3TB4A

Crystal structure of the isc domain of vibb
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
205
structure length
205
Chain Sequence
IPKIASYPLPVSLPTNKVDWRIDASRAVLLIHDMQEYFVHYFDSQAEPIPSLIKHIQQLKAHAKQAGIPVVYTAQPANQDPAERALLSDFWGPGLSEETAIIAPLAPESGDVQLTKWRYSAFKKSPLLDWLRETGRDQLIITGVYAHIGILSTALDAFMFDIQPFVIGDGVADFSLSDHEFSLRYISGRTGAVKSTQQACLEIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vibriobactin-specific isochorismatase
publication title Structural insight into the ISC domain of VibB from Vibrio cholerae at atomic resolution: a snapshot just before the enzymatic reaction
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
total genus 75
structure length 205
sequence length 205
ec nomenclature ec 3.3.2.1: Isochorismatase.
pdb deposition date 2011-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3tb4A00
3O91A 3TXYA 3OT4A 4L08A 3TG2A 1J2RA 1XN4A 2B34A 4WGFA 4WH0A 3O94A 3O93A 3R77A 3UAOA 1ILWA 1X9GA 3V8EA 1NF9A 3MCWA 3O90A 3O92A 3R2JA 1NF8A 2FQ1A 3OQPA 3TB4A 4H17A 3PL1A 1YZVA 1YACA 2H0RA 3S2SA 3HU5A 3IRVA 3HB7A 4L07A 2WTAA 1NBAA 3KL2A 3LQYA 1IM5A 3EEFA 2WT9A 2A67A
chains in the Genus database with same CATH superfamily
2IKQA 3ICCA 4S1NA 2JHAA 4RTMA 1XKXA 1LNSA 2DVMA 3A4LA 4GLOA 221PA 3LDGA 4DLYA 1O95A 4P0QB 4FKMA 4I55A 3BMQA 4NOMA 4YR7A 3GXBA 3NOQA 3ZXIA 1JIJA 4XB2A 1B2RA 3PFKA 2NO7A 2D0PB 1JIIA 1QUFA 3MGBA 4YK7A 1PTJC 3BMOA 4N3BA 1T2UA 4Y1RA 2WJYA 5ULLA 5BYJA 2O52A 2HHCA 2FKAA 1J49A 3GO4A 1L5RA 2PKQO 1OILA 5CT9A 1FFWA 5DP1A 3CX8A 2UYCA 1BGXT 4KKVA 1P5ZB 2OL4A 4DJFC 1C1DB 1WHSA 3B5JA 3IV6A 2XA1A 3I64A 3AVYA 4O5OA 1KMNA 1CRZA 3B60A 4R8RA 2AA3A 1J2RA 1MRZA 2VCEA 3SE0A 3B1ZA 3RVLA 3QXGA 3E48A 3KB8A 1YSCA 2I3BA 4YRLA 1HEIA 1E9CA 4G5XA 2ZYAA 4I6GA 3IVCA 2DFDA 3DV2A 2FEWB 4N18A 2Y1OA 3RVMA 1CZHA 3MTBA 3HACA 3LWNA 4FMPA 4HDKB 4V24A 1JR3E 1KU0A 2QAGC 5DM0A 2P3LA 2FAXA 3PFIA 3PSAA 3B9QA 1Q20A 3DF7A 3LUPA 1NZDA 1SUWA 4PSCA 3U26A 5KNCD 1TMGE 1QX4A 5DWVA 2ZTVA 1YJXA 3B2EA 5BSMA 4EF5A 4MP3A 5FA8A 3K7EA 1BA3A 1L5MA 3QVKA 4XVUA 1XTPA 4CBVA 4G09A 3IAXA 1GTMA 3CGGA 4UFOA 2QN7A 5B53A 4J4BA 1L5VA 3QE2A 2X6TA 3QWBA 4Z86A 1ABFA 4GP7A 1RYEA 3EXIA 4DUGA 1VE6A 2Q3EA 3GAZA 2Q4BA 5AIAA 1VJCA 4IEIA 1C9DB 3ER6A 5E6RB 3WWCA 4K0KB 3QXHA 1TAHA 1CLEA 1FP2A 2W4MA 1R0ZA 4MYUA 4IVRA 4LXHA 4JJAA 5I7AA 1YJBA 1IXSB 2K6GA 3AJ9A 3RT9A 4CV1A 2P3QA 5CBKA 5JDIC 3NNDA 4DCNA 4DDHA 3MJTA 1UM9A 5EERA 4ZYLA 5AJZA 5EC8A 3SS9X 4HWPA 4IJMA 2YFYA 1Q1QA 1U81A 1VG9B 3HSYA 4YRJA 1AC5A 2ZYGA 1KP2A 2IXDA 5ICCA 3RADC 1XROA 4FS3A 1PYGA 2WIGA 4MIYA 1UPUA 5KREA 4OHVA 4B3GA 2HQSA 1DUVG 3CWQA 2JEOA 3JTEA 2GRJA 3L1VA 1JDBC 5EOVA 4G86A 4ZTUB 2HI0A 2KWIA 3DVLA 4M22A 1OU0A 1P7VA 3GHYA 4AG6A 2IX3A 4FFWA 4GBED 3IXMA 1H1LB 1OPXA 5ITZB 4LJ7A 4R84A 3WYDA 3BXEA 3FZQA 2MR5A 4YO8A 2I6XA 4C7MA 3FPCA 1M75A 3KT8A 4LBZA 5FNVF 4WAUA 2IBMA 2P6MA 5ESDA 1GCIA 5JYBA 3IOEA 3NG1A 4DLZA 2R6AA 5K7SA 4MS1B 1LX7A 1NBOA 4RDCA 4BO2A 4D9MA 4DB4A 3I76A 1I1NA 3L04A 4Z5XA 4EPVA 4YAJA 1J33A 3IIJA 3C8ZA 3NOOA 4OP3A 1XXHE 3JQGA 3N8DA 4D99A 2CT8A 3NBXX 4QXQA 1ECFA 3ED1A 2BM9A 5EWJA 3C0KA 3GOQA 3AUFA 5CPBA 5EMKA 1Y5NA 3ZDRA 3TTXA 4ENWA 1ZITA 3QKSB 4ZDKA 5DBOA 1J07A 3JRXA 3PUHA 4X7RA 3Q0EA 1NASA 4PONA 1QPGA 4X1YB 5A4MS 2QTLA 5ARDA 4NJOA 2QVBA 3CQ9A 5FPSA 5FJIA 2VDUE 2DT5A 3BE6A 5KVVA 1Y8QB 2ZIZA 4MUKA 2EBHX 3PGMA 4L0DA 4YXWA 1DKPA 2DFPA 3X1DA 5A02A 4X66B 4IG4A 4L73A 4MMXB 5JPDA 4KHPB 1ZRNA 5BW4A 2ZYHA 3KEMA 1KEZA 4FUTA 3I8OA 1TF7A 3KJFA 2ODNA 5IHPA 5KOJA 4G0WA 3P9ZA 1GPMA 3NTVA 3MJDA 3S68A 1EWRA 3UC9A 2X0EA 5KWIA 3E6AA 3FW1A 3GC6A 4PSKA 2H4ZA 4Y0VA 4QG3A 5D00A 2DUUA 2ERCA 2OV3A 3CPJB 4GQAA 4HUQA 4IWXA 4RMNA 1NJ2A 4R8MA 4Y7CA 5EZQA 3EWIA 1RYFA 4YRBA 4I66A 1T3TA 4ZDIA 3INTA 1OTHA 3QU7A 4R1SA 3GGSA 3E3NA 3C5CA 2NU6B 5IBCA 5MHTA 3W7AA 2HWUA 3AF1A 1LCIA 3ZWCA 4UE6A 5GPBA 2Q5QA 3BXXA 4BJ1A 1CT9A 4LFBB 4Z7OB 1O6CA 1Z36A 1PTJA 3CZPA 7AT1A 3OIGA 5B1IA 4D80A 2IHJA 1DV2A 4C06A 5BV0A 1IRIA 1QHHA 2QK4A 3B9RA 1BKDR 1UWVA 5GIOE 1B6TA 2FZKA 3TBKA 1XMSA 2FN8A 3KXLA 5CLFA 1EVQA 1Y6JA 1P60A 3ETEA 4KPGA 2EJWA 1Z33A 5EMJA 3LC1O 3ZU2A 4YRTA 1KC1A 1Q15A 1V25A 4EENA 2QJRA 3V1NA 3ZBUA 3TQIA 4EO4A 3I12A 4OHFA 3SZLA 1CJSA 1E5TA 3MCTA 4YIKA 4V03A 1DWPA 2LXNA 3UH0A 3NR2A 1D0VA 3IP3A 4BFYA 5K03A 5KJFA 1W85A 3SF8B 2FZVA 2GPBA 2QAGA 4WNYA 1JBQA 4TTIA 4ATNA 2ORIA 3ZXXA 3VJKA 1ZSNA 1Y7TA 2NTVA 4Y6QA 5CM9C 2PS0A 4LJ9A 1IEQA 5EQJB 2VZ8A 1CFZA 1Z83A 4GF5A 4GPTA 4M3NA 4JI3B 1NQTA 4JOSA 3RT1A 4E0BA 4NZPA 4CUJA 1Y37A 1KFBB 3GPCA 2G06A 5FI3A 4F9FA 2VNHA 2DGDA 3C7AA 1LS1A 4INAA 5CFZA 3U7HB 1KQFA 3PQDA 4L5CA 3B1JA 2PH1A 5DNCA 3JD4A 2FR8C 3EPJA 3L7YA 4QGBA 1V7QA 4IV0A 1PL8A 2O48X 4HDSA 5CFQA 4M88A 4Q21A 2IY7A 2QXYA 4MR8B 5TEWA 4KXVA 3UCXA 2ZB4A 5JDIA 1SU7A 2UXBB 5IH3A 3RJ9A 4EDFA 1UXKA 3LY9A 3ROQA 2VAWA 3A6LA 4ZCTA 3NYIA 4NCXA 1BH6A 3KHSA 3VTFA 2X5XA 4EG8A 1ZM9A 2FJ0A 3VR2A 1QHEA 5HRAA 5B6JA 3R75A 3THXB 5BQ3A 3CZCA 2P77A 4U7GA 3KQNA 1VLZA 1G42A 1YUMA 4YMUA 1FW6A 4WBXC 1XCOA 2EEZA 3K6SA 1XT6A 4GPAA 2HMTA 4QRHA 1S02A 2D06A 3IERA 2WWIA 2OD2A 2QJWA 3G8DA 3K5WA 3WQRA 1VE7A 1EIZA 4G85A 1SG0A 4D1YA 3L41A 2NUAA 5IFLA 4FEEA 3FHLA 5IC5A 1DRVA 4F38A 2O2IA 4OI0A 2IUEA 3R8CA 1X8LA 2C82A 4EFNA 4XDYA 2NO9A 4X20B 4KAAA 4RHYA 3MF4A 5EG5A 1KXZA 3H9UA 5KWVA 4JXXA 1WP9A 4KL8S 4P3OA 5FO1A 2G17A 3ILVA 4AXXA 3LUDA 4DMHA 2RHRA 5IZ4A 1NAHA 1US8B 4I99A 2AGVA 2V58A 4IL5A 1UKEA 3W2IA 3V1YA 2PMWB 1OBFO 3OBBA 2X8BA 3QE0A 3VPHA 2PUFA 4MV4A 1KO5A 1RIIA 1SVSA 3F90A 3GDHA 5SYNA 1DCFA 4XX0A 5GGYA 2XT9A 3HP4A 4TMVA 3UT0A 5I3CA 1JWBB 5HGJA 1VG0B 5KTTA 3TI7A 2PXHA 2NAFA 3QPVA 4KE6A 2JRLA 4A6PA 1PX2A 2Q46A 2QW8A 1B0AA 2XEDA 3PS9A 5AFSA 4NFSA 1SKMA 3IRUA 2VDWB 4REOA 1EM6A 2P9BA 1W47A 2BMWA 3HA2A 1E1CA 4EI9A 5IFKA 1AK2A 1M1YB 4WCFC 3CV3A 2JLZA 1KYYA 4X7BA 4LXUA 5TY0A 1J5PA 2UKDA 2OZVA 4ZVRA 3JPWA 3DMPA 3I52A 2NG1A 3H9EO 5BR7A 4MWBA 5HUJA 3BIJA 2PNFA 2XCLA 5I7FA 3PDWA 1JDJA 1EGAA 1QYXA 4HB0A 2QI9F 5JE8A 2FPXA 3FPBA 4C30A 3EGEA 2OV6A 3D1LA 4TLCA 5BURA 3OLVA 4W5HA 1YUNA 5DCYA 4RJLA 3HUTA 4MI9A 1EX9A 2MINA 4RV4A 1JHRA 3I5AA 3A6KA 1RYDA 2NLOA 1L5WA 2YXDA 2QUBA 3RVSA 3RFTA 3AG6A 1P1FA 4EW6A 5FH9A 4AKGA 3EUEA 4KU4A 5A0FA 1NXPA 1ZU5A 3DEYX 2VO1A 1K3FA 1WCV1 1L5ZA 2FHPA 3NBMA 3O4IA 3OICA 5K8CA 1UC4B 3FOZA 3HWRA 3AFHA 4ZTBA 4KSBA 1JFSA 1PTKA 2XCQA 4RCZA 3S2FA 2BSQA 3DXZA 1I3KA 2O5VA 3JQDA 3VU3A 2HQBA 4MWSA 2G4LA 3RIMA 1WLYA 1QQ7A 2EW1A 5BQOA 4RVFA 4OMDA 4BVBA 2H4XA 4O2BA 3A10A 4NOLA 3RWMB 1XU9A 2ZUFA 1YK1A 4DGSA 5CD9A 2IH4A 2X76A 4F6CA 1ODLA 1V26A 3T1OA 2ZG6A 3GJ0A 3ESRA 5EWLB 2IYQA 1Z5OA 4WDRA 4U9IS 2YFKA 3HU1A 4QDXA 1P7YA 2H57A 5JU6A 1BEZA 1KARA 5BNWA 4RK5A 3F1LA 3N6RA 3GUYA 1HX7A 3MTEA 1ZM7A 5K8IA 3KELA 1C8BA 1J20A 1HPLA 3OZSA 2FG6C 1I1HA 1RLTA 1MGOA 3GEGA 4BQFA 4F96A 1P4SA 4B3RB 3DVRX 1GNPA 4QLAA 3U49A 1GGEA 4CRWB 1H2XA 3AL0C 4Z1MD 3FROA 2H1WA 1FUIA 1LV7A 1HFEL 2Y76A 5A6SB 5K9ZA 1OH5A 1TZJA 2YRWA 4QM6A 1X92A 4RGBA 3AI3A 1EFLA 2FWIA 3TW8A 4HRXA 1BW9B 2EEPA 5JAZA 2H1CA 3CISA 5TT1A 2CUTA 1Y5IA 3KQTA 4MIKA 2VQSA 1RAGA 3FVQA 2QUZA 4ANFA 1XDGA 2FR8A 2P1RA 3WIUA 1W36C 3OU7A 5B30A 2QRVB 3IELA 4EFMA 1C9YA 2WB4A 2CNBA 3HCRA 2PTGA 3NBKA 4RELA 4ZEVA 5JEDA 1I5RA 1OLXA 3UXHA 4HK4A 2NN3C 4CL0A 2CLMB 1NOKA 3DGFC 2CLEB 4TYQA 2WYUA 2OV2A 1ADBA 2XYHA 4HGPA 5BW8A 1PNRA 1HYGA 4CT0A 4DMRA 1NQAO 1IBSA 1ULBA 3LRPA 2H08A 4NZOA 3ONDA 3Q9UA 5DTJA 5EQDA 1W5TA 3OZTA 4JBGA 5GONA 4E51A 5C37A 5F76A 4ND4A 2RB5A 3FNFA 1IHYA 1MVNA 3C6KA 2ORVA 3O3NB 3OPVA 2VYND 4GT1A 3NDBB 1CUSA 3ROMA 2PFKA 3RU3A 4HWRA 1JQDA 2CVOA 3C98A 3VPGA 5DHSA 3TRDA 3NBZC 1V7ZA 4ZREA 3VSDA 1U65A 3N6VA 3IQHX 2DH6A 3IPYA 5CLIA 5E8RA 3M33A 2XMQA 1E0SA 3PQ8A 4HQ0A 4ARVA 1SGWA 2XUKA 1PJTA 3AH8A 2JGFA 1H2YA 2HC9A 2XD4A 3BHIA 1FTQA 3ETHA 2DCUA 3OP1A 5AOAA 1Y82A 3KXIA 3DZ8A 4KH1A 4KVZA 3SC2A 5CFRA 2C2XA 2WMOB 4R7GA 1L5YA 5EIAA 3MFQA 1QF7A 2HBQA 2E21A 4O4JA 2ADOA 3K8YA 2H5JA 3ZZMA 1XV5A 4I81A 2EW2A 1MB9A 2LUOA 4Y0AA 1EAYA 3IV9A 2BJHA 3NW9A 2OVFA 1C3JA 1NIPA 2H9IA 2ZUBA 3BH7A 1L5QA 3FFWA 3H2SA 3ONWA 3PLRA 4PQYA 3TCNA 1LBIA 1T3GA 1TD1A 1NBMA 4JITA 4MVJP 5JNRA 2NWQA 3U3JA 4ZYTA 4J2TA 1LFAA 3N0TA 4TMFA 1IUPA 3BWBA 3ZC3A 4WCFA 3O4RA 1PLKA 3I05A 3EG9B 3AFGA 3GGCA 4WNAA 4MDEA 3SYRA 4DEVA 5F1KA 4KFUA 2A4KA 1P17A 3DC2A 3OETA 4HPWA 2OBXA 1WY5A 5J59A 2WBLC 1WRBA 1H6BA 2G72A 4QQ8A 4JEMA 1AQLA 1MOPA 1NLZA 2MSNA 4QQFA 4FILA 1X8JA 4JYPA 5BN3B 2VUUA 5CBPA 5EIXA 1H8HD 3MFYA 2NTNA 2AVNA 5E6SA 3A6FA 2GJ8A 4K6MA 4AZ3A 4BGDA 1M2KA 4GXTA 4JP2A 2KBFA 3SXUB 1Y3FE 4OXNA 1BQ3A 3ITEA 4Q1BA 4JC4A 1N8TA 1JDTA 3DEHA 4LHSA 2GYUA 2SCUB 4L9WA 4X6LA 2JI8A 4F72A 1EWTA 1WPXA 3FPHA 1KPIA 2VHCA 3IUNA 1LBSA 1NNLA 1W0JD 2O1WA 2DR3A 1LSSA 3EFHA 4IIHA 5D5QA 4Z9XA 3RRMA 5JADA 3ABOB 4GOMD 1Z4OA 3WK6A 3CZ9A 4RH0A 4EFKA 1Y9JA 1GZHB 5BUCA 1NN5A 1BE8A 1XCJA 3D5QA 4FOPA 3KOYA 2D8AA 3RTCA 3W8DA 1ISPA 3BIXA 3TWOA 1Y9DA 2FA9A 3A0RB 4TS4A 2WTAA 4XW2A 3ZX5A 1T29A 2F3TA 3FFTA 4YH1A 1L4EA 4HN9A 2ZBEA 1Q0RA 2G8NA 2PUDA 3L5OA 2PZAA 3BRSA 3RTEA 1NU8A 1OB5A 2Q6TA 4FSDA 4JC0A 4BTVA 2WZDA 3CO0S 3TJMA 4BFCA 1HE1C 3FZGA 2C3MA 2VOJA 4M7PA 1D07A 5CB6A 3FCAA 4BO7A 3JZAA 3ZLJA 4CEHA 1RW4A 5AM5A 2ZVQX 1J21A 4H2DA 5WRFA 4IZ6A 2PX0A 2IPXA 1GV0A 3ELUA 4OBEA 5M3BA 3OQNA 2ZUUA 2UZ4A 1R8SA 3QXXA 5CT8A 3EEOA 1TD9A 2FK7A 2PKYX 4AMVA 1UMKA 1DCMA 5C8XA 3DE0X 3V8NA 2P5UA 4Z9YA 3SR4A 3II6X 1WOYA 3AR2A 1G9XA 1ZFNA 5EPOA 1DU4A 1KI1A 2E49A 4CM4B 1W8IA 2ZSAA 3PZRA 1YL5A 1QG4A 2J9XB 3DV9A 3HDTA 4RQUA 1ADJA 3AR4A 5DX1A 2OCLA 2V7BA 1LQTA 2QWXA 1YOVA 4CKXA 3U9TA 5EHIA 1ZNWA 2WWVD 2F1OA 5B7QA 3DMGA 4R31A 4HH4A 1CP2A 1QYIA 2PMDA 2RC6A 4GBMA 4R41A 3VPXA 4BP9A 1W76A 3QHPA 1MHTA 2DUWA 3CB4A 3OTHA 4LS3A 2HYIC 2RAVA 2CXPA 4LXGA 5AK5A 1VKNA 4P82A 3LGXA 2I8CA 4J29A 2X2PA 3I1JA 4WKCA 4FUQA 3PT5A 4WRRA 4PZLA 4IDGA 1A7UA 4Q12A 4BBAA 3ZWQA 1XZFA 1EX7A 2L19A 3I0NA 3SMQA 4Q3CA 1ZVQA 1TL7C 2YZGA 1MX9A 3G2JA 2XVMA 1PE0A 5LSAA 3A1DA 4B79A 3SQOA 1ATIA 3R9XB 1JG6A 3OIYA 3TCKA 1VXOA 3HDHA 2X1MA 4KMSA 4BX0A 3NMUF 3GT7A 2ZB8A 1D1SA 3VDXA 4DR2B 2ROQA 2NUTB 4HATA 3OQ1A 3WQQA 1UQTA 3C1OA 2FV8A 3HWWA 3M2PA 1J39A 2OILA 2A9OA 3EF1A 3NHUA 3LYUA 4WJLA 3FNRA 2IPNA 5CG1A 4EABA 2UVPB 1UADA 4GOKA 4QYSA 3TTVA 3OTOB 2XUZA 1RRPA 2CXXA 5B3AA 4ETWA 3PJFA 3PL1A 4W8GA 4XD7D 3UO8B 3MIIA 1U3WA 4JA2A 1YRAA 3KYCA 3K5HA 4NK4A 4UBIA 4CIXA 3RVNA 1IIBA 3C3MA 2MYPA 4JT4A 4AVYA 3RABA 1IM2A 2PWYA 5FYQA 1EG7A 5K45A 2FMTA 1SBYA 4P4SB 4JLVA 4KQWA 1SUPA 4II2A 5TMEA 4Z2YA 2G36A 2RH9B 3PR3A 3KETA 3IKJA 3EZ9A 4B45A 3GYBA 4O4LA 1HFJA 2Q3DA 1ISFA 1FC0A 1NF3A 1O94D 1G21E 4E5VA 2JIMA 4DCMA 3LUFA 3UAVA 2RHCA 1YL6A 5E9QA 3GG9A 4S1OA 5CP8A 4QELA 5FNVB 5THXA 3FBGA 2B8NA 2W9XA 2F1HA 3GVHA 1V37A 1XNHA 4GECA 3TZ6A 2UUCB 2FYTA 4JYBA 3HG7A 1D2GA 4L5AA 1T8RA 3ENZA 5HMMA 1TKAA 3VR5D 3EZNA 4J9UE 1N5LA 2ODWA 1SBNE 3T7EA 3SVZA 3CTPA 1ID8A 3ROKA 2GF9A 1H65A 2IOFK 2R84A 1GHTA 5K0CA 3E7WA 2SECE 2HXYA 4RTKA 2O05A 1W9MA 1CD5A 3PDJA 4C2BA 5JSZB 1YNOA 4JZKA 3W04A 4X9XA 3WJ2A 5F51A 2SKDA 5IH7A 1K86A 3UWSA 1I1OA 1YS1X 3MWDB 2R4UA 3AM3A 1IBKB 4ASUA 5ALJA 2JGLA 4UDYX 3SX0A 1RYHA 4E5NA 4L95C 2JBAB 2W6JD 3ZQ4A 2GTHA 4MRMB 1D6MA 2J08A 2JBWA 2WDPA 1N5IA 2J0UA 4OATA 3BAFA 3GD5A 4I08A 1ZQ1A 4QNMA 5TEVA 1POWA 1OXSC 2QTRA 3TSYA 2EAUA 1DTWB 3EIXA 4PBSA 3T15A 3NOXA 3KQHA 3VDQA 4BNZA 1SKYE 1QVWA 3KOUA 2VT3A 1SFRA 1WXGA 3Q8MA 3BRWD 2BOVA 4QU8A 1N6HA 3UG7A 1H9BA 1L4GA 2B35A 3B1KA 1ULUA 3F7OA 5A03A 3MYYA 1V16B 1OHHA 3IJEB 1LW7A 4BNYA 3TLBA 2IXFA 3CFYA 3DR5A 3G02A 3F67A 5CYPA 5G4LA 2BTQA 2I6TA 1GEEA 1V4NA 1V6AA 2RHOA 1CYEA 3KR2A 3GT4A 3L43A 3C3DA 4OQ4A 3BGIA 4OVKA 3BZUA 1WOMA 2BKAA 1MDFA 2GAFA 2O8VA 1LBEA 3PKIA 3QBTA 3R6WA 1KTIA 3SVLA 3PGJA 5E3JA 1E5XA 1VPVA 4WBNA 1VL8A 4N03A 4CEJB 5ADUS 2H85A 5LZ8A 4DV7B 3FWYA 1TFRA 3EPRA 4HGQA 3U7FB 5B2EA 2QQFA 2AOUA 3P1JA 4DBZA 3JY6A 3WGIA 2B0CA 3P2OA 4JKIA 4OKNA 1JDVA 2Q6VA 2A59A 4I1RA 5EVJA 4BZXA 4ZCQA 2DBRA 4TS9A 2VTBA 3TD2A 1N6RA 3IR7A 1ZVJA 2XTAA 1LPOA 3VU1A 4RMIA 4G56A 3WYGA 4DXAA 1GN8A 1TI7A 2HDHA 4Z3KA 2HREA 2AV6A 2J41A 2Q5JA 2LW7A 4BVFA 2BFEA 4KRXA 2A0UA 1PCXA 3KFLA 3V2HA 2GHRA 5AVUA 3D8NA 3GD7A 4K86A 4Y9SA 4CQLA 1U3FA 2DH5A 5K0SA 4YTEA 4TXLA 4ZVPA 4C6TB 3IB3A 3BGWA 3F78A 3IVGA 3W5SA 1Z3IX 3N9IA 2Y4NA 3S2IA 3TPFA 4DCJA 5A7FA 3AEQA 4FNAA 3USCS 3V2UA 2G7ZA 2WJHA 3QNMA 4Q4JB 2CXSA 3MMXA 1CB7A 2EU8A 4XB6B 4A1OA 3U4QB 1GA4A 2W7TA 3THWB 2P1ZA 1PWZA 1U7ZA 1FS6A 1R5BA 2ZJYA 2BM8A 1A9ZA 2VXYA 2Z4RA 4RO0A 3T7RA 2W6IA 2IHTA 5GZ3A 4AJLA 1T10A 4HO1X 3L1IA 4JUAA 4JFAA 4MVJE 3GJ6A 1XRJA 3N28A 2VJLA 3AEYA 1IWBB 1K89A 4MB0A 5KHLB 2QG6A 5EKUA 4F2HA 2VHXA 1RTKA 4KR3A 2O8NA 3HKBB 4HZIA 3WHPA 1H69A 2OBMA 1R12A 1ZD8A 4CMJA 2BFCB 1QO7A 2UUOA 2WV7A 2X1VA 1ENOA 1XZNA 2J32A 5REQB 1K6JA 3OCJA 1Y8AA 1T36B 3A9UA 2Q3HA 2E87A 3B12A 1A9RA 2A5YB 1GQYA 3CEMA 4OI2A 3X2SA 4S0XA 3NHYA 2OLJA 1DLIA 3KRTA 3UW3A 4A2WA 5BNFA 3DNMA 3D3QA 3NANA 4J1NA 1X94A 3VYRB 4ITVA 4LYHA 2IOQA 2RD2A 1RAEA 1JXQA 4BGUA 4QDKA 3FTPA 4KQFA 1M34A 3Q0TA 2B9EA 4KIGA 4EY8A 4L27A 4I4TF 5EAIA 3BK1A 2I6QA 1QMGA 4OHPA 4Q3KA 2V3CC 1M8KA 5K6AC 2XR1A 4PQRA 1Z8HA 2GVNA 2JVIA 3O8QA 4EFLA 5JYEA 5CAEB 4LZJA 4Q9LA 1V3UA 2HCTA 2QTCA 4J75A 2OPHA 3L8YA 4CMIA 2Q49A 4S1VA 4X63A 5JS1A 2VHQA 4TRMA 2XQIA 1KWKA 2JAPA 3QMPA 5GOZA 3ZWPA 5B12A 4GPIB 1P9WA 2VI5A 5I4KA 4JBYA 1HDRA 1NAIA 1DEHA 1NVDA 3A26A 1NULA 3L8MA 2C20A 3ONFA 4B7AA 3IV7A 4OHCA 4HAYA 2FUEA 3E15A 2ATEA 3BJRA 1GFZA 5JCJD 1C9NA 3K9BA 4IZOA 4PRYA 2ST1A 4RF3A 5LQJA 3V1TC 2EZ4A 5JJBA 5IAKA 4H7FA 5FTNA 4KO8A 1Z6YA 1F6BA 3ESXA 4I8IA 2PKCA 1R18A 4OMUA 2MOKA 5KYYB 3D8UA 1IL0A 1YR9A 1KAMA 3BYZA 3F5MA 3I5MA 3ZDCA 4TVOA 1U2DC 3DJYA 4DZTA 4BLVA 4MUGA 4XWAA 5IUKC 1MT0A 3E2IA 5AM4A 4K5QA 4MV9A 5DCUA 5K3BA 1L5GB 5HUQA 4IHAA 1NL3A 3MXOA 1B26A 2AE1A 3DHEA 1OREA 1QF6A 3KD2A 2OXRA 2VP4A 3DBRA 1I32A 3HDQA 3ILHA 2AFIE 2WSYB 3BJEA 2WSMA 2Y27A 4XARA 4FSXA 3KT6A 4N40A 3PUVA 4FI3C 5TX7A 4YAWA 4LJKA 1B6RA 1I2CA 2CFIA 1NUTA 2J59A 3K5PA 1P1BA 1M2OB 1X80A 1Y1QA 3IAS1 5G2OA 4M0DA 5SV2A 1VIMA 3SKXA 1TQ6A 5LDHA 1WUHS 1D8AA 3L46A 4BECA 3P2KA 2G1UA 1XFAA 3QV1A 3IH5A 2J4FA 4TLBA 4NFHA 5CNJA 3EGWA 4PLWA 2ZJ2A 3E53A 3H13A 4IWYA 3A11A 4MJXA 4AJKA 2EWWA 5EP1A 2ATVA 2PZJA 3GLRA 3RUFA 3LVFO 2HRBA 6AT1A 5JO0A 4CKCA 5BSGA 3ZWWA 3AESA 4P35A 3ML1A 2B1IA 4QJ5A 2RGXA 3LQ2A 5CVJA 2QM0A 1SKUA 1YZNA 5ER9A 2YHBA 5D3KA 3DE7X 3GMSA 4ZRNA 1DJMA 1G60A 1SVNA 13PKA 1TRKA 1WVMA 1A9SA 1FBNA 2XAAA 3E9DA 2FX3A 3GX1A 3NTXA 4ND3A 1OKKA 3SBXA 1ZK1A 4Y9UA 2IEAA 2HPAA 1QU2A 2HV9A 3KPYA 4YGYA 4ZANA 1QIIA 1QRDA 1XG5A 2Q9CA 4WN9B 3OQOA 1OH6A 1ZNQO 4YPOA 4B3CA 4KQJA 1W59A 4INOA 1YVEI 2R1TA 2C7RA 3GLGE 4G97A 3ZUGA 4B47A 4EB6B 4F0JA 5ANRB 1T5BA 4MQFA 2NU7B 5FBLB 5B57C 4OTZA 3KSZO 4J0CA 5IBRA 5JASA 3PP8A 3W2TA 4RIIA 4YHBA 4IOMA 1VLHA 5EJGA 1A5ZA 1RRGA 2O54A 3A1EA 2DETA 4I14A 5A06A 2R9VA 1VCMA 1J2TA 4KLZA 5HRUA 3TB6A 1N2SA 1YJQA 2ACWA 2WTBA 2Z8YM 4G65A 3HH8A 3U7IA 2Q0HA 4Y2HA 4RHUA 4CFZA 2AH5A 4YNBA 3KFVA 4PLGA 4OQLA 3D4IA 2AR7A 2ASVA 4BFLA 1RRCA 1YR2A 3I6MA 3OCVA 2VDOB 1G3RA 2ZWIA 5I8WA 4UKDA 2WF9A 3VAYA 1DJPA 1Y8ZA 2BEUB 1X2EA 2QVYX 4FOTA 5GY7A 5HDBB 4LYDA 2W0SA 2YZNA 3WKAA 4XQGA 3FMOB 5JXIA 1E1QD 1SXJB 2R8PA 4B7XA 3GLFA 4DV1B 4XX1A 1OAKA 3VH4A 1P1CA 1VIVA 4W9RA 2AR9A 4ZT7A 1FY2A 2HM7A 4RK4A 3D4PA 4O2LA 2NU8B 3WV4A 3HU2A 5D5HA 4AUMA 2HF7A 2HAEA 2CLDX 2V8BA 3CBQA 3T34A 4XUDA 2O2GA 5I7UA 3V4PB 3OCXA 5EJ9A 2WDZA 4PLCA 2PSHA 3Q3CA 2XZTA 4Q02A 4CDRA 5JXHA 2QRJA 4IIDA 3VSEA 1U5AA 3PUWA 3ZZ0A 3JVDA 1CERA 4JK3A 1SVMA 3W9UA 5K6AA 4PY2A 5G0SA 4TV8F 1J09A 2B8JA 2DMRA 4B6JA 2C99A 3UK7A 5IKEA 2NU9B 1BEEA 3NBQA 1Q1NA 3AFIA 1R4MA 1KSFX 2IP2A 3R4VA 4G07A 3CPSA 3K6KA 4Q4HB 2ZU6A 5LDDC 4L7VA 4PGHA 4BJ6A 3OJFA 1IVNA 5ESRA 4LF4B 2OPBA 5AJWA 2X7JA 3ORSA 4BMXA 4B5KA 3C4VA 1ODFA 2WM2A 4RD3A 1INLA 3ENNA 3GZTB 3RANA 3RK4A 3KJHA 3ZTWA 2J67A 2AS0A 3CG0A 2ZWPA 3WB1A 2OUIA 3D3WB 3KC2A 1XD2A 4JUBA 4WLUA 2XOXA 3AIKA 3OVMA 4X97A 3HV0A 4XVHA 4D2IA 3D7RA 4HYYA 3I61A 1DC8A 1VPLA 1E2FA 4LOJA 5C5IA 1N2XA 4EQ6A 4IIXA 1WKBA 2FZ5A 3G5MA 4YS6A 5EUMA 4DPMA 5AW7A 1XHFA 1OFHA 3P0HA 1FU4A 1RRMA 1DBWA 3GFFA 3HBMA 3EIHA 2JGDA 4MZDA 3V2GA 4BP8A 4QARA 4FONA 5TPWA 3ORYA 2AN3A 3A37A 4AUNA 5JO9A 3F6BX 4MGKR 1XR3A 1Z06A 3PQ2A 1U2DA 1AE1A 2DHRA 2EVWX 4Z3OA 1ACMA 3IQGX 4I46A 4L2IB 1HK7A 2FW6A 2PX2A 2ZGVA 1K4MA 2UYOA 4D44A 1GYRA 4P8RA 2O8CB 5K2OA 4IXTA 3M8KA 1GSIA 2XNKA 3I1YA 4TQGA 1Q0LA 3N2GA 4CUKA 4CQMD 4EHBA 1G8YA 4YAUA 4L22A 2D2EA 5CM2Z 1EZ4A 1P0QA 3MERA 4XUCA 1L7MA 5DMXA 2NO5A 3SM9A 4QDZA 4PLZA 3STUA 3UTCA 4WNCA 3PNLA 4IQ4A 1OVGA 3WNQA 3NAMA 3L49A 5K0EA 1RZUA 4DPKA 2WWFA 4W5TA 4PLTA 1U2QA 2R47A 1WSWA 3FHTA 2F4NA 2QX8A 3HA5A 4YMSA 1YI1A 1KVUA 3MRXA 1MW9X 1AQJA 2AX4A 2JGMA 1BCSA 1C9JA 2Z95A 1IDOA 1YE5A 2D1RA 4INPA 5E9JA 1FRQA 2VJKA 3DWEX 5EZSA 4DJ5X 1YMVA 2NPIA 2KSQA 5BQXA 4YJ3F 1PDWA 3GG2A 1TRHA 3KTOA 1GQ2A 3K8ZA 2G67A 1YB5A 2X4LA 2CNNA 4H3KB 5EI5A 2OFXA 5E4JA 3BBLA 3Q3VA 3CJTA 4HEA1 3Q7PA 5KKAA 3L6UA 3QELB 2AZXA 2QRGA 3NRCA 1KOFA 5GP1A 2Z43A 5LU9A 3C6YA 3IEVA 3D6VA 5K0TA 4ZU3A 3DOJA 3EA5A 4N82A 3MMPA 3HGMA 4HMQA 3OH8A 2BF7A 4CM9A 1P2BA 1T6YA 3EJ6A 3LW7A 1G8GA 4K9OA 1VMEA 1TO2E 2O7RA 2Y1FA 4OQEA 2OFFA 2GD2A 5LD2B 1FMFA 2DT8A 5GJVC 4QUGA 1E20A 4RVDA 1NZFA 5ALSA 1S4QA 4HSEA 1GT6A 3W2EA 4CJXA 2CMFA 3LQKA 4UULA 2H2AA 3BCRA 4ACBA 5JR3A 4B44A 4WEOA 2G77B 3NHFA 2Y1KA 1EDOA 2CMKA 2YWGA 3P7MA 2IPOA 1EFVB 3FPAA 3CSUA 2EKBA 3AR8A 1S1MA 4R2LA 2B69A 4H9GA 1I4DD 3WYEA 1RU3A 1A82A 1QIDA 1UDXA 4CT5A 1Z0FA 1Q3HA 3IIEA 1KL7A 1D1PA 2E18A 1NC3A 2F48A 1U7XA 4HAVA 1XAJA 5DLPA 3K1YA 4J0FA 2REQA 4Y1GA 1B00A 1GUDA 4B40A 1LW6E 1K8XB 3I28A 4KAJA 3K0AB 4Q9HA 1CUYA 4IDNA 1L4HA 1XCGB 5KYUB 5EHGA 4X5OA 1MVLA 1UJBA 2OQIA 3GFRA 4E09A 4OHOA 4D4MA 5BR8B 4Y2UA 4YALA 1XVVA 3AOGA 3IBCA 2JFVA 3Q5DA 2B34A 5JD5A 1Q0PA 1EFPA 1CR2A 2DFNA 2WAYA 4M7WA 3G8BA 1OFVA 2CHVA 1WB4A 4O4IA 3U62A 1F60A 3VR5H 1N25A 1ZM4A 1C7RA 3G5TA 2HA0A 1MO5A 2AKAB 5DK4A 1T9BA 1NY6A 3VR4D 4YJ2A 4JI0B 5F7ZA 3C1AA 4FMBB 3R1IA 4WGGA 4XSVA 4YAKA 2IIQA 3KCQA 3RS9A 4D5EA 4UAVA 3AX6A 4F6RA 5JAPA 2ONJA 3OM0A 1FVXA 1KY5A 1AD2A 1QVVA 1Y42X 3EISA 3CJQA 2AYXA 2IQ5A 3LO8A 4FZVA 3ZD8A 3B2QA 1MW8X 4K2AA 3ZV3A 2TYSB 2YOHA 2PZBA 4RSMA 5D7BA 5TF4A 3VNVA 5GV8A 4DDKA 1OIVA 2ZAIA 4B3DA 2C2WA 3VISA 4MUJA 5LZ2A 1SIBE 2FPUA 3FHCB 1N1EA 4XYLA 1BD3A 2HMAA 3HCPA 2R1VA 4KLRA 1Y8RA 3NFYA 2GESA 2D74A 4P4UA 3R7WB 4C22A 4CEIA 5EIFA 2HPVA 4L85A 1Q57A 2X40A 5IS2A 4ZJUA 1S4MA 2XXJA 3OOSA 2I1WA 1F17A 3HV2A 1HO3A 5I7SA 1Z73A 4OX9B 4U6QA 1FRNA 1RVDA 3BGSA 4CL8A 2JAQA 2VA8A 1RCTE 4UU1A 4D0RA 1PD0A 3AJ8A 3SM3A 1G3IA 3OM8A 4X6XA 3IMKA 1N7JA 1E62A 1GITA 5LXTA 4CFSA 1DOZA 3BA1A 5DI3A 5DCLA 3PDIB 4QDJA 3MLAA 1AZTA 1Z47A 2JLSA 3AUXA 4NHEA 2WF7A 2W2TA 4MUHA 1CVRA 4RESA 2FJUA 2B4QA 2CY0A 4U7WA 2V5AA 4EKNB 4J7XA 2JS7A 4PHGA 2BGWA 4HBGA 4ZD6A 2RHTA 2V98A 3NM6B 1I4LD 1NT2A 5TIIA 4TLMB 1UBFA 1LBTA 1L7VC 4ZPJA 3NEAA 4TKVA 2IVFA 1SUSA 1QO0D 3SYMA 4LW8A 4UNNA 2KM1A 4M7RA 5B7NA 2OCBA 4PYKA 4CNBA 1HTTA 2C4KA 3D0OA 1K8RA 3GRZA 1P19A 4WJZA 3WSWA 2IXEA 3QG5A 1JEEA 3I1FA 1OTYA 1JYEA 3UB4A 3W4JA 1L4YA 1ZVVA 2HCBA 3OCWA 1GFIA 3ICWA 2WAAA 4HGYA 1EESA 5HTKA 4BEBA 4I5DA 2QI9C 5ARBA 4YVFA 1KI3A 3MMSA 1IZZA 2PX3A 2Q5EA 5DULA 4EFDA 5BSEA 1ZJYA 1KDRA 2H2GA 3MAJA 3TFWA 3LGAA 1O9HA 3V00A 2BGGA 1XRRA 3N2ZB 5FWAA 4ND5A 4Q4LA 3JCZA 5J58A 1NF8A 3VM6A 4Q4CA 4N3CA 3H7AA 4M6WA 4Y2RA 4BB0A 3JQ9C 4Q9IA 4D0LB 1R66A 2ZITA 3KWMA 2UAGA 5A7HA 621PA 1MQ9A 1TTQB 3BDIA 3BMCB 3QIAA 4HEQA 5FLYA 3R9IA 2VP0A 5FTLA 4PLYA 1DC5A 1CJUC 3IE0A 2M2IA 2PRKA 3PQFA 4OLBA 1MX1A 4PAWA 2C07A 1JZSA 1ADGA 1DDGA 1N5JA 2O0LA 1KZ4A 2I7XA 4MHOA 3DV0B 3NT2A 3WP0A 3VUFA 4D3ZA 5KBYA 5A4AA 5IVKA 2ONYA 1SB8A 3HXPA 2ZJ5A 2I4TA 3P9YA 4GXRA 4DDUA 4LOIA 3SG0A 1M5RA 2O2JA 4L9SA 4W7HA 4HNAA 2DECA 2W2LA 4NPAA 1RJ9A 4KXQA 3TM4A 1CEQA 2PKRA 4EVIA 1APBA 2ZEJA 4G36A 1U2EA 1JLLB 4UUAA 4NQZA 1COWA 3K9QO 3QEMB 5T3YA 4OOEA 2ZI9A 5J63A 5EHXA 1Q0QA 1TC1A 4PVCA 5JLJA 3LOUA 1UMBA 4M1OA 3RAJA 2EX4A 3NONA 4IEEA 3F2IA 1GU0A 2E48A 1C4KA 3JYHA 2XMDA 1E32A 3O91A 4IJKA 4BNFA 1N0HA 4XD2A 1H2BA 2WOJA 1TXGA 3NHMA 4ZC8A 2CXUA 1XIVA 1P77A 2NUPB 3L05A 5IT9A 2R0QC 2GXQA 3QMVA 4IZIA 5BWCA 1EQAA 2BT4A 1DELA 4J0DA 1W9HA 3F3SA 2VWQA 3TJRA 5AQ1A 1CP3A 1NN1A 3OQBA 3G88A 2AXNA 2G0AA 4K9MA 3VO1A 5ALTA 1OZHA 3SHWA 2GBPA 2QG9A 4LWPA 2VJPA 4YJFB 4LRWA 3D6AA 3DNFA 2OXTA 3E58A 1P39A 1Q95A 2XXAA 1I2ZA 1Y89A 2CSUA 3AIOA 4TL6A 5TMDA 2GF0A 3F97A 2APJA 3K1TA 2PUAA 5IM5A 1JKMA 1LZKA 1PS8A 1GNSA 3PDCA 2PUWA 3O8OB 4UNQA 4YDQA 3IQFA 5DNVA 2VRCA 4HNGA 2G6BA 3G7NA 4WV3A 1MOSA 4GG1A 4MP8A 5CDFE 2RG7A 1JTEA 1J4AA 1MBZA 4RPLA 1REQA 2PWBA 5SZIA 3IKMB 1Z35A 5CEFA 1H4QA 1UKVY 1UKZA 1GTL1 1LEHA 1XTVA 2PH3A 1CETA 4IXNA 5DHPA 5JCOC 2JLYA 2XUGA 2YMMA 1S3SA 1P72A 4DMCA 4IFIA 4KE9A 3UJCA 4EUFA 1H8EA 3GLUA 3DDZX 1SCUB 3PCRB 4KUHA 2RJNA 3ZGNA 1KHHA 1O96B 1W4ZA 4UM9D 4O5AA 4LC1A 1H0KA 4I4TB 2E4WA 2A9PA 4Q3NA 4XRRA 3KXKA 4B3TB 3RBZA 4ARBA 4WADA 4XH9B 2M1ZA 4GMGA 3F6CA 1QK4A 4JGGA 5H7XA 2UYYA 4BKQA 1X0XA 3VPDA 4E14A 4YV7A 1OJLA 1RQPA 2R87A 1DG3A 4HFRA 1IATA 3BQNB 1BXGB 3B1XA 4NC9A 5TPZA 1TADA 1OASA 1Z0ZA 3QQ5A 4W8HA 1YNSA 3MG9A 4NE7A 1CS0A 5EL0A 3RLIA 2G09A 4AO7A 4AQDA 1X1TA 3GFOA 4OFXA 4YQEA 2R4QA 4JBXA 2R66A 2H5EA 3H5NA 1KIFA 3FHJA 1UDCA 4FMDB 4LNUA 5CYOA 4MB2A 3ZY6A 4BCCA 3P9NA 3RSOA 1FX0B 1X38A 1Z6GA 1YACA 3R44A 3ZY5A 4DA6A 2OXFA 1G38A 1YVPA 2GNPA 5TS2A 4HYQA 1X1QA 1GA6A 4CM5A 3KEGA 4JYZA 5JEEA 1J7KA 2WE7A 2A1IA 1RQ2A 4ZQIA 1FYDA 4YCBA 4L8WB 2H1OA 2P7HA 1XX6A 4EOGA 2WIDA 3MWGA 3DVAB 1LJUA 1XA3A 5B2FA 1R5OA 4HDRA 4MCAA 3TSCA 3EOAI 1JI0A 4BFZA 3ZTYA 4DC0A 4IBOA 2UYHA 2B2NA 4QU9A 1RQLA 2FSIA 3JQ9A 3DZGA 2BDEA 3UNXA 4WVLA 1KE1A 1DQNA 4DDTA 3M5WA 5FUXA 1BD4A 5J4KA 5C34B 2MYUA 1R0RE 2IUSA 5G40A 4IKEA 2W2PA 4HRAA 5G41A 3I6YA 3SF0A 1BDHA 1WCXA 1JH8A 1FJGB 4EZBA 4H15A 3LLVA 2J6IA 4RVNA 3AI7A 2ZBFA 3HKCB 4HTFB 4YQZA 1I4OA 5C31A 4KXWA 1YQWA 2VWHA 4IWNA 1I13A 1QRAA 3CGWA 5C5CA 4I7EA 4AJHA 3ZHOA 1D2RA 4JU8A 3O1IC 2B37A 3L9XA 3RYIB 4Q00A 3RS4A 4V0QA 1RKXA 2M98A 2X8JA 2ZAOA 1RDFA 1PX0A 1RYBA 4OHKA 4E2FA 5A5DA 1OT5A 1AB5A 2FZGA 2HJ9A 1CIJA 4C9BA 5J2TA 4O1MA 4U3JA 4B0OA 1QH9A 2XD9A 1U9CA 3DBIA 4OLHA 2EOAA 1U3CA 1NV9A 5KU1A 3NXSA 4MKXA 1EUCA 2PD4A 1J2EA 3EVFA 3M6WA 5M5BA 2BFBA 1TLLA 1ZCAA 2XDYA 3U13A 2UZIR 3IEIA 4I3FA 3T1NA 4BNUA 4D02A 5LYJF 4KX5A 5HZHA 2WIFA 3R3YA 2GD6A 4DZRA 5EUQB 4ESEA 2PR7A 1UK7A 3CRMA 3IT2A 4CCSA 1FUKA 2WYWA 1ZRMA 4DM4A 3PB3A 1P29A 4JMPA 1R6AA 1TJ4A 1ZMXA 2QY9A 3KALA 3BB1A 2EARA 5FTJA 3G0GA 5D01A 2I87A 2XZOA 1PU2A 5HCUA 4FYKA 1QRRA 1RBMA 4G6ZA 2I4OA 1PFUA 3H1BA 3UMRA 1VRWA 1RWWA 3HN7A 3QM1A 2PVSA 4DNOA 1V7PC 3FOWA 3KL2A 3JQQA 3M6FA 5IBQA 3INYA 4GLFA 5DHTA 1IBCA 2Q2NA 4OGWA 3IFSA 4LTMA 4ECAA 5JQWA 1NFRA 2BUAA 1PT5A 3HEAA 5HKKD 1G59A 2W22A 3U3KA 3N7TA 4NMXB 4QNNA 2P9JA 4ZHQF 4OFZA 3UHPA 3ZD6A 4MITA 1SXIA 2J3LA 5JCOA 3PEWA 1DX6A 2D54A 3FRIA 1U3GA 4JQOA 1F1BA 1X7XA 1J8VA 2JZOA 2J5XA 2OV1A 3L2OB 4JNKA 3NGMA 3GNLA 3TZHA 1MJGM 5K4GA 2HHJA 3H9BA 5I9IA 2EGGA 1FYEA 1SHZA 3TMKA 5FTMA 1HEYA 1PDOA 4II3A 3VKVA 3DG9A 1EX6A 1UBRS 2AMLA 3IUPA 4TWJA 3BCSA 5CIYA 1K4YA 1Z38A 4OQDA 1PWXA 1EBFA 1QE5A 2JFUA 2ILVA 5H3LA 5T6MA 3SBDA 3W8EA 3QLTA 3ZWXA 1R74A 4LY0A 1T1JA 4P32A 3FLBA 1ADYA 4ZAWA 1W48A 2OYRA 1EVLA 4XFJA 3UMJA 1RCFA 3OSUA 4W7SA 2QVZX 4ER5A 2GZMA 2HUPA 4ZMBA 3F5FA 3LBYA 3AETA 5JVDA 4NZZA 3TG8A 3I04A 2AJ8A 3OU2A 4U4AA 3SICE 2QENA 3ANXA 2Z5FA 4YJGA 2Q2QA 4FX5A 2F43B 4M0CA 4ZAFA 1TM2A 4DGQA 2XYQA 4GGMX 3FXAA 4NX2A 4ZODA 2Q5OA 4GKKB 1QWSA 1O03A 1Y63A 2RDMA 3WLLA 1NFQA 3ACCA 1I3NA 1P1HA 3FPGA 2VLIA 5AJVB 3RUPA 3TAHA 4CG1A 1CZNA 1Z34A 2JFXA 3BWMA 3H5RA 2ZWMA 5DSZA 4FYHA 3RUIA 4F8JA 3AUYA 3REQA 3EZLA 2OZLA 4WPGA 2BGUA 2PAFA 3L0DA 1EVKA 3I9FA 3PIIA 3Q3GE 4Q01A 4XB1A 1TZ2A 4BQNA 2JH3A 5LPNA 3ZKAA 4PZAA 4AYXA 3C85A 3IAM6 2YWCA 1THTA 1M9NA 1C9KA 2NYAA 3CZMA 3EYAA 4LDJA 1PIWA 3SXUA 3U81A 1WUTA 3EDYA 3OWOA 5KYWA 1JDPA 3LVBA 3L8HA 3NB0A 1M2EA 1TZBA 1KYIA 2GAOA 4FFBA 4FYJA 3HB9A 4QUBA 2ZS9A 5TE9A 3T9CA 3WFIA 1PJ2A 2P0YA 1ZNXA 4DR4B 1QV6A 2CVZA 2VJBA 1C7FA 1S2LA 1T25A 1TYAE 2YFHA 4MWZA 1X7ZA 3LF1A 3GLVA 1HETA 2VHTA 2A57A 3KR1A 4UE2A 5C8VA 5CB4B 3MGCA 5BSTA 1PEDA 2XUQA 1NSTA 1HT3A 2CUNA 5DV9A 1IZ8A 3OEWA 4CKBA 2Y71A 4I8XA 2JL1A 2LD4A 4ZA2A 4K1LA 3RC7A 5JBIA 4QHYA 5C8YA 2Q1TA 3HCOA 1LC0A 2VXBA 3IOYA 4CKEB 1WNFA 3M1IA 4YRNA 2XMPA 4KMRA 1Q44A 3QX7A 1JG3A 4H6VA 4OQFA 4BFTA 3K9CA 2OK8A 4MRVA 3ZE1B 4CPDA 4J4HA 3QHAA 1LDMA 1WP4A 5EZYA 1PWHA 3R3JA 4QTUB 2B4KA 1L7QA 2FMHA 5EKTA 1Z2DA 2EFDB 2WU0A 4B1FA 3W5BA 4Q39A 4FGKA 1YU6A 3VVBA 1ORTA 2NVWA 2WM3A 1KKLA 2FG7C 1G7CA 1HL3A 1PJ3A 2E4VA 1OVMA 3KVYA 3MW8A 3N07A 4RD2A 5CT5A 3Q8LA 4LV6A 3ZK8A 4ZVUA 4PX2A 4GKJB 1VSUA 1R4NB 4YLGA 4JD5A 3VR4H 2CXHA 3KKNA 5CURA 8AT1A 1RMTA 1FRVA 5DN9A 2JJ2A 1ADCA 2ZAGA 3L40A 1Q7EA 3BH6A 4FNOA 2CE2X 3L4JA 2WWXA 4P1ZA 5JAQA 3HKEB 4PF1A 2ODEA 5TR9A 1ZC3A 3GJ7A 1LLFA 1E64A 3KKKA 3RBXA 4YRIA 3M5CA 1UC9A 1K8QA 1O08A 1CNFA 2DJ5A 4Z7QB 1YB4A 3R24A 5IVDA 2YIVX 1MAVA 4M53A 2OXIA 1B73A 1VXRA 2GM4A 1M54A 2TS1A 4W7IA 4HGRA 2Z57A 4KBFA 1U1GA 5IAOA 4M1QA 3DE3X 2ZR0A 4NCBA 5A04A 4DCSA 4W5OA 3FKSD 4Q05A 2XDQA 3JQ7B 4KN9S 5FBRB 1VL5A 3QU5A 1ZOIA 4AMZA 4DJEC 1ULHA 1P6QA 1PW5A 3G3EA 3TZEA 3ZI7A 1E3TA 4ALKA 4WXYB 4K8RB 3EIWA 4NU8X 3ISJA 1MC8A 4RZ2A 1HYHA 2H9AA 2Q2VA 4KE7A 1GTJ1 5JSUA 3N5KA 4CT4B 1ONBA 3DEFA 2WPDA 1V8FA 3OEEA 4CM1A 1SU8A 4LTDA 1P45A 1EEXB 5DF1A 5CXSA 3UK6A 2WYHA 3C3YA 3EQ8A 3VKUA 3EFBA 5C0OE 1GP2A 2QP3A 3CS3A 3EZYA 3IXQA 3I3SR 2JZNA 3OX1A 2PX5A 3R6DA 2PSSA 4NR0A 1QRSA 4XKJA 1E9SA 4MPTA 4WZBA 3VSBA 4M54A 4DKXA 4J43A 5L9AA 3A32A 4YRFA 2DYKA 3DMDA 3CTMA 3OZCA 8MHTA 1UBMS 5AKKA 1AKVA 2G1JA 1E4OA 1XZBA 3KB1A 3JARB 1V11B 1DHRA 4IQGA 3COSA 2ZBDA 3A58B 4RADA 4OKIA 2YCLA 1I10A 3PEUA 1YJCA 2QMEA 1K68A 2J31A 2W11A 1NYTA 3GCXA 3JWHA 4QFBA 4TKUA 2WIJA 4TVBA 3T3PB 4B84A 4B75A 5H3HA 4UOEA 3M5DA 1XDBA 1N8NA 2V4MA 2YVAA 3N76A 1WPRA 1KI7A 3M3PA 4KKXB 3FCXA 1YBHA 3RUCA 3SD7A 3HDVA 2J0VA 2N75A 4PPQA 2C83A 4YRCA 3WL8A 3JSAA 4BVKA 2QU7A 5LU8A 1UMCA 1EHCA 1LI4A 2FFRA 1YXMA 3N1UA 4FMCB 4G4GA 2CDCA 4PHHA 2FW0A 1S9HA 4D43A 4QHSA 3EB9A 4V0OA 1SD1A 3TECE 4B73A 4H3VA 1TAGA 2R4TA 2XNCA 2ZJ0A 3T5AA 2EIXA 3UAYA 1HSOA 1LPAB 4ZOLB 4EB8A 3PHLA 4IINA 4XA8A 3A3KA 4OCZA 2Z2YA 1DG1G 2EG5A 5DT9A 3SC4A 2EW8A 4K6CA 2JFQA 2ZXFA 3CUSA 4G1VA 2O3TA 1ZRHA 4LRQA 3BF7A 1CPYA 1YE3A 4L0QA 3NPAA 4LDZA 2XNSA 1X8KA 1PFGA 4IQ8A 1DQYA 5JCPA 4LHXA 1GTVA 3ZK9A 2HIAA 1Z2CA 3U3OA 4PPNA 4WOBA 2RHWA 1TQ2A 3C7CB 2CL5A 3CF4A 1MXFA 3D2AA 2VPWA 5DISB 3S29A 3VVCA 1G5FA 1M6HA 4JGIA 1ZPDA 2V0GA 4Z49A 1KMHB 1Y7IA 3GOHA 1XQXA 2VSNA 5HE9A 1F0NA 1JSXA 1LVUA 2X2FA 4OH1A 3N86A 3WMXA 4K9LA 4GMFA 1GVHA 2OCDA 5L4LA 4V0MA 3OZXA 1L4BA 2Q6KA 3DDUA 3LQ1A 4QDUA 4CKWB 4URVR 1V95A 4EPRA 4JI1B 4OK3A 4CCYA 4W9MC 1C0PA 3PKZA 3V5NA 1WZEA 2ZRNA 4L07A 2XOKA 2WSBA 2PUHA 3OAAA 3PD1A 5LQMA 2JASA 2HMWA 3NBYC 3WWOA 2HRCA 3ICEA 4C4ZA 4GSLA 2GA8A 1G55A 3FDIA 1QBKC 2YTZA 3N58A 1FNMA 1XTQA 3KNZA 4OK6A 5E8JA 1PKXA 1VSTA 2VPTA 3LUJA 3D6TB 5EMNA 2CSXA 1RSZA 3ZH2A 2Q0QA 4XGNA 4MGHA 2ID7A 3FCUB 4ZFNA 3BTSA 4QUEA 1HEUA 3OIUA 1DJOA 1JVSA 4WESA 1H3FA 2C9ZA 1JHMA 3H6HA 3PNVA 3K9HA 1R64A 3TI9A 2QHXA 2HNKA 3AUTA 3KQQA 1RD4A 1U5CA 2WA1A 4L8YA 1EFKA 3E35A 3TQCA 3WWZA 3GLIB 4G1FA 1T8UA 4LHWA 1GPUA 3STTA 4D3SA 3T5PA 2ZBPA 1OAAA 3RQSA 1PL7A 3LXXA 1YB6A 2HGSA 4CTJA 3QE4A 1KOJA 3EF0A 3EXAA 3NBAA 4NOKA 3SEAA 2XW6A 5KYTA 2HK9A 2B98A 4IV8A 3I2JA 3AHFA 4QBFA 4R51A 1PZGA 4DLAA 2FY8A 2IYOA 3EGOA 1Y6FA 2P1DA 4FCTA 4YLEA 2CLFB 1PFYA 1AK9A 1FLVA 1FDTA 1R6XA 1FTYA 2QV7A 4HLDA 3DKKA 3REGA 5GIPE 4G1CA 3GPBA 3V1LA 3ZCTA 3EFOB 1NF9A 3MUNA 4Z9FA 2B5WA 1EVYA 1X13A 2J4CA 3HGTA 3C48A 4A0QA 1RI2A 3PICA 1CR6A 1W88B 3GH3A 4Z1MA 2Z9CA 4LF6B 1ESCA 3UBTA 2GPAA 5HDQA 4C07A 4ER0A 3W5CA 3C3KA 4E5UA 5BUSA 4GE3A 1DRJA 3SJ7A 4C01A 2DFTA 1KY3A 4JSYA 5K8TA 1GPDG 4EHNA 3ZOZA 1WABA 4IDPA 5CHEA 2J85A 3FH0A 4NBUA 2DLNA 1X9IA 1DMSA 1XVAA 1RI3A 4II7A 4KV7A 1L5OA 1O0BA 1E1RD 3BRCA 2J3IA 4RMJA 4XXHA 3TZCA 3VOSA 1MKYA 1U7PA 2AFRA 2B4AA 3GH1A 2I3DA 3LOQA 1ANKA 1FK8A 1JIVA 2WHPA 1A04A 2JI6A 1R88A 1JHAA 2FWPA 4H3SA 3RSQA 4CF6A 1A9XB 2W2KB 3LDFA 3OJEA 3D6JA 3FUTA 1M1NB 4RK7A 3V4ZA 1ESMA 5IRCD 4HCJA 2FP4B 4I6JA 3R7SA 5TLSA 2NYRA 1STOA 2GJ9A 4R3UC 4RV9A 2EKQA 4NDAA 3UB3A 1U28C 2P9YA 3T3EA 2DPGA 3WTCA 5GINE 1F9EA 5JD4A 4DS3A 3H1TA 3SNKA 1M0TA 3E23A 4TMKA 2ECPA 3RAPR 4I50F 3KJZA 4B46A 4XEHA 5FA6A 3LCCA 4TMYA 2XPCA 3DBLA 2JGJA 1G8MA 3WL6A 4N5MA 4OUDB 4L16A 2FW8A 3CZ4A 4LX8A 1SZJG 4TN1A 2NSLA 3FDXA 3ICVA 2GPSA 2PGXA 3AJAA 3WLSA 2RGAA 6GPBA 4K26A 3LHDA 4L7QA 2DWCA 1FP1D 2JH9A 2WI8A 3FYSA 3RRFA 5DLYA 1JF8A 3RV3A 2PKWA 2YRXA 2V96A 5FUYA 1UOQA 3BL6A 4M36A 4ND8B 4LGYA 3S27A 2ISQA 2AZ4A 3SZMA 1L7EA 1NA5A 3WHKA 3MLBA 4ZK2A 4MW4A 4B83A 3K1JA 2BMFA 1ZQ9A 5CIQA 5BVHB 3DL2A 1D2MA 1G8JA 1I5OA 3BVPA 2GXUA 4QOSA 4V0NA 4ZKEA 3EIQA 1N8KA 3PKJA 4IIEA 1OTXA 1AG9A 2XODA 3X1WA 1OYYA 4AY4A 2Q21A 1B43A 4QGFA 3S55A 1DI0A 1NR1A 2NV2B 4B6FA 3BSYA 3IKLA 2QTGA 1WLSA 4WOJA 2CE7A 2IYPA 3RUDA 1R8JA 3P0EA 1T2FA 5GWXA 1DNPA 3DSRA 4URFA 3HO1A 3HCAA 4ARUA 4QT4A 2CV2A 1DIHA 4V1CA 1U04A 5ICFA 2XGJA 1VLQA 2QM8A 3P0FA 2YVKA 1H8HA 4X90A 1H0SA 1ZIYA 3GRFA 3Q1LA 4BDTA 5HZKA 1Q3KA 1WMDA 2IZZA 5IYZF 4BU0A 4D9FA 2CXOA 3U3DA 4CQMB 4KMOA 2MMCA 1SQ5A 4BNDB 1THMA 1XRPA 1UJCA 1UBNA 2XYPA 4K8OA 3M3HA 2WMDA 3BA6A 2FN7A 3EA0A 3G2LA 4PNZA 2ZIEA 3V9AA 1MO4A 3ND7A 4BN4A 3D9QX 3ZBQA 4FZ5A 2YXLA 1TM4E 1XXHB 1XWIA 2GD0A 4NWIA 1QTIA 4UVGA 3FYDA 2JDID 2FZWA 1VI2A 4HUJA 3IEPA 4HDCA 4S3MA 3U4DA 1TQDA 4Z4QA 2CZQA 5JAOA 3DP9A 1W2GA 5J1SB 3V4RA 3O75A 2JAUA 2VUIB 3LHSA 2PBRA 3UWMA 3AM5A 4JP1A 5BQ5A 3DE4X 2O07A 4UBLA 2H1VA 4BWGA 4Z53A 1HC7A 3NRJA 1NYLA 1E99A 2ZE7A 1ZK4A 1YDMA 2J3QA 4NS4A 5CHYA 4CMHA 5C4IA 2NMVA 2ZJAA 1C7JA 1SK9A 2CYAA 5CDTA 3SR0A 1Z0SA 3PT9A 3UMMA 2WG0A 2HQ1A 3ZDDA 3E7PA 2C0CA 5E6RA 2DP4E 1M1YE 4NJEB 5J43A 1PG5A 3Q7TA 2WOOA 3T0IA 3ZDQA 2AFHA 4M9RA 3UHAA 1A71A 4LMAA 2CFOA 4RS3A 2C2ZA 1DIGA 4ZI7F 1T9GR 2EBUA 2QZ4A 2G07A 1PSZA 3U7EB 2A88A 1JJ7A 1V8BA 2AF4C 4V3CA 2O2EA 3KJNA 1QZXA 2JBHA 3MCZA 1EIWA 5GZ1A 2ZETA 2H29A 3NTUA 4QZVA 4UDXX 1U9JA 4LK2A 1JBKA 5K0LA 2VATA 2EHJA 3P2EA 2ES4A 1SC4A 5BOSA 3NHBA 1EZZA 5J2UF 5FI0B 1F6WA 1ZD3A 4ZI5A 4Q3EA 2FEOA 1TAUA 3OT1B 2ZYRA 1U0RA 2ZXEA 2V7QA 5C1IA 2XUFA 5JPIA 4A6DA 1QYWA 3K8OE 1NBIA 4L50A 4L72A 2BZGA 5KHOC 1OROA 2N9UA 2FMIA 1U28A 1C8VB 3CU5A 5I9TA 3T35A 1YVUA 4CM6A 1QTNA 5BWOA 2VQ3A 3KFXA 4LE1A 4JVMA 2DUNA 4ZJPA 3IDZA 3JRWA 3SJBA 3H2HA 2CF5A 4JQYA 2QMZA 4HJRA 1DCKA 5KNBA 5B1YA 2QA5A 1R3DA 2G1KA 1VJGA 3DOEA 2O4CA 2OHOA 2EFHB 3JYQA 1ES9A 3Q0IA 3R09A 4TV8A 5B58C 2Q5LA 2AC7A 3RI3A 4G8DA 4R1QA 4KWIA 4LBVA 4AW9A 2VDKB 1OC4A 3CVUA 2TMGA 4HDMA 1U0OC 4OP1A 4CODB 3ACDA 2R8ZA 3AF6A 2IGBA 4EPYA 3SQDA 1C7ZA 1CJTC 4UMVA 3RC9A 4C7BA 4X1YA 3OLWA 1C81A 1HMYA 5AI9A 1BC5A 3DEJA 4UHFA 1NQUA 3BC1A 3IGFA 3LT1A 3MJRA 3MGGA 4FOLA 2QVXX 3DB2A 4XD7A 3FYUB 3PZBA 3TMYA 2HXGA 1KDYA 4BJ3A 2NTJA 3G8CA 3WGHA 1NMZA 5LZ7A 1RR6A 1ISGA 2LTAA 1ADFA 3IHTA 4UAUA 3WI7A 3X43A 3ZDYB 1ORWA 3PXUA 2F17A 1JEQB 1DFIA 1X70A 1XA4A 1QR2A 1PR1A 1BFKA 4ZC1A 1BGVA 4QDOA 5EE3A 4E21A 2QD2A 4YUAA 4O3MA 1O95D 1Q0UA 1N2JA 5IJZA 2XRYA 1ILEA 4RF2A 2OR3A 4GIBA 4UC0A 1LVHA 1LDYA 1OV6A 1T9AA 1YVDA 2FWJA 1FUEA 2ODBA 3DWIA 3HYRA 3B85A 4HWOA 3H4TA 4TL8A 1K0FA 1OF1A 3S7TA 2ACVA 2PJUA 3WNVA 3JWPA 3SQLA 3STYA 1J1ZA 3RIGA 5BSFA 3RGWS 1Q14A 3I2HA 4KO1S 1BWPA 2NU6A 2V9ZA 3DZHA 3N0XA 3QXCA 4I6EA 2QTVB 1WL8A 3A4TA 1SQGA 5AJHA 1K7CA 3B3FA 3DBHB 4EELA 4YCSA 3LLCA 4KFRA 5HTOA 1AK1A 1JB1A 1CKEA 1ONSA 2ZIXB 1Q11A 4NG4A 4IJ6A 1D2NA 4PTLA 5B36A 3ISTA 2EATA 3NLLA 1USUA 2VCHA 1TEZA 2J0EA 1NW6A 3DT6A 4ZQGA 1E66A 3COJA 4GYYA 4F84A 4YRQA 1XAHA 3HL0A 1HNXB 4UNIA 1CUWA 1RKQA 2WUVA 3HJRA 4OB7A 4A5OA 5LMZA 3HFJA 3G0DA 1EQUA 4YJ3A 3WWEA 3UAZA 2XMBA 4BWVA 2W6JA 3H4VA 2P40A 1LI7A 4PR0A 1N2OA 3K72B 5E4FA 3LT2A 3QPWA 4ZOCA 1RM3A 5FOUA 2P6NA 3QI2A 1SRRA 2PKXA 1DWQA 1J90A 1YRLA 2QZZA 3HBNA 4FE7A 4P84A 1WW2A 2GK4A 4RCYA 3RC2A 4PCAA 5F7JA 1CQWA 3SZUA 1MLDA 3BRWA 2WG1A 3ITDA 4DUGD 3DZIA 1C9EA 1E7SA 1ZBQA 3VOTA 2P75A 4KAXA 2IQIA 4X62B 1IQPA 3LTNC 1H0RA 1NXQA 1HT0A 1Z5UA 1W5AA 4JB2A 4QPCA 4RZUA 2P8SA 5LZ5A 4H77A 4MKGA 2PX8A 3HVHA 3G85A 1QUEA 3MS7A 1TW2A 3OLCX 1E4VA 3SGLA 3GBSA 2EDCA 2WF5A 4RA6B 4BRSA 4C5AA 4DA0A 4ZJYA 9MHTA 1EG2A 3DO6A 4MR8A 1LBQA 2LV8A 1OIXA 2C7BA 3ITNA 3LP8A 3NV9A 1YHNA 4PNPA 2YW9A 3TM5A 3AP1A 3VTAA 5EJ7A 4XLLA 1JFTA 1P1IA 4HWKA 4L57A 2VHJA 3TVDA 4MQ6A 2JCSA 2ZBRA 2WZQA 1F7UA 4UEQA 4DXHA 4RX1A 1P0IA 3H65A 1GL6A 5BORA 1JAIA 4I1IA 4JIGA 5JG7A 4BX3A 5FTWA 1FSFA 1A2OA 1NW9B 1Y9ZA 5KDOA 4J2OA 4XCQA 1E61A 3CLTD 3HXMA 1ZZEA 1IG3A 2A33A 1V8OA 1TA0A 4OM8A 1KQNA 3KZCA 3LZ6A 1SCIA 3LCMA 1J2JA 2FN3A 4REQA 4KTTE 2V7WA 2XUIA 4IG9A 5HPYB 3E5RA 5BV2P 5AHKA 3RF7A 2YJTD 5ALEA 5K8LA 1G0NA 2CCJA 2ZANA 3V8BA 1KZ9A 2QTMA 3KZXA 4X20A 2BL4A 4TS3A 3AGQA 3I30X 4JJIA 5CCBA 2V55B 2ZSIA 2V3VA 3EBLA 3WYAA 5ALYA 3A6EA 2SKEA 2XQGA 1E3QA 2PHZA 4DSUA 4L0MA 2W4QA 4UHHA 2JHPA 3HCBA 1KU6A 3RTGA 1AURA 2Q41A 4RTQA 2JLUA 2W2OA 3L7MA 3S2GA 4A6XA 4F9EA 1A5AB 2VF4X 4LJSA 5TQ0B 1GXSA 1ZOOA 1L7RA 1USVA 3L8DA 2IUTA 4YXWD 3L01A 3ZCPA 3TK1A 2QEQA 2RONA 3AEXA 1RBQA 1ZP6A 1FFEA 1PK9A 3OY2A 3UMBA 3MZ0A 3ELDA 1Z2PX 3KPJA 2A0XA 2ZB3A 3ZW7A 2VTDA 4PPFA 1V41E 1SWWA 4RLFA 3PHCA 4X1KB 2DBQA 1CUDA 4HFJA 2FFHA 4AT1A 3L0SA 2IT1A 2YOGA 3DEAA 3NP7A 5CX4A 4BS9A 3FUUA 1R8YA 4OQQA 4ZQBA 2J0SA 1IJKA 2WT8A 4F2WA 1QTQA 3F6EX 4BXOB 3HFRA 1G9TA 1W2WB 1S2IA 2Q6IA 3QMMA 3Q2IA 1X7HA 3MINB 2CD9A 2WVGA 3QVJA 5C81A 5KU7A 1P8AA 3HFSA 4ZAGA 1Y6GA 5FIUA 1RPZA 4GHWA 4XVRA 2GASA 3HCNA 1XN4A 1Y4DE 5KTMA 4HXEB 4P38A 2AMYA 4TXMA 4MV7A 2WVHA 1JLRA 2IYLD 3D64A 1Z2NX 2VAXA 1M5UA 1O4WA 3G0IA 4KN5A 1DEOA 1Q7RA 3N2YA 3QEOA 4Q7EA 3WGLA 5JSQA 3AVXA 3ZQ6A 2A84A 4PXYA 4KLNA 3PF8A 4PANA 4OUKX 3C74A 3TE6A 4AF6A 3MQ2A 4AECA 2R86A 3UV7A 5BYKA 1MABB 4MYTA 1DAGA 4DNQA 3RJMA 5BVGB 4NY1A 3GY0A 1WTAA 3R6GA 4QYXA 3FOFC 5LA6B 3MS4A 1A9PA 2QX9A 2FEAA 2A92A 4KFCA 3B3AA 4EKYA 1N2ZA 3B6ZA 3KLPX 1KVQA 4BMYA 3TIXB 3MELA 1EVEA 2KI5A 2R2GA 3DMTC 3L0IB 3EFEA 3TLYA 5AKLA 2I4NA 1DC7A 2B82A 2WA2A 3D54D 1XK6A 5EJMA 3GARA 4M1EA 3NUGA 4PHCA 1F8XA 1F4LA 3F9RA 2AWNA 4B6OA 5J4YA 5ADVA 1QXSA 1U94A 1VKRA 2R48A 5KAPA 1YIDA 3CA8A 4AKSA 2OORC 3V4VB 3GNSA 3A6DA 5KTPA 2FDCA 3OF5A 5EWLA 5FOSA 1RAIA 5HK9A 1Q77A 3TEMA 4EA9A 3CURA 3I6QA 2ENUA 4OI1A 3U09A 3WZLA 1WDTA 3IPLA 5EZ5A 9LDBA 4ZT2A 3UMYA 4NZMA 1BS9A 2I4IA 5KX5F 3AOEC 3EVAA 3RWBA 4YROA 1HTWA 4CM8A 4E3WA 3LKBA 5JCJA 1TM5E 1HRDA 3HBLA 3ZU3A 2GFIA 2W6OA 5KAMA 5BT9A 1CQZA 1TQ8A 2RCNA 5DIZA 1XF1A 4TM7A 1O0CA 4EX6A 1RXWA 3ER8A 1MDBA 3FA2A 4MVCA 1TEHA 4UREA 4DPLA 4EZIA 3SKVA 2FMXA 4WGFA 3OHPA 4RGVA 1SAYA 1TCVA 1QOQB 4PO8A 4EGCB 5LOVA 1KQOA 1J0CA 4XRGA 4RXTA 5HCIA 2GETA 3TX6A 4DLLA 1OFUX 5ILGA 4HEHA 3VR2D 4DQ0A 5B3LA 1KK2A 2E0IA 3ROFA 4A0HA 1BCRA 1ZGCA 1NSYA 2MU1A 4MQLA 4RFSA 5TQ0A 2OGSA 2WVJA 2QN2A 3PLNA 4L6IA 3VR0A 2OYSA 3DO5A 2XX3A 3H2GA 4IKOA 3MJHA 1DUIA 1MOZA 1D7OA 1WXEA 2GZ1A 4GM0A 3RJZA 2R7MA 1JJVA 4MRAA 2PVPA 2WR8A 3B48A 4J94A 3W5AA 1QK5A 4KGVA 3MRVA 1M1UA 1HOXA 3FUWA 3MSCA 4ILEA 4DCCA 2XB6A 4ZICA 3GDWA 5FULA 5JZ9A 2YC2C 5AW9A 4HD8A 1CY0A 2M6RA 3DBVO 4FLFA 4ZAXA 7MDHA 3I45A 1OFGA 2B9VA 3LBIA 4NXMB 3P2MA 5J5AA 5F3DA 4AD8A 4XIYA 4KMMA 1NP3A 2HRRA 4EAAA 3ZN2A 3CVVA 2GEJA 1HR0B 5B6PA 4G9EA 4QSHA 1BMFA 2VTKA 2OXCA 3FF1A 4HQOA 2ZYSA 4MQ4A 1WXIA 1N34B 3IQDB 4MQEA 4I5FA 1PBTA 2NXJA 3EAGA 3D3NA 4PLVA 3SEZA 3WWYA 4FYIA 2O8FB 2GCOA 2ETXA 3T06B 3QSYA 4PZCA 3K30A 3L92A 1UMDB 2JJ1A 3ASYA 1KFKB 3MPOA 5ALIA 3KQLA 3QE3A 3CSSA 3AEKA 5BO5A 4LZAA 4FQ5A 2QV0A 2VHYA 4JR0A 2R751 3OZBA 4R1OA 3SBEA 2SBTA 4WXPA 2IEIA 3GRKA 2R44A 4TUYB 2B4TO 1YJ5A 1PJQA 1H5NA 3AHJA 3QF7A 2QTTA 1GAWA 2HNBA 1XMPA 5B58T 5FAKA 4KZPA 1N2EA 5EINA 2W2QA 4X1OA 1GSAA 4U63A 3HABA 2PFGA 4F8YA 2HL6A 4EJFA 3F6RA 3Q8XB 3D0QA 2JFZA 3N05A 4ENSA 5BN3A 2NO0A 2E7ZA 1I4WA 1VMDA 3A31A 3GJXC 4DR6B 3A06A 3WBFA 2JLXA 1E1QA 4DR7B 1D4ZA 3N2IA 1I5EA 4WKBA 1X15A 4P4LA 1O0SA 2WNSA 1TQ4A 3TINA 3ZCXA 1MU0A 3JQPA 3SDZA 3SJAA 2DLDA 1A50B 1PZNA 4I5IA 2QMYA 3GR6A 3Q3IA 1M8FA 4JN6B 5GM1A 4JBIA 3CINA 3DLTA 5EEGA 1HY3A 4D7AA 3DFKA 3DE1X 3M1AA 4RY8A 1GADO 3KL4A 4DWVA 3DMTA 5D3MA 2IYVA 1RP7A 1N5OX 1V8PA 3LTEA 3K6RA 1RAAA 5IDYA 3L4BC 1JFFB 4XFDA 2FUCA 1KYZA 4RMHA 4KDCA 3R3VA 1P6XA 1UZNA 2PA0A 1PGQA 3LV8A 2OORA 1SCJA 2CHUA 4QVIA 3VJRA 2M6SA 4YP7A 2EBWA 3HI4A 4X3OA 4Y2GA 4XWGA 4HQNA 3I8XA 4H7IA 4D26A 1KDVA 3M6UA 2IZ1A 5TXGA 5T67A 3KS9A 3O26A 3VFDA 2CLCX 3UTDA 2P0AA 3AOEA 4FEAA 5LB2A 3TIVA 3VO9A 3WDLA 5DGHA 3ZIDA 5F9HA 2B1GA 3W7VA 1CUBA 4UW9A 2IUFA 1Z7BA 2W58A 4MS4B 2NVUB 1ZNYA 3AIIA 3A1SA 3ADKA 4ZI2A 3M89A 2IYAA 1A4IA 1G21B 1Z0AA 4HMPA 4I55F 1P4HA 1L7AA 1TCAA 4JQSA 1QH1B 2O50A 4NNOA 4YUVA 4CLXA 2NZYA 4RKFA 2PUBA 2OZEA 3R74A 3UT6A 3GZNA 5I7VA 1DARA 2NZUG 2GCNA 2PU5A 1E6UA 1XTZA 1ZMOA 2RAUA 4JI4B 2GWHA 4G84A 5A0VA 3P0RA 2P2SA 1C8KA 1WO8A 4CWAA 3UYKA 3CVWA 3KQSA 5M29A 1ZUD1 1O57A 4Y3UA 4NBWA 4UEOA 3PC6A 5DDIP 5AXDA 3D2CA 4FT2A 2R7AA 4IGEA 4E7OA 5FUWA 2I91A 1QGED 1N5RA 1YHYA 2X1HA 3A6GA 1B6SA 1HNNA 1VYVA 2DTDA 3CF2A 3M2TA 3NIFB 3A9VA 3S1AB 5E6UA 3FUXA 1TIBA 5C53B 4AYTA 3DAGA 1VHJA 4FXOA 5JATA 4DT1B 1D4AA 1JPNA 4CIWA 3JAWB 4MQ5A 5HOEA 2DWQA 5I4BA 1K75A 2J6HA 4M9ZA 1LY1A 1G6OA 3D7MA 2A3RA 1FDSA 3IMGA 2IW3A 3KKEA 1GNRA 1QP8A 1YIAA 2HCJB 2O0KA 3T1TA 4A16A 3NRBA 2XKJE 1PZMA 2JLCA 4D9EA 1MOQA 3PE3A 1G64A 2IOFA 2DF8A 1UDWA 1C3VA 2I6UA 1TM7E 4NV3A 5ERYA 5EPEA 1A7JA 2HT1A 3A3OA 2PJRA 3R5HA 1BJTA 3SHOA 4MQBA 4L51A 1L9KA 3NHWA 4KO4S 4R5HA 4ZI7B 2QM7A 3KJIA 4D9GA 4QU5A 4QDTA 1NBMD 5KTKA 1KEWA 3OWXA 1P62B 4TXNA 5KNDA 1N33B 4AKHA 1EVIA 4U0KA 1A5SB 1IY0A 1DBRA 1JTVA 3ASUA 3OT4A 1PO7A 2YNMD 2ZUWA 4IMRA 5ELLA 1KZYC 1X74A 3KUKA 4CF3A 1V43A 7REQB 2UV8A 3OY7A 1F9AA 3Q3HA 3OG9A 2ZRGA 4WLEA 3SEFA 3PQEA 5J2UB 4U00A 1ZH4A 2NQ2C 1MZPA 1S8OA 4G89A 4C3VA 1WD7A 3SKYA 1CY6A 4PZZA 2VJMB 5DXAA 1CEXA 1G20B 2VEDA 3STVA 3K9GA 2AK2A 3WYNA 4JV5B 5HIAA 1ISJA 4MWDA 4I0WB 3ZV6A 2QZJA 5CA0B 4UBMA 1YU9A 2ZIVB 2PZFA 3OF3A 1LH0A 1K3UB 4XJVA 4OQZA 1GU1A 2FFQA 3NKFA 4HTAA 5F9MA 5KVQA 3O2QB 5KOIA 2OAP1 1U80A 1D7AA 4JJKA 5F35A 3TLGB 3H1AA 4FDMA 4ER7A 1PK7A 4NP6A 3QOFA 4LDPA 4QXRA 1Z15A 2QB5A 2AI3A 3PUXA 5CRIA 3QX3A 2XB2A 2A58A 4MV1A 4RENA 5EP4A 3CUKA 4AJ1A 5FOQA 1SCBA 2B2XA 3Q9NA 1JDSA 3DZCA 2JLVA 2WWTA 1SRQA 2XGOA 1AN9A 2YJ6A 4U7TB 4C0AC 2D4AA 2DQZA 4D4GA 1QGUA 4R98A 2J5BA 2BY4A 2P68A 2FPRA 1FZQA 1U0NA 2UVQA 2JCYA 2WINI 4KP7A 1U1DA 3UFXA 3WKEA 3MWDA 3VR4A 5JAHA 1EWKA 2JKZA 1V39A 3T0GA 3ZZ1A 4B76A 3K1AB 1WQ1R 4YJHA 2A0WA 3PGLA 4ENUA 3U48A 5H4GA 5COQA 4UZEA 2Q2OA 3L4BA 5FHRA 1VIAA 2A6PA 1E5QA 5FFMA 2Y67A 4EBBA 2C9YA 2B83A 2P79A 2XA2A 3CX3A 4KWTA 1OWLA 2HPHA 2LDBA 1YS7A 2C3YA 4KDRA 5ALPA 3QVXA 2HJHA 3AR9A 3DEZA 6NULA 3PJRA 1EXNA 4FYXA 4C2TA 1DTWA 1AUOA 1GQQA 1NNUA 1X19A 2ZT8A 3FSGA 1YB7A 3ON5A 5CEJA 3NIGB 4IH1A 1JQBA 1A27A 4UTXA 1XYVA 1NF2A 1IQUA 2ZUVA 4QRDA 5AESA 3LYHA 4RKWA 5CB4A 2BONA 4PWYA 3RD5A 5KWJA 4JEIA 2Q6LA 4GM4A 2ZUCA 3B7PA 3E81A 2NP7A 4IIJB 1I6MA 2AWOA 4YV0A 1LDBA 4Z9AA 5LBIA 1JQLB 1XEXB 2GEBA 2PRJA 4ISCA 1YB1A 3SQNA 1AX9A 1LU9A 3JAKA 4KNWA 1JH9A 4LOAA 1P5RA 3LM8A 3P4UA 3KWJA 4P3KA 1NUUA 3K15A 3SLRA 4B3FX 1QVAA 1Y1LA 1VCOA 2QUJA 1KJNA 2AIRA 2B2CA 2HNAA 4NNPA 3GRAA 2AEEA 2QKYA 4J7CA 3E1GA 2HPZA 1EWYA 3TEJA 1YR7A 1ULZA 3TLZA 3D4LA 1ATZA 3E5MA 1VGQA 5EGSA 5CG2A 4CEJA 4KTVE 3B1WA 2AW5A 3PRYA 4KXMA 4J1TC 4IICA 4FKBA 2QMOA 4IXWA 5E1DA 3UMFA 4DQKA 1SXJE 2PL5A 5E0OA 2GPNA 1P7PA 3BTOA 3P9XA 4IIGA 1P0FA 2Q4EA 3PNSA 4RJIA 2X5OA 2AEFA 4XI9A 2B4YA 4GICA 3GQBA 3E4CA 4WXHA 4X8HA 5U4QA 4KGZA 1X42A 5A4FS 1DLJA 1JPUA 4ES6A 3VV3A 4MINA 5E95A 5KTRA 1HDOA 2H8KA 3ANTA 4O1HA 2NTYC 1WS6A 3T12A 2C61A 1KAQA 2HMVA 3UJDA 4CI0B 1OYWA 1YR8A 4G3XA 1UXHA 3V42A 4R2WA 5B2ZA 2O14A 4P53A 3UT5B 3N70A 1V7CA 1WDWB 3N8GA 2FB9A 3KSBC 1XWFA 5C9ZA 1ZNZA 1Z4JA 2GSDA 1IWPB 5C5DA 4LF5B 4YFVA 3TLAA 5HFAA 1PSDA 3F7TA 3OZGA 5I51A 4JBHA 4DOMA 2D6FA 4OIMA 4QVKA 1ECBA 2NYVA 2Z6VA 4R71A 4EIWA 1OLSB 1S3GA 1FP7A 1RFLA 1D6NA 3VDRA 2Q4DA 1WY7A 5CLHA 3U7QB 1ZN7A 3HJAA 4OYYA 4YUXA 4XM1A 4IJWA 2FE1A 2CB0A 4C08A 2RGCA 1JA0A 3SS8A 1OBHA 2BE7A 3V6MA 4WINA 2Q28A 4TWIA 4X71A 4ZOEA 3GCWA 4Q37A 4YCAA 1JXAA 1T43A 4P7FA 2R8BA 2AEJA 5LZ4A 1FW8A 1EDDA 5DGTA 1NDHA 1VG8A 2BFCA 2PV0A 4AZTA 1Y48E 1Z2AA 4EI2A 1V9SA 4KQ2A 4LGMA 4F6LA 3AINA 3WQSB 4M37A 1FFSA 1C0IA 1PW7A 3DULA 5FBVB 1G7RA 3EVTA 1MG0A 1GM5A 3SLGA 1JZQA 1LDNA 3WLQA 1I0IA 3NTLA 2GF2A 1Y80A 1C0EA 5KDLA 2GEVA 3OESA 4AZWA 4WKNA 5DO9A 5C1OA 3N2KA 2W8BB 4PICA 3HRIA 5IM4F 3DEIA 3IVMA 3QG1A 4QUKA 5LMCA 4FCVA 4OAOA 4ASUD 3GWZA 4F4DA 4LFCB 2D2VA 2W37A 3RFXA 5KTOA 3FWKA 5JS7A 1JV2B 1XB2A 5CAEA 1ISIA 5KQMA 5F4BA 1ZK3A 4IUCS 3VDMA 3HA3A 2DQKA 1B41A 2O2DA 1X1RA 1JSRA 1LLDA 4F4UA 1L8AA 4HNTA 3CNHA 1C4XA 5D84A 1M67A 2WK1A 2D5LA 1M66A 3AXTA 2HW8A 1IRXA 2A5DA 1RLJA 1CUEA 4IIVA 4MV3A 1Q0SA 2ISSD 2Y0PA 2W93A 3NAQA 1E8MA 3D7KA 2H6EA 1ORVA 2BFFB 1QX3A 1Z4PX 2QE7A 4OSOA 3WIBA 4A8PA 2OHGA 4AN4A 2AXQA 2HEGA 5EMLA 1WETA 2XCRB 2I67A 1OHHD 1LLCA 1N3IA 5I9SA 3TW4A 1ULAA 2F1JA 4P81A 4MV8A 4RTPA 3ST7A 4C7JA 1A2BA 2IXBA 2WSSA 4M7OA 1BVUA 1N6IA