3TBLA

Structure of mono-ubiquitinated pcna: implications for dna polymerase switching and okazaki fragment maturation
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
256
structure length
250
Chain Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of monoubiquitinated PCNA: Implications for DNA polymerase switching and Okazaki fragment maturation.
pubmed doi rcsb
molecule keywords Proliferating cell nuclear antigen
molecule tags Replication
source organism Homo sapiens
total genus 59
structure length 250
sequence length 256
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00705 PCNA_N Proliferating cell nuclear antigen, N-terminal domain
A PF02747 PCNA_C Proliferating cell nuclear antigen, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.70.10.10 Alpha Beta Box Proliferating Cell Nuclear Antigen Proliferating Cell Nuclear Antigen 3tblA00
3V61B 1U7BA 5IXAA 2IJXA 2ZVVA 3GGRC 2HIIB 1RWZA 5IWDA 2NTIB 4HK1A 1IZ4A 3P91A 2ZVMA 2Z0LA 1AXCA 1VYJA 3G65A 5HACA 2ZVLA 5CFKA 2IO4A 2NTIC 1B77A 3I2MX 3GGRB 3FDSC 1UL1A 5E0VA 4CS5A 5AUJA 1PLRA 3A1JA 1SXJF 1U76A 1GE8A 3AIXB 4ZTDA 2HIIA 3HI8A 3AIZC 1RXMA 1UD9A 2IX2B 1IZ5A 3VKXA 2HIKB 3FDSD 3V60B 3V62B 2ZVKA 3GPNA 3GPMA 3GGRA 2IX2C 1PLQA 3A2FB 2HIKC 3HSLX 4YHRA 5E0TA 4L6PA 3G65B 2NTIA 1T6LA 4L60A 2IO4B 3LX2A 1B8HA 3K4XA 1YYPA 3F1WA 1DMLA 5B7OA 2OD8A 3G65C 3U61F 3U60F 5JNED 3U5ZF 5DA7A 3AIZA 2IZOB 3IFVA 3LX1A 1ISQA 3P87A 2ZVWA 5A6DA 2AVTA 3TBLA 2AWAA 4D2GA 3A1JC 3AIXA 1RXZA 5E0UA 5H0TA 2IZOC 1W60A 2IX2A 1VYMA 5IY4A 2HIIC 3P83A 2HIKA 3WGWA 4TR6A 1CZDA 5DAIA 4RJFA 3A1JB
chains in the Genus database with same CATH superfamily
3V61B 1U7BA 5IXAA 2IJXA 2ZVVA 3GGRC 2HIIB 1RWZA 5IWDA 2NTIB 4HK1A 1IZ4A 3P91A 2ZVMA 2Z0LA 1AXCA 1VYJA 3G65A 5HACA 2ZVLA 5CFKA 2IO4A 2NTIC 1B77A 3I2MX 3GGRB 3FDSC 1UL1A 5E0VA 4CS5A 5AUJA 1PLRA 3A1JA 1SXJF 1U76A 1GE8A 3AIXB 4ZTDA 2HIIA 3HI8A 3AIZC 1RXMA 1UD9A 2IX2B 1IZ5A 3VKXA 2HIKB 3FDSD 3V60B 3V62B 2ZVKA 3GPNA 3GPMA 3GGRA 2IX2C 1PLQA 3A2FB 2HIKC 3HSLX 4YHRA 5E0TA 4L6PA 3G65B 2NTIA 1T6LA 4L60A 2IO4B 3LX2A 1B8HA 3K4XA 1YYPA 3F1WA 1DMLA 5B7OA 2OD8A 3G65C 3U61F 3U60F 5JNED 3U5ZF 5DA7A 3AIZA 2IZOB 3IFVA 3LX1A 1ISQA 3P87A 2ZVWA 5A6DA 2AVTA 3TBLA 2AWAA 4D2GA 3A1JC 3AIXA 1RXZA 5E0UA 5H0TA 2IZOC 1W60A 2IX2A 1VYMA 5IY4A 2HIIC 3P83A 2HIKA 3WGWA 4TR6A 1CZDA 5DAIA 4RJFA 3A1JB
chains in the Genus database with same CATH topology
3V61B 1U7BA 5IXAA 2IJXA 2ZVVA 3GGRC 2HIIB 1RWZA 5IWDA 2NTIB 4HK1A 1IZ4A 3P91A 2ZVMA 2Z0LA 1AXCA 1VYJA 3G65A 5HACA 2ZVLA 5CFKA 2IO4A 2NTIC 1B77A 3I2MX 3GGRB 3FDSC 1UL1A 5E0VA 4CS5A 5AUJA 1PLRA 3A1JA 1SXJF 1U76A 1GE8A 3AIXB 4ZTDA 2HIIA 3HI8A 3AIZC 1RXMA 1UD9A 2IX2B 1IZ5A 3VKXA 2HIKB 3FDSD 3V60B 3V62B 2ZVKA 3GPNA 3GPMA 3GGRA 2IX2C 1PLQA 3A2FB 2HIKC 3HSLX 4YHRA 5E0TA 4L6PA 3G65B 2NTIA 1T6LA 4L60A 2IO4B 3LX2A 1B8HA 3K4XA 1YYPA 3F1WA 1DMLA 5B7OA 2OD8A 3G65C 3U61F 3U60F 5JNED 3U5ZF 5DA7A 3AIZA 2IZOB 3IFVA 3LX1A 1ISQA 3P87A 2ZVWA 5A6DA 2AVTA 3TBLA 2AWAA 4D2GA 3A1JC 3AIXA 1RXZA 5E0UA 5H0TA 2IZOC 1W60A 2IX2A 1VYMA 5IY4A 2HIIC 3P83A 2HIKA 3WGWA 4TR6A 1CZDA 5DAIA 4RJFA 3A1JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V61 B;  1U7B A;  5IXA A;  2IJX A;  2ZVV A;  3GGR C;  2HII B;  1RWZ A;  5IWD A;  2NTI B;  4HK1 A;  1IZ4 A;  3P91 A;  2ZVM A;  2Z0L A;  1AXC A;  1VYJ A;  3G65 A;  5HAC A;  2ZVL A;  5CFK A;  2IO4 A;  2NTI C;  1B77 A;  3I2M X;  3GGR B;  3FDS C;  1UL1 A;  5E0V A;  4CS5 A;  5AUJ A;  1PLR A;  3A1J A;  1SXJ F;  1U76 A;  1GE8 A;  3AIX B;  4ZTD A;  2HII A;  3HI8 A;  3AIZ C;  1RXM A;  1UD9 A;  2IX2 B;  1IZ5 A;  3VKX A;  2HIK B;  3FDS D;  3V60 B;  3V62 B;  2ZVK A;  3GPN A;  3GPM A;  3GGR A;  2IX2 C;  1PLQ A;  3A2F B;  2HIK C;  3HSL X;  4YHR A;  5E0T A;  4L6P A;  3G65 B;  2NTI A;  1T6L A;  4L60 A;  2IO4 B;  3LX2 A;  1B8H A;  3K4X A;  1YYP A;  3F1W A;  1DML A;  5B7O A;  2OD8 A;  3G65 C;  3U61 F;  3U60 F;  5JNE D;  3U5Z F;  5DA7 A;  3AIZ A;  2IZO B;  3IFV A;  3LX1 A;  1ISQ A;  3P87 A;  2ZVW A;  5A6D A;  2AVT A;  3TBL A;  2AWA A;  4D2G A;  3A1J C;  3AIX A;  1RXZ A;  5E0U A;  5H0T A;  2IZO C;  1W60 A;  2IX2 A;  1VYM A;  5IY4 A;  2HII C;  3P83 A;  2HIK A;  3WGW A;  4TR6 A;  1CZD A;  5DAI A;  4RJF A;  3A1J B; 
#chains in the Genus database with same CATH topology
 3V61 B;  1U7B A;  5IXA A;  2IJX A;  2ZVV A;  3GGR C;  2HII B;  1RWZ A;  5IWD A;  2NTI B;  4HK1 A;  1IZ4 A;  3P91 A;  2ZVM A;  2Z0L A;  1AXC A;  1VYJ A;  3G65 A;  5HAC A;  2ZVL A;  5CFK A;  2IO4 A;  2NTI C;  1B77 A;  3I2M X;  3GGR B;  3FDS C;  1UL1 A;  5E0V A;  4CS5 A;  5AUJ A;  1PLR A;  3A1J A;  1SXJ F;  1U76 A;  1GE8 A;  3AIX B;  4ZTD A;  2HII A;  3HI8 A;  3AIZ C;  1RXM A;  1UD9 A;  2IX2 B;  1IZ5 A;  3VKX A;  2HIK B;  3FDS D;  3V60 B;  3V62 B;  2ZVK A;  3GPN A;  3GPM A;  3GGR A;  2IX2 C;  1PLQ A;  3A2F B;  2HIK C;  3HSL X;  4YHR A;  5E0T A;  4L6P A;  3G65 B;  2NTI A;  1T6L A;  4L60 A;  2IO4 B;  3LX2 A;  1B8H A;  3K4X A;  1YYP A;  3F1W A;  1DML A;  5B7O A;  2OD8 A;  3G65 C;  3U61 F;  3U60 F;  5JNE D;  3U5Z F;  5DA7 A;  3AIZ A;  2IZO B;  3IFV A;  3LX1 A;  1ISQ A;  3P87 A;  2ZVW A;  5A6D A;  2AVT A;  3TBL A;  2AWA A;  4D2G A;  3A1J C;  3AIX A;  1RXZ A;  5E0U A;  5H0T A;  2IZO C;  1W60 A;  2IX2 A;  1VYM A;  5IY4 A;  2HII C;  3P83 A;  2HIK A;  3WGW A;  4TR6 A;  1CZD A;  5DAI A;  4RJF A;  3A1J B; 
#chains in the Genus database with same CATH homology
 3V61 B;  1U7B A;  5IXA A;  2IJX A;  2ZVV A;  3GGR C;  2HII B;  1RWZ A;  5IWD A;  2NTI B;  4HK1 A;  1IZ4 A;  3P91 A;  2ZVM A;  2Z0L A;  1AXC A;  1VYJ A;  3G65 A;  5HAC A;  2ZVL A;  5CFK A;  2IO4 A;  2NTI C;  1B77 A;  3I2M X;  3GGR B;  3FDS C;  1UL1 A;  5E0V A;  4CS5 A;  5AUJ A;  1PLR A;  3A1J A;  1SXJ F;  1U76 A;  1GE8 A;  3AIX B;  4ZTD A;  2HII A;  3HI8 A;  3AIZ C;  1RXM A;  1UD9 A;  2IX2 B;  1IZ5 A;  3VKX A;  2HIK B;  3FDS D;  3V60 B;  3V62 B;  2ZVK A;  3GPN A;  3GPM A;  3GGR A;  2IX2 C;  1PLQ A;  3A2F B;  2HIK C;  3HSL X;  4YHR A;  5E0T A;  4L6P A;  3G65 B;  2NTI A;  1T6L A;  4L60 A;  2IO4 B;  3LX2 A;  1B8H A;  3K4X A;  1YYP A;  3F1W A;  1DML A;  5B7O A;  2OD8 A;  3G65 C;  3U61 F;  3U60 F;  5JNE D;  3U5Z F;  5DA7 A;  3AIZ A;  2IZO B;  3IFV A;  3LX1 A;  1ISQ A;  3P87 A;  2ZVW A;  5A6D A;  2AVT A;  3TBL A;  2AWA A;  4D2G A;  3A1J C;  3AIX A;  1RXZ A;  5E0U A;  5H0T A;  2IZO C;  1W60 A;  2IX2 A;  1VYM A;  5IY4 A;  2HII C;  3P83 A;  2HIK A;  3WGW A;  4TR6 A;  1CZD A;  5DAI A;  4RJF A;  3A1J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...