3TB4A

Crystal structure of the isc domain of vibb
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
205
structure length
205
Chain Sequence
IPKIASYPLPVSLPTNKVDWRIDASRAVLLIHDMQEYFVHYFDSQAEPIPSLIKHIQQLKAHAKQAGIPVVYTAQPANQDPAERALLSDFWGPGLSEETAIIAPLAPESGDVQLTKWRYSAFKKSPLLDWLRETGRDQLIITGVYAHIGILSTALDAFMFDIQPFVIGDGVADFSLSDHEFSLRYISGRTGAVKSTQQACLEIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the ISC domain of VibB from Vibrio cholerae at atomic resolution: a snapshot just before the enzymatic reaction
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
molecule keywords Vibriobactin-specific isochorismatase
total genus 75
structure length 205
sequence length 205
ec nomenclature ec 3.3.2.1: Isochorismatase.
pdb deposition date 2011-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3tb4A00
3OQPA 1NF9A 3IRVA 3MCWA 3V8EA 1ILWA 2WT9A 3HU5A 4H17A 4L08A 4L07A 2FQ1A 3TXYA 3PL1A 3R2JA 1NF8A 2H0RA 3TG2A 3O92A 1XN4A 3O94A 4WGFA 3OT4A 1J2RA 2A67A 3O90A 1X9GA 1YZVA 2B34A 3R77A 3O93A 3KL2A 3HB7A 3S2SA 1YACA 2WTAA 1NBAA 3LQYA 4WH0A 3TB4A 3UAOA 3O91A 1IM5A 3EEFA
chains in the Genus database with same CATH superfamily
1U0OC 3S4YA 2BTQA 2YV5A 3QTLA 1TD1A 3I64A 1QZTA 4FN5A 4IH9A 4YYEA 1CEYA 4L6IA 2VJNA 3K0AB 3WYGA 1OASA 1G2QA 2VDNB 5B3KA 4HFJA 4ACBA 1Z6ZA 3AJDA 4BNJA 4UTVA 1J00A 1KFBB 2BGIA 4CQMD 5C2JB 2RJOA 3DQPA 1MFZA 1ZXBA 5G4LA 4X6YA 1O94C 2XSZD 4N39A 1PV2A 4TS3A 3KLNA 1WP4A 1BGXT 2E6KA 4JQZA 2EG9A 3C3EA 3OM0A 1IY1A 1GRVA 5FOWA 2PWZA 3O1IC 4UATA 7REQB 1GPYA 1S4MA 1T15A 3D1LA 3GEHA 2XVZA 3GFGA 4MQUA 5ALZA 3X1DA 2CUZA 2X5OA 3UA4A 3VZCA 2F1RA 3H87A 2YJTD 4JI7B 4M1KA 1OGJA 2NO6A 4CF6A 3QA9A 4P35A 2WI8A 4ZHSA 1ZVQA 1M5UA 3KD2A 3OPMA 4EQ6A 2XE7A 3AOEA 4EZEA 4PLVA 1FX1A 3D8UA 3ETNA 3COWA 4IZIA 3GLFE 4EF5A 1AQNA 1ESDA 4OG2A 4EPYA 5L4LA 4XQGA 1UXOA 1XWFA 3ACCA 3KZOA 7ABPA 1J2JA 3R0QA 1WPGA 4ZOLB 2YMLA 3EFEA 5EQDA 3AB3A 1YIOA 1UMBA 4FYJA 4KGXA 4CM1A 1W9MA 4W9MC 2AHRA 4UNRA 2O2DA 4H35A 1DBPA 4Q4CA 1CQXA 2CXHA 3IUBA 1LB1B 1LNQA 4QPPA 2D06A 4WEQA 1XU9A 3FCCA 1T0UA 4FFBB 2C9MA 3JTMA 4BFUA 3VNSA 3ABRB 4OGGA 1E4EA 3F7OA 5TXGA 2I4MA 2QUJA 3AV0B 3E1KA 3VA7A 1DDOA 3HXOA 2I2DA 3ILHA 4LXXA 4B3IA 4QM6A 1R3DA 3JVDA 1T4DA 1IZYA 3CNEA 5TEVA 4F2HA 1W8DA 5B58C 3MM4A 1N36B 1N6HA 4ARUA 2GHIA 2CZCA 2LTAA 2EZ8A 1TM7E 4M22A 1NFQA 5GTDA 2JLZA 1EVLA 2XVXA 3ZHZA 4KGVA 5KQRA 4X0EA 4WK2B 4NG4A 2W43A 3KJHA 4J16C 4KI7A 1MAHA 3CJRA 4HQFA 2JH8A 3DVRX 3WIUA 4U9UA 5K99A 4E1VA 4B9AA 1DG9A 1PX0A 3LA6A 2WWTA 4R6WA 1E32A 1PHPA 2IU0A 4UXHA 4B6PA 1IUKA 1TO6A 1ZY2A 1ZH2A 3A25A 1EVJA 4F71A 1RYYA 5JXWA 1EFHA 1CNEA 1HEYA 1YJ8A 1L4UA 1FW8A 1VCNA 1YS4A 2C9BA 2OBLA 3DZFA 2OFOA 3PQ6A 2Y9PB 3BFJA 3HB5X 4YQZA 4JBYA 3G8AA 3IVCA 4S0XA 1P3Y1 1VA4A 4OYYA 2ID4A 2UV8A 4PNPA 1II0A 1BYIA 3AY7A 4DLZA 2X2PA 1C3EA 1Y3CE 4HUJA 4M98A 1XQ1A 3QVVA 1T5TA 1EYZA 3AI7A 4JUIA 4B6GA 5CNIA 4PG8A 2ZWMA 2QVZX 2V74B 2W2QA 3F7TA 1DMRA 1GGHA 2J5XA 1UPAA 5CM8B 3M5DA 2NTEA 2O0HA 4U7JA 3X2FA 4MLPA 5CW2A 1E7MA 1WSBA 1DFHA 4ZREA 3JX9A 5K4HA 4KL8S 1C7RA 4ENUA 2UUPA 3LXUX 3PICA 4C0XA 3E9MA 4KXNA 5CVDA 3SIPA 1JH9A 1XYYA 1Z7WA 3LKVA 5FL3A 1ONNA 1QQ7A 3RYHB 3BH0A 1QCYA 4ZU1X 4DA6A 2FV8A 1I94B 1E3MA 4XLTA 3MJSA 2FP4A 3K16A 3SZLA 2HU2A 3UOGA 4B9EA 4C9BA 4WXPA 2BFMA 3PIRA 1KU6A 3CN9A 3G59A 3CRMA 4CUZA 3BBLA 2OV4A 3DDOA 3W5JA 1FYEA 2AG8A 3D7LA 4HEJA 4BQEA 1F7UA 4KH1A 3WIOA 2Y4NA 2EF0A 5L7WA 2TMYA 1CUBA 5D6OA 1T5IA 3KVOA 1YVDA 2HH9A 1I7NA 4YGYA 5AJWA 1K7XB 2IKSA 1P6UA 2RGCA 1BFKA 3HV2A 3D3WB 5DK4A 4BQSA 5C8YF 4NCJA 2V1UA 3HUDA 1Y3FE 1I3NA 2I3DA 3DMTC 3CE9A 3RLIA 4Q1AA 3EPHA 5EMJA 4X71A 2R4TA 4PM4A 5BR4A 1VJ5A 5DHQA 3H6GA 1EFAA 4WFJA 3R0VA 1N5OX 4BJ6A 1USKA 4HH1A 5HZGA 4D74A 4Q7LA 4MA5A 1LY1A 5IHXA 1XRPA 3CM0A 1QVRA 3NHBA 2X8WA 4IGIA 3N5KA 4J0CA 2Q7DA 1BWSA 3MW8A 3MJ4A 4S05A 1ZJWA 4B43A 5EUQB 1H2YA 3UUGA 2W0SA 5HGXA 1X14A 1O57A 2V5VA 4E5SA 3L8CA 1BEZA 3UN1A 2WKPA 1ODJA 3QUTA 4V3BA 4MGZR 2ID7A 3TLAA 3U4QB 1C7JA 2OG1A 4QZVA 4HAZA 1TVEA 2BI8A 2IF2A 2IW1A 2WPDA 5SV2A 2FN4A 2JASA 2NV0A 3A1NA 5JMPA 1N6IA 2B1IA 2JAPA 3I04A 3ZKAA 4B0PA 1JHRA 2R97A 4W5TA 3WQBA 1GQYA 2R7AA 4AUKA 2DFLA 2GHTA 3U4IA 3ZCSA 3H86A 2BGJA 1NM5C 4RM2A 1G20B 1DBQA 1Y1QA 3GP3A 4NMXB 4Y6PA 1H4QA 3NBZC 1IZ0A 5SY6A 1DARA 1P61B 3GU3A 2CVFA 2J4CA 2VPQA 3H05A 1JSRA 1ZD9A 3K6JA 4BE9A 4EDFA 4JYCA 1FTYA 1T9DA 3D8NA 3LLVA 4BYMA 4CFZA 1PR6A 3WRXC 4ZCTA 3NHPA 4CFSA 2JK1A 3FRIA 4LRUA 4A6PA 5LKAA 2GFQA 2H7XA 2VT7A 1KDVA 3SYNA 3VC7A 1KJJA 4ND8A 4H0NA 2I6SA 1J06A 1BN6A 2PWBA 4Y1RA 1E3DA 4DMHA 2OHVA 3QXXA 2NO5A 4Z1MA 4ZDJA 2R6GA 3ECAA 4JB3A 3TVTA 3UYKA 5I7OA 2HQSA 4FYXA 3TQTA 3QX8A 4JEUA 1U9ZA 1SPXA 3COPA 4I6GA 2H92A 4QOIA 3A37A 3WA6A 2FFBA 5FAXA 3BXFA 2HV9A 3DP7A 5I51A 5KX5B 1OW3B 4OHVA 4ZEOA 4ECEA 1H85A 5FFFA 3RVLA 2BF4A 3H3XA 3WYCA 5BSTA 3NXSA 4NKRA 4JLBA 2V4MA 3UWPA 3W6UA 4KV7A 4I55B 3U62A 1ZUNB 4WKOA 5H5JA 3U09A 1EFVA 1K7FB 1P1BA 1Y1PA 2RH9B 4RLHA 2ABWA 3ROMA 4CXMA 3MG9A 3BFXA 3DDNA 4PQRA 1PNQA 1KHHA 1ULUA 1KMNA 2RAFA 2QPOA 1GZ4A 3FWNA 2PE5A 2V96A 1L8AA 1H05A 2WKWA 4BLWA 3WK9A 1W76A 4MQLA 4X44A 3UOWA 4NFSA 1X0XA 4MINA 1RKBA 2QK4A 1VZ3A 3MJVA 5D87A 4AWXA 5CK4A 3ZD9A 3HXLA 4DOMA 4LCEA 1IN1A 5EQFA 1JHZA 1OREA 3DVAA 1VE1A 1Z5VA 2FVYA 3LY9A 4Q24A 5CTJA 5CHEA 1QVAA 3RVOA 5IN5A 3UJ3X 1Q0QA 4FOLA 4DV3B 1AZSC 1QCCA 2DF8A 3BFKA 4QHYA 2VDQB 4NX2A 3ICOA 2OV6A 3B5JA 3OCCA 4G8BA 4U7WA 3JQGB 2J6IA 2Y99A 4KPUB 1FJ2A 4DJFC 1P2DA 3SIXA 3PHIA 1W34A 2BP7B 3FR7A 1AK9A 1C7FA 1A50B 3O9MA 1KXJA 2OHOA 3SS7X 3ZE9A 2QVXX 3LL7A 3MLBA 3DOFA 3PQ5A 5HDQA 5IDVA 5CEFA 3IBGA 6CHYA 1QE0A 2RGDA 4HEA1 5L51A 2P5TB 4QEKA 1NXWA 3ZXYA 1ZA2A 4TQAA 3FLAA 1Z2NX 1J1UA 2F8LA 4JQSA 4D9NA 4M0CA 5P21A 3OTOB 1CJVC 5BWLA 3HA7A 3TOSA 1JBEA 1XXHE 3IAFA 2C7RA 1I3CA 4GR4A 2XUDA 4QYTA 4BLOA 2CZGA 4TV9B 1B8UA 5EKTA 1T8SA 2IHZA 4E5KA 4I3FA 3PPXA 2WWXA 1TQ4A 3T35A 4IP0A 1OXSC 1Z07A 4HRAA 3OSUA 4K03A 3WGNA 2FPOA 1OI3A 4CUJA 3LDGA 2FGKA 4C04A 1XMOB 2ZDHA 4HBGA 5E4JA 5JZMA 2IUYA 3ID6C 4MR8B 2CLLB 4I9UA 5MF6A 2O3RA 2M1XA 5EVCA 2AW3A 1YXMA 3M6MD 2PSJA 2QX6A 4BGIA 1GLGA 3OTQA 2K4MA 2CXUA 5FYDA 1OUMA 2WWGA 1NHGA 4XVCA 3LUPA 1BE1A 2J0UB 4U0JA 2FF7A 4UUBA 3TNLA 1G8SA 4BNTA 4FVTA 3I34X 1XVIA 1CC1S 1GKIA 3V5NA 4EUEA 4KI0A 3ND7A 1PT7A 1G8JA 1XMVA 4ND7A 2J7PD 1S7GA 1XF1A 3IEKA 4HGZA 1CB7A 5DF1A 3UNXA 4AP6A 3RANA 2AV6A 4B4UA 1WXDA 5JMTA 2QTHA 5I4IA 3E1GA 4F4DA 3L4SO 4GBMA 5H8WA 1QK5A 3RJMA 2ZT5A 2EP7A 5IUNC 1RBQA 3TLBA 2IEZA 2C9ZA 3TMAA 2GSWA 4EJMA 1MEEA 1XZ8A 4LYFA 4BQOA 3VPXA 3KQHA 5T3YA 1NZFA 1IQRA 1K8XB 3E81A 2AK2A 4YJHA 3W4IA 4TM8A 1L1RA 1A2BA 4DMKA 4L16A 2IUFA 1K0FA 3B3FA 4KAJA 4KWCA 3ZWBA 5JECA 3P4YA 2WWRA 4R40A 4HJXA 1KR5A 2CL7X 3P9ZA 4PFQA 4F5DA 2IBTA 3BA1A 1E1RD 3EJWA 2EXXA 3GNQA 2ZBPA 3UWMA 4LYAA 3WAGA 1C9DB 5EXDA 4PQGA 1ST2A 4B4KA 4AQYB 1U2DA 3C6ZA 3AZQA 1II8B 1XCGB 3GGDA 3QXCA 5DBHX 5K3FB 5BN4B 3HJHA 3INNA 3MFYA 4JHXA 1H6BA 4EHDA 3DV9A 2WJGA 3AF4A 4X94A 2QLMA 1ZM4A 3DGEC 4OGLA 4YHHB 4XA8A 4ESEA 3OOHA 1VJ1A 2RGNC 4J2HA 1XTVA 521PA 3M3HA 3V1KA 2CE7A 4FHZA 4JCOA 3D3EA 3ZZNA 2Z1NA 5CA1B 5L9AA 2LE0A 2ZYWX 5AH0A 4I1IA 4KXVA 5KQSA 2Q8QA 3BGSA 3QUBA 4OXYA 3FY4A 1O9BA 1PNOA 2YVKA 1ZJJA 1Z2DA 4UBIA 2JHFA 3F1LA 1VJRA 4QJ4A 4RK1A 2BUCA 3ASVA 1VC2A 4J6FA 5C81A 2HRBA 4OFBA 2LCIA 1F8GA 3ADCA 3CW8X 3RRFA 4D3ZA 4DA4A 1UK8A 2DETA 1H8HD 4Q02A 4P38A 1LUAA 3BQNB 3CR8A 1Y8QA 4NCBA 1DXYA 3A0UA 3AXTA 1N34B 1MV5A 3EYAA 3JS5A 4CF7A 1PT5A 1G5IA 3GA7A 1DV2A 3EVEA 1X7ZB 2D2XA 3GWZA 3JWPA 4LWOA 2BGUA 1XMIA 1G8YA 3DOUA 1TJPB 3I92A 1JUDA 4HB3A 2RIRA 4HQRA 3I9V1 1BG6A 2ZYHA 3IDAA 1D2NA 2RAVA 5FOTA 1JWAB 1XD8A 3D7RA 4LHYA 3MUOA 1TQHA 4MS3B 3PJFA 4HN9A 4EHIA 4EY8A 4H1WA 2XKAA 3RT7A 3LUAA 1UJ2A 3TRKA 4BTEA 1V3UA 3W2FA 2ATXA 2C4NA 3EASA 3AZPA 4S1WA 4Z0TA 3WMGA 2Y0CA 1P0PA 1W85B 1Z0FA 4WJLA 1HE3A 4R05A 1TA4A 2Q5CA 1I4DD 4CODB 4YJFA 2RDMA 3G2KA 4YDHB 2WAMA 1S3GA 2WF5A 3T99A 2E5LB 5FI1B 3VO9A 2EQAA 4QDUA 1C29B 3T7AA 2VJBA 3E05A 1EUDB 1U2ZA 2I8LA 2YZ2A 3OTHA 3AUYA 3Q9UA 4AYTA 4OKNA 3FWKA 1H42A 1ICEA 4L57A 1DOHA 1YQTA 3G2NA 1H65A 5AOAA 3LP8A 10MHA 1Y34E 2ZTHA 2A35A 3MB8A 2WQ6A 1PL6A 5HVNA 4JBWA 3UHJA 2Q1XA 4GP7A 1A97A 4JBHA 4RF5A 5HJ5A 1GCUA 5GMOA 3WGJA 4X8OA 4BAGA 4KQJA 1VBNA 3HV0A 3GPCA 1ONOA 2HQBA 1CF9A 2YS6A 5BYKA 1Q1EA 3WJAA 1HFWA 4LXGA 3CE6A 4RPGA 2PUEA 3OESA 1A72A 3K9LA 5F1OA 5IM5A 1CY1A 1DAIA 5IDQA 2JCBA 4IH1A 5FLYA 3WNCA 2VPYA 2ZJAA 3W2GA 1E5DA 3OZGA 4OHCA 4M87A 3NKLA 2XXBA 4GMXA 1UDCA 3BL6A 1J49A 5FO0A 5KOHB 3RAGA 3UW3A 5EWMB 3HYTA 3OKAA 2PJUA 4MP6A 4TTSA 1IULA 1Y8RB 3PLAE 4OYLA 5A7HA 5JO0A 1XU4A 3EGCA 5HM8A 4YCMA 3WLLA 4BRSA 2Y8EA 3ZH2A 3ZR4B 3RYHA 3BMNA 1U02A 3BSSA 1Z22A 1RDFA 4RMIA 2IC5A 1EHCA 3ISTA 4I1RA 3T15A 4DCSA 5G0VA 4LMRA 1M34A 2WYUA 5G4KB 2CVQA 4UMEA 4HTFB 4Z4IA 1SA0A 2GBGA 4R2MA 2OTCA 5BSUA 4BU0A 3QEBZ 2QL6A 3UICA 3QKSA 1ZMOA 2JH9A 4JI5B 1M2EA 1FSPA 3P7MA 2DTDA 2K6GA 4OFZA 3A31A 1J70A 3CH4B 3OOYA 1RLTA 2R6FA 3EC2A 5AJHA 5ESDA 4K9RA 5CX1B 4QU8A 2PH3A 1OKKD 4RVDA 5DLEA 3GP8A 2NP7A 1KOGA 4LY9A 1BJTA 1MTOA 2PZBA 5CLFA 1G6KA 2FR8A 2ZYAA 2OMKA 3LRTA 3WG9A 4FQ5A 4Q9IA 5E6SB 2G88A 1VECA 2PMEA 4R0MA 5BN1A 4JSRA 2QS9A 4LQCA 4RUKA 1L9KA 4TWRA 2ZJ5A 4MLDA 1P7ZA 2CJXA 1L7PA 5ALGA 5FULA 5A1TA 4XWWA 3DUFA 2JA1A 3IXMA 3L4BA 4DWJA 2I4OA 2OO5A 1OOEA 3E9NA 1ODTC 4IHAA 1VJCA 1SC4A 3BQMB 4ND2A 4B34A 2IGTA 4OIMA 4LZWA 1UWKA 1V11B 1ZINA 3O3NB 1BOOA 1VYUA 2H8KA 1G5FA 3FPLA 4UAJA 5SYNA 4D42A 5EWLA 5JNRA 4ZQIA 2FPRA 3MTIA 4PPQA 1N3BA 1QRSA 1NVFA 1RP1A 3GEGA 4GZ3A 3WGVA 2OBYA 4TKZA 5HQ3B 3NHZA 3EPLA 2XGSA 5BQOA 3GLFA 3K2IA 2XNDA 1RAEA 3EE6A 1WOYA 1BHO1 3JR7A 4LYYA 4OQZA 2PU7A 1SXIA 3A1WA 1XMXA 4ETMA 4AECA 2XZOA 4NIMA 1UWLA 4UM8B 1NMQA 2P3QA 1XCMA 4S1TA 4UFPA 1BWPA 5DO9A 3QSYA 2AX4A 2PX2A 1A2QA 1MX9A 1T9CA 2BVNA 4MV8A 3QY0A 2W93A 5TVKA 1CE8A 3EEFA 4AROA 1QP4A 1DADA 1X7XA 2IPXA 3L43A 3HRIA 4E2WA 3ZHTA 3FF1A 2QZ9A 5JNUA 4LFAB 4KR6A 4FE7A 5JDCC 4N48A 3SOPA 1H23A 1A9XA 1G8AA 3B7PA 3P45A 4I2NA 2HMWA 4J9VA 2E7ZA 4PBSA 5EAIA 1LF5A 3RFUA 4JLWA 4F2WA 1S9DA 1OKKA 1QP7A 1GRRA 1OA0A 3U5ZB 1QHXA 2NAFA 3NVAA 5JEDA 1RZRD 1EU1A 1X6VA 3C43A 4IL5A 4G5HA 2FE4A 2GA9A 1UAGA 4CMBA 2QX8A 5EL0A 2J3MA 1QG0A 3ETLA 1U3CA 2GCOA 4LYEA 3QYFA 4YAWA 3WK4A 1DGQA 5JYDA 3W1VA 5AW9A 4TROA 2AXNA 2HRDA 2X4GA 3N75A 1ZSVA 4UDXX 3VU1A 5JSUA 4AWAA 1DCKA 3DCNA 3DEKA 3CX7A 1EM8B 1ZUIA 3WGIA 1N2ZA 3S8MA 4OHOA 1I7DA 3C87A 4D4GA 2YHSA 4MK4A 5AFSA 4O4IF 3EC1A 1QHSA 1CZNA 3P26A 2IHKA 5K05A 3NTQA 5FPSA 5SZJA 4CM4B 4BEJA 4F5WA 3T3NA 1NVEA 2PXAA 1S2NA 1QP0A 1QAOA 5GWXA 1C3JA 1T36B 2HLNA 3N39C 1SN7A 4FKMA 4A8TA 3HSYA 1B8PA 4EKYA 4MOWA 5KO2A 5LOVA 3G7UA 1Z74A 4WLNA 4NL4H 1NKTA 1IAQA 3LVFO 2NU8A 4C08A 5JAMA 3S5JA 2A5YB 2IELA 5JD6A 3ZE1B 4KTTE 3NBYC 1ORVA 3C7DB 4BFYA 3A36A 3ONNA 1D6MA 1FFSA 1ETHA 3PUYA 2WTNA 5TLSA 2GPAA 4XDYA 2JI4A 4I50F 1D2AA 1GA1A 4H9GA 4R8KA 3EMBA 4Y9UA 5KCZA 2CDAA 3AR6A 2IHNA 4QL3A 2GEDA 2QSUA 3TQRA 4EPWA 2ZSHA 2D74A 2GYVA 4O29A 1OWOA 4BV3A 3PQ8A 4K2AA 2UUBB 2P2DA 1J21A 2GCGA 5BV8A 4NYIR 4ZMSA 4NP6A 3TNJA 3H2JA 3Q41A 5EJ5A 3LMKA 4RAOA 2A5FA 1BE6A 2IOYA 3IVMA 4MZDA 4XB6B 5C8VA 1DJPA 3LHDA 4CIWA 4HXEB 4W8OA 2ISCA 2DZDA 5CLGA 1KSGA 3AU8A 4FW9A 5ADVA 3DHWC 1NXPA 2E85A 3SE0A 2HWWA 2YUTA 5F3DA 1BVUA 1P77A 1XFAA 1T4GA 1S6YA 1RE0A 3KX2A 4JODA 5E8RA 3PXGA 4BC1A 3CH6A 3U4GA 4LE1A 4CFYA 2FYTA 1W85A 3HB0A 2C42A 1RAAA 3DKIA 4IXNA 1IHUA 1SU6A 4RFSA 5KSPA 5NULA 2O2HA 2QN7A 3DBLB 3V4OA 1V37A 4C7BA 2IHVA 1XD9A 2POCA 4M36A 5FOSA 4ZHQA 2C9CA 4B6QA 2BC9A 4I3GA 4MS3A 4ZQHA 1E0JA 1P9NA 4HSGA 4QG7A 4EWLA 4NV3A 3BFPA 1J09A 2XDQA 4Q7EA 3P9YA 1N0UA 4QDXA 5I4CA 1EVKA 2IEDA 5JVDA 1WHTA 5F51A 2YV3A 1I3OA 1NPTO 1RYNA 1GFIA 2OB1A 2SCUA 2HK9A 3H9QA 1QAMA 1V1RB 2QD4A 2HPVA 1JQAA 2REXB 3STXA 1HKUA 4OM7A 1V11A 1RM4A 2WICA 1IMJA 4GE0A 4W6ZA 3A1CA 4G5OA 1ADCA 2QV0A 2XOKD 5JD3A 3V7FA 1RC8A 1GYQA 1S2OA 3QEMA 5FQOA 3HYLA 2W11A 4Z9YA 3E9ZA 1K6EA 1XCOA 2GERA 4MMYB 1LBIA 4RK6A 2DFPA 1F2UA 3M4ZA 4MKIA 3B78A 4Q93A 4JX9A 4KPYA 5ALJA 3GMSA 4QARA 1ZVKA 2EBHX 3RRXA 4ZK2A 1LU9A 1TLFA 1ZN2A 5ALTA 5T41A 3RBVA 2VHUA 4HATA 3C3BA 2ADOA 2IDZA 2QQ5A 5KNCA 3NR2A 3TFWA 2P35A 2UUAB 2PBFA 2RKBA 2I76A 5K4AA 2AQIA 3DOCA 5L7TA 2J85A 1DRUA 2G0AA 3LT1A 4TWBA 3NWEA 1Y5LA 4L78A 2B8WA 2MMGA 4EBBA 3MA0A 2VHEA 4RMNA 3KTOA 4F4IA 4IUDS 4R8LA 2ZRGA 3SIRA 3IOYA 4RELA 3II6X 4GKJB 4XLZA 3MCUA 3H2BA 3H8WA 1H94A 3E9RA 5T8KC 3RUPA 1OH5A 3ZHSA 3OJCA 3NAGA 4PY2A 2Z5VA 4D9BA 4Z8YA 1OZAA 5A5DA 4H7PA 1I2AA 1NQUA 1VKRA 5I48A 4IIEA 5EEHA 4CTMA 4WFQA 2COEA 2D62A 2IP2A 3KHTA 4QG3A 4FI3F 1DPGA 2Z95A 1UPXA 1TCAA 4GMHA 3C41J 5JXHA 2ZCJA 4LXQA 4LW8A 5G1OA 3BRSA 1CJKC 2X8JA 2UDPA 3GH3A 4O2BA 4CCYB 2WJVA 3HBMA 4D4LA 2B92A 2V5AA 4M6WB 4NS1A 2H4JA 3BE8A 1IUPA 2XYHA 1YE8A 3R0JA 4G8DA 4BFTA 1KZHA 2H2GA 4FGZA 4L8WB 4DLAA 3FIUA 2AFVA 1K08A 4P6VF 1Q50A 5JRJA 4V02A 2ECFA 5L3SB 3C24A 2C88A 1AKQA 1TKRA 4U3JB 3E5NA 2QNBA 2OYSA 1NNSA 5COBA 3FPGA 1TO1E 3JPYA 1TF2A 4LVNA 3CLTD 3RV3A 4V1CA 5EKUA 1CPYA 3KJZA 1H2AS 3VTAA 5B4TA 2IY7A 2XNKA 5AO9A 4EG0A 1F12A 1L7MA 2V7UA 3CZ5A 3S2FA 3L18A 2GCIA 4A73A 5CITA 3JQBC 5J2TF 1MABA 2V4UA 5FWDA 4HN4B 1G21B 2HADA 3GGSA 2NUTA 1UZUA 3AY3A 2AVDA 3KU4A 3NYRA 4UEOA 4XRRA 5KS2A 3BMOA 1E8MA 2WTAA 3HY4A 1AQJA 1TC2A 4GPD1 2WTEA 3AOEC 2VHQA 4A6XA 4MW1A 4CQJA 5T57A 1JBQA 3EDMA 3IILA 3LHKA 1UBMS 4I5FA 1A71A 4EO7A 3HKBA 1SVOA 1SBZA 2F43A 5I7WA 4P22A 4H27A 4OSEA 2DR3A 3NO4A 3FPJA 3TRHA 3IKVA 4EECA 1QANA 4QNRA 5F4ZA 4PO1A 1G8PA 1E2KA 2YVQA 5DXAA 1SOMA 4JJKA 3PD7A 3KZVA 1E5TA 3F9IA 2I4RA 3PFGA 1GXSA 4YO8A 3FCUB 4G4JA 2JLBA 5BYBA 4JR0A 3MMSA 2V7XA 3R9WA 3FYUC 2C4TA 1LBEA 1WUTA 4IGAA 3RSFA 2J1LA 5IX8A 4TMKA 1PJ8A 4TRJA 1P18A 4BKRA 3EIWA 4AJKA 1A5TA 2J9FB 3E18A 2NPFA 3IALA 1ULSA 1NQVA 2EFGA 4U6QA 4JVSB 4AY6A 2YZ7A 1XD2A 2VVTA 3T3OA 4LDZA 1G8KA 2V9ZA 3NM4A 3PEVA 3WGKA 1FPQA 4ZJYA 1FW6A 2XLCA 4UMDA 4BEVA 2DLDA 5EJFA 5F3RA 1RQXA 4IBOA 1ZQ9A 3F74A 3VU8A 1RI3A 1YZHA 5JDCA 1GPNA 2X3UA 4INZA 5GGYA 4RVFA 2J5BA 4EHNA 3AUFA 2RE8A 5I6DA 1KMCA 2EQBA 1I14A 4HQKA 5AW4A 3DE5X 1EFPB 1SPBS 1ZIXA 2NYVA 3OPNA 1V8DA 4Q4AB 3L7CA 1Q7TA 4IHJF 3BXEA 5ITVA 4YTEA 3ET5A 4REQB 1IBMB 4J7CA 3TKYA 3GI1A 3RS3A 2QBYA 1PFYA 1M6EX 1PWXA 3K32A 2WJ6A 3G8BA 3NAQA 4KODA 4LY0A 5IYZB 4A10A 1FSSA 2HAEA 4XJVA 1PR0A 2Y92A 1X3LA 2O3UA 3JVUA 4CLRB 3L46A 3IR7A 1UR5A 4O8CA 4XIGS 2M6SA 4YCJA 5DHPA 2ZUCA 3N0RA 3LYUA 1C9YA 5A7GA 1FP4A 4FNMA 1XJ5A 1Q7EA 2HFKA 2REQB 3CKYA 4OQMA 4C7XA 1GHTA 5FBVB 2GM4A 3VJRA 4I1UA 4LTDA 4IHJA 1AUVA 4NJEB 3QWAA 3VDMA 4J0IA 3OE7D 4K6FA 4AP5A 2ZREA 3O4FA 3GA5A 1G16A 2GGSA 3CZ4A 1HH4A 3Q6NA 3DOEA 1KERA 1I6LA 1PGQA 1FVFA 3MNFA 5LLDA 4A5OA 2KQUA 2W2NA 1JAHA 4KVAA 2Q7OE 4C03A 4K9SA 1U65A 1LLUA 4PRZA 2VUHB 5CH3A 1FMTA 3PQ4A 1U7XA 2QRGA 5ECDA 3QLUC 5C51B 1EB8A 1JNYA 2CFSA 3ZEIA 4PVDA 1Q7RA 1KIFA 1ODCA 3EIQA 4OAPA 3D4PA 4Y7DA 4EYQA 3AHJA 5KNBD 4G1VA 1SKAA 5CA1A 2WINI 2ATEA 2J0UA 3IP3A 1NW3A 4C01A 3MAGA 1JWLA 2R96A 1NC1A 2LD4A 4PLCA 4XWGA 1E0SA 1KQNA 5U9CA 5GADl 1ND5A 3CUEF 2O8FA 2GM9A 1BD3A 4QYSA 1AO3A 1SK9A 5LFAA 1NZDA 1W4ZA 1ZN8A 3S6JA 1A9YA 2GR9A 3WO1A 4CKEB 2JZNA 4RPKA 5KYXA 3LCJA 1RPTA 4XKJA 4WEOA 3DMDA 2H1IA 1UKZA 1Z0DA 4ZAWA 5JJKA 1KK3A 2G25A 4IOKA 4PCLA 3OCJA 3KHKA 3KTDA 4L0DA 1EFRD 3GO4A 1J8VA 2Y6VA 1N4DA 3IEMA 3LT0A 4R1MA 5J2UF 1JDVA 1JMVA 2H3HA 1MC5A 4AKHA 3AH8A 2JGLA 1G98A 4D9CA 4B74A 1OIVA 1KL7A 5AVKA 3GG2A 2OCBA 1J0CA 3HDQA 2ZRNA 1I7SB 1T8RA 3PNMA 2E4XA 4C7MA 4OXRA 3GARA 4M6WA 4U2GA 4ZYLA 1TEHA 1BSVA 2K2WA 4OH1A 4G8CA 4WT7A 3WOVA 5J3JA 1TTTA 1H3FA 1B3BA 2DAPA 3QVWA 3IT2A 2XLBA 3JQ7A 3PR3A 1OU4A 2UZ1A 1L6RA 3GXOA 3GVIA 3F8SA 1JFLA 4MO9A 4UNSA 2AJTA 2DH5A 5FNVF 4C0JA 2CBZA 3TKAA 1PDOA 1RJEA 3BSYA 2AMYA 4K05A 4C0LA 3GX1A 1YMVA 4QQRA 4Y6LA 1YQXA 1GQQA 5F4BA 2PRZA 3B8EA 1HZJA 1JA1A 1NDQA 3T3PB 1Y4UA 3ILXA 4EHJA 1EWVA 1FSFA 3I4FA 3U3OA 4DJ5X 3R9XA 3V4VB 3CVVA 5REQA 2ZYUX 3TD2A 5FUXA 3JV7A 3G5LA 2P2NA 4Q3LA 2J9YB 3GGCA 3GJYA 1H1TA 1BROA 4J3FA 3KQLA 2I2XB 2Q1TA 3V2UA 4IDOA 4JC4A 1V25A 3TD6A 5F23A 3EPKA 1PG5A 1RTKA 1WS6A 1MX5A 1VHJA 3FFAA 4NBUA 1W7AA 3HQ4O 4EG5A 1YB2A 4MW6A 5IARA 2VIIA 3ZI0A 4IDNA 2NIPA 2ZJ7A 4DV2B 3FLEA 4NTZA 4H7DA 4EYGA 1UEXC 1ODKA 2P6RA 2A3NA 3ZHXA 5LQAA 3PJEA 4EGSA 5FEUA 4YX9A 2I7DA 4J0FA 4AJEA 1CQWA 1OXVA 2P6PA 3SKVA 1YTUA 1GKLA 1TPYA 1N2CA 3L05A 4Q9KA 4ZRMA 3IP5A 1DC8A 1IWOA 1SVKA 1N3LA 3GLIB 2QLJA 1WXGA 5KYYA 5AHRA 2DYKA 1XTBA 3AIIA 4S3MA 3AVPA 1BRMA 1JH8A 1XZNA 4C0BA 2YWJA 5KWEA 3HPQA 4QREA 4CMGA 4MEBA 3WB1A 4ARVA 1ID8A 3ELBA 1NJ5A 4U6NA 1DAFA 1I4TD 1KBOA 4X1IB 4QPNA 1Z0UA 3HN6A 5DX1A 4ZT4A 3BZUA 4ZI5A 4ARZA 3DZGA 2RHWA 3AUTA 3QF4A 3FPKA 4KACA 3T94A 4XLLA 1EGVB 4X91A 2G8LA 3JATB 1PV1A 1DTEA 1XAJA 2OCDA 1C4XA 3BDIA 5C0OE 2P62A 5LBTA 5DLQC 3WWDA 4IWXA 4C4XA 4JC5A 1YVUA 2X4LA 1SJ9A 1TM4E 1CV2A 2F59A 2XQKA 3HR8A 5DWVA 1F0KA 4ZXFA 5L3SA 1E2JA 4KXYA 1GGKA 4ANFA 4JT4A 1EFPA 4GM4A 2JFPA 2CWWA 4YT2A 2IL1A 2JKYA 2WM3A 1PE0A 3QBDA 3WWPA 1F20A 3FCEA 2F3UA 2DQKA 3JYOA 1BYUA 2NSJA 1N5MA 3LTNC 2XB2A 3KKZA 4A1FA 1RQ7A 3DA8A 1DEKA 4FHCA 4MULA 2BKUA 5IS2A 1SHUX 3PDIB 4ITRC 4FS3A 1DBVO 1T34A 2ANCA 2WSLA 3K9CA 4LCJA 3ROPA 3DB2A 3WBBA 1ZUWA 4LZNA 1XTZA 1FRZA 1FQWA 2IYQA 2EZ9A 4F4HA 4ENVA 4DB4A 4G1UC 4CNBA 4DEVA 1C7IA 2R8EA 3HKEB 2FWPA 2PT7A 3IHTA 1U80A 4KDFA 3OZEA 3AINA 1CZHA 1GPMA 3DWIA 3HC7A 3UW1A 1Q15A 3HJGA 3HVRA 3WX0A 3LSYA 4TXJA 3GPDG 2OO7A 4PC1A 1H2FA 5IJ9A 4Z1MD 1NR5A 5G3YA 1X42A 2X0RA 4GSKA 4UBNA 3RGGA 3H4MA 1IHPA 1XHLA 2KBEA 4MUXA 4QNNA 1E3WB 5IH3A 4FMCB 5C3UA 1FFEA 1CP3A 1EFCA 2ETVA 5B2ZA 4V2UA 2CXRA 4J8PA 2WF9A 3NVDA 3TFOA 1R0WA 2VP6A 1HSZA 2UZ4A 1FMLA 2AD5A 1E6UA 2BHLA 3KR0A 2Q4BA 2GDZA 2WHRA 2FPGA 3Q7RA 4IFEA 1CD5A 4MX8A 1DEHA 2FLKA 3O4IA 4FNOA 7GPBA 1NW9B 4B45A 4IW3B 2O6HA 4KYVA 4MHOA 2ZPUA 3F9RA 2QXUA 1W25A 1YDEA 1EG2A 1G4AE 1SIBE 4C0AC 4DWWA 3RC8A 9MHTA 2XA9A 4OMFG 5DB4A 5KEIA 1E1NA 3P2JA 3WGMA 4BZQA 4Q05A 2C2MA 4Q3OA 5ALNA 2CY0A 3DC2A 2VSYA 5DPMA 2CFCA 3RAPR 3IVAA 1ZG3A 5K20A 1ISFA 1QQTA 1PLKA 2J48A 3OCWA 3QQ5A 4JI1B 6REQB 4MV4A 4C2UA 2P67A 2VWQA 2DWOA 3KOUA 2B8TA 4CLEA 2GLUA 4LV6A 1U2TA 4TN1A 1BFUA 2P9BA 6Q21A 2ZQYA 3QJGA 1WUHS 2CC2A 1JEAA 3NALA 1DC6A 2V7BA 2OCYC 3AIKA 2I55A 4J2OA 5CB4F 4IIJF 5DOZA 3PNPA 1SC1A 3LPCA 2ZP1A 4DXDA 3ZYCA 4M54A 1UAAA 4KREA 3BX1A 1N6KA 2ZXFA 3TSWA 4P33A 2QF7A 4NI5A 2EJUA 1HT3A 1UK9A 5TQ0B 2FP4B 4NENA 4H0FA 2XX3A 3SYMA 4C05A 4HCJA 2JEOA 3EGXB 3QPCA 5ALUA 1YQDA 5C4IA 1N8TA 1H69A 1YCHA 2IEAA 4WUVA 1E2LA 1JVNA 4DBZA 2XE8A 1CDOA 4JT8A 3RUAA 3NNNA 1U4SA 1LPNA 5LQSA 1KO5A 1GZ5A 3P5SA 2E9SA 2OHXA 1N5KA 1PJQA 2D5AA 2Z3WA 4KDCA 4MNTA 4CMJA 4TTVA 4LNUA 3WZ2A 1ZD5A 4L8YA 3EEQA 1HK7A 4IGFA 2GBLC 2YYAA 4KE6A 4TOIA 4ZAYA 4PIMA 3SGLA 1C30B 3KFVA 3QV1A 2ZJ2A 1GRQA 1G3UA 4PYJA 2P9YA 2CSUA 3CBQA 3DDSA 4IJVA 1E2HA 2A2ZA 1VKZA 4Y1EA 4B7ZA 1U8UA 3CEAA 3EGEA 5TY0A 1Z6AA 5D3ZA 2NU6A 3SNHA 3ZK9A 3O26A 1IONA 1T6YA 1K27A 3LQRA 3ML1A 4L4XA 2W2KA 3C3JA 4N7BA 2GM5A 4UNIA 3VKFA 4BS9A 1PSZA 4YQYA 1P6QA 3Q0IA 3UQYS 1PYGA 1JT2A 3M4XA 5BSEA 2JIDA 2D3WA 1CQPA 1C4WA 3L8GA 4HNHA 5KC9A 2H4YA 2J4DA 3UK1A 1WBBA 2Y67A 4F46A 1NN5A 2ZBGA 3OE7A 3IAM6 1M2FA 4IDGA 4F38A 1O0CA 4H18A 3RQIA 3DM5A 2QPLA 4ZOQI 1FUIA 4UNQA 3FMGA 5ERXA 4ER6A 4RTQA 3H04A 3IPYA 4RQTA 1Z8FA 2JCGA 1MFPA 2SCUB 1SD2A 4LQDA 1C4OA 4RVSA 1Q5PA 1JQBA 1UEJA 5G0TA 3BRCA 4Z2YA 4TKVB 2IWRA 1AT1A 4K9QA 4HFMA 2XDQB 2ZI5A 2QTVB 4EFMA 4ALKA 5JLAA 1F06A 4L74A 4AUMA 3NOVA 4P93A 4N0MA 2ZTSA 2F7SA 5CURA 2JATA 3H2IA 1ICIA 3GPLA 2P4EA 4MPRA 1DCFA 2JBHA 2OGUA 1FUUA 2DFTA 3D6MA 4TZ0A 2Q5JA 1E4EB 5JC1A 3CIOA 2C54A 2OOKA 4GYYA 4LI3X 4M88A 2IYAA 3E5RA 5DBOA 1QFYA 3DOOA 4PAGA 4LGYA 3ZU5A 1Y9EA 2WZBA 2PEZA 4J3JA 1QK3A 1JKFA 1XZEA 3AUUA 4ZQBA 3D6HA 4B0OA 4YEDA 1CP2A 2P3SA 3PGKA 2YW2A 4ZAXA 1WNFA 1WUIS 1AKNA 1P81A 3K9NA 3MTEA 1F4LA 3I6QA 1ISIA 1H8ED 3C2QA 2IH2A 3LQFA 3UBMA 4AMBA 1EE2A 1F6WA 2CMKA 1B74A 3IQWA 2WNSA 4FBMA 5HA5A 5JI3E 4QAQA 2Q0QA 2B4RO 3K0CC 5AI6A 5EIHA 3VJLA 1TMOA 1SBTA 1Z16A 2XTNA 3JQ9A 5DIFA 3UAGA 4CIAA 3EX7C 1Z0IA 4MP8A 1Q1QA 2JCXA 4WKNA 4XGNA 1U7TA 2C7QA 4WXYB 1DRJA 2BMFA 2RMKA 1ODSA 3T3IA 2PRSA 1M1YA 2JF0A 4XSVA 5B58T 5GV8A 4YT8A 1WM1A 2QLLA 2P3OA 1P73A 2Z43A 1VYTA 3K09C 3F98A 4EKIA 1FK8A 3ABZA 4Q1FA 1J8YF 1FF9A 1D0SA 3VH4A 1XN1A 1U7UA 3B9RA 3CHYA 3OLVA 4UQLA 1AO0A 2QGNA 2QPTA 1MB3A 3DCJA 5IAAA 4Y2TA 1SQ5A 2OENG 1NBEA 2ZVQX 4KWTA 4KXWA 4MVJM 3QMWA 3GVHA 4RXUA 5DJ5A 1WHSB 3DAFA 3AFOA 3RVBA 3K70C 2VP5A 3GFSA 2WYHA 3GZNB 3IQZA 3RIEA 4C0HA 3H0EA 2RGBA 2YDXA 4CMEC 3VAYA 4QGSA 5A03A 1FJXA 4PR0A 4TMYA 2P9GA 1J9GA 4AB1A 2FZWA 4D96A 3UIEA 3BTVA 5E6SA 2O23A 1MA3A 3IBYA 2BTEA 2IT1A 1KAEA 1WTCA 3OLZA 2FUCA 1E2FA 3D2BA 3G1TA 2HMAA 2ODWA 3N7TA 4HDQB 2J6HA 2XSZA 3B53X 2R00C 1VHQA 3RYTC 3KSUA 5BRAA 3I0ZA 4X1KB 1LJ8A 4BWFB 1KP3A 4Q4HA 3AUJB 3OCXA 1L5KA 3KLMX 3U0VA 3W5BA 3NM5A 1AXGA 1W0JA 2OK7A 3H5IA 5BR7A 1N2SA 3N6XA 1GVHA 4MQEB 5AOBA 3KJGA 2OILA 4GGOA 1FXWA 3IULA 2QTWB 4DMGA 2C0PA 1MRNA 1GSHA 2W83A 1JBKA 5ERYA 2X8AA 5B37A 4CDMA 1XDWA 2CLFB 4WMLA 3B2EA 3W5HA 1KDTA 2PQ2A 3A05A 5DOVA 2XD9A 4I99A 5J1TB 1M7BA 2X8LA 3DMGA 1LW7A 3PDWA 5BQFA 1E1KA 3OE1A 1Y6QA 4DRZA 5IUJC 5F21A 4HVTA 1O77A 4RDXA 2X1HA 3H1GA 1YSCA 2YN2A 1T2VA 1KEKA 3DHVA 4HDAA 3KXIA 2ISQA 3CC8A 1CF4A 5HUHA 2A9RA 1RHRA 3S99A 5HTOA 1W87A 4RJLA 1R0ZA 4OJMX 1VCHA 4YREA 5TE9A 2XXAA 2HYIC 1OXTA 1GUDA 1U7PA 2BI4A 1ATIA 4O0LA 5DSZA 3SLKA 4BJ5A 4AIRA 4FGUA 1FYFA 1Z0SA 5GOTA 4O4LA 3L07A 4LC0A 1J9ZA 4NQRA 4BO7A 3GJ6A 2FRVA 5AKYA 4FYWA 4CKCB 3LWDA 1YFKA 2AN5A 3UVEA 1RVDA 3BRQA 3FDZB 3QPUA 4K46A 3U48A 1PU2A 2ILTA 3AL0C 4RIGA 4DBLC 3NDBB 1EWQA 4YRTA 4RGBA 4JLJA 3PGXA 3G2HA 5HE9A 1GGNA 2FPKA 3SYTA 3MVEA 4BCCA 1IB0A 1R27A 2A0YA 4RPLA 2C5BA 2EW2A 2Q27A 2XI4A 4YMVA 2DMRA 2C5EA 2ASEA 1LSUA 1EDOA 1AUQA 2PO7A 3IQHX 3QU9A 2P7HA 4L4SA 4KQ1A 5A2GA 3D8RA 2CNNA 1K6MA 1R8YA 3HGTA 3R3SA 3WL5A 2F55A 1GUYA 5EGSA 2E5FA 1XXLA 4CM8B 4BO8A 4CMAA 3GF4A 4OI2A 3LX5A 1G59A 1OPRA 1V7PC 2C2HA 1ZRHA 1JG6A 1F14A 1W9HA 3LS2A 4FFWA 4LJLA 3M6AA 3K94A 3QVGB 2Y1FA 1ADJA 1VPDA 4MDFA 2WFMA 3BZBA 1FLNA 1CUWA 2OAGA 4KLAA 4I81A 3BORA 4MWDA 4TT3D 4LF6B 1M1XB 1Z5NA 1XL0A 2PX3A 2VJMA 3EFOA 1WXHA 3L8YA 4UQPA 4FOPA 2CXOA 4TV8A 2JFBA 3VV3A 1KMMA 5J4HA 5C7OO 1LTKA 2MMCA 1L5MA 4QVIA 3FFWA 4TLAA 3ZEAA 5ABPA 3HWX1 3CURA 3HJAA 3CVUA 4P0QB 5HJ7A 5EZYF 1FJHA 1Z5WA 4AS2A 3K0FB 1GT6A 3E2PA 5KIAA 1N6OA 1NYTA 4HFRA 4XFJA 3DYVA 4MW5A 4YN3A 5BUSA 2RGUA 5LLTA 1Z4QA 1UBOS 3RC2A 1IUOA 1BVRA 3KCQA 1JHUA 3CLUD 1JLRA 1SHLA 3HCRA 4LMPA 4B8ZA 5IBCA 2QP4A 1C9JA 5L6MB 1UBHS 4R81A 1ZGJA 3QHQA 3FCAA 2BFAA 4MYHA 4KEAA 1CJCA 4IJWA 4K9KA 4ZVLA 4II3A 5UKDA 4G89A 4AJ9A 3MBIA 2OCIA 1YZQA 4V0ME 1TAUA 1VHDA 3JRXA 4Y6QA 4D02A 1KVQA 2RK6A 5LJLA 2AFIA 2QI9F 1R5NA 1AQ6A 1WF3A 3UFXB 4DDVA 1DIRA 2C5SA 4OB6A 4PLTA 4DLRA 1QF7A 4P86A 1NXXA 3ASUA 3FX2A 4P4SA 2H1CA 3R5HA 1O54A 1VDMA 1GN8A 1MRSA 3GCZA 3LXMA 4ADSG 3TOZA 4X45A 1WB4A 3MBKA 2BGWA 2O3TA 4M8SA 2F8SA 1SNYA 3V8NA 1NNEA 2NVUB 3KALA 5JYBA 2FEWB 4R1OA 3JARA 1EQ2A 4CHTA 2GXUA 4UW9A 2QVLA 4QUDA 5FBQB 2NSDA 1SKMA 3THRA 3FBTA 3ZDAA 3I9JA 4DW8A 4KSCA 1EFVB 4J1NA 4QLAA 4RA9A 5TNXA 1I7PA 1KI1A 5CUQA 5BXYA 1G0NA 3OPYA 3B1XA 1SXJB 1C9NA 5D00A 3OQVA 2YXLA 1QZUA 3ONFA 3H2ZA 3RS7A 2L42A 4RYDA 1RAIA 1UDWA 1GSIA 1B00A 3K09A 2IEIA 3L0IB 1KE2A 2QIOA 1EUQA 4LZOA 1T25A 4HQLA 4PXAA 2E2WA 1PJSA 2R1VA 4R6XA 5EZ6B 3TR6A 3FHTA 1H22A 4X62B 2M32A 4NBSA 1GAJA 1PZNA 3WHIA 3GJRA 1BD4A 2PGJA 2PEYA 1IBSA 4QJIA 3S8YA 2P1RA 3HEBA 4YJ2F 1IIBA 5KDLA 3CZ9A 2PWYA 4YRPA 1P5ZB 3C8UA 3EGVA 1RFGE 3EVNA 2HIHA 4I2VA 3GT3A 1KVTA 1ZI9A 4N0DA 1CDDA 3GFTA 5LNK6 2GBCA 2NXEA 3KSDO 1ZK2A 1Q11A 5DW0A 5JWHA 1QKIA 3HU1A 3TIFA 1WEKA 1KKUA 1I5OA 1TKCA 1B93A 2Y1DA 1ECFA 1OFTA 3DZJA 3LCCA 2H1VA 3DOIA 4P84A 5LQRA 2VNKA 2NNWB 3JYQA 1U1DA 2E0IA 2QN8A 4PZCA 5DCLA 1VG9B 5FORA 4AULA 3K20A 4I4NA 5TEWA 4NBKA 2PA3A 1LZLA 3GRCA 3SSAA 4MMXB 1PWYE 1A8HA 5T6MA 4RHTA 1VBKA 3UV3A 4YY3B 1RJWA 1KPIA 1U7WA 2Q1WA 3EVDA 3S44A 1N78A 1YMUA 2FQ1A 1YKGA 2HMSA 3F46A 4YPVA 1JAYA 4NFHA 4FSXA 4YMIA 5JSZA 1TW3A 3KAKA 4YROA 3N59A 4YS6A 3GAMA 2WZCA 3T06B 1O6FA 4GRDA 1DBSA 2XR1A 3KZXA 2GN0A 3K0HA 3E7DA 3L7BA 1ZNYA 1YRWA 3LL4A 2ENWA 1DKPA 1CIVA 1HYHA 3IAEA 1PG2A 2WAOA 4PRKA 2ZEJA 2B2NA 2YWCA 2M6RA 1HTBA 2OFPA 4J91A 4RCYA 3SXPA 5IU6A 4ALJA 4HH3C 2QVGA 3EZGA 1R10A 1DQZA 3C5HA 2YWBA 3ZC3A 5I9IA 4PHTA 4PLZA 1W0JD 1XRRA 1L7OA 1NVVR 2ZAYA 3AOGA 5F98A 4K86A 3W7AA 1WX1A 1CEXA 2WE8A 5CJ2A 1G8MA 1SUSA 1LXCA 2ZE5A 1T26A 3OJFA 3ISJA 4D0SA 1ARZA 4CMEA 1RVV1 5L40A 4OGKA 4MJ3A 1RWXA 2A6PA 3AG6A 4XOIA 5LDGA 3SR0A 3OD1A 3VAZA 4L5CA 3LPAA 3FLBA 2WC1A 4JBLA 4ZOEA 1ZR4A 4FOOA 1E59A 5EHQA 3TW0A 3ZE0B 4V38A 3GCWA 4PFJA 1JT9A 2O19A 1G42A 2P68A 4IOLA 5JCXA 4HS9A 3WGQA 1CEQA 3PGA1 5TPWB 5C8YB 4J16A 3W3AD 4CYMA 4YWHA 2GARA 4M9SA 2VP3A 3PRYA 3EWIA 4MAMA 4QIHA 1GPWB 2QD2A 3ILVA 2B4YA 3H6KA 2C1ZA 4L3OA 1N5LA 3KUXA 3HZOA 3IBTA 4M21A 5DK6A 1GJRA 2IZOA 3RNOA 1LWOA 4YCDA 3TRIA 2NUPA 1V0JA 1G7SA 2LKDA 5AM2A 2BGKA 1QVVA 5HW0A 4PG7A 4CCWA 1A9SA 3FDFA 3PPIA 3D6JA 1PL7A 3GUVA 2ZW9A 4CV2A 4F4UA 1U6JA 3MJDA 4R1LA 5IEJA 3M1AA 1Z6GA 4GBED 2YICA 821PA 1P72A 2YS7A 1P74A 2H4XA 5DLYA 1XQVA 1IBCA 4ZCLA 3WQSB 4PVCA 3C8ZA 4L2IA 5B7NA 1PJBA 1ZAKA 4PO3X 4A2WA 5AKZA 3FG9A 4OXXA 3EQ9A 4YJGB 2N0SA 3PG5A 1R6AA 4YP1A 3ZGLA 3LK7A 4JLOA 3B6JA 4LX8A 2DWQA 1F17A 1C0IA 3AR7A 3NJ4A 1E2MA 2VAVA 3MS7A 1P75A 4JJIA 5LA6B 3GG9A 4S2EA 4B2YA 3EZNA 1QGUA 1NYQA 4Z2AA 2YZKA 3OP1A 4OHZA 3I76A 3OPYB 1MG0A 3CF6R 4H7IA 2RH4A 3NB0A 3AMVA 1LBQA 4LJ6A 4YUYA 2NQ8A 4LJKA 4MUEA 2VDWA 1U8TA 2R62A 2REQA 4RY8A 1T5BA 3H9JA 2GVDC 2JLCA 4N18A 5F3WB 2VPIA 5LQNA 3ESXA 4WNAB 3LUCA 4F4CA 3PX2A 4GT1A 2QM7A 3DDWA 4O59O 2P6NA 2C7OA 1IG0A 2ZR9A 1E58A 4BB0A 4CKBA 1EDZA 4CLRA 3LNCA 4CMKA 3HJUA 1U3DA 1XU7A 2WU3A 2WAXA 4MH0R 4C21A 2HA7A 3MRXA 1JX6A 3WB0A 1LTQA 1MEOA 1Y82A 2H2DA 2ZYTX 2ZT8A 3CH7A 3DONA 1O1YA 4FFBA 2PV0A 3GRRA 4D92A 4REQA 1ECGA 4MARA 1A8QA 3FM9A 1LX7A 2FX2A 3HDTA 2LRHA 3E61A 1ZUNA 1J7JA 4LJ7A 3AHIA 4OQQA 5D5HA 3IP7A 4EJ0A 5CA1F 1SBCA 2PUAA 1HZZA 4HRYA 1EWYA 3QI7A 2HV8A 2WFLA 4FINA 4RK5A 1OCEA 1QYVA 1YB4A 4YUWA 2A4KA 2WJ3A 4IYRA 4KQGA 4I66A 3AR3A 4RKQA 4Y2JA 3DWFA 1FU7A 4AY4A 1V26A 4DANA 5BR1A 2RGXA 3O7WA 1HG1A 2R8BA 4FZRA 3G0CA 2TECE 4ND1A 4US2R 1O94D 4IJQA 3LH5A 3SJZA 3VR2A 3WK6A 2BF7A 2HJGA 1RXYA 1NN0A 4RHFA 3FFXA 2WJYA 2F4VB 1UIMA 4HGYA 3ND6A 1B41A 4DSAA 3EAQA 5JAPA 3ILSA 3H5OA 4X1OA 3AEYA 4QU5A 1J2TA 5DTJA 1G5QA 1PJRA 3ETEA 3FA2A 1WVGA 1R4NB 4YMTA 3CW9A 3U3XA 5CAEB 2P9HA 3LWBA 4JJAA 1OBHA 4RS3A 3VH1A 4EA9A 4X24A 4I4TA 1RCUA 1WSDA 4NBRA 3V1YA 4ASUD 4X66B 1YZTA 3HB7A 3BRWA 3C3YA 1OV4A 4L4ZA 5BT9A 3IMGA 4M8IA 4ZTBA 2FPIB 2VJKA 1SXJA 1FZTA 2FLWA 1XVUA 2CLHB 2WJJA 2G83A 1NJSA 2DY1A 4XW2A 1AKVA 1L1QA 3KOOA 5FPTA 4ZDIA 2ZE8A 3FETA 3OT1B 1MB2A 1ISRA 3OZDA 2C4KA 2WU8A 1YU9A 2WUVA 2DHCA 3KQQA 3VOBA 4TL9A 4RK4A 4IUYA 1PQUA 1U8FO 5JY1A 5DGIA 5DIZA 5JDIC 4Z7OB 3BMXA 1E1RA 5FD8A 4EJSB 3PJDA 1VKHA 4CMCA 1IK6A 3S28A 3RF7A 3PVZA 4ZVSA 2JGDB 4WCDA 5K0BA 1BIFA 1AOXA 1XTJA 3CLVA 3O4GA 4OBXA 5EI5A 2X1MA 3IDFA 4KOEC 4QTYA 2B7BA 3FUXA 4V1CB 1EKXA 2DJIA 1Q1GA 2FPLA 5DWQA 3MS4A 1MORA 4JA2A 2Y27A 1CUIA 5JNVA 3BWEA 4JS0A 4B35A 5JUWA 1M6WA 3KV1A 1NOKA 4HWOA 1PFUA 3N7UA 2HREA 4W9NA 3LECA 3LJKA 4IVQA 4JB0A 2OBXA 4LXUA 4UU7A 4RZQA 2EZTA 5JEEA 5HP4A 4JASB 5IWAB 3IOMA 2DXIA 2XMDA 3D3NA 1SELA 3FKSA 1RPZA 4J0QA 1RAHA 5A3VA 5HF6A 3RH0A 3ZDYB 1KWGA 2R5FA 2Y0PA 2YJ4A 3PJRA 2B0CA 4BLUA 1U0JA 2ORED 4BMDA 3QX3A 1EX1A 4RD6A 1EA7A 1KI8A 4DJJA 3IC5A 3W1WA 3GRYA 3X1YA 3EEOA 1JJ7A 1X2BA 2G8NA 3LZ6A 1C1DA 1HT2E 3JQFA 3EVBA 2WUFA 1X9HA 1F8FA 2ZWAA 3R6GA 4S1PA 5DYTA 1S8AA 1BKDR 2AJCA 2I71A 3VHLB 3EDQA 5HS4A 1T29A 2DUMA 1SWVA 4B48A 4RLFA 4ZN6A 3UJ7A 3PT5A 2PZ8A 2I1QA 4N8EA 2BL4A 1FUKA 4QLBA 1Q77A 1BQ3A 3ZY6A 4UTPA 4XRGA 1ZM2A 4ZVOA 4HZUB 4HRXA 4HDRA 5K6AA 1NIJA 2J32A 1SFRA 1N7IA 5KJ1A 4TX1A 2NZ2A 5JQGF 4B4OA 1DHRA 2JAOA 1HL7A 3X1JA 4I5IA 3HCCA 4LXHA 5KJ6A 1AMUA 1SUEA 3OX4A 2VJYA 5K0GA 3OX2A 3VKHA 4PZLA 2EP5A 2P78A 2CUNA 4W63A 4OMUA 4JXXA 4QFBA 2XWPA 4Q6WA 3UCXA 3N2LA 1RHKA 2E21A 4J0GA 4ZICA 1M34E 3AO0B 3KJNA 4UUOA 2Y68A 3B2QA 4DIUA 3R3HA 3DOJA 1JPJA 4P7KA 3FKQA 3L8DA 1ZGHA 4YONB 4D3SA 3NOOA 3G0HA 4NABA 3JAKA 5KVVA 1RXIA 4FTWA 4N3BA 1KNQA 4DA7A 2RHMA 3LPMA 5EXEA 4CLOB 3ZJ4A 3HJCA 1UKCA 2O0LA 2VTKA 1AMNA 2C5GA 4FDUA 1W0KA 3UQZA 4BKPA 1XA4A 3FDXA 1WHTB 1QTNA 1ZGGA 3B3GA 3B13B 1LLDA 1X74A 4EG4A 1K5PA 1NURA 3MRSA 3HS3A 3LM8A 4FDVA 4W1QA 4DILA 3PNVA 2C00A 4JL8A 1KS2A 1Z36A 1LF0A 2Z58A 4X20B 4D80A 3GLGB 3RC9A 1S9HA 1X1QA 2W6CX 3KKQA 3O8BA 1R16A 4EOGA 5A4AA 5BWMA 1BDIA 4RVCA 1A8IA 1J0AA 3I5MA 4NBWA 4P4NA 1QJ4A 2FF5A 3KEQA 3ZY4A 4LF9B 4L9RA 5K45A 3H8VA 3L6BA 2AJ8A 2G1JA 3GYBA 5JPCA 2O0KA 3HCEA 4RSHA 3I2HA 5DHUA 2GN1A 4O4LF 1OIWA 3A27A 1A8SA 2O2ZA 2HTEA 2P9TA 4P2BA 1IK4A 4KWEA 4IXWA 2V8BA 3DMNA 3AL2A 3GDHA 4TQUS 5DNVA 5LN1A 3DQQA 1W48A 2GPBA 4CL2A 1F60A 3ELYA 1ZLXA 3NJRA 1AHIA 1KJIA 3MTAA 4TXLA 1FUEA 5D5PA 2A5DA 2IV7A 1X7GA 3WKEA 4J1TA 4EG3A 1JPNA 2HDNB 5FTMA 1ZXXA 3B2NA 1L5QA 1O96A 5SZHB 2E82A 2BGNA 3CN7A 2R68A 2Q5LA 4BMZA 3DHYA 2GTHA 2RBGA 3UMSA 1SGWA 5B5SA 3TIVA 1WV1A 1KPHA 5GQSA 1SHZA 4MCAA 3Q3GE 1CUGA 1EVZA 1QX3A 4YRGA 4YIHA 1N6NA 3UMGA 3GCDA 1WMDA 4QO8A 3QVUA 4KDRA 1V16A 4EZBA 3BERA 4AMVA 4B5LA 1JG4A 1XNRB 4XB1A 3WBFA 2IV3A 5M04A 1NMSA 3UK2A 3EHDA 1HI9A 3SBXA 3IQFA 3V2GA 3U9TA 2ZB3A 3H2HA 3AESB 5CA0A 5KNCH 3NWOA 4G01B 2UYOA 1ST3A 3GD5A 3BREA 4FNAA 4IS2A 2HM7A 1QTRA 3C45A 1QKKA 3A7DA 1QUFA 2WV9A 1DO0A 3F8TA 4QRHA 3MQFA 3RBZA 4LJRA 1HYBA 4M9ZA 4BBJA 1MB9A 1IFXA 2VHTA 2NU9B 1Q2UA 1YS7A 1OFGA 1ULTA 1XL1A 2XQIA 2ZI9A 3AEKB 1H2EA 3HU5A 3IDSA 4G97A 3JD1A 4JB8A 1G2IA 5DMXA 2QTBA 1ZJZA 3VYWA 4BTLA 2G7MC 1JHDA 2VJOA 2XCQA 3E9CA 4MGEA 1SCUB 3A11A 1R0CA 3PFHA 4MLCA 1DOZA 1JDZA 1C30A 5DYGA 4DR2B 4IR7A 4CL8A 4FFPA 3CX6A 1AKYA 1ZL0A 4AO6A 1EFUA 3OP4A 2HW8A 4BV9A 3NFRA 2WU1A 1KGDA 2CVOA 2LDBA 3S3TA 4MS1A 3RKRA 2IDJA 4KR0A 1YI8A 2D5IA 5LQJA 1RJ9B 1ULBA 2BMVA 3D0QA 4LBVA 3PGJA 4CIXA 2YRFA 3RVSA 2OAP1 4QGGA 4RIFA 3IPXA 4BX8A 5A6VA 5BOSA 4BFSA 1QHIA 4MUGA 1F3OA 4H3SA 1JXQA 3OJOA 3K8OE 3BL8A 3BXZA 4XSHA 5T4EA 2PGNA 4J3NA 4E31A 2WR8A 4KVZA 2F8TA 4HC4A 4ZCSA 4F6CA 3SR3A 4R2HA 4HO1X 4HS4A 3VR3D 4DAEA 3ZWXA 1EJ0A 4ND4A 3LQ4A 3AFMA 4OJNA 4ZCPA 1ENPA 5IXYA 5A4DA 5D84A 3LBHA 1SU4A 1I5RA 4UXIA 5EJMA 5KTRA 2XUZA 1KFJB 4NEQA 4FDMA 5HOQA 4R83A 3ZWAA 2PRYA 5AVWA 1H2WA 1S3FA 4FT4A 3VPSA 5JTTA 1JDBC 4QVGA 5BYJA 1AKEA 2FW1A 1QV7A 3HP1A 4FGWA 3DVLA 1YQWA 1ZX1A 1M2OB 1Z6QA 2QUAA 5EZQA 5NLLA 3ZWYA 4B3TB 2QW8A 1PGJA 4LX0A 2HA6A 4R2XA 1WD7A 2SNIE 2DR0A 2XHZA 4ZVKA 6PFKA 2GBIA 1L7DA 3RBAA 2DT5A 4C4ZA 2IS6A 3SFZA 4UKDA 4QTTB 3KXPA 2FZCA 1OU0A 3FNEA 3NC0C 5EWJB 1BMFA 5M34A 3BS4A 5JMWA 4DSNA 4NH0A 4BO4A 1R5JA 3Q2IA 3ZVKA 4UOZA 3DHNA 4KXQA 1GNSA 5K8TA 1BMTA 1U4OA 3K7EA 2CLSA 1N6RA 2PH1A 2W2KB 3PWZA 5DBIA 3U1VA 3VC1A 5ALWA 5BN5A 3KQPA 4PLWA 3SQXA 3WRYC 3KKKA 4R5MA 3QOXA 2IZ6A 3AJRA 3MWDA 1S2IA 3FDIA 4DMUB 1IWPB 4L75A 4M60A 2Q5EA 4A2PA 3MWKA 3EUWA 1C9MA 4U1RA 3HJTA 4DE5A 2X14A 2J67A 4NYJR 4R8SA 2OQVA 3VHQA 4B85A 1XDZA 4DLNA 3U6BA 4H31A 2PX8A 3SC6A 5FAKA 4KHPB 4BNUA 1X1TA 3LU1A 2QAGA 4HLQB 4RIIA 3T1TA 3AB8A 3CVJA 5HIAA 4Y0AA 2G28A 4B83A 2PAAA 2OAEA 1NZJA 1AA6A 4JX8A 1SBHA 2WWFA 1JDPA 1TTHA 3DL4A 3QWHA 4G56A 4LPSA 4RSMA 2G9QA 3RCBA 4UBOA 5K8CA 5BPHA 2VUTA 1SK8A 3MMPA 2AXEA 4DJTA 1BE8A 1K2WA 3EDCA 1YBFA 2HYDA 4MXDA 4O2AB 3ESBA 1JXMA 4RL6A 4BNMA 2O8NA 4CV0A 5INTA 3D59A 5AKXA 5JSFA 1O96B 4Y2PA 3V8QA 2B1QA 3AGQA 3IKTA 4H6XA 3NQ41 3TW8A 3A3OA 3KKNA 1NI4A 4L1KA 1CRLA 1H3EA 1CFZA 1DQSA 1GAQA 4X8MA 4R1UA 3GR6A 3JQFC 3P94A 3PF8A 4ZAGA 4OLHA 4I50A 4ZZIA 4XIFA 1FP7A 2PHZA 4HNSA 3EQZA 5EJ2A 1DE0A 4ED9A 2FZGA 4J76A 1U2EA 3AETA 5FWNA 3VX4A 3O8QA 4QOJA 4B3XA 3DFFA 4QVKA 1CERA 1L0BA 3PYXA 4JENA 4U4AA 5E4YA 3ZVRA 1T9ZA 3W5CA 2QN6A 2R85A 4TL8A 1Z73A 1T9AA 2ZJZA 2B1JA 3M4YA 4NE9A 2WU4A 4P7BA 3UC9A 3VDXA 5JZVA 4YNBA 4URUR 1ADFA 5FUQA 3AI3A 1X80B 3RVJA 4K2HA 3KSAC 1VCMA 2C4HA 4HAOA 2W42A 2C9OA 5CFNA 1AG9A 4ES6A 4HWGA 4CTNA 1WDTA 2GMWA 1XEXA 3ZPXA 4DQUA 3LC7O 2ZJYA 5KYVA 5JH7A 1AF4A 3H2GA 3A9UA 4ZU6X 4MMZB 2OHIA 1GFZA 1SHJA 1V1JA 1VI2A 2UYQA 3G5UA 3NHMA 5CG1A 1KZ4A 4WV3A 5DM60 4DJDC 1J5EB 5JZ9A 5DHFA 2QDKA 1L5FA 4TLCA 3CV3A 1F48A 4LRXA 5BQ5A 1E79A 2HLDA 4QNMA 2O2CA 2VP0A 4EUSA 4PHHA 2QVYX 3QI2A 2X0DA 3RFTA 1R3UA 2HBYA 3THOA 3OVMA 3WDKA 1JEJA 3MGGA 2C83A 2WT8A 2QY9A 2I03A 1F5SA 1TZ2A 2DH6A 2VCYA 2JFNA 2YH2A 3MRVA 1XA0A 4M0FA 4EX7A 4FX5A 2YFYA 1RKXA 3IVGA 3Q7PA 2P5SA 3A6ZA 2CNLA 4YR7A 1K89A 1WEHA 1B6RA 1FTGA 3O4VA 2GN8A 2H17A 1M76A 4FCWA 4OHMA 3S1AB 1CETA 1AN9A 4RH1A 5SICE 1ZK3A 4EY3A 5JS8A 1NU6A 1NSYA 3N07A 1KPGA 1C5KA 1P44A 2QI9C 2DB3A 2CXPA 3CF4A 2IBSA 2W00A 2PGLA 2BMDA 5DN9A 4RPCA 3ICQB 4TSRA 2XQGA 5KHAA 4TXNA 2Q4EA 4R69A 5ADUS 3H1EA 3ANNA 1KJYA 1WCIA 1MC8A 3BOSA 4QTZA 4RD4A 4WCVA 5DM70 5IYZA 5BSGA 1E5LA 2F90A 2FWRA 2ZETA 3ERCA 4ZK6A 1NQXA 3LW8A 2OHGA 4O4HA 2EHDA 1UZMA 1JYEA 3DLCA 4HNQA 3SQWA 1QMGA 2RB4A 3HXMA 2C7PA 2SKDA 2H11A 5J59A 1GTSA 2ZM5A 3MOGA 5L45A 1L5OA 2JGFA 1G63A 5FL7D 5JAZA 3JYPA 4EBFA 5BWCA 3OQOA 1TEXA 5DP1A 2XY4A 4EZIA 3MTDA 1RXSA 1Z8HA 1YE3A 3LQ1A 4UPVA 1II9A 5HG0A 3OJEA 4RE6A 4HUTA 2DFVA 2H0QA 1Q92A 1ZL2A 2IYZA 3OJLA 4FCVA 1ZZGA 4KPGA 2QRMA 3HN7A 4MR9A 3OZ7A 2RG1A 3UTCA 1LSSA 1J5XA 2C3UA 3KYBA 8AT1A 1Z82A 1H6AA 2IHTA 4G0XA 3U3DA 1OX4A 2OUIA 4BB9A 3RI3A 5FA6A 5K8JB 1EMDA 3U81A 5AHXA 3V7YA 3LLUA 1HDRA 4CDNA 2OGWA 3PNSA 1MW8X 1NOJA 2QDXA 2WUDA 3CH5A 3KV3O 4RA6A 4W82A 1JI0A 5CVVA 5IC6A 1HF3A 5CDUA 3GFPA 2GJ8A 3GUZA 3ICEA 4EPTA 3L1UA 1XRMA 3UXHA 5BV2P 3ZQ6A 2XBMA 3NIDB 3BHMA 4DADA 5HS6A 5JH7F 1R6VA 2ZQZA 1XZDA 4MGKR 3TK1A 1JHVA 1WG8A 2K2QB 1K75A 5H83A 3QLVC 2UXBB 4FJ1A 4JBIA 1U3GA 3B1WA 4UCXA 5F78A 1FDTA 3SKYA 3T1QA 2XDYA 4GI3A 2JBAA 3D31A 4MR7A 3HKBB 3QU5A 4PC6A 1US8A 1IM8A 2HJHA 4RJIA 2C8KA 1QYRA 5J5AA 1Q17A 2O3SA 2Y1XA 4GD3Q 1N2HA 2QQEA 4L72A 4Q16A 3D0OA 4B6OA 1ADYA 1R8SA 4HSEA 5AXDA 2G77B 221PA 3EC7A 3L8EA 3OA2A 3TEMA 1T8YA 2I5PO 2WMNB 1C81A 3Q12A 3X3HA 2FJ0A 3BB3A 4NONA 3IEPA 2NUPB 2QRJA 3CMCO 2X9QA 1CQZA 4GOOD 4RZIA 2I34A 3LC0A 5CDFA 1GDTA 4C1NA 2RHLA 2ZUTA 1SOUA 1DSSG 1ZD4A 4PCVA 3VH3A 1PGNA 4YMSA 3AFHA 4IILA 4NOJA 2AR0A 1NN1A 2BZ0A 2WIAA 4PYOA 4DC0A 5KYUB 1C1XB 3CO0S 2C7BA 5JFGA 5I7HA 3LY8A 3U1BA 3ESCA 2BHTA 5KCMA 1NRWA 1XA3A 1ZI6A 3QG5A 3N3BC 2DUNA 2YFQA 2PT9A 4ZQEA 1PJZA 2FXVA 1QM5A 3E22A 1FP6A 1IAVA 5LB2A 4BIMA 3LBYA 1VL2A 2QUZA 5C8DA 4KIGA 2WD8A 4EF6A 2NXCA 3FGZA 4COOA 4MKZA 4GICA 3AKEA 5FHQA 4YRBA 1YJ5A 4Z9AA 3MOIA 1NTOA 4MRMA 1RABA 5E0KB 2FW9A 2YCBA 2V7TA 1TKBA 4FR0A 2C0QA 5IN4A 4V0OA 4G67A 2VHJA 3FPAA 1KC1A 1UBUS 1C3OB 2HA2A 4TS4A 2Y77A 1MRZA 3AUXA 4X7BA 5DBEX 4YCLA 2QZZA 3OIUA 1KS9A 4IUCS 1JJIA 4IINA 1A4RA 2N1MA 1FRNA 5FYQA 2BJHA 2OHJA 3SBDA 4RANA 3U61B 3O3OB 1WUJS 3TLGB 4EI9A 1ZSNA 3WTCA 1EFRA 1SCJA 4LOJA 4TRRA 5K0SA 1XZGA 3GQVA 1TZBA 3LUKA 2VK4A 5I7SA 4GU5A 1VJDA 1USGA 3O3CA 5E8JA 1GG9A 3RKSA 3V1TC 4DG9A 2B8NA 1GCOA 1U9IC 1RXEA 2QROA 3ND9A 4KOAA 1PSDA 4Y9SA 2L82A 5C5IA 3R5JA 1WETA 3H42B 2GFHA 1GKUB 2RHJA 2GF9A 2IEGA 2Y9MB 3DF7A 3O8OB 4NYIQ 3ZU6A 5FEMA 4FFOA 1FY2A 4Z4CA 2YXPX 1W4CA 3DZIA 1QPBA 2I4LA 4Y3UA 4EMSA 4OUDA 1E3EA 4S1OA 2DWPA 1JG7A 2FPUA 3DP9A 4QDOA 4Q82A 3U7FB 3HJRA 1TRHA 4GWLA 1K8ZB 1F2UB 3OCZA 4OHXA 4BNYA 4GVPA 4RULA 4QGFA 2JHGA 2MJLA 4IJUA 2VTEA 2BFWA 2BH9A 1MJFA 3GFQA 3PWKA 3UJBA 4ALNA 4RNDB 1ISHA 2I1LA 4LDRA 4YJ2B 5YASA 2WYOA 4BO2A 5AMXA 3V80A 1MLDA 1PYOA 3IUJA 1QZ3A 1QHHB 1ABFA 1B6SA 5J43A 3KBBA 1XO1A 1V96A 2J9GA 3K5PA 2YY7A 2H65A 2P0YA 3T1VA 2CHFA 4EPVA 2OR3A 1O5TA 2R84A 2FUEA 3GVCA 3K0FA 1LFAA 4MYRA 5C1OA 1TDJA 4MAAA 2XH8A 4MS4A 4J7AA 4O2BF 4OL9A 3WGTA 2BPOA 4DIDA 1JYSA 2X1VA 3K0EA 3T5MA 3ZDQA 3IJPA 3QVLA 2O5EA 5EMKA 3W06A 2PSSA 2MWMA 1XEXB 5ALMA 4C0SA 3Q72A 4J4HA 4E4YA 1MX1A 1OH7A 4LF8B 5KOJB 2WWIA 4H7FA 4MB2A 2ERXA 4FGLA 3VVBA 3AKYA 4TT3A 2YFHA 5LXTA 3R6TA 4FEGA 2HO4A 3MZ0A 1ESEA 4WY2A 1D3AA 1M6VA 1V4NA 3B1ZA 1VYVA 3E9YA 3E27A 3WLMA 1CUAA 1AB5A 1Z88A 2BEWA 2BGLA 2IE0A 2IZ7A 2I3GA 1T8PA 1BS1A 2OQRA 3EWSA 3HVHA 3IPLA 4RE5A 4E5NA 1PTJC 1DWQA 3ZLTA 1DIHA 1Z6XA 3L8MA 3ABIA 4B32A 1P9LA 2P6MA 4P08A 4BNKA 1Q3TA 4A9AA 3I2IA 2G82A 3ZJVA 1OYOA 1WABA 1F0PA 2EFCB 1YFJA 1Y6JA 1QBGA 3CRNA 3PNBA 4HEHA 4ITVA 4LZLA 5BNFA 3V55A 1EDBA 2NTVA 1TGVA 3FTQA 5EZSA 2D1SA 1ZD8A 1P9WA 3MWFA 4JDPA 3K4PA 3U7IA 4AZ3B 4E70A 1GTRA 2CF6A 4HQNA 4QLOA 4QOEA 5DT9A 5D85A 3ZWOA 4WNCA 3OQIB 1FYVA 3FDZA 3DXXA 3ND8A 5DCYA 4DNPA 2VRWA 1O0SA 4F2DA 3U3ZA 4K5QA 5JS7A 1F0YA 1UMDA 2GA8A 4P54A 4EY5A 3S2YA 3ER9A 3CLRC 2VXCA 2VJQA 3MLEA 5M7EA 3DG9A 2AXPA 5A3QA 4NAVA 3RK0A 1M6NA 4FDAA 1C7ZA 1RU3A 2CXNA 2OXCA 3VUFA 2VK8A 1Z6PA 2XTZA 1P2SA 2A0WA 3FSEA 4O2AF 4TYPA 4TWZA 3FNBA 3TO5A 5BQ3A 2F9MA 3AUKA 3DLTA 4N49A 2OZVA 3KTAB 5KYNA 4X6XA 3AQ4A 1ZISA 2DQZA 3IIEA 5HIKA 1FMFA 3CT6A 4NC9A 2HIMA 3MWDB 1Z4LA 3TFQA 5T3UA 2BSAA 5IKOA 5JHHB 3NYQA 3QJ5A 5KTOA 1BOFA 1N92A 1TUBB 2JFVA 3EJ6A 4JQOA 1CSEE 3R4CA 4RW0A 3S70A 1J42A 1M1NB 4HDNA 4Z4GA 1L2TA 5FT9A 5K09A 3MC1A 4CIBA 1CFJA 1P60A 2QYSA 3CWQA 3AI2A 3OETA 4DXHA 4RSGA 5JS6A 1XPUA 4YO7A 3CR7A 1LQ2A 3GJQA 3V1NA 4IAOA 4DZRA 4QDTA 1Z4MA 4IDPA 4EJ2A 1O6GA 3I23A 3WLKX 2I91A 1DIAA 5CCDA 1U04A 1BU8A 2O8VA 4J07A 1A98A 1Z4PX 2DPMA 2XCUA 1YR7A 2ISSD 1ZOSA 2MSEB 2O1SA 2YZNA 3CXRA 1HQCA 4HYTA 4LJ4A 4JT2A 4LHXA 1VP3A 3G5AA 1WZCA 4FDLA 4JLVA 4FSHA 4TVBA 3WNDA 3FUTA 2C96A 2FPPB 2XCOA 2EC5A 3GZNA 2Q3EA 2PS1A 5B4VA 3SM3A 5IVDA 3ZS9A 1W6UA 3VDRA 1RWBA 2X8JB 1CUYA 3RUIA 4AF7A 5AVJA 4OLJA 2KB0A 4M0PA 5AQEA 5IAKA 3GRAA 4RTPA 4MEAA 2PLAA 2XVAA 3L6UA 1AE1A 1KBZA 4FT2A 4XTCS 2EW1A 4U63A 4XEHA 3SS8A 2RCNA 1JMKC 1I2ZA 3M6WA 1VSQA 1RM0A 1Z28A 3U26A 1ZEJA 4P3XA 4PINA 4MVWA 4KLCA 4B73A 1EVEA 1EQUA 2R86A 4GOKA 2BFDB 5JMOA 3C6KA 3EDYA 4KE9A 1HNXB 4YI3A 5JCJD 1IOZA 1GLNA 1TCUA 1TJ4A 2PKRA 4MA0A 4V0KA 1G4UR 1VI6A 4B71A 2G1UA 1E3JA 2QTAA 2G67A 1FRFS 4Y7CA 4GYWA 4PG6A 5FBWB 2FDRA 1MPXA 1SXGA 1GVNB 2XCIA 1R6UA 1B8OA 2NZWA 1U6KA 2Q3LA 1TEZA 4QPCA 3CLHA 3B89A 1RRPA 3UKDA 3HFRA 4YMLA 1V3TA 5IT9A 1ZIDA 3PXCX 1KMHA 4XCVA 1RACA 5E4FA 2J46A 4KR2A 4ZYZA 2AN9A 4BO9A 1KEUA 4DDKA 4MYUA 4F6RA 5LQUA 1ZCBA 2XTJA 3LNTA 2DFNA 2FK8A 2QRZA 1JFVA 1FL9A 1N25A 2AVNA 4V1CI 5EHIA 4ZGGA 4TLEA 5L3ZA 1YS9A 3N74A 4W6QA 4JZYA 3T4EA 3LHFA 4BOYA 1IN4A 2H4ZA 4RIHA 3K9FC 4ZDWA 1I0ZA 2AOTA 2JK0A 1T8UA 3CLKA 5CHYA 5JO9A 2UYGA 1AZWA 4ZZ1A 3EA5A 4BVEA 4MWCA 5CA0B 3D8TA 3NEPX 4US1R 3K8ZA 2H07A 4YMUA 4HTFA 1RQLA 2I66A 3MIIA 4ODIA 3K71B 2FW8A 1G2PA 1VJTA 3X0DA 1BRTA 3IT0A 1V16B 1RR6A 1WMFA 3HHPA 2ST1A 2C59A 3ESZA 4L6CA 4NCHA 3RIHA 4DMRA 4D26A 2QVCA 1L5NA 1VFPA 1R50A 2AZXA 4D0NA 2BFBB 4V3CA 5LM3A 4V0SA 4L4UA 5HNKA 3Q85A 1G18A 3ROXA 1GKKA 1Q44A 4M49A 3VR6H 1Z5GA 4AJIA 1ZJYA 2YTZA 1KO1A 4DYHA 4P7GA 4Y1GA 1KHTA 3UWKA 4OI0A 2PUGA 2C3YA 3IPAA 4HLUC 2O8CB 3DDZX 1FFXB 4Z3OA 1GD1O 3FAZA 3O4JA 1DIGA 1N4AA 1CRZA 1HKHA 1ZIYA 1DX6A 2HUNA 1XRSB 1IOLA 2O20A 2O6LA 2RCYA 4KNWA 4YAGA 3GRUA 9LDBA 5B12A 1C8VB 5HCNA 5CNMA 5GJWC 1DTWA 3ZKWA 1CR1A 3C6YA 1FZQA 2EJVA 2PX6A 3OO0A 3ENVA 4WCFB 4RY2A 3WK7A 3WGGA 4BC0A 4BKQA 2J31A 3G68A 3T8YA 1K2VN 4GL4A 4KQHA 4FFLA 4CJXA 3OZFA 1M33A 1YZLA 3U44B 1WA5A 1CY2A 1PJ3A 4NCKA 3ULKA 4D5GA 3U44A 5HYVA 1YZ3A 1I80A 3UJPA 3PKJA 1P4JA 1WDLA 3ANTA 4F93B 2QN3A 3INTA 1EXMA 1ESMA 3B3QA 1T5HX 3CY6A 5CB8A 2ZVPX 4DGSA 1XTKA 4U02A 4RJTA 3L7JA 2W71A 4CMHA 4DLWA 3H0KA 4B4WA 4ZJPA 4XIYA 2WG1A 3UMVA 5JISA 2D7CA 1QUEA 4IIJA 2XXAB 1MGPA 3V8RA 4G5SA 1ZNXA 3N70A 3QIAA 2C97A 2IGBA 1A2OA 1P31A 2VJAA 1OPXA 1QS0A 5FWYB 3AVVA 2WNHA 3EIFA 2IYUA 4FMDF 2HXGA 3UMCA 4DIOA 1USUA 3V33A 2ZQ5A 4NCIA 2IUEA 3SXJA 1B14A 2Z2ZA 3LTEA 2QTVA 3I8SA 4BXOB 1GU7A 4B46A 1E3LA 5A02A 1JDUA 3SAJA 3D0RA 5ADWA 2AE1A 4GR9A 4K88A 1TK2A 1DO2A 2NU7A 4DSUA 1TADA 1ID1A 3GNLA 3L7KA 2A67A 1PLJA 2QP9X 3KUUA 1TD9A 4NK5A 4GMDA 4LXYA 2GD2A 5KYWA 3EPRA 1U0EA 2XITA 2YN4A 3D2CA 2ZJOA 3G6WA 5DULA 1GEEA 4B6EA 4B6FA 2QU8A 3E3AA 3A1TA 3HWWA 3S27A 3QFRA 1PK8A 1AD2A 1FYDA 1RYZA 4TKUA 2H9IA 1KNXA 1T3SA 1Z0AA 4RGQA 2C3OA 3NH9A 1S96A 1ADBA 2R8RA 1JECA 1TCVA 3JASB 3MQ4A 3ZIAD 5KOYA 3H6HA 4PYMA 3QKSB 4LDJA 2GCPA 4KK4A 4M4SA 5ANRB 2XCSB 5FI0B 5IDWA 1WAMA 3O7MA 5CK5A 3KETA 2ANBA 1SU8A 2Q6VA 2QVBA 2OHFA 1O4VA 3RS5A 5KC8A 3L79A 3IAAA 1SUFA 2YZMA 1JDBB 5B1SA 3ROZA 3HEMA 5JAQA 2CCJA 4IWYA 5DYWA 5H3HA 3A4MA 3TLKA 3AUAA 3GA0A 4A8HA 1RT9A 2Z9DA 4LJ5A 4EO4A 3QX7A 1LPSA 1V9LA 2JGMA 2RC6A 2EKPA 2XMSA 5CJJA 1GL6A 3KZCA 4IV0A 4UUPA 5EP2A 4EITA 1I1HA 3AGPA 3G9UA 1ZGCA 3MS2A 2H48A 3EQ7A 3O31A 4MTLA 4CM3A 1R5OA 2IHJA 2JAXA 2M98A 4GP9A 4OGWA 2WJHA 1XDGA 4A36A 4PF1A 1KO7A 1CUCA 2FMFA 2HWUA 2DPLA 2GZ3A 2VATA 5EIFA 3SFVA 2L19A 4KXXA 2E4ZA 2D8AA 1OAOA 2X9GA 4YCCA 2KJQA 2XGGA 5IWCA 4JSYA 1IJFA 1L4FA 3FF4A 3FYHA 5D3KA 5J5CA 3OTGA 1U2PA 1BH6A 2BFDA 4J4TA 4QE3A 2AUMA 5DX0A 4ZHQB 1B0UA 4E2FA 1JKMA 3RLFA 1YCDA 1AKRA 1ECJA 3PUJA 5COQA 4KE7A 5ED0A 3WLOA 5JNSA 1O97D 4PGAA 4XD7D 1Z8NA 3T5PA 3L7NA 4KHZA 1C2TA 2VA9A 2H06A 3IDOA 4Z4FA 2ZYRA 4FHGA 2JCVA 4CKZA 1AMOA 1Q14A 2O48X 4PTYA 4FXOA 3TOCA 4BFZA 3QVTA 2BEUA 2VAXA 1PR2A 4XDZA 2OWEA 3ZCXA 4HGOA 5BV0A 2YV1A 1RHQA 2FZVA 3HLTA 3QVOA 4W5HA 3SVLA 1XZMA 5HZKA 2C98A 1EP3B 1PDVA 1KIAA 1QK4A