3TB4A

Crystal structure of the isc domain of vibb
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
205
structure length
205
Chain Sequence
IPKIASYPLPVSLPTNKVDWRIDASRAVLLIHDMQEYFVHYFDSQAEPIPSLIKHIQQLKAHAKQAGIPVVYTAQPANQDPAERALLSDFWGPGLSEETAIIAPLAPESGDVQLTKWRYSAFKKSPLLDWLRETGRDQLIITGVYAHIGILSTALDAFMFDIQPFVIGDGVADFSLSDHEFSLRYISGRTGAVKSTQQACLEIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the ISC domain of VibB from Vibrio cholerae at atomic resolution: a snapshot just before the enzymatic reaction
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
molecule keywords Vibriobactin-specific isochorismatase
total genus 75
structure length 205
sequence length 205
ec nomenclature ec 3.3.2.1: Isochorismatase.
pdb deposition date 2011-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3tb4A00
3O90A 2FQ1A 2B34A 3HB7A 1X9GA 1NBAA 2WTAA 4H17A 3O91A 3V8EA 3EEFA 3IRVA 3S2SA 2H0RA 3OT4A 3O94A 3KL2A 3OQPA 3PL1A 3TG2A 3TXYA 2WT9A 3TB4A 2A67A 3LQYA 4WGFA 3MCWA 4WH0A 1J2RA 4L08A 3R77A 1ILWA 3UAOA 3R2JA 1YZVA 3HU5A 1YACA 1IM5A 1NF9A 3O92A 3O93A 1XN4A 4L07A 1NF8A
chains in the Genus database with same CATH superfamily
1JA1A 2C7BA 1NJFA 2JNWA 3KX2A 5K0CA 4EPYA 3EMBA 4K6OA 1IHUA 2VK2A 4GO1A 1Q7EA 4DABA 4PO8A 4E0BA 4RTQA 1TTHA 4KRXA 5INTA 4G5SA 4R8VA 1CJUC 5LQKA 2VPWA 3T3NA 3IHKA 4IIJA 4L15A 5JEEA 3WISA 2DMRA 2JAWA 5TMPA 3DBHA 1M2NA 1K7SN 3IELA 1UKZA 1XV5A 3K9GA 4XSGA 1H0RA 1Z8DA 3E1SA 3N8GA 1FFDA 3OTIA 4H6WA 4EJSB 5ALTA 1U5BA 1IZ7A 1JKFA 2HCJB 4HLDA 4R0NA 1D1QA 4F4DA 3CZPA 4DLLA 4U7JA 1ID8A 3OBBA 1U80A 4R1PA 4DCCA 3VX4A 1GSIA 1LVHA 1TRHA 3ZCTA 4UATA 4EY4A 3UYLA 5LYYA 2XX3A 4CODB 3LCJA 3DUWA 2YWCA 1ES9A 4PIMA 3VGPA 5BVGB 2FMXA 4KREA 1DFIA 1N3YA 2ODBA 2P0AA 3NC0C 3R5FA 4KLRA 4RULA 2BFOA 1G1MA 1R4NB 2IXTA 1IYZA 4Y2XA 1WETA 1YJQA 1RZVA 2W9XA 1OROA 1UWLA 3V4LA 2CD7A 3DKIA 1U0LA 2CZGA 2I2FA 1OXTA 1WHSA 4X54A 1CQXA 2UUCB 2OY0A 5ERXA 2CDAA 1Z4JA 2BRUC 3JCZA 1ZH6A 4DLWA 2P4QA 1KAEA 4URYR 4BB9A 2OV8A 3TTVA 3WK9A 2BKXA 5F4BA 2BF7A 1F3LA 1R27A 3IO5A 4Q7MB 4EELA 4B3FX 1L4LA 1NUHA 1Y5LA 3CLUC 3L1KA 3DEZA 3OZEA 4B74A 4YONB 5C1BA 3DE0X 3RJTA 3QOYA 4US0R 3GJRA 1O3YA 4RF3A 2QZZA 5CDGA 5IDWA 3OF5A 5K5EA 4M99A 4DMHA 1H6AA 1NUQA 1W5SA 3OE7D 5FNVA 2XTZA 4GMKA 3AF2A 8GPBA 3IJRA 3QVXA 3T5DA 4KGXA 5ALOA 1T8WA 4DVGA 1UL1X 4H1UA 3OFKA 2XYPA 1TM5E 2G40A 3WAJA 3EZ9A 2J6BA 3ZVKA 4Z54A 1JFTA 1M8PA 4YJHA 2ZCVA 1GFZA 2E48A 2X2FA 3KCNA 5CJ2A 2A4MA 3WFIA 1V3QE 4BDSA 2G9ZA 3PQCA 3KAPA 5B3JC 4I6EA 1RKBA 3WWZA 1Q3HA 4CLRB 3TNDA 4YAIA 3UMRA 1R2QA 1T9HA 2ACEA 3C24A 2UZ1B 2LNDA 2R1UA 3HJHA 4IIBA 2C95A 2CL6X 2H2GA 2GXQA 5BV7A 2H0AA 4LFCB 1SIBE 1ZHFA 3RWOA 2IWRA 1N6IA 5C1IA 3KJNA 1MV5A 3WDSA 4DDMA 1IM8A 4D98A 3ZK9A 3L49A 4PINA 1U0GA 3M2PA 1DC8A 1X7GA 3QP9A 4CUJA 5HZGA 4QU0A 1Z0KA 3R3XA 3T1VA 3ZLVA 1J5EB 4N3AA 3QELA 3BERA 3E58A 4C87A 4ESHA 2GQ0A 1LBIA 5CXUA 1B0UA 3GC6A 1THTA 1TMGE 1HORA 2Y92A 2JFQA 3JQFA 4RD3A 5ABPA 2GZAA 5JNTA 1N77A 3A70A 3PT5A 4JLKA 1NUTA 3BWYA 3D31A 1AGYA 4AJKA 2QYOA 4ML3A 1HDXA 3BXEA 5KKNB 4XUGB 1GZVA 4TL7A 1KYTA 2WP8J 3BGWA 3NP9A 3QPVA 4ZU1X 1L4BA 3O8LA 1C5KA 5K0GA 2ERYA 3G59A 4RHUA 1MPXA 1EQUA 1WV1A 4RK7A 4MQ5A 3N75A 1UMBA 1SXQA 2R8ZA 2C77A 3A2LA 3AXSA 4B3JA 4OQLA 1GTJ1 2CLMB 2XE4A 4RD4A 5LB2A 2XXJA 1X1CA 3FSGA 1EFCA 4KGDA 4ZDKA 3L7NA 5IVHA 2JI4A 4HTAA 3C8MA 5TC4A 4I8DA 4E14A 3D5EA 4C2BA 1QP7A 2CE2X 2GKSA 3HB9A 4HDSA 4LXGA 1N2BA 1ZN7A 1DO2A 3ESAA 1BS1A 1KO8A 1WEHA 1LQTA 3NVAA 1XWFA 4OYLA 3RFFA 3EYAA 2J0EA 2A92A 4RVGA 2IU6A 3RHTA 4AUKA 2C9MA 1H22A 1B43A 2R5FA 4ERXA 3JQ7B 1L4NA 2C2ZA 1W44A 3CLVA 2V9CA 3NPAA 1XTSA 2C0QA 4OKSA 3R7WA 5CG2A 2R0QC 4EHNA 4U2BA 5JAZA 1IZ0A 2QN6A 1JR3A 1U7UA 1EGVB 1Q0LA 4C06A 4K81B 1QMPA 3FTQA 3ZWMA 2J9FB 1WX1A 3A27A 3PENA 4JOCA 4HPWA 5ITZB 5A7GA 4P3NA 3GEMA 3D4BA 1EUDA 3KKZA 1PQ4A 3QUBA 4P3PA 4DLZA 1CJBA 4EA9A 4P7GA 5CURA 2CUKA 3OQPA 4LV5B 3KPVA 3ZNNA 2Z5VA 4ZZ3A 4IDCA 2D06A 4IUYA 1CJTC 2A5GA 1PJ4A 1LV8A 1N2CE 4HWGA 1G7SA 1CW2B 1NJ5A 1CEXA 4JC4A 4DDWA 1UWCA 5A4AA 1WCYA 2F3QA 4FXOA 4ND5A 5HFJA 3ZLBA 3C74A 2YHUA 5K3DA 5ERGB 1LVUA 3LM8A 3W5HA 3KCQA 1NNUA 3DKVA 1KDVA 2FETA 2Z9CA 3D6TB 1PZXA 3Q8WA 1Y1LA 3L0SA 3MRXA 2AFHB 4GW3A 4KVAA 3S2ZA 3OAAD 1KU0A 3SYTA 4QGSA 1XMJA 4CF6A 4JB0A 3RS7A 1NXOA 3N58A 1N0VC 4JSYA 3ZZTA 4ZHSA 5I9SA 2WC1A 4A6EA 1G3UA 4B80A 1SKUA 3HYTA 1Z74A 3WMGA 1KVRA 3FYHA 1PFVA 5BW5A 3KKEA 1RLMA 4YRGA 2HU7A 5A1TA 1MIOB 4PHGA 4EDHA 2H00A 4OUKX 2G4LA 5IDYA 2DAPA 3CVOA 3AB8A 1UXOA 4WV3A 6REQA 3VOTA 4R69A 3ZJ4A 1XRLA 4ZO6A 4DSTA 5IFLA 4PZEA 2DGDA 1UDWA 5DTRA 2BFDA 2PANA 2Q45A 1HQDA 1C7IA 1I10A 2Q07A 2X0JA 3C7AA 4FI3F 3ROTA 5IS2A 2YWJA 2HK6A 1GSOA 4N54A 3JASA 2X6TA 3NTUA 3SFVA 3N0TA 1MORA 3R09A 4M36A 5GVSA 3U31A 4DHEA 1NVVQ 1T9AA 5FTJA 2RHCA 5B3AA 1NLFA 4D46A 3Q3HA 1D4FA 1MB2A 2GEDA 4UE6A 4EPXA 1FYFA 1P1CA 3ORYA 1QZUA 2IYPA 3T7CA 4XIFA 1FNMA 1ZC4A 3OZIA 3Q2OA 4IMIB 1FDRA 1RWPA 1C9MA 2XNKA 3K9LA 2PKQO 5E7JA 5FFFA 1NXWA 4DJ5X 5KHLB 2JD2A 3A0UA 2V5VA 1ZN8A 3T1TA 3L6OO 4F3TA 4K28A 3LL7A 1N4AA 1PT8A 3ZE8A 3RVNA 5E9AA 3UOWA 2QIOA 5JFGA 4YRLA 1LEHA 3M83A 1XTPA 3KTFA 1DUVG 1II8B 2ZPUA 2RK6A 5YASA 3EXIB 4YJ2A 4W1SA 3JALA 3IP6A 1KI2A 1K1EA 1JZTA 4CDMA 6PFKA 5I9LA 2R8BA 1T5OA 4NBVA 4Y1GA 1EWTA 1K68A 1Z37A 2COKA 1X7HA 1JQAA 2FNAA 2C3OA 2MU1A 4Q4AA 3AFNA 2FW8A 2ZTSA 3MWDA 4V0KA 3SQNA 3WBJA 4FMCF 1FFEA 3WTCA 4TWIA 2GPNA 1RLTA 1KOFA 2H1VA 3KT8A 3DWFA 5AUQA 4YPOA 3N0XA 2PZLA 4AG5A 4IRMA 1WBBA 3RC9A 6ABPA 1IHXA 3B7GA 3B8EA 4TRMA 2BEKA 3IPCA 4YJ3F 5KYNA 3F6PA 1VSBA 2F9MA 5FBRB 5D3MB 2Z30A 5KKAA 4LVUA 4GYKA 1PZNA 3QEJA 2WTNA 1PIWA 1SD1A 1V41E 2EZTA 3I5MA 1CUYA 1TNDA 2JS7A 2P2CA 3I73A 5EJGA 2ZKIA 4MLPA 1PT6A 3PJEA 1UEIA 3TIIA 5HTOA 2VTBB 1X7DA 1K8QA 3DOUA 4IIJB 1UXJA 2IUTA 3HYRA 1YGPA 3L02A 2RGYA 4BNZA 3C7KA 3JQAB 1NJGA 3OOEA 3OPMA 1M9NA 4R05A 4DEXA 3H4MA 4L78A 2AX4A 2ZB8A 1SRRA 1U8TA 3A3OA 4RTKA 2VO1A 1LU9A 3P20A 5A2QA 5AK4A 1V7PC 2ZRDA 4HI0E 4PX9A 1J49A 1STOA 3Q7EA 5CA1F 4IHJB 1G55A 4HMPA 4R6WA 5TGZA 3B13B 2IDKA 4BMOB 1Z6YA 4IMPA 1E7RA 2DUNA 3O1IC 2DULA 3AUTA 3CSSA 9ATCA 2A1TR 2W22A 3G02A 1KKLA 4MQEA 3TVTA 5CFPA 2BIFA 2GJ8A 2JGMA 3DBRB 3WK7A 5KIAA 1QAQA 1W47A 1KQNA 2WAYA 3CC8A 3EIOA 1U7XA 3K15A 2OC4A 5ADVA 1KBOA 3TSOA 4KAJA 1Z0ZA 1I6LA 1B1AA 5D85A 3HADA 1T4CB 4PYLA 1JHVA 3IP7A 3LSYA 4MI6A 2W0MA 5I7FA 3N0RA 3SSMA 4LZLA 2QUJA 3THXA 2FLVA 3V2GA 2QENA 2YN0A 4BGVA 5G3ZA 5HQJA 4QBHA 4P5EA 4Y9TA 5GVRA 4E46A 1YCGA 3TRFA 3U6KA 4M0MA 2QT1A 4UD2A 1Z22A 4WOPA 3HLTA 4RJ2A 1V5GA 4I8IA 2GESA 2M98A 4K05A 2NQ2C 3IQEA 2OCKA 4KXWA 3L7MA 1X15A 1YL5A 3SZGA 2QX9A 1GCAA 5DTQA 1G1AA 3BIJA 3QKIA 3WBKA 1TTPB 1Y3HA 1YRLA 3GEPA 2IYQA 4ARZA 1NI4A 2JIZA 2P40A 3C14C 3S2IA 2O19A 3L7LA 2G09A 3NWBA 4MS1B 4EYKA 4GWGA 4ND7A 3NU1A 1JPNA 2XOEA 5JMOA 5AXCA 3P26A 2XKJE 3GH1A 5IXJA 2B1RA 2ERXA 1FQWA 2ODWA 2ZANA 1SCBA 2PUHA 4YHBA 5HKKA 1QHSA 3BMXA 3NKFA 4IFBA 4UREA 4EEKA 3L43A 4X0EA 3EHDA 4F6LA 1Z7EA 5KYGA 1CJMA 2IH4A 4O2RA 4TMFA 4UEKA 5BSMA 3K70C 2XMQA 1VL5A 2O0LA 3HKDA 1EYZA 3LUBA 4Q1VA 4CHGA 1K6JA 1S3GA 3MBOA 4TLMB 5J2TB 1JR2A 1N7GA 2G63A 1TZBA 1A4RA 3VU3A 5EHZA 4KVGA 2EWMA 2UZIR 3FYCA 1BTOA 4GPIB 1HG0A 2XRYA 3PWKA 5BNFA 3CVUA 1P9LA 3E5MA 1FZTA 4C29A 1XTRA 4IH4A 4JA2A 4N40A 3NB0A 1U5AA 3D43A 4QHYA 4P98A 4BGIA 2GJSA 3ZEIA 3V4SA 1Z0JA 2GRAA 4FIDA 3TMKA 2PS3A 1PWYE 2OZLB 2O0MA 3VV3A 4UCXA 3M6XA 2GPAA 4CEHB 2FCRA 5EERA 1DO0A 2FG7C 4PXSA 1M2FA 1ZN9A 3OWXA 1E2JA 1NSFA 4ODIA 2WM8A 5DGHA 3LTNC 1RNLA 3HQ4O 3T0IA 4KTTE 2P7HA 2IX9A 4XOIA 5K0TA 4IFEA 4YT4A 1YS9A 2WBLC 2B98A 1E69A 1T1EA 1XHFA 2X1VA 2DPMA 4F46A 1DUIA 3NI2A 4MR7B 2P9YA 4F8YA 4YCCA 1QP4A 1EVZA 2O2CA 2QNIA 4NZOA 4J0GA 3OO0A 2BGWA 1HPLA 2XNDA 4B73A 2J0VA 4RJIA 3ECCA 3BSWA 1K7CA 2H7CA 2I22A 2GSDA 4ZO8A 5IT0A 4QOJA 5J4YA 3FNIA 1O8CA 1VE7A 4NZ9A 4YXWA 2ZJBA 1T0IA 3QKRA 2IHUA 4NJOA 3IUJA 2HDNB 2Q0HA 4LQCA 3L46A 4IXDA 2IHYA 3AW8A 3BA6A 3QX7A 3SY8A 4B09A 1BVRA 1U2DA 3EBLA 2ZT7A 4IJQA 4CIWA 3HSKA 3LUJA 3U3RA 4UXHA 1NJ6A 2C7OA 1OI7A 2PMCA 3LXRA 4LCJA 4MKIA 2QSZA 5DGCA 3F5SA 5AKGA 1AD2A 5DGTA 5F4ZA 3WNDA 1VYUA 3BXPA 3AGQA 2AUNA 1IJFA 3HCNA 4NCNA 4R1LA 5BRAA 5EHQA 5EJ8A 2AHOA 1GTMA 4LUCA 1TQ6A 4QICA 2R9VA 4Z0PA 1R5BA 3MT9A 4MV7A 1UOQA 5EG5A 1PV4A 2VJNA 4GT1A 3CX3A 3HACA 5C52B 4JENA 3CWZA 4E5NA 1DTWB 2VQ6A 3ZD7A 3FNFA 3JQ6A 1P7ZA 1JF8A 1ZJJA 2WYOA 1YJBA 4X6XA 2COEA 3IAHA 3M1IA 4D4IA 2ZYVX 4IDBA 5JTTA 5J2UA 4KLCA 1ZCZA 4QYTA 2QN1A 4EUFA 3T0FA 2GO7A 3AW9A 3QEKA 3RGGA 3U13A 1E3LA 2FAXA 3H3JA 4KGZA 4XEHA 5BT9A 2JRLA 1FFWA 2WWRA 3PFIA 1OBFO 4Y2SA 1L4UA 4RC9A 1DAPA 2NIPA 5C18A 5AK0A 1G4UR 1NHGA 3GJ4A 1WP4A 3RS8A 3JQEA 1GPWB 4P58A 2OO5A 3ED5A 1T3LA 4DG5A 5KJFA 2RIPA 4NY1A 5LQCA 4NK4A 4LG1A 4TLCA 1TJNA 1ZM3A 4ZDJA 1G4AE 4UTNA 1W0KD 1Z08A 4MAFA 1MRZA 4B6OA 4F4CA 2BGGA 1NOJA 3AETA 3WB0A 4OBXA 2DT8A 2Q2NA 1PKXA 2AC7A 3G0BA 4LV6A 1QSGA 5JISA 2QX7A 4EL5A 2ECQA 1QUEA 2XGMA 2ZRPA 3L0BA 4Q7KA 2IWHA 3VR5D 4WA7A 2HA7A 1TU0A 2BFFA 1V95A 3CLRC 2CMGA 1DBWA 4QRHA 1NE7A 4AUEA 2DB3A 1G5TA 3AQIA 2IQ5A 2V3CC 4IEIA 3W34A 4D9EA 1YZKA 3PXGA 2F3UA 4YUXA 4DSNA 3DFIA 1TCBA 3D6JA 4FXPA 4UEQA 4Y9SA 3WOHA 3LUDA 4R9VA 1W49A 4MOWA 4HDMB 5AK3A 1XKQA 2EL9A 4OYHA 4GRDA 4K9QA 4LDJA 4P3XA 2J6HA 1TMOA 1DC6A 4XDGA 4FTWA 4O0MA 1UPFA 2HO5A 1KYWA 2VT7A 4EYEA 5KTNA 1VKZA 1KZ4A 3CEPB 4YC7A 1B4DA 4CV0A 5JEDA 5ICMA 1ZJ4A 2H52A 2Y1WA 4UUOA 1VSQA 1V1JA 4TT8A 3B6KA 1VLJA 3SGLA 4B3GA 4H59A 5TPWA 3WZMA 2JGFA 4AQDA 1C3XA 2NVOA 4JKOA 4V38A 5TS3A 4KR0A 3GLFB 2W6ZA 1A8HA 4Q1FA 3ZUGA 1RBQA 4UJ5A 5JXJA 2AJDA 5LBUA 4BO8A 2P68A 1ZM4A 1DCKA 1UBTS 4J0HA 4FFSA 1MAUA 4R1MA 4CDGA 3M49A 2H4WA 4NYJQ 3EVFA 5F1PA 3UJAA 1TVEA 3P9QA 2IQIA 5AKIA 3S28A 3PCRB 4KGVA 4GD3Q 3KR2A 1PFWA 1M10A 2IRWA 4FHFA 4FK8A 2ASVA 1S01A 2CV2A 4QUDA 1O77A 2ANCA 4WZAA 2A9QA 3UMVA 3R41A 4NIMA 5TDHA 3TRIA 1B23P 2C42A 3K72B 1W1WA 1WDWB 2W7TA 4MQUA 1N2XA 5C4IA 1UPCA 3PEFA 5IAKA 4O5OA 1U5CA 4EYOA 4F06A 1D7OA 3FOFC 4MICA 5D3QA 5E9JA 3UV6A 1E7YA 1TRKA 4OAPA 2WFLB 2VJCA 3KDAA 4QC2A 1ZO8A 4QYSA 2VYVA 1WCIB 5TVGA 3NT4A 4QQRA 4BO9A 4AECA 3KR9A 1O94D 2WYUA 4FDVA 3PVZA 2PJZA 4XYEA 4AJ4A 1I94B 4DCPA 2UVPB 4PSDA 2HDWA 2PZBA 3H4VA 4JLMA 2QG9A 3SDBA 4N9QA 2JLQA 2YCLA 1RT9A 1MBZA 1P60A 1UM9B 1VKHA 2AG1A 4QDZA 2XTNA 3FNGA 4DS3A 1XA3A 3KL4A 1I7PA 1K8YB 4UPEA 4K0KB 3EEBA 1RC0A 3UMCA 4ARZB 3PEVA 1FRNA 2YMPA 2R6JA 5BSWA 4FB4A 1MJNA 4IDQA 4PNZA 5HG0A 3NGLA 4WEQA 2WE8A 4L4XA 3DVAB 4RQAA 5J9FA 4I14A 2GXAA 1QO0D 4CG0A 1E6EA 2O5RA 3MINB 5AOCA 2G8NA 4Q01A 3C6MA 1KK0A 5FNZA 4DY6A 2CXQA 2H0RA 3NBUA 3BCHA 3CR8A 3ROMA 3EIWA 1QG6A 3LQ2A 3V00A 4TTIA 2VUIB 4N0MA 1T6BY 1JQBA 4L51A 2VDUE 3O4VA 2CNKA 4PTLA 1JBKA 1BOOA 4QE3A 1S8NA 2PL3A 4UNIA 1FTQA 4PWZA 4QDUA 1XP8A 2JLUA 3DDCA 1YDWA 1BWPA 1R0SA 1QJCA 4L0CA 5CT9A 2O0KA 3K71B 2J30A 2HK8A 3OOSA 2CDNA 3QG5A 2WFMA 4QGBA 4UKDA 5BYBA 5IJWA 4ZTUB 5LJLA 3F8WA 6CHYA 5JVDF 3I0NA 4HAOA 4K3VA 5C8YB 2QTZA 4JB8A 4PYKA 1QRRA 1P9OA 2W2TA 3HA3A 2IDZA 3OOYA 1H5QA 1I1OA 4M54A 4NCHA 4P7KA 6REQB 1IH8A 1Q0ZA 5SZIA 5AW6A 2G1PA 3BRWA 3ECSA 2I6XA 3GEDA 3LRXA 1KNXA 1XTJA 3C3DA 4IFIA 1SUCA 2J3IA 4TV9F 3TR0A 1P39A 2QKYA 4E5DA 4PGMA 2FR8A 5LQAA 3I37X 5C5IA 1D03A 1RJWA 3TLMA 1BVUA 1JG7A 1B8OA 1TF2A 1U98A 1IWBB 1JHZA 1VTKA 1M83A 4J1TA 4YA6A 1WPXA 5K3FB 2BFEA 3P0RA 5BQ3A 1Z07A 3K16A 1UT6A 1HFJA 2QM0A 3EIFA 3NTXA 1BHSA 3Q6MA 3QNWA 4YK7A 5FHQA 3VAYA 4AK9A 2WMDA 2LTAA 1VB5A 1OX4A 4ZMSA 3F73A 5GONA 1P0MA 1U2EA 1C29B 1NP7A 1Y3CE 5JJKA 3EUAA 1LS1A 3BMCB 1NBAA 3C0KA 4RIIA 2GN1A 1AKNA 1ZICA 4WKOA 4M1MA 4KQFA 4XARA 3ICQB 2HU2A 2H4XA 2LUOA 1IOVA 4MI1A 1R64A 4XE5A 4C9BA 4FOOA 1JAXA 5IN4A 1DU4A 2SNIE 3CVWA 5HW0A 1Q74A 1M34E 1GQSA 1I30A 2GBLA 4TWJA 2A5DA 2YMLA 2OENG 4WGGA 2GEVA 3HKDB 1GQQA 1XCLA 2GBIA 4Z1MA 5DM60 4K9MA 4B2PA 5CFMA 2G80A 3QOXA 1YE5A 1G42A 3S1LA 4H7EA 5AXBA 4QLOA 4BV3A 4DB2A 5AO9A 4CNQA 1ZCBA 2BGRA 2C96A 3GLGE 1CR0A 1CC1S 3AI7A 4TV8F 1T2DA 3PDIB 1ICIA 2X9QA 3TDNA 1T8PA 1MAHA 3U4DA 4CM6A 2WWHA 1SIUA 2XKBA 4WBNF 1C8LA 4X85A 4O8ZA 4Q7EA 1NIJA 1BGVA 3I8XA 1T2NA 2ADMA 5AJTA 1RQ7A 5H83A 2C5FA 1JDBC 1XK6A 2XZTA 4RSRA 3TG2A 2O8CB 3PR2B 4QARA 5AD1A 3F0TA 3LOQA 3BULA 4RQTA 1AS3A 1OB2A 4ND4A 3OEYA 1SA0A 4NOLA 1SUDA 4UM9D 5IARA 4AICA 1XMVA 3FGPA 4MDHA 2GETA 4WD3A 4AZ0B 3SK0A 3OJFA 1P44A 1Y7IA 1UOPA 1MOZA 1EAMA 1ZONA 2OK7A 2R68A 3ZV7A 3VO1A 5A9RA 3B7WA 4RZ2A 4AMYA 4QTUB 1J8QA 2YXDA 4MYSA 2LCQA 3BRCA 1KEVA 1RJGA 3LRPA 3RFTA 3M4ZA 1XK7A 1BE0A 4KH0A 4LC9A 1PQUA 3KWFA 2GKGA 1IL0A 3D0QA 1P6UA 3SX2A 1CERA 2JJ2D 3FBWA 2FRXA 2ZRAA 5KYWB 1FJHA 4CE6A 1U0NA 4UNSA 2B8EA 2DQSA 4ZCQA 3QVTA 3VDNB 3VSEA 3KG2A 1EIWA 1ZOLA 1P9RA 4MS1A 1KETA 4JJIA 3EMDA 5HEKA 3L1VA 3BF7A 4AULA 2HQOA 4ZCTA 3DMDA 1U0JA 4QNMA 4KXQA 5CH3A 4MV6A 4UHJA 3GB9A 3OEWA 1YK0A 2WF5A 4UU0A 3IV9A 5ALFA 1A2BA 4LWOA 3JVEA 3QW2A 5KTMA 2WQ6A 1OFVA 2X5KO 3JQPA 4PSAA 4CLOB 3AP3A 2W4MA 3ANMA 2F55A 1EXVA 2VJMA 5DCWA 4Q1CA 1BS2A 1P0IA 4HLCA 3ZWCA 2YNMC 2QQ0A 2B4TO 5GONB 5CUQA 3QA3E 2FSPA 1Q2XA 4C20A 3QEMA 1OVMA 4PIPA 3BJIC 1L7RA 5AKZA 4BNHA 1LBEA 5K03A 3MMNA 4KBYA 1N3LA 1KYVA 1JG2A 1U2PA 3WI7A 3C3MA 1OAOC 1M76A 2VTBA 1T9GR 1U1DA 2WKPA 5GINE 3II6X 1ISJA 3A4IA 5EWMA 3SXPA 1XDWA 4L1KA 4O1IA 2BEUB 1I6MA 1UM9A 1RWKA 1Z5OA 3ETLA 2ZTVA 3LXXA 4B17A 5EP2A 4EQ6A 4XPIB 1OX5A 1WNFA 2IOYA 2IPAB 1RAIA 2G6BA 1TZMA 2X40A 5F3RA 4EUKA 1AHNA 2ZAGA 1AKMA 3HU1A 3FB4A 1AQIA 4N7MA 1M72A 3OTWA 1E79D 5JE8A 3EPPA 1CJVC 2WT4A 1SZDA 4TYMA 1YJXA 4FMPA 4C4AA 1XRMA 2Z5GA 5EEGA 5CCBA 4HDNA 3A6PC 3JWHA 2VUUA 4IJUA 1Z28A 4MI9A 2XYQA 2P9ZA 3OIDA 5KVVA 2WE7A 1YZYA 2Z98A 5ENVA 2VQDA 5JSYA 1CTQA 1GEGA 4QGAA 4B76A 2FPIA 4ERNA 1DPFA 4RGBA 4KQXA 3ZU3A 4ASUA 3WXMA 3TGPA 4YB8A 3H2KA 4E33A 4RTSA 4XSVA 1XG5A 4F04A 1FMTA 2C54A 5IP5A 3HMQA 1AKVA 3WQRA 5EIFA 2JCSA 3DHVA 1I3CA 2G5GX 3AWIA 4UBIA 2LDBA 3CPEA 2EF0A 5CVVA 3HGTA 2WK1A 2F67A 3KVRA 4LDAA 1PYOA 5FTWA 2E49A 4A8JC 4A27A 1HT2E 5SV2A 4DTCA 5BV8A 2EFYA 5B30A 1QH8B 1Z2OX 1XDZA 1UOEA 3PT9A 1SUEA 2R6GA 3HVKA 4XEUA 4ASUD 4EG7A 1NI5A 1KARA 2FRDC 2PD6A 4UUNA 5AKKA 3U4IA 3A9UA 1XX6A 4TKMA 3T1HB 3P2OA 1P3Y1 4YBRA 3DCJA 1XRSB 4FEEA 1XVTA 1WZEA 3AY6A 2QQ5A 4HB2A 3LP8A 5BMVF 1T8TA 3TLAA 3ZI0A 3VR2A 2PO5A 4QHSA 4CG2A 2JBHA 1CUCA 1XMIA 1NVKA 4R0MA 4DMFA 2G07A 1ODSA 5KNDH 4JBHA 1QOPB 3PQ6A 1W35A 1QYRA 3PRKE 3TZLA 4EATA 2CEKA 4HV4A 2BGLA 2ADFA 2Q1UA 1BFUA 1ZX1A 2AMYA 3PF9A 5AP9A 1ICEA 2VT3A 4QGGA 3F46A 4GHWA 4WXRA 1ZU4A 3ZLJA 3SX4A 2F1HA 1PGPA 4ZCIA 4J7UA 1NV8A 2PIDA 1TFUA 3TIXB 2HZBA 2HMYB 3CZ5A 2YVLA 2W58A 3DP7A 1GA6A 5IMSA 4GDFA 4QKQA 2ZIFA 3P9YA 4M87A 2WAOA 2V7UA 3B1FA 1C0EA 1IG0A 1NR1A 3IQIX 1MX1A 1WEKA 4NMHA 5TNXA 4A8JB 2QLJA 2WVHA 3KQOA 2FPKA 1HLDA 5JNWA 1EP2B 3IDZA 1Q7RA 4U0KA 3FKJA 3P0HA 1UBCA 2D0PB 2IYOA 4CEJB 2XW6A 1VSVA 2BLNA 2FV8A 2V7QD 3EFEA 3W79A 2IY8A 1UDBA 1RAFA 2ZCUA 1VIDA 1I2AA 2NTVA 5LNK6 4TSFA 4AM8A 4ZAWA 4EVRA 4CF4A 3NORA 2O52A 4GGMX 4KXVA 3GFFA 1ULZA 3MQFA 4MIEA 5EMKA 3ER9A 3ME5A 3RREA 5L6LB 2WKQA 4E88A 2PT9A 5AM1A 4EY7A 5JZSA 3C5EA 2J5KA 4I0WB 4JP3A 4PO1A 1T1JA 3CYFA 3GH3A 2XMRA 2RG7A 3THWB 2RFLA 3K1JA 5IF9A 5K0SA 2PMBA 4P7JA 3UOAB 1Q12A 3FTPA 3UAWA 1PLLA 4ES6A 5I47A 3A2NA 4P84A 1GTSA 3ZIUA 4LE2A 1B3RA 1A8IA 3BE5A 2J4CA 2JEZA 4L3VA 2VNSA 2B8TA 2PU7A 5JJLA 2YN4A 4GH5A 1KY4A 2FN4A 2PX4A 1VG1A 1U8YA 2J0SA 2Z2YA 4MGHA 4BLOA 1TZJA 1CU1A 1X7XB 1XAHA 3L6BA 4WH0A 4INPA 2D1RA 2X7XA 2PVPA 5ALIA 5JBNA 3GLGA 3KZMA 4KXFB 1L5NA 3UK1A 5AICA 3ADKA 1VL6A 1OLUB 2P4SA 3EA0A 4DW8A 3DLHA 2XQVA 4F4HA 1ONBA 4EF4A 3KOUA 4FMDF 2G36A 2A3RA 1WZCA 3ZU6A 3FI0A 1CS0B 3AY0A 1CHNA 2ACVA 3TNJA 1XZQA 4NCKA 4QQFA 4WA8A 3MTEA 5LXTB 2HADA 5KYYA 3SKVA 4LY6A 5A3VA 3TIFA 3S1AA 5DVZA 2PLAA 4DA6A 3UWMA 5B2EA 821PA 3WJ1A 3N2EA 4W5JA 3DW1X 3FVRA 4XD2A 4CF5A 4PGFA 3G68A 5C8VA 3A1NA 1EU1A 5DGDA 4JXKA 1F12A 1K4YA 2L17A 4XR9A 4DQLA 1E9BA 2NV6A 2VH1A 3DAOA 5FPPA 3QLVC 1IVSA 5M29A 2HBRA 4IVRA 3E9MA 1ZOIA 5LWQA 4DC0A 4QBTA 2X8LA 1BD4A 1YR3A 1F60A 2CHUA 2A94A 3E4CA 3FPEA 1YOVB 5UKDA 3LV8A 4YT8A 3M89A 1NQAO 3TSWA 2Y93A 3NTVA 5AKEA 1J56A 4NF2A 2M6KA 1YC5A 2M1ZA 4BEJA 1GZHB 2WD9A 3OZ7A 1Y1KE 3FKQA 1AKTA 1H66A 5BYJA 2DBYA 4K8RB 4N8DA 2VWQA 3WX0A 4BTLA 4RSMA 1JN0A 2I1WA 1P62B 1Q1QA 3B6JA 2ZIVB 2JC3A 3BL8A 4RD2A 4CIYA 5K0NA 4IPTA 1JH9A 5EMNA 1LGYA 4N8EA 3EFBA 3HU3A 4RHXA 5HIIA 1ZR4A 1MA0A 1TLTA 2GD2A 4KPFC 4ZOBA 3KYIB 4U6QA 3WLPA 1PUXA 5A03A 5JYEA 5L51A 1VZ2A 2A9RA 2FPWA 4HDNB 1N6KA 4NPAA 2FE1A 5FBZA 1FLAA 4L07A 4NCAA 2IZ0A 1TLLA 3R7NA 3ZNOA 3J80A 1JHQA 2JLCA 2YJTD 1BX1A 1JSRA 1VHQA 3GAZA 3OLXA 4C0XA 4BIMA 4M7WA 1Q5PA 4KIJA 1ANKA 1D07A 3ON5A 4YMUA 3A1EA 3BC1A 4CQJA 3H5IA 4ZMBA 4ILKA 3LUKA 1T2FA 4KKXB 5MDHA 3KYCA 4O4JB 1PSZA 2J9YB 3BX1A 3H2IA 1AMUA 3AR7A 3WYBA 3TI9A 2FR1A 3ST7A 5ADWA 2Q6KA 3OQNA 2ZU6A 4RNCA 1E6UA 3F7TA 3QZUA 5DULA 3JPWA 4NCJA 3B9PA 3QNUA 2WAMA 1VCHA 1JKIA 5GV8A 5BR1A 3EISA 1SCDA 1USGA 4RMHA 3X1YA 4E5PA 3KYDA 1IQRA 2X1MA 4U7TB 4NV1A 4IYJA 3SSAA 3ZXSA 3LHDA 4WY5A 1FXSA 2QMUA 4M22A 2EIHA 2AH5A 2P6PA 4L2IB 4EHFA 2XHEA 1JFSA 1JV2B 2OC9A 3W6OA 2FPMA 3E05A 2Q3FA 5BQPA 2O2GA 2IVFA 4TWRA 1X3LA 4CUZA 3SXJA 4E12A 4CKWA 1MJGM 3I6BA 3QFHA 1XB2A 2O1WA 1WDMA 1B15A 3VOSA 3KQMA 1YU9A 1OYWA 1PQWA 2G1KA 2YYAA 1T4BA 4IO1A 1QANA 1S96A 5C9ZA 2Z9DA 3B1VA 1D2NA 2ZFUA 2ZRJA 4GZMA 5EY5B 3H18A 1XZNA 1X42A 4OBWA 4PSKA 5AIAA 3T1OA 2FRDA 4NFHA 4ZFNA 1KC1A 3NC1C 4GIBA 4JP5A 2YWEA 3COZA 2QM7A 2XZOA 1POWA 5ALJA 4AYXA 5F3DA 2CFRA 3RIMA 4GQIA 3C3EA 4L0DA 3I8OA 4IWYA 1SVLA 4H2DA 3QQ5A 1ILWA 3ZV3A 2O14A 1N2JA 2GLUA 2QY6A 2QXUA 3WYCA 3LT0A 3C4QA 3NHRA 4BEVA 5IAAA 1WXGA 4OX9B 2GZDA 2OO5C 3BK7A 5FQOA 1W76A 2VTDA 1U0TA 4WZBB 1U0OC 4MJXA 3C6ZA 3L7CA 4J90A 1YR6A 4MAAA 3HCPA 5AKYA 1Q0PA 2J7PA 4UFPA 5DTIA 3O3OB 4Y2HA 2EKDA 4PAOA 2C1EA 4HAZA 4AWXA 4DMKA 3WGIA 3H3FA 3L8DA 4D9NA 3VPGA 3IRVA 3C1AA 3ER6A 4WL0A 3TQOA 5CLJA 1PCXA 1NAHA 3LYAA 2PUFA 1FYWA 2QROA 1FXWA 1EUCB 2YXLA 1Y80A 3AFMA 3AFOA 1XQXA 4IEFB 5IT9A 4DA8A 1RXUA 5CVTA 5EXPA 3OCWA 2PA3A 1V8PA 4ND2A 3WA7A 2QGFA 4KYVA 4DPLA 2O5VA 3OQIA 1PDOA 4Q9HA 3VC7A 1XQ6A 4BHTA 5KJCA 2AJLI 2ATIA 1WO8A 1GZ4A 1YBMA 2H63A 3JTEA 5EZQA 2D4HA 2ZUBA 1QIEA 1XLWA 1NG1A 1R4MB 1IRIA 4M0UA 1BKDR 1I1NA 2P2LA 4CCAA 1XDUA 4E21A 2A88A 1CETA 1WXXA 1FJ2A 4E51A 4HX5A 5REQA 1R8XA 2WT8A 1RI3A 4IUBS 4LNUA 1VHLA 2XGSA 5G1NA 3O4RA 2SKDA 2ZRCA 1ZR2A 1HRDA 4RF2A 3RSCA 4D0LB 4HRYA 5DW0A 3CH7A 4MQ6A 2J9GA 3SR4A 2B6NA 1CG6A 1EIZA 2YQZA 4V0ME 3GELA 5COAA 1RZUA 3LG2A 2YHIB 4GSKA 1DRKA 2FG5A 2XAUA 1X1SA 3E7XA 5LP1A 3EZFA 1V8FA 3KJFA 2ST1A 2XCIA 4P35A 2J5XA 2O1SA 3LX6A 4F85A 5EIXA 4ZQGA 1O87A 2V9ZA 1H2YA 2PIAA 4YFYA 1FL9A 1J0BA 4I19A 1V7QA 4RHCA 2ISQA 1DWUA 4UFNA 1F9EA 1SCAA 3SLRA 5JADA 1E2UA 1JLRA 4OI2A 4RX1A 1R4AA 3UGQA 1ZZGA 2W6CX 4BECA 2REBA 4F6RB 4EKYA 1CY2A 4S35A 2I9PA 5BWCA 4Q9IA 1KSGA 3TB4A 1Q92A 1GD1O 3CPSA 4GX2A 4TM8A 1OFTA 3GLHB 4DSAA 2RD2A 2W93A 2W8BB 2QP3A 2ZBUA 5E4YA 1E77A 2ENWA 4YRMA 1IIBA 3ZKAA 1M6NA 1ZOOA 3L8YA 3NJRA 5CB0A 5J43A 4HVAA 4PGAA 1ZRHA 1ZQ1A 4Q39A 3F74A 4XI9A 2J31A 1W73A 4XJTA 3TQRA 4KPEC 2JZCA 3ZKWB 2FF5A 2QRQA 4ZARA 1IY8A 1NXPA 1XSEA 5EIBC 1LXCA 1XTZA 3UK0A 5F3WB 3NKLA 1EB8A 4J0QA 3CE9A 3N5KA 2RHRA 1Q0RA 1SIOA 4RABA 3W9BA 3MSCA 1QQ7A 4R8MA 1NBIA 1ZD3A 4PHCA 1Y82A 2CJWB 2IUEA 1CYEA 2IF2A 1KAGA 1UK9A 3UT6A 2ECKA 5BPFA 2O4CA 3SS8A 1AC5A 3EBPA 4YRCA 1UEXC 1MHTA 1EVKA 1SBHA 3D8BA 1L5HB 1T4GA 3CH6A 3QW4B 4ZV9A 1KPGA 5HF5A 2C4KA 2GPYA 3EVBA 2A8YA 3AEQB 4YFVA 4EMSA 4YRKA 1NVAA 2FMTA 1YB4A 2NUTA 1MO2A 3SICE 1P3DA 1N0WA 4DM3A 2OO7A 2QUIA 1SBZA 1Q77A 2J3EA 1OWLA 2VXBA 2ZR7A 3MMXA 3QBEA 3GT7A 3KAKA 3QX8A 2JGRA 5IZ4A 5K8JB 2GLXA 2R6HA 2FPIB 3Q10A 4Q9DA 1E2LA 2IE8A 4YS6A 5ITWA 4J6FA 3E22B 4LQDA 3ZK7A 1VFPA 2XUIA 2FOXA 5ALWA 3D7KA 2JLZA 1SHTX 3BWCA 3CKMA 4Y2UA 1HI9A 1SUWA 2VDWA 3CLRD 5CFNA 2H3HA 1S3SA 3WGKA 3H19A 4KYTA 3KTOA 2DVMA 4MYRA 5EI5A 1ZINA 1U8FO 3E9YA 4YMGA 4XYMA 4ZJZA 3ZDAA 3N0VA 1PL0A 3T7IA 5ECGC 2V6JA 3W6NA 3WL7A 4BJ5A 4Q3CA 1C8KA 4G5QA 1BCRA 1W29A 4I99A 1EEHA 1U0RA 3DV0A 3ZE7A 1P4JA 1H3EA 4WEOA 1ZEMA 2ZJ3A 2IYEA 3H11B 3X1MA 5JATA 4OHKA 5KYYB 3AB7A 4NU6A 1OQAA 3TBKA 4Y7CA 4EX6A 2KI5A 1F2TA 1JQLB 2QD3A 3Q87B 4HGYA 4D9FA 4DN6A 1TE2A 1KRWA 4IKPA 1BWQA 3H5TA 1WDLA 4K6GA 1HYHA 3U3KA 4JZYA 2GN9A 2YXEA 3IALA 4X8LA 4ON9A 5AXDA 4U7DA 1XU7A 3T9FA 1Y3DE 3FJYA 5KWVA 4D26A 1UPTA 4GDMA 4HPXB 4EW6A 1WP9A 4HQ6A 3W77A 3EVAA 3DV2A 3MTJA 1DAGA 1E99A 1N9GA 2QI9F 2H7YA 2XDAA 4PAWA 2PGLA 1KH3A 1R0LA 1VLVA 2XDYA 3ZUPA 5J59A 3DXZA 4HEJA 4ZZ0A 5JALA 4E15A 1Y8RB 4HNAA 2MDTA 3AEKA 3ANTA 3M3HA 5E2BA 3T7RA 1F2UA 1HE3A 2MSNA 2P3QA 3JARA 1VKNA 2DQ4A 2WHPA 3GMDA 2XF8A 5F23A 1IIRA 2JDID 5LZ7A 5BWBA 2ISCA 1Q57A 4Z2YA 4YN3A 3TTSA 1H2EA 1G59A 5EXXA 2BTOA 2QAGC 4MUYA 3BWBA 4OIFA 5L7YA 1NC1A 3ZKWA 3Q3JB 1GYPA 2DWUA 4IHJA 2PRJA 1MX5A 1A1SA 1ZH4A 2CHGA 3FPBA 5C1OA 3AHFA 5ALZA 2ZROA 2ZT5A 4CM1A 4LZNA 3DMGA 4ZANA 4W6ZA 3W2EA 4EY5A 2Q0SA 1Y6JA 2IKSA 4DIBA 4YRAA 1AXRA 3HCFA 4BCBA 4QT4A 2B2CA 1XAIA 4POOA 3U19A 1IB6A 4MKFA 3BOSA 4WKGA 5LM3A 2RHWA 3IXQA 4I9HA 2O20A 5CG1A 3SWWA 3Q8LA 2Z2IA 1H5NA 3FDXA 2ZITA 3LS2A 3O2SB 1OJ7A 2Y2UA 3G8CA 4EB6B 4Q9AA 3BD7A 5HKKD 1GG2A 4RXMA 5ALMA 4RPHA 2HJ9A 3VHQA 2HI0A 3LY9A 4XFKA 2OYCA 5BVHB 2YV4A 3M6AA 1D0IA 3A4VA 3QUCA 3QXGA 4V3BA 5FP0A 5K8LA 5L7TA 2QGNA 3RNOA 4BE4A 4DCJA 1SVIA 1NNEA 3PDHA 1LC0A 3QV2A 2Z3VA 1KHTA 4W1RA 1A5AB 5EOVA 1DTEA 4B4OA 4X1OA 4RA6B 2PQ2A 3K20A 3VYTB 2CLSA 1IM5A 1AXEA 1U1CA 1XKLA 2GJ4A 2JJ1A 4KODA 2QZSA 3BYZA 1ULBA 4FGLA 1X77A 3CNBA 4B3SB 5J2UB 3A3KA 4Q0MA 4D99A 2ZTHA 5H80A 4AX8A 3MEQA 3IIMA 3DTVB 3O74A 4RV5A 1IY1A 1S3IA 5ANRB 3UO8B 3ZHYA 3DD1A 5BQXA 5AOAA 2Q7OE 5DM1A 4EPRA 1E18A 3UK2A 5BWLA 4QU9A 1M8GA 2DBVO 3OCXA 3TOVA 3WKBA 3K8QA 3NV9A 4UQLA 1I51A 1C9JA 2AR7A 2WP0A 1SVNA 2X4IA 4QJBA 1T3HA 3HWWA 1QYDA 3T9CA 4FHCA 5B36A 4XQ9A 2GEUA 2R8YA 4ZYYA 1X13A 4U7FA 1IMJA 5EWLB 5C2JB 4RA6A 3T7EA 1J8YF 3IC5A 3K1TA 3R2JA 3VTAA 2AFIB 4PE5B 4QUJA 3DOHA 4YUAA 1N2OA 1GPLA 2CUTA 1LNSA 1N5IA 4YP9A 3O21A 1QK3A 1BQ3A 4BLTA 2OQ2A 4H15A 4NABA 3OUZA 3RRFA 5JBQA 1JWLA 3G8DA 1A9QA 4B48A 3S81A 3QLEA 4H4EA 3H5WA 4OXYA 2IYTA 2HWKA 1YCDA 3WGQA 2PSEA 1EWKA 5M34A 1EX9A 1UIRA 1HE8B 2HIAA 2QEQA 2FWMX 4XGRA 4C4ZA 2ZXEA 1NF3A 2B1QA 4B6PA 4F71A 5BV0A 1W4LA 5FOXA 1GGFA 5GOZA 3FD8A 1YFJA 2R11A 1D4OA 3MOIA 3OEHD 4WXPA 5FLKA 3RTAA 4IRUB 1UT5A 1EWRA 1A7AA 2IYYA 4C7XA 2P2DA 3UGKA 1R6UA 3X1XA 4ZT4A 2C59A 4BO0A 1VMDA 4U2EA 4JXXA 5FR2A 1EP9A 2OAGA 2V54A 4MR7A 4DLBA 3BAFA 3IAM1 1QVWA 4ALIA 3A3PA 3IUNA 3LGAA 2FPXA 2I4RA 3OT5A 4FNGA 3R0QA 3LXUX 3EXHC 4EHKA 1NVVR 5FFNA 3F2IA 2PD3A 1VBNA 3JR7A 4MSUA 1IN8A 1BH6A 5EJFA 3UFXA 5I9IA 3ZIDA 3AEYA 1PR2A 3FW1A 3ZWAA 2YICA 3Q11A 4V0RA 1BXZA 1EK2A 3N74A 3JVUA 3TTWA 1N3BA 3OT4A 4GU5A 4OL9A 2FX5A 2QQFA 4B34A 1TEHA 2D2IA 4KYIB 4PZYA 3WTBA 5LIPA 1P2BA 3WB1A 3GLGB 3S68A 2MCFA 1QF9A 2GT1A 1EFVA 1DXOA 1MKYA 3D6UA 1CQIB 2GN6A 2P1ZA 1KJWA 4YNBA 5ICGA 4I7EA 1MNQA 1AKUA 4TM7A 3LX5A 5DM0A 1O96A 2CLCX 4WNYA 2LR0A 2E1PA 1NBOA 3IBYA 1S2LA 1Y5RA 2CZQA 2JAXA 1XU9A 4PLGA 4JNKA 1KU6A 4GPD1 4PYQA 1PO7A 1T0HB 2K6GA 4HQFA 5HF6A 1NDQA 3U7EB 1SKYB 1T35A 3M5PA 4DV6B 4N5IX 1DKNA 1NVDA 1K89A 3MRVA 5DYNA 4GPBA 4EUHA 3ORFA 3RDPA 1B73A 4YMIA 2WSMA 3N6VA 1GITA 1KDOA 2EGHA 4CL3A 2EKQA 1GNTA 2I3AA 5LLSA 4M53A 3SHVA 4DXDA 1UOOA 4JI3B 1VPEA 2I76A 4PYNA 4EO9A 3QLJA 4E31A 4DJTA 1KI6A 4C7KA 3HDQA 6YASA 4X1KA 5U1PA 1AUXA 1W2GA 3BILA 3G6WA 3ZI4A 1CF2O 4ZT2A 5CW2A 2J3DA 1JIVA 3AVVA 3PE6A 4KRGA 3SZ3A 5A3JA 2GAAA 2VK4A 3CEHA 3EVEA 4LJLA 5AI8A 3ZW8A 4WBNB 3R6TA 4CIDA 3N07A 3GBVA 4GVLA 2ZUSA 2QTLA 3O31A 2YC2C 4UMFA 4B3TB 3K0FB 3HZZA 2LV8A 2NLOA 2RHBA 1Y1TA 1ACMA 4UJ3A 1XOIA 1O96B 1U1EA 3AM3A 4Z7JA 5B1HA 5JDCA 5LYJF 1VP3A 2ZQYA 1P4HA 2FSUA 3GCXA 4BMVA 1B6SA 5IF3A 1EA5A 1XC7A 1JAYA 4OA5A 3TE6A 5CDFE 2O5EA 4B6QA 3QPCA 1GLNA 4D4HA 3ETGA 1U3GA 2WJ4A 1C80A 2ZYGA 4ZVMA 5SY9A 1DAHA 1QH9A 2CVFA 2V03A 4F5ZA 2F8TA 1YR8A 2PH7A 5K3OA 2BEJA 2KLBA 3EDCA 1QCCA 3AR3A 3L7YA 3N70A 4E30A 2GCGA 1E20A 1V6AA 3L0ZA 3MTIA 1PR5A 4ZVTA 4UM7A 1S1CA 4TS9A 4P7FA 2OHOA 1ONSA 2RJOA 2GXSA 3KVYA 4RELA 5DIZA 2Q3BA 4CM4A 1EK0A 1V0JA 1P5RA 3B6ZA 4TMXA 2AUTA 4GGOA 1PZFA 4DLNA 3LIPA 1FDVA 4FE4A 1Y8QA 5KHOC 1M8FA 5IWAB 3NHPA 1SZCA 1DIOB 1YAJA 4YGYA 4PRZA 3M6LA 1E7MA 2PWZA 2O3QA 3NHZA 4JYPA 2I1VB 3D8SA 3FYDA 3PR3A 3X1JA 1BN6A 4MYCA 3ZNPA 1ACLA 4D4GA 1AT1A 4DPMA 2B3TA 5IKXA 1QV6A 2GPWA 3E81A 4J2OA 1A7UA 5B7GA 1X80A 1TMKA 1KWKA 3CJQA 2D6FA 3LDHA 2UYQA 4Z9XA 4BFLA 2PUCA 4GEKA 2VWGA 4HFNA 1JR3D 5DP1A 4KR3A 3L1JA 1FUIA 2V96A 4W5WA 3PXDA 4U2GA 4NS4A 1U28A 1YKSA 1E3WA 2EW8A 4H17A 1ZD9A 1VCIA 1ZUD1 3EDMA 2V74B 3OJWA 4XGNA 1DZ3A 1P45A 4MWCA 4D4JA 3STXA 1MFPA 1GCGA 5D2CA 4B44A 4MIOA 2XWBF 5T7BA 1G41A 1HEYA 2M6SA 4LTNA 4MRMB 3ZU4A 3ILHA 4C2UA 2FFJA 3W2TA 1A82A 2P5YA 1CXZA 4O4LB 3BAZA 3E53A 1J21A 5GONF 3ZX5A 2XDWA 4KLZA 3UHJA 2B30A 4BX3A 5DLDA 2ZJ0A 3RVPA 4MLCA 1PGNA 3NWPA 4JEHA 5BQOA 2BMVA 2ON6A 4WNAA 3RYCA 2ACKA 2H3EA 3UWDA 3A6LA 3EXAA 4AIIA 2NO7A 4MRAA 1QXSA 1DQPA 3AU8A 2BF4A 4MHTA 3LKVA 5TT0A 3TZCA 2C2WA 3ANNA 1JR6A 3G79A 2ODQA 5IBPA 1FSSA 2IUYA 4MULA 2WWTA 2QHXA 3DZBA 3TUJC 2FW6A 5LVAA 2VDRB 4IIVA 2AI2A 3PX3A 3TLJA 3ETNA 2QPOA 4RCVA 3B5JA 3LDUA 3Q6IA 5LKRA 4JJKA 3WGYA 4EB3A 5EWJA 1FDIA 2OHHA 2VPQA 1GFIA 3AG6A 3LT5A 4R8LA 2AD1A 4MGZR 5IM5A 1GL7A 1IUNA 2B9VA 3OZCA 1YRQA 3OMLA 5GV7A 1JEQA 3PUHA 4O3MA 3MBKA 4L9WA 2HSEA 4GOXA 4B7XA 1SMKA 2JIPA 4HWRA 4RORA 2GFQA 4EB6A 1AQ6A 1E89A 3E70C 1PDVA 2HHAA 1BAPA 4GZLA 4YLEA 3R0VA 1DKLA 1U8ZA 3D3KA 3V8EA 3ZEAA 4FYYA 4EARA 2XCQA 2AKYA 2PKWA 2JAQA 4LJYA 3I2YX 4IR7A 3S44A 3D4IA 2FWAA 3Q5DA 1JQJC 2FGKA 3PC8C 4NBTA 2FPGB 4WK4B 2O8CA 2IEIA 1QGYA 1COWD 5FORA 5DTMA 2AN1A 2VA9A 4YJFB 1ECBA 1LFDB 4MMXB 1I3KA 3QVWA 2DJIA 3E7WA 4XCXA 1Y7PA 2RI1A 5B6IA 2OLJA 3OIYA 5AKXA 5DTEA 2VIIA 4BB5A 1JDBB 1P77A 2BLLA 1AB5A 2VP6A 2XLBA 5DBHX 3I76A 4EG0A 2UAGA 4EO4A 4E94A 1ZK3A 5CA0A 5B4TA 5CH8A 2ZIGA 2HA0A 1XZPA 1H6DA 1C41A 1NT2A 1TCVA 4FMCB 4XD7D 3W5JA 3NYRA 2PT7A 3WGNA 1YCHA 4OLAA 3ZXUB 2DLDA 3LVRE 3IP5A 2O2XA 2SICE 1VFNA 4E6PA 1SUIA 2DH6A 3DO6A 2KLHA 4YIHA 5E4JA 3MUOA 4KFCA 2D4AA 2OP0A 5LA6F 2AI3A 1E79A 2PL1A 5B1DA 1EX7A 3QUTA 4LX0A 4EHJA 1V96A 4JX8A 3OC6A 4BASA 4ZV4A 1LPNA 3KZNA 3SQLA 4RTOA 2R48A 4JVLA 5L45A 1VIYA 4PHFA 3T5BA 4WFKA 1QV7A 4AG3A 4BO6A 4Q7QA 1DAEA 1F4LA 4OX9Y 2H1HA 3EG5A 3ZZ0A 2C2KA 2AKAB 4F9TA 3GD5A 1BFKA 2CNBA 3DL2A 1AQYA 1QUFA 3D4PA 2RBGA 5BSEA 1MTZA 5KREA 1F48A 1U2TA 4EKEA 1UCFA 3UICA 2O8FA 1GQRA 1LWNA 2VXCA 2YWHA 4TQUS 1XDSA 2VEDA 2ZWAA 3DCYA 4X1YA 1ZIXA 2JVIA 1HDCA 1VCNA 2NTJA 4R1NA 4IKOA 2XT0A 1J7JA 2BEUA 2R7KA 3DQQA 3ML1A 4OQFA 5E6RB 3BTSA 3RYHA 3WMWA 5JAIA 5IKPA 1ECGA 3IPRA 3L9XA 3HXQA 4UXJA 4C78A 4F9FA 5G4KB 2HBZA 3DTTA 1MX9A 3C3KA 4G1BA 3IUMA 4KG7A 4M88A 4N7JA 5EEHA 1G20A 3TQIA 3ZV4A 1PR9A 4JMLA 2R65A 2C8JA 4JLDA 2B61A 4MMZB 3EC1A 5ESRA 2P67A 3RRJA 1W8IA 2ABWA 1K6XA 3OEHA 3K0CA 2G72A 1AN9A 1OV6A 3ELWA 2W2VA 5HR5A 3R9XA 1NWCA 1SG9A 4UDXX 4ER3A 1XWIA 5JY6A 1GTVA 4N3NA 1ENZA 3RFCA 3RM3A 1ZXXA 4CW7A 3GDOA 3WIEA 1ST2A 2D74A 3ESXA 3U56A 2EARA 3T9DA 1TKRA 4RDXA 3THSA 3QU9A 4LF6B 4MS4B 4NDAA 4X3OA 3ZJYA 2G67A 4RKRA 1KEUA 4RU1A 3KV1A 2BSXA 4U9IS 2QRUA 5A5DA 1X7ZA 3IR5A 2GILA 1LVGA 3TCNA 4MW2A 4ENUA 5BW4A 2PMKA 3IJPA 1HZJA 4E1VA 1KSHA 2G7MC 3TTYA 1FU8A 3VRHA 4NEHB 3DQPA 1Z62A 2Z4RA 4NZMA 4UVEA 2F43A 3M3DA 2TRSB 1E66A 2UDPA 5AW0A 1HNWB 3QYFA 3EQ7A 1O94A 1Q95A 4R2HA 4JU8A 3FF4A 3K0CC 5T4EA 3KEQA 4YYEA 3S7ZA 2XGOA 2EYQA 4QPZA 4ZA2A 1ZESA 3JD4A 3V8NA 4I2NA 4PO3X 1RC1A 3E2MA 1KFKB 3HGMA 2VDNB 3CBQA 4MB6A 4ZD6A 1RQGA 2Z57A 1L6RA 2PGXA 2I91A 2JJ1D 3GNSA 1SUAA 1WD5A 2KMLA 2QD4A 4KVZA 3DTNA 1ZSYA 3QEAZ 1M33A 1L1FA 5CTJA 1CZRA 1KL7A 1TZ2A 2R66A 3C43A 4X8HA 2PX3A 2W4IA 4FMBB 3UUEA 1MXHA 4L0MA 4A4DA 1ECLA 5I9MA 4FQ5A 3VQTA 2PX5A 1XCGB 3DWIA 1R74A 3OECA 4LYDA 3UCXA 5B4VA 1VJGA 2AOUA 1VI6A 2GBCA 2ZSIA 2WNIA 3T4EA 3IIKA 2AVDA 2UXDB 1IWPB 1FVFA 1PNTA 1DBQA 2WLTA 3G2QA 4IIXA 4B6EA 1XF1A 4R2XA 2NUTB 3U09A 1CQWA 5KNBH 4XTCS 4IDAA 1QQTA 1U0FA 3BQMB 3FPJA 4OSPA 4LOLA 5FWXA 2ZSDA 5K09A 4LZJA 4O2BF 4JBLA 3GZNB 3FWKA 4OHYA 1U3FA 2WKRA 5NLLA 4EAQA 5FOSA 3PIDA 2L18A 3F9RA 1KERA 4G4GA 1H2AS 1T5BA 4JXZA 5JVDB 4FM9A 5IW8A 1EZ1A 1NRXA 2OOKA 3BMOA 2HLNA 3HXOA 1FTNA 4MVYA 1BHJA 3LE8A 4FNMA 1R50A 1N7JA 2W2LA 1NVMB 1UR5A 3L0PA 5FDFA 3ICEA 2ZRIA 4B81A 4RHEA 2GZ3A 3LPDA 2NVUB 3INTA 5IDXA 2PAFA 3R3UA 4QBKA 3D7RA 1FFSA 1UBJS 5CFRA 3INGA 3THXB 3DD5A 4BTEA 3OOJA 2O48X 2GHIA 1D2MA 1UBHS 4E1BA 2JFHA 3KLNA 4GYJA 1YIDA 2BFEB 4XTRA 2BJVA 3UMYA 1Z5ZA 4LDQA 3I1FA 3OQ1A 5J2TF 1Z9BA 1F2TB 2CXUA 3CUSA 3DEJA 3S2YA 5A6VA 5CX4A 3WK4A 3VU9B 3GEIA 2N47A 4B3IA 5HKBA 1VCMA 2XWJI 1ZOSA 1LLDA 3QM1A 4KOAA 1TUBA 1RKQA 4RPLA 4BN0A 2EAUA 1RHRA 1TM3E 2L42A 4QBIA 4RY2A 3W7VA 5HIJA 1TEVA 3EE6A 5K0LA 3D0RA 4ME6A 3MGCA 2D8AA 2JG3A 3O94A 1QHIA 1GUAA 2CYCA 1ORHA 2HUPA 4YRPA 3UMSA 3EW7A 3UT5B 1RM0A 2OZPA 3BMOB 3IP9A 4RKEA 2IEDA 1IZ8A 2O3TA 3QPUA 1ZAKA 4KN8A 1H6BA 1WDTA 2DUWA 4IX9A 3RODA 4ZYLA 2I8AA 4GBED 2PXHA 4OXRA 1H2BA 4WFIA 4O25A 3OCUA 2XQFA 3HCBA 2OV1A 1PZGA 1R9GA 1TI7A 5HS6A 3C3PA 5CPBA 2Z8ZA 3A05A 1K7YA 1OX6A 1A9RA 2R6ZA 2V4ZA 3LHIA 4YRQA 3SXUB 2JIMA 1U9IC 1L7DA 2Y1DA 2CYAA 4RD6A 4IDGA 1XLTA 1VSTA 2O2SA 3ESCA 4L28A 5H02A 4NE9A 2CXPA 4JGIA 4BTVA 2IUFA 4AI6A 4RZSA 1EM6A 3JYLA 1IY0A 2JD0A 1XZIA 2DUMA 2MSDB 4TXLA 1OAOA 4XJXA 4PN7A 3L84A 2QL5A 3FUWA 5C7LO 1EUYA 3CR7A 4KQKA 1N32B 5EJEA 3I2JA 1MD9A 1L8XA 1U31A 5CVJA 3PGLA 1SAYA 1N25A 5K0ZA 1KEZA 3RAGA 1YRBA 4KIFA 4REQB 3S29A 2PH5A 3V4OA 4HLQB 4JY7A 3WLOA 5JCXA 3R3JA 4ACAA 2COUA 1XVAA 1ZIYA 3EZXA 1OU0A 4PZUA 5DNEA 4OUDA 2JJ8A 4QVGA 2CXNA 4JEMA 4G0MA 2ZJ1A 5T4HA 1L5LA 3H9QA 1L8AA 4C04A 4LK2A 1CNEA 1ESMA 2ZRNA 2UUPA 2JAPA 2NSLA 1XTIA 3NW9A 4F3NA 3EPHA 2OBMA 5DXAA 5CR9A 3AOEA 4WESB 3FI9A 1NYRA 1HYQA 2ID7A 5TARA 4ZEVA 1WXFA 3AUUA 3H05A 3FMGA 3H42B 5CLLA 1C9KA 3E84A 4GKVA 4DMCA 2XUZA 4YWHA 1CP2A 1IJKA 2GDZA 3UPUA 5DBFA 3N39C 3RT1A 4C4XA 1Z0UA 1LZKA 4K1XA 3QX3A 5A2GA 3BH7A 4KN6A 4Z3OA 3GQVA 4NBRA 1EZZA 4IH9A 3VVMA 5JJ5A 3UM9A 3DE7X 2QDXA 1HX7A 2XF2A 3ESZA 3RUDA 2YN2A 2YRXA 3SC4A 3ZU5A 5GMOA 2GM5A 3NRJA 2XYHA 3CH4B 4W63A 2WZCA 5DHSA 4QAQA 3H1GA 4DM7A 1HE4A 4KL8S 3GPDG 1BRMA 2C00A 4I1IA 4W1PA 2XPCA 3LLVA 1E5DA 1JX6A 1VSUA 2OFPA 4UU7A 5JD4A 4W5OA 2E4ZA 2VYQA 4AJLA 3P2IA 4HX2A 2D7CA 3MAAC 3O1JC 1QF6A 3QY9A 3BFJA 4MR8B 1JFRA 4IBOA 1I7LA 5CX1B 3LWZA 1NUUA 5DDIP 4KIGA 3T5AA 3FAKA 2I29A 1KJIA 4TKUB 4DSZA 4L4ZA 4URUR 5MN4A 1PNRA 1DUSA 5BSFA 3A32A 2EBHX 1KH1A 2EKPA 2R79A 4EDFA 5LXTA 1UAGA 2WJPA 3GFSA 3MGKA 1R9JA 1T6NA 4MCHA 2HIMA 1XLTC 3B60A 3ESRA 2AJ8A 3EXEA 4YI5A 3VR5A 2ZJ6A 2CSXA 4B2LA 4KO8A 2W2QA 1L1RA 1JWAB 3NWJA 4Z51A 1XDDA 2HXYA 4UM5A 5I5EA 3JD1A 1UQUA 2I4IA 3THRA 3TFWA 1C81A 2NPIA 4CR7A 1N6HA 2VDOB 2FH5B 1GPH1 3T7AA 3R8CA 2BC9A 5BW8A 1QE3A 3F47A 2OXCA 1KY5A 1OWPA 5G53C 1ST3A 4FDUA 4S1NA 3MA0A 5IAOA 3I6MA 1U2DC 4YMSA 1AKEA 3Q9NA 4IDFA 1U02A 3CT4A 3ZH2A 2BM8A 2C84A 3F6SA 4QUAA 4B3HA 5BSUA 3ROXA 1R16A 4NZPA 3RH0A 1JT2A 3RU2A 3T1YB 1A95A 1CLEA 1JALA 3PC2A 4DCOA 3F6RA 4IGKA 4K7JA 2NUBA 5KJ1A 1JXMA 1WMDA 2CNOA 1Z45A 3EWNA 4KIWA 4TTRA 3VUEA 7ABPA 4QVIA 2GPBA 2X2OA 2IODA 1SHKA 5IYZB 2XI4A 3BSSA 4LXIA 3I83A 2Q21A 3EXFA 2J7PD 2AQHA 4V1CA 2JCVA 1Y9AA 4XB2A 3PFCA 4WVFA 1PVDA 3E18A 3ROFA 2RH5A 1R10A 1XEFA 2Z8YA 1VXRA 3BA1A 3FIUA 1XCPA 5CDTA 7MDHA 3UPDA 3G7NA 2G82A 3KOXA 4KX5A 5B1EA 2QN9A 2OAEA 4UTOA 5AM2A 4OXKA 1RKVA 1JMKC 4Z2AA 3KTDA 4TGLA 4TTPA 1CB7A 1DOAA 5GJCA 4K87A 1YVUA 4RS3A 3PXAA 3RCBA 1E6CA 3UWSA 3VH4A 4JX9A 1QTRA 4R9UC 2G17A 3PF8A 4L6IA 1YWGO 1T3ZA 5WRFA 2ARKA 1IULA 1LJUA 1AK9A 1E6KA 3JR3A 3PNBA 2YXBA 4AG6A 4UOEA 1C0KA 2JGEA 3U3DA 4YXWD 5C3MA 1YKFA 3UUGA 5HSGA 4BAZA 5KQGA 2Z6UA 1IY9A 3JQQA 1NBEA 2AOWA 4CKEA 2JJQA 5TPZD 2AOXA 1C4WA 1DOZA 3K05A 1S9DA 3BWVA 1ZM7A 4H0NA 2PMDA 1FSZA 2YHSA 3MYYA 4ALMA 1ZVKA 2WYVA 3HDHA 1J2RA 1NZFA 3BH6A 4EFKA 3BFKA 3QWIA 1PT7A 1DI0A 4XVHA 3UHAA 3CEMA 3DDZX 4XFJA 4XSHA 4YX9A 3FWYA 3P9NA 1GVHA 4DCMA 2V5UA 2OV4A 1MQ8B 3HB4X 2QTTA 1RBZA 3WWOA 1V37A 1E2QA 2C2YA 2VSYA 2A9VA 2XTMA 3EFOA 1QR2A 4IVNA 3QWBA 4IV5A 1F4PA 3MTAA 2HSWA 4C3OB 2IY7A 4EHIA 3KFVA 2G6TA 2VSOA 2YVKA 1JZQA 2A1UB 4KFTA 4N12A 5JROA 2QRGA 2AD5A 3Q41A 4B2YA 3QLVA 3AR6A 1QP0A 3K6SB 1CUIA 4FFWA 2BFAA 2YOGA 5DOVA 4H7FA 2DLNA 4KQEA 3D6HA 3L2OB 3PZRA 4CLEA 1P91A 1XFAA 2XTJA 5FA5A 4ZIRB 4LVCA 3HJCA 4OJMX 1RRKA 4IIGA 2C07A 3AO0B 2BWJA 1KR5A 1C0IA 2M6LA 1TC1A 2OXTA 4FBGA 3W6ZA 3LYLA 1AURA 2XZDA 1O9GA 5E3JA 4F1JA 2BFFB 1OLSA 1K06A 1LKZA 1ODTC 4TYPA 1ZMOA 2I7TA 1E1NA 1T8UA 3AR8A 3DKKA 4YQFA 1T10A 5CXXA 2EWWA 3FCOA 4KSCA 3GPCA 3CGGA 3WRXC 1BWRA 3WIDA 4F1WA 1E6MA 4EJ0A 2JAHA 3AILA 3AHDA 2UVQA 2ZYRA 3K5IA 4QOSA 2H2IA 5F1KA 2BPOA 4MCIA 3YASA 1WWKA 1PU2A 5BR8B 4UDYX 2JIOA 1QH1A 2Q4TA 4JUAA 3DCNA 1J5XA 5FWYA 2K7ZA 3I1IA 4MWZA 3B2QA 1ZYUA 2GERA 3LT4A 3T41A 4BNFA 4QDOA 3LPNA 1OZFA 2JK0A 3GCGA 4CHTA 5MGBA 1CEEA 1SQFA 2G7ZA 3H5RA 3UATA 1JFVA 4Y2TA 3VAAA 4WECA 4UHHA 1UDCA 4YCMA 4C0LA 3UB3A 1XMOB 4PTYA 1E9VA 3EIQA 2V98A 1I6KA 2Y2VA 1K9VF 3Q1LA 4P53A 1KIMA 1VCOA 3CW8X 3N28A 3MILA 4Q03A 1Z82A 3W9UA 1BE8A 3ZIAA 1O6ZA 3DYIA 5BN3B 1D2RA 2O2YA 2GF2A 3GGJA 4OGGA 1QFJA 2DPYA 1CNFA 2GRJA 1EM8B 2GTIA 4MEJA 5HILA 4B32A 1D6MA 1DKPA 3BDAA 4ZYVA 4F2HA 1YB5A 5LMUB 5KNLA 3ADPA 1BVHA 1CZNA 2PY6A 2J3JA 4W5HA 4JU9A 3KYBA 4BQOA 5HQ3B 3D6FA 4R98A 5CTAA 5A4FS 1JEQB 4RF4A 3WQHA 1BE1A 1C0PA 3B3FA 2PK3A 3TNYA 1RHJA 2X1HA 2RBKA 4JC5A 4HB3A 2GAFA 3EQZA 3R9WA 2VAPA 1SCUB 4ROSA 1YR1A 1RRMA 3EF0A 4C0KA 3P9IA 3S55A 5IHPA 2VLIA 3P96A 4GXQA 1H6CA 1PBTA 2P2GA 2V6FA 2ONJA 4LECA 5F1OA 4CCWA 1TAGA 4BXOA 4K9NA 1D1PA 2O4UX 2WG2A 3I28A 4KDEA 1GVNB 2CDRA 2C2XA 2E9SA 3K31A 3ICCA 1G6KA 1AKQA 1Q15A 2G76A 3TRDA 4B6FA 4PF1A 2WIDA 4HQRA 1O58A 1IBKB 5I8PA 1L3CA 1W4AA 1WOYA 2Q3CA 1HEUA 3L8EA 4ANFA 1U8XX 3PKZA 4C0QC 3E15A 1JHUA 3GVIA 4PPNA 2IDJA 4A0RA 2QDKA 5DI3B 3EGXA 5HIAA 2XCOA 3UC5A 4JJGA 1NBMA 3CF4G 2OFFA 3AEXA 3Q0TA 4WY8A 4RY0A 4MQFB 1W0JA 5BR4A 3WRXA 1NNI1 3OHPA 3WKCA 3HK2A 3FSGD 4RGVA 2NSHA 3EQ2A 2PDAA 3EDYA 3IHLA 4KMOA 4LMAA 2WWXA 2NSJA 3BD6A 2W6MA 2FZLA 5H9VA 5LA6A 3RIEA 3MHTA 1P75A 1XJQA 5IRCD 1NV9A 3R5TA 1XQ9A 4K6HA 5J2TA 3UJHA 4NMWA 2YJ6A 4PQGA 2FQWA 4HO1X 4N8SA 3TWOA 3IEPA 4LZZA 1GA4A 2L2QA 3QHAA 1L4GA 2GI4A 3DL7A 4GWLA 3UANA 5KX5B 2AGVA 2RHJA 2OD9A 4IJ6A 1FU4A 4RJLA 3PG5A 4OMUA 2UYCA 1G8HA 2B25A 3IL2A 4R8RA 3GWGA 2HLPA 3GFPA 4FSHA 2A6PA 4RK6A 3HNRA 4KXXA 3Q1KA 2VDMB 2ZSFA 4QHTA 3RT7A 2J9FA 3HFRA 4AJ1A 4BO1A 3ND9A 2WD7B 2W42A 2C5GA 3L92A 5KAMA 4R51A 3ZJVA 3EULA 2Q4BA 3U3MA 2VT2A 3IBCA 1TUIA 4NU8X 4IJMA 3GUYA 3LWBA 1CRLA 3D6MA 4RVUA 4M1OA 3MWGA 4KXNA 1E2BA 4BFVA 3OF3A 2ZBGA 3SOPA 3OEED 3C3BA 3MC1A 3RBAA 3LUGA 3RKRA 4E5VA 3K0AA 4ZYXA 4DGSA 3OTOB 2QW1A 1DG9A 2IYSA 5KOYA 2YHBA 4CTKA 1SHJA 2FQXA 4FYKA 3VJLA 3T0GA 3X1KA 3D8RA 3PNYA 4WE3A 1K4KA 4NE7A 1ZMTA 1UBNA 3RSOA 2F1JA 2X1LA 2IUSA 1OBHA 1FNSA 2NAFA 3GGPA 1JSZA 3H84A 4Q3LA 2Z1DA 3TJMA 1FTGA 4CLRA 3P2YA 2W37A 2FZEA 5E0OA 3ZY5A 1EFUA 2ZAMA 4A1FA 2H4ZA 3D3NA 4B0PA 4DV1B 1KKUA 1L5SA 3ZWYA 2NX2A 5BRJA 1W36C 1PS0A 1EKXA 1S2DA 3QFRA 1F5NA 3A9SA 4RIFA 4TVKA 3RUEA 3ZGOA 4AJ9A 2FW1A 4O5AA 4MW4A 1GZ5A 1K6MA 4FDAA 4U8GA 1EDZA 5CJJA 1JMYA 4IIYA 4POAA 3ANLA 4MA5A 2AQ8A 2LP4Y 3FMVA 1THZA 2YZMA 1KY3A 3QU2A 2PD4A 2ZSHA 4EQ6B 1NMQA 2BM9A 2NTEA 4L74A 4UVGA 1NMSA 1DT3A 1NYTA 1H1DA 3IPAA 1FFGA 3JY6A 5COBA 4HLNA 2LD4A 3OT1A 3PPVA 5DNAA 4Y2PA 2JLVA 2PJUA 3REFA 1FXUA 1V1RB 4PLZA 2P41A 3P8ZA 1FTWA 1TECE 1FOEB 4YVFA 1JBQA 4ARAA 1X92A 1HTWA 4TZ6A 1I2CA 2BTQA 1IG3A 3NNNA 1UODA 2F43B 2DECA 1A5SB 3WADA 1H69A 5BV1A 1W94A 5J58A 4DNXA 3B70A 4JVOA 4BUCA 2C5SA 4RGQA 1SKBA 3VTFA 2QN3A 1NBME 2GN2A 2W43A 3NVMB 4UVHA 5J5VA 1R6TA 5BURA 3ZZ1A 4C7BA 1KI8A 2PEZA 2BGJA 4N49A 4TKVB 5H59A 4AW9A 2FX3A 3DO8A 1AQUA 4L9RA 1GSHA 1EK1A 1E2HA 1M5TA 3E9EA 1OH7A 4JLUA 1FB5A 2NG1A 2P2ZA 4JR1A 5TQJA 4L16A 1ZFNA 3N8NA 3OFVA 4ZDIA 2P6NA 1D6JA 1E96A 3MB5A 4RLQA 1A8PA 4GMGA 2XWPA 3LA6A 1ZWLA 3LZ6A 5HM6A 3TH5A 1JJVA 2VATA 1HBJA 2WKWA 5FA8A 5K6AA 4Z0NA 2QU8A 3WHPA 5ED4A 1V6SA 3OPQA 2HPHA 3GEEA 3JVVA 4KC0A 3QITA 1P5ZB 2RI6A 3C41J 3JATA 1VLHA 4QFMA 1JT9A 4OFXA 2VAXA 2Z0MA 2H2DA 2HRRA 4CMBA 1V5EA 2XH8A 1GAQA 2FLKA 3QMVA 4FR2A 3SM3A 1D6SA 5F35A 4BNDA 4DYHA 4QUKA 1P33A 1VDMA 3KJXA 1RPTA 4NCXA 4DCUA 1JU3A 4DAEA 1KAQA 2O2HA 4YROA 2DFVA 2QVXX 3GJZA 1Z16A 4QULA 4MEAA 3A6HA 3KOYA 3STVA 4BPBA 2WUEA 1ADGA 3R5XA 1SCQA 1SVSA 2BEVB 3ONVA 4OQ4A 5ADHA 3PGJA 1VECA 3SIXA 2HCFA 2HTEA 1I5RA 2IPLA 4IDDA 3FWZA 4F45A 2VJAA 4GXTA 3LLUA 1J0CA 1ZRSA 3K32A 4JLJA 3C3YA 1GAWA 3VDMA 4AWAA 2CN1A 4YP6A 2DETA 4YQZA 3OCVA 3EWAA 1TTQB 3CNQS 2NUAB 1QHFA 4ZOLF 3WB2A 8LDHA 1PFQA 4N0QA 1ORDA 1PZEA 3KSDO 3QEMB 2CL5A 1VYVA 2FYTA 3DDWA 3GO4A 3LSTA 3WNZA 2DHEA 3TOCA 5TF0A 3GCDA 2FJ0A 4X6LA 3JW8A 4ZVOA 3B7PA 1G21B 4O4IA 4HG2A 4LI0A 3IEUA 3GIDA 2XUPA 1T6YA 3ABQB 2K7FA 4KU4A 1CY6A 2VNIA 1KDRA 1NSTA 3AC0A 4E5UA 5A3QA 2MTBA 1MDBA 3KR0A 2DBZA 2IA5A 2PBLA 3QA9A 3OD1A 1D5WA 1WM1A 2R6FA 1EGMB 3L07A 5C0OE 4MLZA 3C97A 5BRNA 3IURA 5CD1A 4MW7A 3U37A 3BGSA 5AKJA 5IXSA 4XGKA 1CEQA 1E1RD 4OHOA 5CYFA 3QU5A 4AY3A 4R1QA 1XTBA 1HOXA 3C8UA 1QRTA 1GWNA 3CNNA 2FHSA 4KWTA 2I3DA 3C5HA 1A72A 1BROA 4P08A 3BORA 4OXQA 2H11A 5ERYA 1GV1A 3H1TA 1SOWA 1E1CA 1FJGB 1CUWA 4EKNB 3CB2A 1IVNA 3CKYA 1YS6A 3FVVA 2DH5A 4MWGA 1TJ3A 3UV3A 1IONA 1WZIA 3LT1A 4GX0A 2AK3A 1L8QA 4BQNA 2F1IA 1C8VB 2PBFA 3QG1A 2ZB7A 2A0WA 3BB4A 3TD2A 2J59A 2YZKA 3AHEA 3HKCB 1PWHA 1PQYA 1SUFA 3AOGA 2I7VA 4QPCA 3OOWA 1RMQA 2D2EA 4ZJPA 1T2VA 3P52A 1DQZA 4ZRDA 1SBTA 2WOOA 4KI7A 2G3YA 2YJ4A 3AJDA 2QVYX 3IMFA 4IYRA 4MW0A 3AQ4A 3CWCA 5LU8A 1JG1A 4DBLE 5K0FA 2NV0A 5H8WA 4HVLA 1G5QA 2PLNA 1MGOA 2W4QA 3A9TA 4BO3A 1F0PA 1YDEA 4YJDA 2PZ8A 1EQ2A 1NE2A 1Z35A 4N65A 2I4LA 4BVAA 2TMKA 3CZMA 2AEFA 4C2AA 3NHWA 3NLLA 3CKLA 4UOZA 4KR7A 1ZKDA 1ZA1A 3UJDA 4BNLA 1KOJA 4OD0A 2EU8A 1XALA 2ECFA 2REQB 2O8DA 4UAJA 4D3SA 3IMCA 5DK4A 4NBUA 3AFHA 4GAEA 4OHMA 1LDYA 1QO9A 3FAZA 4OKIA 5F64A 3IUSA 2QS9A 3G0DA 4RTMA 1CUGA 2PHZA 2PUVA 2QK4A 4PG6A 2VPTA 2J6IA 4UUMA 2J3HA 5IABA 3MUEA 1SXJE 3KZOA 3OESA 1USVA 2FUKA 4EIWA 2V1UA 1BO6A 4S2UA 4GSYA 3OZRA 4KRYA 2DWOA 1N75A 4G24A 2ZWVA 4F2DA 6AT1A 1MW8X 4HB4A 4MVJH 2IGTA 1QGAA 1R4ZA 2PWPA 3JQDA 2AA3A 1D1TA 2OORC 4RUKA 4CV3A 2WTMA 1CUAA 3QKSA 5BUQA 1EESA 1OXBB 1FXWF 5H4HA 1MEJA 2WMNB 5GIOE 3H9EO 2Y1CA 2ONCA 4JP8A 1W85A 1WHTB 3CEAA 3CF6R 2NXWA 1BE6A 4JQCA 4K6KA 1XUOA 4AFNA 3J7TA 4U6NA 2A9OA 3M7IA 4JOQA 4A8PA 3RO7A 2CJWA 3FFAA 4IIEA 1XDBA 1Q19A 3RF6A 1H93A 5L53A 2X14A 1XRJA 4FGJA 4PR0A 4OMCA 2ZJFA 4QRIA 5T3UA 2Q6OA 2R60A 1YOBA 1FX0B 4RENA 2EG5A 5CA1A 1RJEA 3DLIA 1SC3A 4BN4A 4J1QA 1R15A 3KHKA 4CMJA 1TM2A 4COOA 1PLKA 4G5YA 3PNOA 4NP6A 1YU6A 4WJKB 3EAQA 5FBWB 4RKWA 3SZRA 3VYUB 3N86A 4AMZA 4A91A 2HDOA 1M6WA 2PX8A 5EMLA 4MVJF 3BM5A 2BKUA 4DCSA 5CIYA 5KDDA 1GKLA 1ADJA 1SXJA 5FQNA 2AR0A 3BCUA 3OM9A 2ZI3A 1LX7A 3NZEA 2YV3A 3JQ8A 2YX1A 4GOOD 1GU0A 4U00A 1W1UA 1I3NA 5HKOA 4GKKB 2ZPTX 1Z29A 4B71A 2HMVA 2RHMA 1RR6A 4KZKA 4TXHA 2XRFA 4G8CA 4CM9D 4BLWA 1ARZA 1NDUA 4MQBA 2Z9BA 4H0CA 4ITRC 1ZGJA 3U61B 2OXRA 2MOKA 2OQIA 2NYUA 4WBNA 2GWRA 1N2EA 2AW3A 5DLPA 4CKCB 4E03A 2IKQA 1NP3A 1ZI8A 3IEIA 3OZFA 5BW6B 1OA0A 2ATVA 4PYOA 1EFPA 4MRRA 4UM8B 1MT0A 1J90A 1UKVY 4KN9S 2RCYA 4ADSG 2RI0A 2GHRA 2H7VA 3EPRA 4P7BA 1UMCA 2JAOA 3W3AD 3RS0A 2YUIA 1T26A 5KDOA 2O3JA 4BZPA 4G63A 3R5KA 5CX1A 4GKAA 2RHGB 3OQOA 3U7GA 4RAOA 3CLTD 1RXSA 3V1NA 4PY2A 5G1OA 1N6PA 2GYYA 3EASA 2MR5A 3WYGA 3I5UA 2C29D 2LW7A 4O4IB 1KYYA 3F5QA 2GB4A 2I2XB 4HH4A 3ZC3A 2AMLA 2D1SA 2FMUA 3TRHA 2C94A 5JCZA 2O1EA 1GGEA 4NBKA 5KTKA 4EB8A 4YCSA 2AC4A 1B3BA 1VC2A 4GXNA 5D1NA 4PPQA 2NXJA 3CX6A 5B3LA 4C2TA 2OGSA 4QFDA 4NVRA 2E1RA 4G67A 5GIPE 1FQKA 3G5UA 3W4IA 2JRCA 4L76A 4RNDB 5IPFA 3RYIA 1JVSA 1T6ZA 1I0IA 3RB8A 5T67A 4BFYA 4QZVA 1T2UA 3FOCA 3P1JA 4OBEA 2QG6A 3AKZA 1UJ4A 3VHXA 1V47A 2RSLA 3UWKA 5JC8A 3ZCUA 3MWDB 3I9KA 2Y1EA 4WESA 4RMJA 1U7TA 3RAEC 1EM8A 3HLKA 4BQRA 4DL9A 4EYSA 5L6MB 1B8PA 1Z7GA 1KRXA 4B79A 2QTCA 2WT9A 3ENWA 5EWMB 4F3RA 1O8BA 3RBZA 5BYAA 3LUHA 3UXEA 1AQNA 3W5DA 4HXFB 4TTVA 1XELA 3EXFB 3JQAA 3D2BA 4YDSA 5EKUA 1DX4A 2IZOA 2EZUA 4S1WA 4RD1A 4UW9A 1OIXA 4PG4A 4JT9A 3GARA 5JV5A 1DWOA 2HXGA 3B82A 3DJYA 3ELDA 2WZBA 2FSHA 3IPYA 5M5BA 1FUYB 1I4OA 4PLFA 3RI3A 2RHTA 5HKLA 2FMIA 2OR3A 4K9KA 1B0AA 1DS6A 1KO7A 2V6IA 3I9LA 1KO1A 3HBAA 1E7SA 3MWJA 2HM7A 4LF4B 2QN7A 2XQIA 3QKUA 4J3FA 3T54A 3S8YA 3IEMA 1SKMA 4L4UA 3HY4A 4C7OA 1GU7A 4LTMA 3RIYA 5KBYA 4RH3A 1SXPA 1QYVA 2H51A 3E9CA 4L5CA 4WXYB 3EG9B 3UWOA 1A8QA 1N3IA 2A0KA 4HDKA 3O8DA 2CXRA 2F9LA 1B0PA 2X77A 1QOZA 2O9JA 5E3HA 2UVPA 5I7EA 3PQFA 3LC1O 1P29A 4BZXA 1T4CA 3AL2A 3P0IA 3W8EA 3PGVA 2CDBA 5H70A 3G1WA 3DAHA 5ALKA 1KAMA 1F8UA 4GX5A 2AN9A 3UJ8A 5E38A 4ZWNA 1EVYA 1JIJA 1Y6RA 1U9ZA 1DIHA 2NO4A 1XMPA 3PWSA 1XD2B 2GHQA 3B8HA 4QUEA 3T8YA 2G08A 3CMMA 4UHDA 1VZ3A 3BD8A 2BDUA 2UUOA 4U2DA 5BNTA 1V8DA 2VF2A 3UN1A 2EQ5A 4P4SA 3S1SA 1BNCA 4KJZA 4B47A 4OHXA 4OJTA 1YMQA 4XM1A 1QAMA 3T5MA 1B0ZA 3AEUA 4P38A 3DEKA 3BMNB 3D4NA 3TQFA 1PT9A 4XVQA 3TVDA 1QK5A 2EQBA 4X97A 5KX5A 3T94A 5IJAA 4PNEA 1JQKA 2NZYA 1J33A 2ZT6A 3L06A 4DUGA 5TT1A 1FRQA 4X60A 4RZQA 4KQHA 1VJRA 1TYEB 4HUJA 1XJ0A 2IGBA 4TZKA 1CIPA 2FXVA 1NAIA 4XQ0A 1I4WA 4X7PA 1LRJA