1YIDA 2DP4E 2MJLA 2ZRHA 3HUUA 3I9LA 3V1MA 1AN0A 5FFMA 3T9FA 2M6KA 3UATA 3FX2A 2IPOA 2IBSA 3LFUA 2O48X 2XUPA 3VKFA 2ODQA 1RP7A 1DXOA 3HN2A 3PA8A 3ZH2A 1LRLA 5AKXA 4QUAA 4K9MA 1KDVA 2B36A 4FNAA 3SF8B 3E8XA 3ZS9A 1ZRSA 4DY4A 1N36B 4TSKA 3GP8A 3CZ5A 3RQIA 1YHYA 1M66A 4I9HA 3ND8A 5HF8A 2H2IA 2FI1A 2AFIE 2ZULA 2H4FA 2J08A 3LX6A 3H1BA 4TL9A 5DCLA 2JLXA 1IBLB 1TQ6A 1RAAA 2ODNA 2VYNA 3GRAA 3J7TA 3ACBA 4PICA 4R2XA 2HU7A 5FOUA 3CJQA 4ITUA 1G55A 1Q7RA 1YQDA 2IBTA 1JHMA 2J4DA 3WK8A 1VJ5A 3IMFA 3PFCA 5I9IA 4QATA 4HLQB 4LYDA 1I4LD 4J7XA 5CFMA 1E1QA 4B7ZA 4ZDIA 1DDIA 4PQFA 4Q7EA 5A62A 1IM2A 1JLRA 3N58A 5BN5B 3ZNQA 5JEDA 2YDYA 5IDWA 5TLSA 3R3UA 1EDBA 3PK0A 5JVDB 4OA8A 1T5LA 1VE1A 1X87A 3OPQA 1U4OA 3P9SA 3LUJA 1Y1QA 3A04A 3TLAA 3U39A 3VR5H 5KTTA 2ZJ6A 4Q7LA 1BMDA 1J2RA 1OHHD 5E2AA 3KETA 2HHJA 5KNLA 3TF5A 4BNIA 4WBNF 1J25A 4US1R 4H3KB 1B3RA 4JHLA 3GW8A 4V0KA 5EKTA 4OP2A 1MZPA 3QEMB 3HVHA 5IJWA 3AIKA 3WWEA 4HH4A 1KL7A 2OORA 3LCVB 4PS1A 4B8YA 3ORRA 4DLZA 1A96A 5FCDA 1G59A 4Z4GA 2QTHA 3TMAA 2WQ7A 3TW0A 1LBTA 2A7QA 3BCHA 3IERA 4YR7A 2Q8QA 1R6BX 1RXCA 3K0KA 4YALA 4K9LA 1S3SA 1VLQA 4MJLA 4C14A 1C3OB 3G0HA 5CURA 1OAOC 3B6KA 2O8VA 3CEPB 4WNAB 5E4FA 4IUDS 2WVGA 3M5DA 1I4TD 4H4EA 3PNLA 4EG3A 2FLWA 1KR5A 3W05A 3CG4A 3OE7A 1ZP6A 3QEKA 1R6DA 1KMCA 1J1ZA 3K6RA 3SHQA 2X0EA 2O1XA 3IC5A 2WKQA 2ZUCA 2FSFA 3BXXA 2GF0A 4JYBA 4MP6A 2A86A 4YEDA 4CKCB 5JYDA 4ZTZB 1MOZA 1JDTA 5ALXA 1N3IA 1V8ZA 1M6VB 4EW3A 3WOVA 1P5ZB 3LLUA 2IY8A 5JNWA 5DNYB 2DY0A 3IPYA 2OLKA 3GMDA 1QZXA 3MBKA 4E6PA 4L4XA 1YFJA 1KFEB 3S29A 2OHOA 3PXBA 4PRLA 1QTNA 2O7VA 1XHEA 2PO5A 3GRPA 1R0XA 2IV7A 4FFRA 2CXRA 3F5MA 2PUHA 3T1QA 3HMQA 3ZPXA 1TA0A 4LYEA 2R0QC 2QRPA 1TCVA 2A5YB 4RSHA 1OU0A 3QBEA 1KQGA 1PG2A 5DRTA 3NBQA 2XZTA 3U4IA 4NK4A 4QQRA 4EO4A 4ENTA 4YMUA 4S3MA 4CL2A 1WE2A 3S28A 3ZHZA 5LMZA 3IDZA 2ZTLA 3A1WA 4LK2A 4S1VA 1Q0TA 1NA5A 2HMAA 4HFJA 5ELLA 3MUOA 2HRBA 3R3ZA 5KUTA 4MKHA 3ICQB 2I66A 4MINA 4LVCA 4RK5A 2DGDA 2V5VA 4RENA 2FEPA 2VJBA 4UCFA 1EK2A 3AF2A 1DRJA 4RQTA 3U1BA 3OVMA 3ADPA 3ZIUA 4XA8A 1E4EA 4A8PA 3L7BA 2D62A 4IHJA 4IDPA 4O1HA 3C7TA 4GYWA 2CLLB 3SEAA 3MXOA 2W58A 4X0EA 3K92A 2V4ZA 3WKBA 1DELA 1TM2A 2GPWA 4A10A 4OOFA 2V3CC 2CLIB 2EZUA 3NTXA 4TV9B 1Q1NA 2EZ9A 4YAGA 1I32A 4RQAA 5BRNA 1NPTO 1Y6JA 2P2SA 1OLSB 2I3AA 2W6PA 3LSYA 3LT1A 2DPYA 4MS4B 4NL4H 4PHFA 4BZZA 3DVAB 2R60A 4PC3A 3UJ9A 4Z53A 5BQOA 1DTEA 2D8MA 4X8LA 5CVVA 4MWGA 1AKUA 1C9MA 3A25A 1WUKS 3OP4A 3WISA 2E6UX 1FS5A 2PO7A 1N3LA 2PBRA 2CF6A 1UJ4A 3L7KA 4TQUS 4LBYA 2H0AA 3ZLUA 2IW1A 5JW6A 5KTNA 2FSGA 1BW9A 2ZR9A 2CW5A 2QYTA 1OZ0A 3EVCA 2FU5C 2WLSA 2EWVA 4FGZA 2P2NA 1H6DA 4D9FA 3AR5A 4OXKA 2I65A 3U60B 1T2NA 1WAMA 2CE7A 4N3GA 2B4AA 1KERA 4N54A 5GPBA 2SCUA 3IUJA 4H3HB 3JQQA 4M89A 5DCYA 1CEEA 3I83A 3E9NA 1NJ6A 5K1ZA 5J2TA 1E77A 1R50A 2P9EA 5ARBA 1RD4A 3IUQA 1EH5A 3WWPA 3R0IA 4E4YA 3RC8A 2WWVD 4D3YA 2JZOA 2ID9A 4XPZA 3SHVA 5SZIA 4KE9A 1NMEA 2X7JA 5FBRB 3BL8A 2VQSA 1EUDA 2XB8A 3AV3A 1I1HA 1Q19A 3FZGA 4GW3A 3IUBA 4IJMA 1RYBA 1MV5A 4I1VA 1V39A 2L82A 4QXAA 4L22A 4BO9A 4E33A 2P9YA 1CZKA 4LF8B 3OUZA 1H1DA 1U8AA 3HDYA 1DO0A 4NMHA 2EDCA 4O4IB 4RIFA 4WHMA 4CMEC 1MMFB 2VAPA 1R4AA 2ZRKA 1R0ZA 4XWTA 1D7OA 2Z8ZA 3K9WA 4ALKA 1MNQA 1GVHA 3OMXA 2D5AA 2ENWA 2C1ZA 2CV1A 2OO7A 1ZOSA 3DOEA 4LRWA 4RKFA 1UJCA 3BD7A 3KDSE 3ZE7A 5EHXA 2YOHA 4A36A 3EQ9A 3WQRA 2GNOA 4GX2A 4IHAA 1JHZA 1LNSA 3UUEA 3IAS6 3IQHX 2JGEA 3FETA 4O4HF 4FYIA 3FFXA 5H3LA 3VO1A 2FZKA 1ZNWA 4AIIA 2XKKA 4LF9B 2Q3MA 4DJEC 5ALUA 4LDQA 3HJFA 1C3LA 2NVBA 1XZCA 3TXAA 2O0LA 3IP7A 4HEHA 3PTLA 1Z6ZA 2GPYA 3LQ2A 4AY5A 2B6HA 2I2AA 1HLFA 5KNCD 3I30X 2ZYSA 5BMOA 4LZJA 2GHTA 3PC7A 1FP4B 1ZM4A 2R751 5CVTA 1TB4A 4TWAA 1WOMA 2VNSA 3RSLA 1GLGA 1RXEA 2YWBA 4WKCA 1MU0A 2Q29A 3EOAI 4TKVB 1E9BA 1W44A 5T67A 1KORA 4IV8A 3CB4A 3D3NA 4DR4B 5H1YA 4D3FA 4GVPA 1VPVA 4CODB 2WT9A 3UANA 2GH1A 4KSCA 4PAMA 1K0FA 1TMGE 3ISJA 4JB3A 2F7SA 2FPRA 2I8LA 4UQPA 1USKA 1M2GA 2ZSUA 5KEIA 2Q4BA 3Q6NA 1AA9A 2OB1A 1LNQA 4G8DA 3ZU3A 3OZCA 2J3KA 1FUIA 3NTLA 2WEKA 4L4SA 3DO5A 3VPFA 1XVUA 3M6AA 4ZJZA 3ENKA 5K4AA 4FQ8A 6NULA 3TZHA 2QX6A 1ZUNB 3DMFA 3PQ4A 4FHZA 1H3NA 3D3JA 3W5IA 1RQPA 4P53A 4Q48A 3DAOA 2AW3A 2HTEA 4AKTA 3VTAA 1L4MA 2JF0A 4AY3A 3K8OE 5I9NA 1EWTA 1WPRA 3BWVA 3OOWA 1WB9A 1UFKA 4JA0A 4P4SB 3T7SA 4Y1EA 4QD3A 3ZNOA 5JQWA 2OXRA 1QUEA 4OATA 1T6NA 3IULA 5EZ6B 2REOA 2GZ2A 4LZZA 3NW9A 4N12A 4F7WA 2PNFA 3TBKA 4RZHA 1CFJA 1LLDA 2HMUA 4R05A 4IMPA 2D0IA 1I0IA 1BHQ1 3G23A 1BEEA 1SOWA 5MGNA 4AP6A 1E9SA 3ZIAA 3EGCA 1E2QA 1Q2XA 1L7XA 1KZ7B 1X1BA 3DZCA 2NP6A 1KAHA 2MDTA 3H9JA 1USIA 4C43A 1KA9H 3I6YA 2K87A 5AJVB 3RRMA 5IRCD 1NXQA 2YR0A 5FUWA 2ORVA 3KDAA 2ALJA 1PJ4A 2C2KA 2ZXEA 3CXRA 3OPYB 3U7QB 2QSZA 2ZTMA 2PQ6A 4G1EB 2WWGA 1XV5A 1NI4A 3FN4A 4HLUC 3S70A 4D3DA 4OQMA 2PJRA 1P39A 1SHKA 3ED5A 2X8JB 3MUNA 2AKEA 2DQ4A 3L41A 5B57C 4QM7A 1GL3A 4QXRA 4YASA 5DM0A 4IFTA 3TGWA 3QMMA 1MP0A 2WUDA 5M3BA 2ZB7A 5BN3B 2O5RA 4HUJA 3PWTA 2QVBA 4TV8F 4LVNA 2WNIA 3DHEA 4CF5A 1YU9A 1CJKC 2IDKA 3DTNA 1KEUA 1SBYA 4ND4A 3W2FA 4DLAA 2ZRFA 1UMCB 4I14A 3V8PA 1JLHA 2FZLA 4LHSA 3DKPA 2QUBA 3B5EA 3PNVA 2SKEA 2XV1A 2PT9A 5HS4A 5BW6B 2Q5QA 3SBEA 3E9ZA 1SXJD 3WMWA 4MVJE 1FVXA 2P75A 4IG4A 3V00A 3K70B 1E3WA 3ILHA 4EPRA 4U9UA 2XIQA 3RROA 2VXYA 1KAMA 4EP1A 2V6IA 4PQRA 2OY0A 1JSZA 2ICAA 2IVFA 3O4RA 1A69A 1GR0A 3O5AA 4XJXA 3SQNA 4G0PA 3RTDA 3TFWA 3W6UA 5JROA 3BWEA 2EFJA 4H1VA 5E1BA 4D45A 2GHIA 4AZ3A 1DEHA 2QVGA 1JV2B 5ER6A 2MSEB 5AQEA 3ZBTA 1L9KA 4D9EA 1QG6A 1E59A 3KTDA 1UJ2A 2QE7D 7GPBA 1JQDA 3VXKA 1E0AA 3MGBA 4W63A 3ROQA 3E22B 1HTTA 1CYDA 4CMIA 4OFWA 1IHUA 2XYGA 4YPFA 2Y71A 5ED4A 4MLDA 4TUYB 1RNLA 5AI5A 1XVTA 4R1SA 4TYQA 1UEJA 5LA6F 2YH2A 2BGUA 1QDEA 4FFDA 1K5PA 1GPYA 1WDWB 1G2PA 4REQB 4A8JB 5KX5B 3UT6A 4OXNA 1AZSC 4FZJA 1N6NA 4ASUA 4CDRA 3K70D 2HLNA 3KKEA 4BO2A 2A14A 2Z9BA 3C3JA 1RZ3A 5GJVC 1TKCA 3GA5A 1K1EA 3PBKA 2NPFA 1FDSA 3TIVA 5K0CA 1KC3A 5G3ZA 3V3TA 1N34B 1SU8A 4HBGA 1KU0A 4KW7A 1DO8A 1YB1A 3MRXA 1GRNA 3DBLA 5KVQA 3JD0A 5CDSA 5GZ1A 4FFPA 1B41A 2PZMA 4Y6QA 5KNCH 3LPLA 4GSLA 4BNYA 3DKIA 5C5EA 4CBVA 2NQ8A 2R68A 3BE4A 4RVOA 5U4XA 1KP2A 4LHEA 5HF6A 3OKFA 3KC2A 2V8BA 2PPLA 2Q1WA 2ZTVA 4NCHA 4B6GA 4PG5A 5FTWA 2V97A 2Y27A 1AD2A 5IASA 1V37A 1DPFA 2QW8A 4OHXA 4KWIA 3R1IA 5DMXA 1FLDA 1KU6A 4FU0A 4DYVA 2AFIA 3CVXA 1NWCA 2A4KA 2R8BA 1R0CA 4F06A 2QMEA 3FOFC 3BMCB 3BD6A 4P7FA 1T6XA 4X24A 4AJ4A 1JU9A 4UVIA 4DIEA 5DTIA 2WWTA 5AJWA 3ZD9A 4MKFA 1FRVA 2Z04A 5L6LB 1BDBA 3PRHA 3IMKA 4U02A 1T35A 3OX4A 1NI5A 1XIVA 4Y9TA 1R8YA 1RYDA 3FVTA 2XWQA 5I9BA 2QK4A 4Z54A 4RTQA 1TM4E 2B7BA 2RG1A 5ALVA 2QG4A 2YXDA 3OKPA 4LJ9A 1VL5A 1CQIA 1HYGA 3DB2A 3NUQA 4CKBB 1N6KA 1IM5A 3CZMA 4IUCS 2O2GA 3FCSB 4FJ2A 1DLIA 1UDBA 3OZUA 2J31A 3VGPA 2H6EA 4AS3A 4DT1A 3TX6A 1XE3A 1C80A 5AI6A 1E32A 4G8CA 4ATNA 4F72A 3N75A 5JAZA 2Q1SA 1NW3A 1ZVKA 3EW7A 4M49A 1BYIA 2FW7A 1YZ3A 4IQ4A 4J16A 1IVYA 1T3LA 1BAPA 3FZYA 3ZGXA 3WGQA 4BOYA 1E79A 1T5TA 2B8TA 1LBSA 3Q98A 3EEBA 3LD9A 4PX5A 1P5RA 4GOOD 1ADGA 1EHCA 3RJ9A 2PSSA 1CS4C 1ZK4A 4MR9A 4WRRA 2V54A 4WCFA 5FTKA 5BWBA 2FPKA 1UJMA 2MWMA 2GRUA 4Y2PA 1XNRB 1E2JA 4MIKA 4YONB 4XLLA 5FFNA 2AD1A 1WOYA 2P40A 4MWSA 4BKMA 4KXLA 5KYXB 4M0PA 1A9YA 2Q4RA 4ZMSA 1UWVA 1VE5A 1EGMB 2JHCA 2JVJA 5IF3A 3SQXA 3II6X 3U6KA 1UXHA 4MOWA 1YR6A 1DC5A 2G8NA 2ZETA 3D7LA 1YF3A 3DKRA 1GM5A 2GBLC 3V8NA 3PWSA 4OHRA 1YIAA 3GJ0A 1X3SA 3L84A 1Y4ZA 4UVDA 3R9KA 4EFLA 2ZVJA 2ZIXB 4RVCA 4D4KA 1DVRA 1VRVA 2BFPA 1CQPA 3KEGA 3P7MA 3DO6A 4W6QA 2B1IA 3H2IA 1U0NA 3T61A 3I4LA 4MUXA 2XE4A 4R7ZA 4Q1FA 1R9GA 2PFSA 1ECCA 1O8BA 1CU1A 2QJFA 3GRZA 3ILXA 3JYHA 4OMDA 4J43A 3LT2A 4DIUA 2BE9A 5ALJA 1SHJA 2C4VA 2J59A 2OGSA 2HA7A 1PV2A 4JYCA 2OQIA 5L7TA 5BT8A 1PNQA 2DOKA 4ZU3A 5JNRA 3BDIA 2JFPA 4JXKA 3JYQA 4L4ZA 4ZHQF 2H52A 1WIWA 2ZYWX 2UV8A 1CF4A 3B6ZA 4HGNA 2A3NA 2CUNA 4UFPA 2PM8A 5DKFA 1YB6A 2XUJA 2Z2YA 4F5WA 2NN3C 1ML4A 2CZQA 3ABOB 4N7RA 3IQGX 4R3WA 3SC2B 3CF4A 4LDZA 3EWIA 4OK5A 1AUXA 4JZYA 4RPIA 4MLZA 4UASA 3TNJA 4CGYA 1QKJA 1Y7IA 3DMYA 5AUPB 3TIXB 1NVVQ 5BV7A 4IEFB 5CMLA 3R0XA 3RG2A 3HV0A 2WPNA 2FWJA 1QHHB 2WF7A 4JOBA 2KBFA 3FZNA 3U62A 1U0RA 4A2PA 4HDMB 2Q5HA 3TVTA 1F20A 4H6WA 2V7TA 3LVQE 5T4BA 3RVMA 3QXXA 1UK6A 4HZGA 4KRFA 3UKOA 5J2UF 1TZCA 4DUPA 1SUEA 1AOXA 4MAMA 3BMOB 4RF4A 1TM3E 3LKDA 5D3MA 3E7XA 4L73A 4GH5A 2HGSA 3AM5A 1YAJA 1OZFA 1BKYA 1U1FA 1V6CA 4YCSA 3PUIA 1IY2A 1FFDA 1RWPA 2CDRA 1X86B 2VJCA 3HGQA 4FVTA 4D44A 3JASB 4MR7B 2ZT6A 1W36C 5BVGA 2W70A 1MORA 3HRIA 3KOUA 2GLXA 1DIOB 1LTHR 1RRVA 2FP4B 4GX5A 3STHA 2QTBA 1V45E 1AY0A 1GFZA 1EVLA 3AVWA 1Z6YA 2OP0A 3D4OA 3N8KA 1RBMA 1P62B 2AHOA 4HB2A 4LCJA 4M8SA 3VO2A 4BO0A 3FHCB 4BJ3A 3ELBA 4GXTA 4LN1A 1Y3CE 4RO0A 4MW6A 2G4CA 2PSEA 5IH7A 2REQA 3IHLA 4H3SA 3IBCA 3PQDA 4HDQB 1WXGA 1K75A 2EFYA 4TSFD 4QTXA 3TNLA 3I9V1 5I47A 4N5MA 4RESA 1GN9A 1KJZA 4KEAA 4BNDB 1R5JA 5DBFA 3GJQA 4K9DA 3MGCA 4MDFA 3I5XA 1W52X 1GUBA 4CI0B 2C54A 1IXYA 1L7NA 3W5DA 1IZZA 1Y6ZA 2NV6A 1A98A 2GEVA 2Y1FA 1PZHA 1TQ8A 2R6CA 1FNCA 4FT4A 3UK0A 4FWTA 3PE6A 3EZXA 2GRAA 1A3CA 3AEUA 1IBMB 1VP9A 5BWCA 1VJTA 4TZKA 3KV1A 3JYPA 4IXMA 621PA 1CDZA 2G9RA 1R00A 3N53A 4P4NA 3SI7A 4B2YA 5J1TB 1XU7A 1D6SA 1C8LA 3FJ1A 4OJKA 2GESA 3H8JA 3K9QO 4OG2A 4ZVSA 3HWRA 3L8GA 4EO9A 4N41A 2O8DB 1V7ZA 5P8WA 1V9SA 1U1GA 2P6UA 5BMVF 2DEUA 5E6RB 5TMBA 4NY1A 4AUNA 1WU8A 2RDMA 3KM0A 6PFKA 1X7YB 2YV3A 4BEJA 1M2WA 1DCMA 2HF7A 2F90A 3HCOA 1IY0A 3GJYA 3HB1A 2KSQA 3HR4A 4R7GA 1F7UA 4JDUA 1KYIA 4MI6A 3FVVA 2C77A 4JVOA 3L6EA 4GI2A 1TKBA 1W35A 1E1RD 2I33A 3HB5X 9MHTA 3SG0A 4F4CA 4D9JA 4DJDC 1Y8CA 3LRTA 1YK1A 2IZ7A 4J7UA 4MB0A 1EESA 5ER9A 1AKYA 1UQUA 1LPAB 3K4PA 3AEYA 2ID4A 1KOLA 3EDQA 9ABPA 1GGKA 3IAAA 3H5AA 1YMUA 4LNAA 5KOHB 4E5VA 4XYLA 2QEQA 2VPWA 1WNFA 3VJMA 1PWEA 4AN0A 3L8ZA 2H65A 4KPYA 5MN6A 4RGQA 3NTUA 4MULA 3P96A 1E3TA 3AUSA 4OJYA 2JLCA 3KUCA 4QFDA 4ZZ0A 1GSAA 1DX4A 1W47A 3OZXA 4JVLA 3KFXA 3HCCA 1JLLB 3QFRA 4JLPA 3RVOA 4FLFA 1D6JA 4UPDA 2MCFA 4HX2A 4FMPA 1NLZA 1J1UA 4WXPA 4HXFB 5C1IA 1MA0A 3RTEA 1R2QA 2BL4A 1XPJA 1UBJS 3QY9A 5D3ZA 2A5FA 1UAGA 4JC5A 2BOVA 1YR3A 3UWPA 3ZJYA 1QUFA 1X19A 3FUTA 3K94A 5SV2A 5JD5A 1KO1A 3LQYA 4OGGA 2MYTA 1C7FA 1ETUA 4J0DA 1HZJA 4WA8A 4XIGS 5EMMA 5FOSA 2JHAA 2O8EA 1Y6QA 2QL5A 3OU2A 4FXOA 1ZWLA 4O4JA 1E3SA 2A1UB 2EL7A 1FX0B 2RB4A 3LBAA 1WB6A 4NFHA 2NV0A 3TAXA 4DCVA 2DB3A 4LJYA 2XT9A 4TMKA 1H6BA 3F7MA 3I4FA 3H2KA 4XD2A 3BH6A 3DH0A 1ZGAA 2V3VA 2BFBA 2V6JA 5ECWA 5AVVA 4HI0E 5KYKA 1ZBDA 3WRYA 3NETA 3UQZA 3GYBA 4WOCA 3M9XA 2C5SA 5D6NA 2DZDA 2XBUA 1L7AA 4G86A 5AI0A 3SX4A 1P19A 3FZQA 5CB0A 3UMVA 4HRAA 3IP1A 3D3EA 4IDEA 2NTYC 3GZNB 4QOEA 3KQPA 2Z95A 5G1NA 2YV1A 4FHEA 1Z62A 5CNIA 2BUBA 1OPXA 1ZIXA 3FF1A 1J8FA 2WY2D 2W2LD 3WLHA 2NT3A 4ZCLA 2IHYA 2GCNA 4C4PA 4JSRA 4RF2A 3O1HB 1N9KA 1XMJA 1YZQA 3SHWA 3BQNB 4I4TF 3Q5GA 4FNMA 4O2BB 1KYTA 4CG1A 1TMKA 2PZ8A 2YHIA 3W9BA 4EPTA 3QVMA 4MUEA 5B3AA 1A7AA 5GJBA 2ZROA 2YQ4A 4AO8A 5COAA 4MW0A 4W4TA 1QQAA 3C3AA 4GLBA 4K1LA 1N2IA 1ZJ6A 2XADA 3VPGA 2E21A 3B6IA 2JKZA 4MVJA 1YNOA 4YRDA 5BO5A 4JVMA 1E8NA 4B2PA 5M2QA 3Q8KA 3NV9A 4NYJR 4XW2A 3W8FA 4CLXA 1ZKDA 5LBUA 1EWRA 1UMBA 1GGNA 4EYSA 3K9LA 1XALA 4C04A 3JWIA 1IWBB 1UCFA 3IMCA 4QTZA 1XRLA 3VBEA 3K9BA 4TMTA 1FW8A 3EULA 3DLPX 1XK6A 4JQCA 3VHRA 3IP9A 1KR2A 1GITA 2PT7A 3UXEA 4BNZA 2DUWA 1L4HA 1CETA 3MT8A 5HJ7A 2FMTA 3L8MA 3BCRA 3JQAA 5ESXA 3UO8B 1U65A 4F60A 5K0ZA 1DRVA 3TRKA 5IK2A 4DMGA 5AKIA 1DZ3A 1HQKA 1RI3A 1RAGA 3AJAA 3D64A 3HZHA 3OIGA 4H3VA 2AYYA 3GVHA 4FFVA 4J49A 4OPMA 5G0VA 5HK8A 3SLGA 3R9XA 3CR8A 2WM9B 3Q41A 1Q6ZA 4HAYA 3VZPA 5CAEA 2C7OA 4A7PA 4IV0A 3GROA 1SH7A 5HS6A 1I4DD 2WTBA 4ER5A 1WSDA 4CMJA 1QE5A 2YUTA 2LPMA 4QBFA 1FS6A 1J0DA 1U6JA 1GQSA 2D4AA 3C1TA 3KSUA 5B3JA 2QBYA 4HUQB 4ZKEA 3DTTA 3QNMA 4BVGA 3DYVA 3HXLA 2OMKA 2APJA 3GLFA 2ZRLA 2HOQA 2XOKA 1HNZB 5KTPA 1WG8A 3OCJA 4QBKA 1T1SA 1K7CA 2FWAA 2IIBA 2DVMA 3OA2A 2DT5A 2FFQA 4X9XA 5F1OA 4YROA 3TCXB 5BOSA 1CP3A 1EVEA 4XD7A 4EI7A 2VDVE 3DEIA 1PJLA 4I66A 4DFDA 2UYGA 3OFSA 4KQWA 3JQBA 5K05A 2R8XA 3QLUA 2P2YA 4NBKA 3WIBA 5M04A 2CXSA 1XVLA 2AI2A 2O2ZA 2YJGA 4PANA 4MKIA 4Y9UA 5DV9A 4Z0NA 3R7LA 2D0OB 3KEOA 1UXOA 3T4PA 2UYHA 1EFAA 4KRXA 3SS8A 3HK2A 2QUAA 2GZDA 1QC5B 2PTHA 4M7OA 3H11B 2QPTA 3TRDA 5LNK6 4OX9Y 4DOMA 4EKEA 1DMRA 3THWA 2QV0A 3TLZA 5FFFA 1X13A 3HN6A 3Q15C 4F9GA 1X7XB 1Z15A 5AT1A 1SCUB 2OC9A 4K9QA 4WLVA 2IQ5A 1Z56C 4A1FA 2CSXA 3JQFA 4MZXA 3ZV5A 1FNDA 3H4IA 4G24A 5LQDA 4U7HA 3JALB 4UULA 1L7RA 3T3HA 1Z7WA 5KINB 4KBFA 1G5PA 4ZO7A 2AEJA 1LFAA 1Y7HA 1TM1E 1Y8QB 1NN3A 3EASA 4IJWA 3I04M 2CLCX 3PD1A 4Q34A 2XYRA 4L75A 1NMXA 4OO3A 1L6RA 1USUA 5H70A 2VUUA 1N77A 1DEOA 2IZ6A 4R3UC 1ZOIA 4DB4A 4P9NA 3OIFA 1BX1A 4WGGA 1K8XB 3GF4A 3MTQA 3WA6A 2IZ0A 4OSEA 1YRYE 4HR7A 4UUNA 2CLFB 4LJKA 3LF2A 1S02A 3S8EA 1N0UA 1X9HA 2HA3A 3FG9A 4M46A 3IEXA 4PBRA 5IC6A 2HSDA 4DR1B 4BV8A 4P3OA 4TYNA 2QRKA 1PWYE 3EPKA 4F11A 4WA7A 2HPAA 3E03A 1V1MA 4OXQA 5HOQA 1E6KA 1E9CA 1VMEA 3AWIA 1TCUA 1BE8A 3C48A 3F2IA 4G0NA 5JMPA 5REQB 1AS3A 1U7HA 4X6UA 4MVCA 3AESA 3ZN2A 1D6MA 2DR0A 4I6GA 4Z8YA 1RLIA 1Q1GA 5KVAA 4J4HA 5IAOA 4FTWA 5K6TA 1H65A 1JNYA 1UJBA 2AVNA 1RI2A 4LMRA 1KDZA 3ESDA 1UBOS 1KZ9A 3B3FA 3GAZA 4AZWA 1C8BA 4RD3A 3AUAA 3CFYA 1CNFA 2HZ7A 3A6LA 3GZ4A 1GQRA 1TLLA 2EF0A 4YFVA 3T0GA 4J03A 3OPNA 4IDCA 1Z8HA 2EAUA 2LW7A 1H2AS 2YZNA 3OCCA 4J75A 4CT5A 1F3OA 2R6DA 3I8OA 5AO9A 1SN7A 3P9KA 1EG7A 3ABRB 3MTIA 3G5TA 3ZU4A 5BYAA 1QO0D 2PXAA 3DSRA 3QNWA 1Y48E 3UCEA 1ZITA 1J0BA 2Q4DA 3H0CA 4H15A 3BRQA 1JTEA 3CW8X 3GL9A 3V7UA 5T8KA 4ZYYA 4XUGB 1DKPA 4B75A 3IIIA 4L8FA 2OK7A 4CLEA 1ZHOA 3BFPA 1U8TA 3TLBA 5JCXA 1JVSA 3KHTA 1QBKC 2FRDC 3HXPA 3NBYC 4JZKA 2AXNA 2XCOA 5F35A 4GPBA 4NU0A 4JKOA 4J0FA 2ZIGA 2AS0A 4G1FA 4MB6A 4XAQA 1SD1A 3BFVA 4EYKA 2ADMA 4B3IA 1AMOA 1O0BA 2AOUA 5C8YA 1FTSA 4EKYA 4MDHA 2V0CA 3T7DA 1RVV1 3DD1A 1C0PA 2R5NA 2IYLD 4HXGA 4HAVA 4EG6A 1BD3A 4LYAA 3A6ZA 5G1OA 4QXQA 4YXWA 2VAXA 1QRUA 1KO7A 4AS1A 4NLLA 2EATA 4LF4B 2IYWA 2PRKA 3CT6A 1NBWB 4AU1A 1V95A 2RGXA 3KLBA 2ECPA 1ULHA 1SC1A 3BMXA 3G2PA 4DB2A 3H5NA 4I1UA 3G2QA 4LCEA 2Z2KA 1K6EA 5FP0A 5IDXA 1MUUA 1IHXA 2G5CA 4E5DA 4C3UA 1YBMA 5IN5A 4CM7A 4E2ZA 1DE0A 2ZG6A 3LK7A 5HSGA 4QVIA 2GAAA 2HJSA 3ORHA 1E5LA 1NKVA 1VYTA 2HJGA 4WI1A 2HBZA 1GKUB 1ULTA 3LDUA 2GERA 2QMOA 4X95A 5FAKA 3OZDA 4GKVA 1TC2A 3LPMA 4C0XA 1HT2E 4OUKX 4KPFC 1S0UA 4W1PA 2BGJA 1KQNA 3DWFA 2FNAA 3CXUA 3NTRA 3QH4A 1FSGA 3U2QA 1EE9A 1S1CA 4MW4A 3SYTA 4X1YA 3U4MA 2D5CA 2VRBA 2YASA 3K32A 4PG7A 4H35A 2F64A 4IXTA 3KZCA 4AYWA 4ES6A 4Y9DA 5JDIA 1XCMA 3QPWA 1CQZA 3UJ3X 4EZIA 3GG9A 1OW3B 3A8TA 4IILA 4ETMA 2PR2A 2XNDA 3G7NA 4TXNA 1L0BA 1ESEA 4M88A 2WUGA 5D7BA 3EK2A 3TQSA 4E31A 2KLHA 4S05A 2ZRBA 5IBCA 4L3WA 5J9FA 3MTDA 4MPDA 2QM7A 5FWYB 2C82A 1O94C 4DJ5X 4EMUA 4TWIA 4JP3A 2ZPUA 4ARBA 1NJGA 1YVRA 3I2KA 1C30A 3LF1A 1RQ7A 2V7VA 3OZRA 2WJWA 4WMLA 3ME5A 4RPJA 3D6JA 3OURA 2O6HA 3B2QA 1GDHA 4OUDB 1UC8A 1TI7A 1VSBA 4I1OA 5J5CA 3ZWQA 1DADA 5AVXA 2VDJA 1T8RA 2YMLA 2FPXA 2ECFA 3FOBA 2O23A 3KTAA 4TMFA 3FPBA 4KIGA 4WZBB 1NG9A 4L0CA 2PKCA 3DGFC 1SVNA 5E7IA 4RD0A 4PQEA 3KWMA 1SEPA 1Y0BA 5BQXA 2GXSA 1XMSA 1TO6A 1J8YF 4WLNA 3TRHA 4FMDF 1J8QA 1EVYA 3RVDA 4WN3A 1DJLA 3W4IA 3ZXXA 2GARA 3BE8A 1EFLA 3VMMA 1OA0A 3C3BA 4TT3D 1ICIA 2FDRA 3PRJA 4MIEA 3WGJA 1G63A 1PR9A 1V2GA 4ARAA 1GUAA 4JMPA 4BVEA 4BX3A 2ZSIA 3O8OB 1Z2OX 4DNQA 1PWHA 5J40A 3CRQA 4OYYA 4ESOA 4BN4A 5AESA 2VP9A 2ZUVA 3M6MD 4W7HA 5CT6A 2ID8A 3GVIA 4EX6A 5IVPA 4D1YA 3PV0A 1WY5A 2QLTA 1QYWA 3NO4A 4Q9KA 4Y0VA 1JVBA 4WKOA 4IH4A 4Z4FA 3U31A 4M9UA 1QGAA 1UDXA 1J99A 3JZDA 4U8GA 3LG2A 1Y5RA 1B1CA 2W37A 3G0OA 2COKA 3M49A 3GLQA 1ISMA 1AG9A 3DL7A 5FI1B 3ASVA 3L7NA 4OHYA 1LPNA 3W1WA 3R0ZA 3HJAA 2OD7A 4KN5A 1NASA 5FOXA 4LXTA 4LFCB 3WYBA 4JQOA 1AT1A 2ZI7A 5DK4A 2B4TO 5GZ6A 1JQ3A 3BTUA 3RF6A 1CVRA 3ESYA 1J0EA 1W0KA 1F0KA 3DFKA 1F4VA 2ZUFA 1J70A 4D6XA 4M9SA 4C3ZA 3TEFA 1ZMBA 1QG4A 4RHCA 5KKNB 3WA7A 1WEHA 1CUIA 2RHJA 3CX4A 2FDXA 2O3UA 1OCEA 3SSMA 5DEIA 4K40A 1T36B 3TLYA 3Q9UA 4MS3B 4URYR 3IPCA 2C97A 3EZLA 3RWOA 4X91A 3TD2A 5H80A 1NQAO 4H59A 1IZ8A 1WZ2A 3ZGOA 3DDZX 4EPXA 1ST2A 2BCJQ 5IT0A 2PSDA 1DX6A 1VJDA 2BM0A 3PDUA 3SWWA 2V9PA 4QDTA 1SZPA 1A5ZA 2V4UA 3VVCA 4ZVNA 3B9QA 1IEQA 2JCYA 2JHFA 4WUVA 4ZVTA 1G4HA 1MO2A 4BUJA 2Q3FA 2GWHA 1NONA 2NUTA 1CZRA 1ZD2P 1A9RA 1QB7A 4MV0A 5JXWA 3UAZA 5LOVF 1KJNA 4ZU6X 1W85B 3H6KA 3I5UA 3MA0A 1JF8A 3DCYA 1OBVA 2YRWA 3C6QA 3WE7A 5A5DA 1KF0A 2YVLA 4XIYA 1CUBA 4YI5A 1UC4B 3R7AA 5AKHA 3OETA 4WXYB 2VHTA 4ND3A 1QRTA 2DHRA 3Q5EA 3IP3A 4F96A 2V7PA 3ZV7A 1VHDA 5IMBA 1NBIA 4FFOA 5KYVA 3S68A 5C9ZA 4OEHA 1TVKB 5F73A 2I54A 2YHSA 5BWOA 4FHDA 2HW8A 3VU1A 5EESA 2EWWA 3ZDXB 3PUZA 4C4RA 2G88A 4QOIA 3LBNA 4J3JA 1ZSNA 4G1MB 4MV3A 5AVQA 3VSEA 1IBCA 1RCFA 3QKWA 4OSPA 2IS1A 1YASA 1Z5OA 2RKOA 2W2TA 4I46A 1N3BA 1Z63A 1L4YA 2BGMA 2OHHA 1G9SA 4CPDA 2PH7A 1G2QA 4FW8A 3EVNA 3HCRA 4K81B 1V41E 2I6GA 1VM6A 4PLCA 5DLPA 1N25A 4UM7A 1G6KA 3RYFB 1U0FA 3IPAA 3JCZA 3G5MA 2VYFA 1P5JA 3TLGA 3VR2D 3QXGA 2PJUA 5B58T 4Q3BA 5CTAA 4JIMA 5EJEA 2XSZD 5BSRA 4QU0A 5B2EA 2YBDA 3BK7A 3P0IA 3H19A 3IR6A 2ZRCA 1EB8A 3HKCA 4GFDA 4YAUA 5KPDA 1XRPA 4DM7A 4YCBA 5JPIA 1SFRA 2VF5X 4DMHA 3NT5A 4RNCA 4DRZA 2YN4A 4Q7KA 1G2OA 2AEFA 4Z0TA 1P91A 1K98A 3HFJA 2Q7OE 1O7JA 1YULA 2CL6X 2E37A 1M1NA 5FTMA 4BGDA 3CLUC 1NSFA 4JU8A 3VKWA 1FFWA 1ZN9A 1FRNA 3COSA 3A37A 3K72B 3RFTA 1SC9A 1GGHA 1OSNA 5A6VA 5DGTA 2XR1A 2Y99A 1U8UA 3L8FA 3AR4A 2MT9A 3T9CA 3FHOA 5D84A 4AY6A 2ZANA 3P94A 4O2LA 4ZAYA 5H02A 4BGVA 4LHXA 4E14A 1W5BA 3DV0A 4G1CA 4BJ6A 1ZGCA 3BH7A 2O8CA 1GNRA 1JA9A 5EA2A 1DIHA 3EE6A 2K4MA 1KO5A 5AIAA 5K6AC 4RGBA 3O1IC 1BVRA 2ZWVA 5CT8A 3UMRA 5K0GA 1B0AA 4R8LA 1VSVA 1REQA 2C5GA 3DQZA 2GBCA 1N6RA 3P5BA 5HQ3A 1DAEA 1FP7A 3OT5A 5JZMA 1OLOA 3ZDRA 1YVPA 2C5EA 4KQ6A 1OB5A 2V6GA 1E60A 3JARB 1IY9A 3ZW9A 4EWLA 1YRQA 5BURA 1ZNYA 5JUWA 1WZNA 2FQXA 3OJWA 3T52A 4Z7JA 3OT4A 2FUG6 3RRZA 4B34A 5LNK1 1MW8X 1F8UA 2WFLB 1D4OA 3VR5A 1YCGA 2C98A 2VYQA 3ASUA 3C1AA 4NX2A 1A4IA 4MWDA 5KYNA 2XA1A 2VNIA 2XQVA 3L0SA 2Z2ZA 1PL7A 4BNWA 2D1RA 2Q1UA 3L1HA 2FUCA 5FA8A 3S7ZA 1AH2A 1ZICA 1ZO8A 3CH6A 4FBMA 2HK9A 4F46A 4QECA 4OHFA 1NNI1 5LMCA 1Q11A 8ABPA 1WMDA 4U39A 4L1KA 3MWYW 3ITEA 1SBZA 1M8PA 4OKSA 4CIYA 1QQ6A 1AGPA 1VG9B 1TK3A 4KXVA 1PWXA 1KAEA 2QN8A 2XKAA 3GFSA 5K3AA 4AF6A 4D9KA 1OX5A 1A95A 6Q21A 5GP1A 3W5VA 3OT1A 3JD2A 3JQ8B 2ETVA 3LYHA 1WF6A 3RBVA 3UT0A 4DQVA 3WL3A 5B7NA 3HVKA 3B1JA 3N0WA 3U9LA 1UZUA 1J56A 3THSA 5FPQA 5EIXA 1WSWA 3U4DA 9ATCA 4B6PA 4G5QA 1UIRA 5CCEA 3QX8A 1CVIA 1CE8B 2JIPA 2YY6A 1Y1SA 2FVYA 5BY2A 1PX2A 3QK7A 5IYZF 3FUUA 3ZV6A 4QRIA 2I1WA 1JEEA 1VB3A 2O3JA 1G19A 1B16A 3QF4B 1TADA 2YNMA 3BIFA 5DLDA 4RY8A 4E03A 3RC1A 1RCUA 3OIUA 1UDRA 3IBYA 4N8SA 3Q3EA 1IY8A 1E1LA 4JWTA 1CEXA 2WWXA 1XA0A 1KY2A 4GF5A 4XDGA 5FA5A 5LQCA 4XGRA 2ZR8A 3E48A 2PBFA 3N2GB 2IKSA 1PZFA 4MPPA 4G0WA 5I7RA 4KAXA 1LDYA 1NUHA 3DOFA 4M2LA 3TRIA 2QMUA 3ENQA 4EY5A 2R8PA 5B1HA 3ZJ5A 2OHIA 1T0HB 4ALMA 5GAJA 3JRNA 5TQ2A 1NRIA 2W8BA 2YC2C 3SQWA 2EQBA 5BYKA 1A4RA 1XLTA 2OBFA 2RAUA 4NU8X 2F9LA 2XVAA 4KQHA 4B45A 3T9BA 3L7MA 2NVOA 3CUWA 1UK9A 1KGSA 1V6AA 4Q7MB 2O5EA 3DAYA 5EN4A 2NUAA 3KXIA 3LLVA 3MXTA 4CMBA 1TYEB 3IE0A 1YR2A 3RGWS 4YV2A 3C16C 2BH9A 4FUTA 1E2NA 4UTZA 1GARA 1YZUA 2HA4A 3LS2A 2LV8A 2YMPA 1W9MA 4DIOA 3IH5A 3T1NA 2XAAA 3FTNA 3VDXA 1E1MA 2ZS9A 3FFBA 4LQ4A 4B3MB 1GY8A 1QV7A 3O3OB 2CHVA 3GWZA 4XGQA 1Q50A 4XIJA 3TL6A 3CM0A 3HUEA 2O2JA 3B2EA 1W5SA 2GXQA 3KOMA 5ENZA 2EJWA 4J0CA 4HPXB 4HQNA 1RQRA 1A2BA 2BCGY 3BJEA 3GYGA 4IVQA 4Z9AA 3PKZA 5DT9A 3S0JA 2CNBA 3H13A 4HC4A 3L82B 1M2OB 1PV4A 3FI0A 1ENYA 2CL7X 1KOJA 2CL0X 2WJPA 3CE9A 1TTTA 2V1UA 5BR1A 1YC2A 2O8EB 2Y67A 4PZEA 4I5FA 3L7AA 1IBKB 2WTEA 3BA6A 5AKLA 2PL9A 4L5CA 2HIMA 1JG7A 2P2LA 3RUHA 5KTOA 3GLRA 3RRYA 1GSOA 3NHRA 2IC5A 4X7PA 1YBAA 4TKLA 2P67A 1AUOA 4YDSA 1OBOA 1TZJA 2MINA 3BZUA 5KOJB 1IQPA 4IWNA 2MSLA 2CJYA 2HUNA 3TZLA 2EL9A 5EEHA 2VQDA 3X43A 5C8ZA 3TFOA 4BMVA 1HFEL 3DNFA 3R23A 2H57A 2QE6A 5HZGA 2ODTX 1C0IA 4QQ8A 3O3MB 2CD7A 4Y1RB 5DZSA 5FOTA 1E6CA 2QHXA 4CR8A 3VHXB 3KSAC 1VE6A 3VNSA 1TQ4A 2NU6A 1PFUA 1OASA 2E89A 1OXTA 3PFHA 4IXNA 2F59A 4XVUA 2C8JA 1ONOA 1K86A 5KBYA 3UMBA 4MH0R 5B58C 2GN1A 2ADFA 3TN7A 4UBJA 5CA1A 4ZPJA 5EIBC 2PYZA 3QVWA 3F5SA 2C0CA 5AJXA 3IOCA 4A2WA 3UHJA 3ZX5A 1A8SA 4E2WA 1PJ3A 3FDIA 4ZHSA 1KKMA 3U3DA 3BGSA 2AOWA 3EH1A 4EM6A 2F8LA 4ND2A 1OHHA 1E9FA 2CXPA 2NSHA 3UG7A 4HH3C 1UMKA 5HG0A 4IINA 1OWOA 4RS4A 4NZZA 4PHGA 2IHUA 1SHZA 4IIHA 4Z86A 3SF8A 4BP3A 5ILOA 1SWVA 4H0FA 1JKFA 2XCLA 3HCFA 3DZ8A 2QTCA 1C7JA 1WHTB 2V6FA 2O6LA 1TK9A 4PSUA 2G1JA 2H9YA 2HYIC 1UEXC 3ZC3A 2PVSA 2FPMA 5KJFA 2VWGA 2ZI3A 1WABA 4RS3A 1KJ8A 5CGQB 1Z7EA 3U40A 2JJMA 2RI0A 4BFXA 2QTGA 4P82A 4Q0MA 2ANCA 1LBQA 3DP7A 3WGVA 2IPLA 2V4MA 3AEKA 1F8FA 4JHXA 5ITVA 4QJBA 1USVA 3AG6A 5G0SA 1RXVA 4G8BA 3QVKA 5BN5A 2TRSB 2Q7XA 3GRFA 3MCTA 4UHEA 3KDPA 1U8YA 2IP1A 4BUZA 5JVDA 1U63A 1ZMRA 4JASB 3T7TA 3OIYA 4PZPA 1HZZC 4N5NA 1Z0AA 4YCLA 2YRFA 1ECPA 2C4HA 2JH8A 3A3NA 4MUAA 3OZTA 4O29A 2R1ZA 1GZDA 4HB3A 4L0QA 2D0PB 4RK6A 5DHPA 3TG2A 1LDBA 3ZVLA 2RIPA 4XVQA 2JFUA 1OI4A 3HADA 3KVYA 3QEMA 4YAEA 3OM9A 3QW4B 3EIQA 1RHQA 5F5NA 3RVKA 3VR3D 5H4HA 3W7VA 4TYPA 3SQLA 1FYXA 2QTWB 4BX8A 2R65A 4DCGA 1CT9A 3GBSA 5ESRA 1F1BA 1RFLA 3KALA 5LB2A 1IQ0A 3KD2A 2OYSA 2GM3A 2OGUA 3PJGA 4QUHA 1KVQA 3WKAA 5DWDA 2VTEA 1C3OA 3B1YA 1PG0A 2CEKA 2H5LA 2J67A 4Q00A 4RVDA 5ALOA 4WNAA 5FLYA 3RTAA 3RS7A 3PEWA 3FOZA 1MAAA 1TQDA 4Q4JB 4BZPA 2GUGA 1DQRA 3T99A 1E3QA 2I8CA 1R18A 2RHWA 3F47A 3OE4A 1ICEA 1N6IA 2ODPA 3PFFA 4ROSA 4UU0A 4CL0A 3NIDB 4BWFB 3NATA 3TTXA 2B8WA 4KAAA 2VAWA 4F3RA 5KJ6A 2C2WA 3UT5B 2GBIA 2IP4A 2WUWE 3A0RB 3KVOA 4C2BA 1MRSA 3EIWA 2RFLA 1U3WA 3MHPA 4H7FA 5HDQA 3COYA 1NMYA 1HE4A 1I9CA 1W46A 2G63A 4CKCA 4JVNA 5GM2A 2TYSB 3E3MA 5FRDA 1A8IA 1M1XB 1FSZA 3HVUA 4BATA 2D0DA 3CIFA 1Z16A 2FPUA 2BBWA 2ZT7A 3PXUA 1KH2A 1CRLA 1U9IA 2C3MA 1VCNA 4MRNA 3VNAA 4BCBA 1ZOLA 4QNRA 2CB0A 3V8EA 2R96A 1C50A 4M3NA 2J85A 1FXUA 3JZMA 3Q0TA 3OTWA 3MF4A 1A27A 3W5JA 3HTXA 4M1ZA 5CDTA 1XZ8A 1JJ7A 2WSYB 1QVWA 2I99A 1VG8A 2PQMA 3KQLA 2FSIA 3GLTA 3OPVA 5FR2A 3PLNA 4KQJA 1E6UA 2ATXA 2GEDA 3HPQA 5DH9A 3OQVA 5FBHA 1ONBA 5A5VA 3IXMA 5BWNA 2JG3A 2P9FA 3HQ4O 3V8BA 3VH4A 1UZLA 4AZTA 3I76A 3LO8A 4OHVA 3DLBA 4MHOA 4NBLA 4AX8A 5KMGB 2ZJ1A 4HH1A 5LDDC 4F4IA 2QQFA 4MQFB 3PDCA 3GMIA 3IA2A 5ENDA 4DPMA 2YFKA 3HJCA 4WFJA 5CW2A 4PXYA 3V7WA 4CIDA 1ILEA 5KYYB 2WT8A 5EI5A 2ONKA 1G9TA 3BGOS 4KXMA 2GBGA 3BL5A 3FY4A 3NEPX 4GOJA 1NN5A 2ZFUA 1U8ZA 2VCEA 2XB6A 3P0RA 4XRRA 5C18A 3LYAA 1P33A 2VUHB 4WL0A 1CR1A 2OV2A 4D9BA 4EUEA 2PUAA 4Q24A 2JZCA 4TV9A 4RY0A 2CC2A 1JHAA 1OLSA 3F6SA 4J7AA 1V8OA 4MS4A 3ESQA 3DVAA 2H1SA 1ZCFA 5EWJB 1WETA 1UM9B 2ZJ0A 1TZ2A 2HLPA 4MUGA 3I62A 1XZLA 2BDEA 2HHAA 4IV5A 2JZNA 4Q3EA 1J07A 1PO7A 3IHTA 1X74A 1RQXA 2OCKA 2WUFA 2H8GA 3CR7A 4FI3C 2WKRA 1VKZA 3LOPA 2G5TA 3ZDQA 2Y6VA 4TVSA 4UE2A 1FJHA 1O5OA 2X6QA 3KU1A 5E9QA 4NOJA 3DUFB 4ZOEA 1M5RA 3R0QA 4RVUA 3VNVA 3UMJA 4YP0A 2FA9A 4QBHA 2H5JA 4PRYA 2HV9A 2JH3A 1QANA 4PX9A 2JJ2D 4OYHA 4UAUA 5BUZA 4FP9A 4RL4A 4X8HA 2JIOA 1NL3A 2Z5FA 3JRXA 2VF4X 2ISCA 3NOXA 3EY9A 5KNCA 3MUFA 3GMSA 1GSHA 5CHYA 4KC0A 3FMFA 3EOBI 3IGFA 1KI4A 2XECA 3GY0A 2I78A 1T9GS 2IP2A 2YFHA 3BIWA 2EX1A 3G1TA 1L4LA 1SBQA 1EX6A 4MDYA 4EGAA 3PVCA 4ZPXA 5KIAA 5ECYA 3W79A 4X66B 3ZCTA 5I4IA 5C8VA 4O4IA 2H2FA 3SIXA 3M8KA 4RF5A 1Z0DA 2MSDB 3V4SA 1EFVB 3NWPA 3LHSA 4QDXA 4RKQA 2PRJA 3WFJA 3BSSA 1SUPA 2BZ0A 3MEQA 3GFVA 5FUQA 2I55A 2GN6A 2WE7A 4G4GA 4QUGA 4ZDJA 2VC2B 4OVKA 3N7TA 2ONYA 4ACBA 2BMWA 4TMVA 4OI0A 2YL2A 1EMDA 1H3FA 2V7UA 3HSSA 1JH8A 3OSUA 4NQZA 4BO4A 1PJ8A 4EY4A 4M38A 1QZUA 1J2UA 2HSEA 1GQ2A 1GZHB 1YCHA 4ZEMA 4EAQA 4XB2A 1FP6A 2DSNA 3ECAA 2Q0HA 3KQOA 1SRQA 2GMWA 4L8VA 2JJ8A 2P62A 4WJKB 5TJ9A 3ZEIA 1P6QA 1UP6A 3MHTA 1SNYA 1QRDA 4X7MA 1I7PA 1KEEA 5SYNA 2FEAA 4YK7A 5AKKA 5HK9A 2RGYA 4RELA 4H16A 4KHZA 4M99A 4EUKA 1FP4A 4UBOA 1GRRA 4MKGA 4G5RA 1WA5A 4L3VA 4MS1B 4QSHA 1RS0A 4N65A 3RS8A 1ZR2A 4OCZA 1QRSA 1FUYB 2IT1A 3CISA 3PI6A 4KRGA 1HT1E 2I2BA 3NGMA 4MA4A 2P68A 4TTTS 3WHLA 4TKVA 5A2GA 4F5EA 2EFDB 1I4WA 5IULC 3S4YA 2OAEA 3C5WP 4W5QA 3WO0A 2E9SA 2CDCA 3I37X 2VK2A 3GIWA 2ZIEA 3GK3A 5IBPA 3RIMA 3A3PA 5BORA 3RODA 2M9MA 1PR2A 1V26A 2LP4Y 2WJVA 3KQWA 4NBWA 2ZDQA 5LP6C 5LUAA 1FEZA 3O26A 2Q28A 1M2KA 3OEHD 3Q7EA 4J3FA 1KFJB 3ZNNA 4P6VF 4U5QA 3G8BA 3F4LA 2H00A 4LMAA 4EKNB 2VPIA 5KYGA 4O2AF 3IEIA 5G4LA 5BWMA 3U49A 4HATA 2D00A 3D4BA 3QI7A 1ZUNA 1D2GA 4FIDA 3E7WA 1SQ0A 2B82A 1V4BA 3RUFA 4DJTA 2CVQA 2FCRA 2IOYA 2XI4A 3RVLA 4UTRA 1R0RE 1DAFA 4IZ6A 3A05A 2F17A 3GCZA 2VWPA 5EXEA 4ILEA 4B5KA 4UEOA 4P4SA 4B87A 1I5EA 4Q6BA 3FYUC 3A14A 1DI0A 3UH0A 1KPIA 4YBRA 1O9HA 3RRBA 4EHFA 1E1NA 2AQIA 3WMEA 1G18A 1E18A 2XHEA 3FMGA 3HXTA 1ZM2A 1EFHA 1ATZA 4QXOA 3MW8A 2ERXA 2ZWAA 2J7PD 1UBNA 2PU5A 3Q88A 4ZK2A 1J5PA 2XRFA 4JBYA 4CM3A 2ZPTX 1DBQA 1NMZA 3SKXA 1BKSB 3UK6A 3AFOA 3SM9A 5J4KA 1G60A 5CDUA 5L3SB 4XQCA 2VNAA 3SNHA 3UYKA 2Y1XA 2Y8EA 3UZUA 1VRWA 2JI7A 3MFQA 4EHDA 1RZVA 2HK6A 3CJTA 1CIPA 4JLBA 1Y98A 4Q9HA 2QXTA 3B5IA 3I42A 1CJUC 4XM2A 4ZVMA 1QORA 3OPYA 4IJQA 3U7QA 3UV3A 4IBOA 1W36B 1JWBB 4BLSA 2V65A 4NRDA 4QYMA 4RHTA 4ZCTA 5BSKA 3NIBA 2QE7A 2QVLA 4ZVVA 3EDCA 2X8JA 2PWAA 4ECAA 4PN3A 5CDFE 1YIOA 4CG2A 3AONB 1GA4A 3RKRA 2LXNA 3SOZA 5B1EA 3P19A 4EG0A 3DBHB 5BN3A 5DP1A 2YIVX 3PX3A 4KMRA 4NARA 5FWDA 5TT0A 3U3MA 1GIAA 4ESEA 4AX4A 3WIVA 3T5AA 3DEZA 3TGLA 5J43A 1HLGA 1P0QA 1SBHA 1T6YA 1UMCA 2WD7B 2WWRA 4PR3A 4CL3A 1BH6A 1JFFB 4ND1A 4DSAA 3MCWA 4AN4A 2IU0A 2ZQZA 3DNPA 1DFGA 1PR5A 2FX5A 4HNGA 5B7QA 2F55A 3UYLA 4QOSA 3TBFA 1Z68A 3S2IA 5B4UA 2ZIAA 2C7BA 1GTVA 5AW4A 4N03A 2ZOSA 4YMLA 2XB2A 3TM5A 2PLFA 4ABTA 2IHNA 2YWFA 1UXKA 4HMPA 4AJKA 5JOQA 3CSUA 3KT6A 1FZQA 4JBGA 2XGGA 5F33A 3ZBUA 1QFSA 3L7OA 1EHYA 3JRWA 1W36D 4L0MA 4L6CA 4PG8A 4YLYA 3B48A 2GJ4A 2C03A 2H2DA 1C0KA 1Y9EA 1ECFA 2H92A 4KLZA 8ATCA 1DC7A 3E22A 1PQPA 1T8TA 3BMNB 3N3AC 3ZHUA 1RABA 1XGKA 1Z6TA 4X97A 3WGTA 4OKIA 3NB0A 4TUYA 1ST3A 2LNDA 3MTJA 5A05A 3S55A 2QYSA 5J4VA 2PKYX 3P8ZA 1TLTA 3UGQA 1Q14A 5L4NA 3EMVA 5I7FA 2ZM5A 1Y63A 2C92A 3NPAA 1UBKS 2D1SA 4REQA 4A8JA 1G8SA 2XF2A 1CQJB 2VP4A 4E5KA 4TKUB 7ADHA 5KX5A 1XL0A 4E46A 4FB4A 3QPBA 2IX3A 1ZX1A 4H27A 5EIOA 3V42A 4FM9A 4FE4A 1GYQA 4BV3A 1C4WA 4NG5A 1SXQA 4NXMB 2VG8A 3FB4A 3ONFA 5E8RA 4IGAA 3R7SA 2C00A 5C53B 3WLAA 4YA6A 5AH0A 4KR7A 5GY7A 3ZLVA 2GJ9A 1NF9A 1GPUA 2J3DA 3FUCA 4YHHB 2PZFA 3D8TA 3GFTA 2XMPA 3PUKA 1O54A 3S5UA 2BELA 1QQTA 4HQLA 2V7QD 3IB3A 4MA0A 4KI0A 1PGQA 2DPXA 1LDEA 3UHFA 3GI1A 1K63A 1UOPA 3KE9A 1W1UA 4Y7DA 3ZCSA 4BB0A 4FYKA 2OCYC 3BTSA 4RXUA 4UNQA 3VPXA 4YRNA 1DG1G 4N01A 4O0LA 2AN5A 1JPJA 2BR3A 3NYRA 1GP2A 4MO2A 3BMCA 1NUUA 3KZ1E 3EQ7A 4JLUA 1N2XA 3G2HA 3QI2A 3EFOB 3TSWA 3KKKA 4LK3A 5KQSA 1SUWA 4AURA 4GM0A 1CR2A 4B81A 3CHYA 3EFHA 3NHUA 2VO1A 4Y2QA 1PVDA 4D9NA 1SJ9A 3DOUA 4FHCA 4N5LA 3VJLA 4B6EA 2X13A 3LX8A 3RUAA 4RPGA 3K1JA 1ESCA 1PBTA 1UBHS 3C3MA 2ZPAA 3OQHA 3IKVA 1L5HB 5I48A 1Y3BE 4EVIA 3INNA 4KWHA 1YQTA 2G0NA 4CKBA 2LIVA 2J9RA 1X2BA 1VE9A 2RHHA 1ND5A 2IHBA 2VHQA 4MWOA 1UK8A 4C7BA 1R27A 5I51A 3OZAA 1RP1A 3AT1A 3ZEAA 1DKRA 5IFKA 3FF4A 3WJ7A 4HPJB 4JI4B 4KNWA 2B5OA 1G6HA 3DZFA 1DXQA 5CD9A 1FMLA 2JAXA 2IYTA 3ET4A 2UUOA 3A4TA 1YS6A 3AEQB 3DZDA 3OC6A 4OJNA 5K0LA 4PC7A 4RFVA 3TB6A 1CG6A 1RAFA 3NONA 2XTMA 3AVUA 3VI4B 2X42A 1GA6A 5F9FA 1ENOA 2OV4A 4QX6A 1HQCA 3GNLA 3R09A 1NXVA 2EGGA 1GZUA 5U4QA 2O4CA 2H1LA 3W3ZB 5KYXA 4A0FA 4EJ2A 3E5MA 4J3NA 3OJFA 4BQFA 3PEEA 4AG6A 2Z2IA 2H1RA 3MC1A 4JB0A 4FOLA 4H9GA 3AF1A 3SS9X 4YAWA 5D6OA 4ZRNA 4ALIA 4JUDX 1YGPA 4IEEA 1GPAA 2PN1A 4R68A 1M9NA 4R3NA 3I1FA 5JZSA 1X3LA 2OGZA 4QPDA 4B6SA 2ZE8A 3G02A 5ALQA 2OBXA 3R4VA 2G09A 2HF2A 5CVDA 2MMCA 2RGWA 2ZIXA 3N59A 1PGJA 1Z88A 3R4CA 5D5PA 4U3JA 5INTA 4CQLB 4LJ7A 5AKZA 1VCOA 4ALLA 1J7JA 5DU2A 2JCSA 5KHLB 3C5VA 1YFLA 1HX7A 2ILVA 1XLVA 4PGFA 2CBXA 2GT1A 1IIBA 3QTTA 2DR3A 4HYYA 4DCOA 3LQFA 4RPKA 4EMTA 3DAFA 3IAUA 4C1BA 4HNTA 3FIJA 5HF9A 4RABA 1PW7A 3VYWA 5IC5A 1GKKA 2D1TA 3BWMA 1YVEI 4EA6A 5M5BA 3DF9A 1JTVA 1O6ZA 2A94A 2IZ5A 2P65A 3IUYA 5C2JB 3SC2A 2WZDA 5DJ5A 2QT0A 4GX1A 3TS1A 2DQSA 4C6SA 2O0JA 5JJIA 2DUMA 2RBGA 2NTEA 2XNSA 4MMYB 5K99A 3WOHA 2XRZA 2OCBA 4KH0A 1L7VC 5CBKA 1K9VF 1MGOA 1Y34E 4TSFA 1QHHA 5HEKA 3QWAA 3ZHXA 1AQIA 1IEXA 4HDMA 1AKRA 2IEYA 2Q27A 1IOWA 2ZJ3A 3WWYA 4NMLA 3QMPA 2AG1A 3C6XA 1I2ZA 2QX7A 3M3HA 4DKJA 2H1OA 3P2OA 5JD4A 4UVEA 1M6EX 1PK9A 2I7TA 3BMOA 4WY2A 1GXSB 3AKYA 1QOQB 3ER6A 2F3RA 4LMPA 3S81A 1PT9A 4QKQA 5BV1A 3Q6IA 3EUWA 5UKDA 2YV4A 4C4OA 4M1WA 1DWOA 2BWJA 2FJPA 3BULA 3JASA 1WJGA 4MR7A 3HNPA 5KB3A 1SVWA 5CCBA 2FP4A 2NQTA 3DXYA 2R5WA 2WTAA 3I04A 4GZ6A 4BNXA 4K9PA 2IHTA 2ZI9A 4KGZA 5CXQA 1XZQA 1QIFA 1NZJA 2CJWB 4FR0A 4Q7JB 1M3SA 1IJBA 4E6EA 4PGMA 5H9WA 3VRHA 5AHWA 5JXGA 2NOAA 3I2HA 1M5UA 3A9CA 3HBJA 5TX7A 2YWRA 1NX6A 1FDIA 1U28A 4A9AA 2CDBA 1A7UA 4J2TA 1WTAA 2YC4C 1MRNA 5K3DA 4BNDA 2NYUA 4DQKA 4UTOA 1Z37A 4N3BA 3KJHA 1RMTA 4GZ3A 5DOVA 4PYMA 4CLRB 3AFIA 2EP8A 5LYJB 2DC1A 4JP5A 1UC9A 1E1RA 1R0BA 4WZBE 3ETHA 3T5GA 2V45A 3NJ8A 3A6PC 2X8LA 5DM4A 2PJZA 2HRQA 3RQSA 3VGJA 4J6EA 1UANA 5ICMA 1U2EA 1IHPA 2OPBA 3BHNA 5EP1A 1X77A 2C5FA 5JBIA 2A30A 3JYNA 3WMGA 3U7HB 1JGTA 3ETEA 4LNUB 4NBVA 4BO3A 2WJYA 4GE0A 4CT0A 4H7DA 3BT7A 1MN6A 1A77A 4U7GA 3QKUA 1L7QA 1C7RA 1JR2A 1ZA1A 2OM6A 2PLAA 2QROA 4K6FA 3VZBA 2O8DA 4IF6A 4EHHA 1UWLA 1JFSA 3QVJA 2Y66A 2EP7A 4ITVA 1C3EA 2RKWA 4QDOA 1K4MA 2X4DA 4DV5B 5TC4A 1ZVVA 3N2NA 2WFZA 5E6RA 5H59A 4QYSA 1E2UA 3THXB 1EDZA 5EZ5A 1X7YA 1EKXA 4YRPA 2B21A 1KIMA 5FV7A 3ZHSA 4CV1A 4FZ5A 5FI3A 4CHTA 4E7PA 3SVLA 2VLBA 1XEAA 3ID6C 1OFGA 2HWYA 2XRYA 2OOKA 2QWXA 2EOAA 1D9ZA 2LDBA 3AYXB 2VZ8A 3K0HA 3LL4A 4PYNA 3DDCA 3W6NA 1O6CA 2CT8A 2CVZA 1FNMA 4OHOA 3WLTA 1L5YA 1XO1A 5CFQA 3A2KA 4J0EA 4R2KA 2X9QA 1PN3A 3D6TB 3AVOA 4IZOA 1G66A 2B1RA 4G5HA 4JFAA 3AUXA 3W2EA 4M55A 3G82C 4BEWA 3DVLA 4TYWA 2YIJA 3CZPA 3FPHA 4JSTA 1XZJA 4MV4A 1T3ZA 2RGEA 2XTNA 3AZQA 5KOHA 1NQWA 2TMDA 1ZW6A 3JSXA 1AB6A 4IMRA 1P18A 1U3TA 1CY2A 4YJHB 3ANSA 2VHEA 3TEJA 4CMGA 4INZA 2I6XA 3T1OA 2GK7A 2JLWA 3HA7A 2C04A 3HCPA 4UARA 5BSHA 1D04A 1JLLA 3KB6A 4TTQA 2WB2A 2EZ4A 2ZYRA 4M98A 4F56A 2OHXA 3PVSA 4Z9BA 4EITA 4Z4CA 1PFGA 2VIIA 3ADCA 1PR1A 1GRCA 5B30A 4B3GA 2BTOA 5JD3A 4FBGA 3U61B 5BSTA 3SP1A 3E9QA 4J1TA 4DV3B 2DBYA 1WO8A 2QMZA 3AIOA 3QVSA 3GGSA 4MQMA 1BOFA 3FB1A 4TTVA 3VYUB 1Q21A 2BTQB 1KOGA 2JH9A 2Y0CA 2CK3D 1LPBB 1P0CA 3STVA 2W2LA 3AOEC 3BICA 4BC0A 4DA7A 3U3JA 4HN9A 2DPMA 1JDJA 4GX0A 2I76A 3E82A 5HCNA 3R5HA 3MJSA 2GRJA 2B78A 1MFPA 1TX4B 4GS5A 2A1UA 3UV7A 1FX0A 3GRRA 2PFGA 2FE1A 4RCZA 3T06B 1VMDA 4QO8A 2P2DA 3VZSA 4EG5A 3ONVA 3MB8A 1FNBA 1DUIA 1DC4A 1MVLA 3G0GA 3LE8A 3HKEB 4B74A 1Y7LA 4BO8A 2F6RA 1FUEA 1MG5A 1RPJA 1ZD4A 2C61A 2EW1A 2VP6A 3DE1X 2FX2A 3QVOA 4JJ4A 1EVIA 1BO6A 1MA3A 1YRHA 3CLVA 3DHVA 4IHKA 2Z6AA 3COJA 3OZEA 3F0TA 1TIPA 2FMKA 4J07A 3N8DA 1C14A 1R0SA 3KB2A 3P32A 3TQIA 3WYAA 4B09A 1V5FA 1YCFA 4MKXA 2JGNA 3N2ZB 4N0PA 3GRVA 5DBHX 3GZNA 2EKQA 4LKOA 3GRCA 1I3NA 3OX3A 1L5VA 3GPIA 5CDFA 5SY9A 3F2VA 3F7NA 3Q7SA 4LDRA 4U2EA 4DGSA 2B69A 4H6VA 1LVGA 3P4UA 1JVNA 1MB3A 5SICE 1JZTA 4DG9A 3EZFA 1QS0B 1DOHA 2WWIA 4O2BA 4ZT2A 2GA9A 4D92A 3ZDDA 3KCQA 2TSYB 2ZLBA 3RYIB 4F1KA 4YMVA 4OFBA 4MJ3A 2WUVA 2ASEA 1ISRA 4Y6SA 3P0HA 1E64A 4YJ3B 3CLKA 4GGPA 4JJGA 4GXNA 1IG0A 2XTJA 1A8QA 1GCAA 4PLPA 3IT3A 4H60A 4BLTA 1ZONA 3KRTA 3SLRA 1W5EA 3INTA 2F1RA 2L18A 4IM7A 4KFRA 3WIUA 3NJRA 4EJMA 1DJPA 1QHEA 2ZJZA 3PCRB 4Y2HA 2OQ2A 5B2ZA 3RSHA 3ZU5A 2R5FA 3ROMA 4PW0A 1VLJA 2C2BA 2Q41A 4ML3A 1RAEA 3TPZA 1S2OA 4N5HX 3USZA 3HKBB 2QOEA 4EEKA 2UZAA 4GP6A 3CW2A 2AJCA 4CU2A 4PZ9A 3RFFA 1I7NA 1A9XB 2EKDA 2RMKA 1KFBB 1XTKA 4JLAA 4LQCA 1IN6A 1JEJA 2WJZB 4GNKA 4RK1A 4C7OB 1V7PC 2N75A 3R6GA 3EZ7A 3LWZA 2IH5A 4NEHB 2C20A 4YQFA 1F2TB 3H3XA 1E7YA 1SGWA 3CLRC 1RLUA 3DR3A 4XLTA 4HUQA 5DASA 5FBLB 2CHEA 3TINA 4BE7B 2QX4A 3OU7A 1TD9A 5KNBD 3MSCA 2O8FA 4GI7A 1A82A 3NAMA 1T8YA 2WYUA 1GFSA 3DS8A 3CEJA 4HEA1 3QE3A 4I1SA 1VIYA 5EZYB 1NDUA 4AULA 3HP1A 4NJMB 1OFIA 2BBTA 2OOSA 1FVFA 1KETA 2QA5A 5DOZA 4MRSA 5F7XA 3IOYA 4A4DA 4RJ2A 1CY8A 1VZ3A 4IMIB 3USCS 2I3BA 4DYHA 3RAPR 1I8TA 1Y8AA 3WGIA 5L7WA 2JLVA 4CKZA 1NOKA 4BMXA 2PEZA 1XQ1A 2QD1A 3BFKA 1P7YA 2D2VA 3JD3A 4IQ0A 4JYMA 2AC7A 3MCAA 4ND5A 4W9NC 2ROQA 1L1RA 4Y2RA 4GR9A 1M6YA 5CLGA 5CLLA 5AW2A 5ESDA 2QRHA 2WYIA 3O0DA 1QC5A 2BMJA 3LJKA 1UOEA 3H11A 2B7LA 2VZ9A 3PG5A 1LK7A 3P2YA 4RIGA 2JGRA 4HG2A 1V47A 3EYAA 3PCTA 4EJSC 1QIMA 4PF1A 2JD2A 2HHCA 2H7CA 4OQYA 3E18A 1X7XA 1SCUA 3PF9A 4UU1A 4HWOA 4XTCS 4ZOQI 4CLDA 2DECA 3PC8C 4C0LA 5K9ZA 2R00C 5JS6A 13PKA 1Q1AA 2FF7A 2PKRA 3DE6X 3JALA 3KWLA 4X93A 3W5SA 5IZCC 2A5DA 3HE3A 3A6FA 2NU7B 3ENVA 5GIOE 4C2UA 2VS1A 4IGIA 3CNHA 1Y8QA 3OESA 3E2PA 1G3QA 1SQGA 1G98A 2WP0A 3RG8A 4C0SA 1DFHA 1AZTA 2CYAA 1ZJWA 4C6HA 1EINA 2X9GA 3GEBA 3AUKA 4Q4CA 4KUEA 3O4HA 4ARSA 2ZZNA 2RJOA 3AHFA 3H1FA 3UUGA 1CB7A 1QJCA 1YA8A 1JJAA 2FPIB 4S0ZA 2J9FB 3UOWA 2PXXA 1AKWA 1NC1A 1IQRA 1JIXA 3NHAA 1EUDB 4GBED 1PUJA 3HB0A 1H42A 4QHYA 3W6OA 4R0MA 1QO0A 4GOMD 2BV3A 2A5JA 2IEGA 3L4BA 4R01A 2I6FA 2OHJA 4K86A 4WERA 1E3MA 1Z5GA 1WXWA 1M0EA 4W5TA 3LBFA 1RYZA 3FYHA 1YDEA 1Z6XA 5JBQA 2A0KA 2O7SA 5IT9A 2E2WA 2H7XA 4D9HA 4DAEA 1P2UA 1OZGA 1QSGA 3EGDB 3WWOA 2WAOA 3SMVA 1O77A 3E61A 3L8DA 1DINA 4TRMA 1RYFA 1VA5A 2B8NA 1AGRA