3TBWA

Crystal structure of the murine class i major histocompatibility complex h-2db in complex with the lcmv-derived gp33 altered peptide ligand (a2g, v3p, y4s)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
274
structure length
274
Chain Sequence
b'GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
molecule tags Immune system/agonist
source organism Mus musculus
publication title Conversion of a T cell viral antagonist into an agonist through higher stabilization and conserved molecular mimicry: Implications for TCR recognition
rcsb
total genus 63
structure length 274
sequence length 274
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tbwA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tbwA01
4ZQKA 1GGTA 3CVIH 1OLLA 5D5ME 1HWGB 1CLYL 5B8CB 2Z4QB 3BDYL 1YEJH 2XTJC 1T4KA 1F4HA 3MRGB 4G7VL 5CEZL 3LH2L 4ZTOL 3D0VB 5JA9A 5HHPA 2IAMC 4DGYH 1NFDB 1H3TA 3Q48A 4HWBA 1CD1A 1VACA 1XGRB 2X09A 1JUFB 1GHFL 2Q7YA 2YD7A 1DR9A 2EIZB 1FVDB 4ZPTA 3UYRL 3LKPB 4Y89A 4ZOCA 3T0BA 2DM3A 4UQ2A 4Y88A 2NY4D 5DVOA 4ETQB 4KRPC 1Z6JT 1MJUL 3PHOA 4FZ8L 4KJYA 3PL6B 3RPKA 5ISZB 2VJXA 3FB5A 4ZTOH 3QZWA 2DLEA 5JIIA 3V6OC 1U91B 5I16A 1IGCH 4JDTH 4H88L 3RTQA 4POZC 1ZGLP 1QYGH 2DQUL 5EUOB 2NY6C 3CVIL 3OJVC 5K9QI 1QLRA 5DEFB 4K9EL 4UT6L 3BHBB 3WIIL 5EOCL 1PQZB 4WTZA 3QUZB 5DHXB 1EGJL 5ENWA 1WIPA 3WFZA 4TSAH 3PV7A 3BH9B 1LO2L 5HGBB 3D85B 3NZHL 2NXYD 5DJYB 2BCKA 3IAQA 3MRLA 3QJFB 4LVEA 1Q0XL 4JB9H 2B5IC 1J8HA 5C09A 2OZ4H 2XT1B 4Q6YA 5IT2L 1FVCA 5LAXB 3PE9A 1MJJB 1QRND 4RNRA 2AKRA 4Y2DA 2GTWA 5KSAD 2VLKB 4WO4C 3VFVB 4H0GA 1WWWX 3SBWC 4DTGL 3HAEH 4QLRA 4Z0XA 3CPLA 3BZ4B 3M8OL 1OTUC 3KXFD 4YXLH 1F4XH 4L1DA 3S88L 4NN7B 1X4ZA 2AEPH 4R4FL 4QTHA 2ZCKH 3LN9A 2VL4A 4HBCL 4LKCA 4NUGH 2FJGB 1YMMB 3MRHA 5L2KD 1AKJB 1I1AC 3CXDL 2HFGL 2CKBB 5IGXH 4OZGA 1FAIH 4NWUH 2V17H 1FGNL 3GMQB 2CKNA 1A5FL 1MWAA 4HGMA 1SBSL 4JO4L 4DKAA 4I4WA 5DJ0A 1MFDH 3OKYA 3VMNA 1X5YA 4KMQA 3BE1L 3H9ZA 1U58B 1FNEB 1K6QL 3FZUC 3PXHA 1KT2A 3KPOA 4JG0H 1HH9A 3GIVA 2CJUL 2GJ6A 2E5EA 2DS4A 2FZ3B 3BW9B 3RX7A 2LVCA 3O9WD 5J11B 2A1WH 5JLZB 1NGYB 1I9EA 1IC5H 4J4PC 4FABH 3DVNB 3DX9B 4OFVA 5FHAL 5HHPB 3X3GH 1CICD 1YPZE 1FVEA 5C0BE 4PJIB 4CJ1A 1LGVA 4HQQL 5IVXB 4XNXL 4M6NL 4JZJB 3AB0B 1G7MB 1IKNC 1MJJA 3O8XC 4N8CL 4RGNB 5D6CB 5KSUA 2LAGB 5I0DA 2GK0B 1FC1A 4ZUUA 2CDGB 4R90L 3QI9D 3BVNB 3VFRB 1ORSA 4WI2A 5C0CE 5LGJA 4RGMC 1GVIA 4MWFB 2PO6D 1I85A 3N1PC 4U6TA 4U6VH 1J1PH 1KFAL 3T1FB 1NFDE 5EZOH 1JGUL 3HC0A 5DMGD 4RFOH 3NMEA 2LTQC 3OV6A 3O6FD 4XXCA 1FNHA 3V6OE 5DT1H 5DJ8A 4WU5B 4L8DB 1CT8B 1ADQL 2EE2A 5ICXA 4FNLL 2I9LA 2CKBA 4D8PA 1BQUA 1NBZB 3O2WL 2NW3B 5FCUH 3MO1A 1A3LH 3O9WB 3MRRB 4JDZB 3NGBC 4NGHL 4KXZH 2AJVH 2R2EA 2ADIB 2C4FU 3ZYIA 5C0FB 3ULSA 2Y5TA 3UEZA 5FO9B 5EBMB 1YPZA 2E9WA 3C6LA 3GKWH 1J11A 1VEPA 3LKRB 4HXBH 2GIYA 2XWJB 2C7UA 1FYTB 2VLRB 3BN9C 4ONFL 4DZBA 5JOEA 1DANU 4HC1L 5A16B 5I19L 1P5VA 5E94A 5IOPA 4FQIL 3HB3D 5ECJE 1A14H 5F7HA 1KTDB 2DQGH 2OP4L 2PTTA 1RJLB 4J3VA 4F7MA 1T20A 1MCPL 3INUH 3OAZH 2XZAL 1UC6A 2OL3B 2YPLE 4BFIB 3HZYB 5GGTL 1AXTH 4BSJA 5IB3A 1N7ML 3K4ZA 3MGAA 3GSUA 3GSXB 4U1HB 1F90L 5CJXC 4HWEH 1MJ7H 5CJOH 3OHXA 4XVJL 3SKNA 4XAKE 2WUCL 5IG7B 3OKOB 1BQHA 5GRUL 3NH7H 3CFJB 2QHRH 2FEDD 4OCXH 1ZLSL 4KK8D 3LHPH 5C0GB 3UX9B 4GAFB 4HF5H 4XC3L 4C4KT 1FLRL 3B2VH 1C16B 4WEMB 3ARFD 3BH9A 4D94A 4FFVD 1Q72L 3OKEB 5J6HB 3D85A 3FFCB 4X6EA 4YUEL 5AZEH 1I1YA 2FHCA 3ZT5A 5CEYA 2CK0L 5C0AE 5EBWA 4X7TB 2R0LH 1DJSA 3SJVE 3WHE0 1NH6A 5ELIA 1HSAB 3ARBC 3KXFE 1TZGH 1YMME 5IJKC 2BERA 3QG6A 1OPGL 4UQ3B 1KCRL 2Z8SA 1MY5A 3C5ZA 5D93B 1J05B 2A77H 1OAQL 3OKMA 4CNIA 3QWOA 5GS3A 2Z91B 3LEVH 4NUJB 5DUBB 5HHQA 2F53E 5CHNA 5DEGB 2VXQH 5IB4B 1RSFA 1X7QA 3C8HA 3ULSB 4WJ5A 4LCCA 1BLNA 1NDGA 2BVQB 3L1OL 4X99A 4H5SA 2BRRL 4ZDHA 5HY9A 1CF8L 1YYLL 4CADA 3O3DB 4F57L 2NY6B 2FJFB 3S5LA 4U0QB 2YPLB 3OR6A 3P4OA 5F1IA 4YAQA 2EXYD 5D71H 4HJJL 3MJ8A 4LCWA 2BOCB 5HDLA 2IJ0C 2CRMA 3T77A 3SO5A 1A4JA 5BOPA 5I18L 5DD5H 1RK0B 2J3SA 4Y5VA 3ETBF 3NCYS 1FYHB 1U0QA 2X10A 2FR4B 4LDEB 4OLZH 5KTEH 3VFPA 3VWJA 1A21A 3VG9B 5DHYB 5IFHH 3QCUH 2F53A 3ARGA 3JWDL 4JHAH 4LPTA 3ARRA 3LPFA 2ERJB 1A2YA 1UWGL 2ICEB 1J1XH 5KBNC 2ADGA 2GAZB 3OAYK 1L0YA 3RUGE 4Y1AB 4JG1H 1AY1H 1JN6B 4NN6B 2EDOA 2GI7A 5F89A 1NEZB 3O9WA 2UY7A 3DVNA 4EI6B 5F7DB 1UYWH 5EC1B 3EIFA 4MD4B 1LO5A 1RU9H 3RWJA 5I71B 1S9WB 3OGCA 4LHUB 3RVUD 1ZEAH 2OM5A 3E3QE 4E5XA 2EDRA 3T0DA 5IB1B 2Z8RA 4M8VA 5L9DH 4U6XB 1T1WA 3LSOA 4HUWA 4LPXA 2ID5A 3FB6A 5FO8B 2XRAH 5MI0B 3FB8B 3VFNB 5DFVC 4HIEB 1SJXA 3LN4B 3WYRA 1OAKL 2Q3ZA 2CKBH 1AO7A 1CQKA 2CLVB 2JIXD 4YNYB 4MVBD 1I9JL 2YN5A 3SQBA 2NYYD 5EO0A 5GGQH 5GS0C 1MOEA 3TBVB 1A02N 1AXSA 3AU1A 3ROLA 2AP2A 2KL6A 1KF9B 3SKNB 4AEHL 4EEEA 4PRHA 4LLDB 3PABA 2X44D 1OSPH 2AXHA 2XZQH 3G08A 2GSIB 2VUYA 3IFPB 4ETYA 3ELAT 3JV4A 3MJ8B 4LK4A 1KNOA 2IPKA 2OQJB 3EYFA 4NQVA 2FNBA 4XHQA 5ILTH 1VGKB 2J6EL 4I3GA 3B9KA 4NYLB 2YC1A 4NNPH 1NGWB 1S7SB 5D2NC 3U2SA 1FIEA 1MCDA 4O51A 2AJSL 3B8YA 4WI7A 5T1MA 5IWLC 3MLWL 3GSNB 2IG2L 3QDGA 4JZJC 4RGNC 1JZ7A 1J8HE 3ET9F 4I8DA 1QFUL 1R3JA 2YEZB 3CFCH 4FXGB 5T3ZL 1MEXL 3WS3B 1JMZA 1KYOK 4BQCA 3BKJL 2WUBL 3NCYP 4JY4B 2BNUB 3G6AB 4XPFH 2G5RA 2CDFA 4JFQA 4GUPA 3RX8A 1JWSA 2XQBH 4PD4K 2H8PB 3D0LA 4ZFOA 2XWBB 2FD6L 3GMPA 1KIRB 1NFIB 3ZE0E 2A9NH 3IU4H 2PR4H 1JHTA 4ZSOB 3BHBA 3D39D 2DTSA 3QUML 1V3MA 4DVRH 3T3PF 2XKUA 4UU9B 1A4JB 5T3XL 5J13B 5KN5A 5KVFH 5GRYA 2JKXA 3QUMA 1WWAX 5F7FA 1T6VN 1AIFA 3BZFA 2JCCA 4N8VB 5JXEC 5CEYB 3VFWA 1KCVL 4M1CC 4UT9L 2R23A 3KPRD 4XVTL 5F97E 4BK5A 4ZFOL 4U1MA 4IRSB 5FV1L 3WDHA 2DKUA 1NEUA 4LRNL 4D0BA 4RNRB 1FO0B 1JK8B 1CXFA 4GRLB 5IMMB 4KAQL 5JW4Q 3ZTJG 3QIBD 3VWKB 4BKLA 4ZFGL 4WI6A 4LNRB 2MPAH 1OARH 2YUVA 3BRDA 4YHYC 1MPAH 4AG4L 3ZE2F 3ZDZF 2DLTA 3MLXH 3K74B 1EZVX 1T6WA 3N1GC 2CR6A 4PJHE 1X4XA 3QDHA 2DI7A 3BQUD 1MNUH 4X6CA 3T0AA 3LN5B 2QJDA 5J0BA 1S7VB 5BMFH 1KELL 3HC4H 2J8UF 4HUNB 3I75B 1YA5A 1NKOA 4MNHA 5B8CC 4U31A 3GNML 2NNAB 4N8VG 2ED8A 2FH8A 4ERSH 3MC0A 3PXJA 1V7NL 5IR1A 5EUOF 3L5XL 1RI8A 1P7QA 3DUHA 1B0RA 1ZLVK 3GIZL 5GS0H 2H2SD 5KS9A 5KS9E 3REWB 4QTHB 2I9TB 3N1FC 4IRJA 4BUGA 1CE1H 2IF7A 2OR9L 4HHAA 3OZ9H 5HHOE 3ULVF 1E4JA 25C8L 1X5XA 4Z0XB 4XNYH 3BQUC 4FHBD 5HDBF 1GGBL 1S7WB 4IMKC 5FGBC 2V2WA 1HQ4A 1T21A 4MD0B 2R1XA 1U8LB 4X4MA 4MCZA 4XP5H 4AQ1B 4U05A 4WDIB 1LK2B 1D5ZA 5K9JL 2H9GA 4OGYL 4NZDA 2ZPKL 1BEYH 4D0BB 1K4DA 1NCDH 4OLXL 3CH1A 4K7PY 4PR5B 4ZNEA 3X12A 2NY5L 4O02L 5DJYA 3G5XA 3MREA 4DUVA 5E8EA 1V05A 3HAEB 4KV5E 5IROC 4ZO8A 4G9DB 5FYJH 1BVLA 1BZQK 3UBXG 2VRAA 2CD0A 1ITBB 1UB6A 5T1LD 2BVTA 3GHEL 3VXRE 2ADIA 2P8LA 2QBWA 5HD8D 5L2JB 2VLJE 5DO2D 5C3TA 1JRHI 3SCMC 4XVSH 1F3JB 3VRLF 3EFDH 3QFJD 3SKOA 5CILH 4DFHA 4JR9L 2ZUTA 4JJ5B 3ULUL 2QSCL 3MRRA 5ISZA 1G7MA 1U8QB 4IOIA 4EOWL 1XR8B 2DIJA 3EOAA 3ZSSA 2GK0A 3OWEA 4M7LH 3NACL 3QIWC 3RI5K 1IT9L 5D7SH 2V7HA 4BH8A 4EN3B 1W72L 4YHIB 2HKHH 5LGJB 1GIGL 3BIAX 2YD3A 3VXSA 1UM5L 3VXRA 5INDB 2XN9D 2AK4B 4DJMA 1F3RB 4JQIH 3NCMA 4FQ2H 4L8BB 4YEEA 3LD8C 3S4SG 3VGEA 4KDTA 1A6TA 5HVHC 2ARWA 4GKOA 1AD9B 2AJXH 4JLRA 5E6IC 1D5IH 1FG9C 3AGVA 1I7ZB 4F9PA 3S3SA 4I0PC 4FOMA 1S8DB 2ZUXA 1CK0H 3D0LB 3SE8H 4WU7A 4MAUH 4YZFF 1WAAA 1L9NA 1FZKB 3MA9H 4E41A 3T65A 3JV0A 4M9OA 3T0EB 3BN9D 3OJDA 2FX8H 1FG2B 2CDEB 5J56B 2HA1A 4LQFH 5AAMA 4G42A 4U1KB 3HZMB 1AGDB 1KV3A 4NKDB 2J5LC 1M6OB 2HTKD 1RUKH 1F13A 1QBML 4P4RB 1RIVH 4WENB 1MFBH 4FQQA 4PJHB 1NLBH 1ZV5A 3KPQB 3SEPA 5HXMA 3S96A 5E03A 4P4KD 5T1KD 4R4ND 3OX8B 4LPWA 3TBYB 4JREC 1R0AL 1CXEA 3MLZH 5D70L 3C2SA 4ZS6C 4RMSA 5SWSB 4LCUB 1C08A 2AK4D 2HFEA 2VXSL 5D9SA 1F8TH 2P49B 4D9QD 3UPRB 4PJFE 1KJ2L 4PLJC 5FIEA 1S9KC 1IMHC 1EO7A 2X4OA 4KTDL 2MKLC 5H94B 5JNYA 1IEBA 4X7FC 2C3XA 2AEQH 1TNNA 1CR9H 3EFFA 3FO1A 3FRPG 3MPCA 1C1EL 3H42L 1KLGB 4OLUL 1ONQA 5CBEA 4N0YH 1NAML 4XXDA 1U42A 4OCMC 2BJML 1BBDH 3L9RA 4OCSH 4YX2L 2AK4A 3G6JE 1CFSA 4DW2H 4JFDE 5I73B 3E2HB 3K1KC 4YHKH 5CINH 5TGBA 2WLZA 2KZ1B 1G9MC 4ZXBC 5AEAA 3PWPB 4NC1C 2LFGA 5DMKA 3EYOA 2HT4D 2WLYA 4XB7A 3HE7D 2C1OA 2EKSB 4LEXL 5D2NA 3U4AA 3ALXA 4YC2C 1H3PH 5C2BH 1DCLA 3TO4A 5I1CL 3GSOB 3H7LA 5EO1B 1E4XL 1C5DB 4XNMA 4ZUWB 2Z31D 1ZT7B 1PKOA 3P2TA 5EIVA 5C9JA 4ODWB 3MYZA 5E94B 1T1YB 1JF5A 1CU4L 4E5XB 3T04D 2YPLA 4YDIL 5EBGA 5HHQB 2ZUYA 1M7IB 3HZMA 4OZ4A 3QDJB 4FFZL 2IQAB 3WNLA 4XI5D 1UH3A 5F9DC 2NY2B 5LBSL 1LNUA 1GZPB 2CLRA 2W0KA 4CU7A 2ADFL 3BT2L 1YNKH 4KZEH 3ZTJH 1NDMB 3V6OA 3MRNA 1IAIL 4IRJD 4EI5C 1YNLH 3OR6B 5F1IB 1SY6A 5JIHA 4KVCH 4PJEF 1BZ7B 3U9UA 3G5VA 3S35X 5DR5H 4S11A 2GT9A 5F7EL 5C09E 1K8IB 3K80A 4POZD 3S37H 2HFFA 1A6VL 5CP7B 1MRFL 4OFDA 3DI2B 4XHJD 2X1QA 2OQJA 1WFTA 2DJ4A 3QFDA 4NUJA 4LSTH 4HV8A 4YGVB 3SQOH 3MROB 3ARDC 3GDBA 2I60L 3DMMB 4P48A 2VZ1A 1Z9OA 4M1DH 4WJ5B 1HWHB 3W81A 3L9RB 5BQ7A 2B7DT 1R3KA 4LSQH 4U1IA 4CBPA 5I1EH 2VZVA 5MERA 1OB1B 1KJMB 3BDXA 2WAHA 5ABDE 4C56A 5CGYC 3GSVB 5J1AA 4PJ5B 1J9CT 1F4WH 1P4BH 2AGJL 3QIUA 5AWNH 3V52L 5A2KH 5JQ6H 2H32H 4J1UA 5H8DA 1IGYA 2W60A 4XBGB 4TRPH 2E3VA 1DDHB 4FRWA 4MS8A 5IEHA 3V8CA 1YEEH 5KZCD 1F58H 3A67L 4IOFC 1DQJA 4JM2D 2NTFB 4JY4A 3CZFA 2VAJA 4U6XA 3JV6B 3C8KB 4KI5D 4N5ED 4PJXA 4AQOA 1ZGLA 5J57B 4NC0B 4MJ5A 4NQCE 3PUCA 4PD4J 3I2CH 1A6WH 1AHWA 2DYPB 3VFOB 1HNFA 4MLSA 1WCBB 4KMLB 1UZ6F 2X42A 3ZDXE 4WTZG 4QOKB 1PG7W 1D9KD 4QRUA 4M4PA 1DBBL 3MX0A 1T1XB 2FGWH 4M93C 5ID0A 4XRCB 5FK9A 4KRPB 3WFDH 3DMMD 4F58L 2ZOLA 3AAZB 8FABA 4N5EA 4P5TC 4LPCA 1I8IA 1ZTXL 2EYRB 3FQRB 3QNXB 4NQCA 5C92A 32C2B 4FTVA 2VDPH 4UNUA 5E8OB 4FQJL 4GKZB 4IDJL 4OUUB 4UV7L 3MBED 2VISB 4UUJA 5TF1H 4Z7VA 5IMOB 1I3RB 4JZOA 1NBVH 3TFKD 3WFDL 1XEDA 3PL6D 4F58H 4RMTA 2YXMA 1MRDL 2AV7A 4GBXA 3GKZA 3FO9B 3I02A 5CKGA 3BKML 2HJFB 3DGCR 4PRIB 4YNYA 2OZ4A 4OZHB 5I17A 3TJHC 4H1LH 1KJ3H 2RQ8A 1EA9C 3PDGA 1N59A 2KH2B 3FOLA 1CICC 5JZ7C 5C07D 3BJLA 1OWWA 2Y6SC 1G0XA 2DLFH 2Q87A 4P9HC 4S0SD 3H0TA 3MA7A 4GMSH 2P5EA 1RZ7L 5I1AA 2YOCA 2NNAA 4XGZB 4QXGH 1H3VA 3C8KA 4PJXB 1Z5LB 3T0EC 4PJIA 4JAMB 3NGBB 1P4BL 4M7KL 2IPKB 1ZA6A 4HULB 3MLUH 4E9LA 3P0GB 1TJGL 1HQRA 5TPWL 3MRDA 2B0SL 3R06A 3VG0L 4R8WH 1QSVA 1KPUA 4XWOC 4NYLA 1GSMA 4YXHL 1QA9A 3WN5C 4CGTA 5GGVH 4QHUA 1BM3H 2X2YA 2MMXA 3UO1H 2UZIL 1KJMA 3QSKB 3FHAA 2GJ6D 1YNTA 3PGFH 1OF2B 1TZIA 3G6JA 4G6MH 5LCVL 1CGXA 4NWTL 5D8JL 5FKAA 4NOFA 3WLWC 5CEZE 2YZ8A 4PJBF 5HHXL 3H3BC 3QQ9D 3AU1B 3F5WA 5C0RL 1J5OL 1YNKL 4C59B 3L3JA 4ZTPH 3KPTA 4LVOB 5LBSH 5K9KA 4P5MB 3DRQA 1IC1A 2Q1EA 2UUDK 5I30H 2IPUK 3QRGH 2X9WA 4FFZH 3THML 5IVZB 3CVHB 2GT9B 4QRRE 4WWKC 2JJTA 4YDIH 4PRNA 4F7TA 3DUUB 4KUZH 4MNHB 5K9OA 3RAJH 3EDEA 2ATKB 4Z7NE 1UACL 4K3JL 5B8CA 3TNMA 1EUTA 3AVEA 3KS0H 4MJIB 5J13C 5HSFA 1EJOH 2EH7L 1E4XH 5I1CH 4DEPC 3OAZK 2FRGP 2P5WA 3OQ3B 3O6FA 1S7WA 4LEOB 1NANH 5D1QA 4GSDL 1R3KB 1DFBH 4N0FB 4AMKH 5DLML 4C83A 3GBNH 4NBXB 1R3HB 3IFNH 4U1JA 1XR9B 5J12C 2AI0L 1FVDA 5CINL 3P3YA 4ZPTB 5DD0H 3C5ZC 3ARVA 1V7ML 5JXAL 4DW2L 4ELMF 4OCSL 4YX2H 2O5YH 1T66D 5D7LB 5F9JA 1R5IA 4NZRL 1YY9C 4DK3A 4QT5B 4AM0A 3ES6B 1KTLA 5E2WL 4XMKH 1C1EH 3H42H 4G7YL 5HBBA 4P2OC 2FYYB 4JFFD 4MXVE 1N8ZB 5C86A 1PYWA 4UU9A 3V5KA 4HLJA 3IDMA 4OLEA 3SDXF 1BFOA 4U6HB 4AIOA 3IDXL 1KCUH 3RWEA 3O6LH 4ZFZA 2Z4QA 3CSYB 1T20B 1AH1A 2Z91A 5B38A 3SDYH 5AZ2L 4G42B 1R0AH 4QRUB 1KGCE 3H0TB 4RAUA 4TUJB 5HGDB 2WINA 3C87A 5DZNA 4ALAL 2LU4A 4FQQB 4GKNA 3T0EA 5JW4M 1HYSD 4EN3A 4F37F 2V5SA 3Q5YA 4G6AC 2IH3B 4Q9RH 2Y07L 1D6EB 1DBKL 1INDL 4GW5B 3K81A 3MJ6A 3WJJA 2OMBA 5F7UA 2FX8L 1W0VB 2OL3L 4U1LB 3NABH 1TETL 5E6ID 2OTWA 3H7BA 3MLYH 2V5TA 4N8PA 3KPQA 2HVKA 4PTTB 3QPQC 5MEND 3QR2A 5C0IA 1X3DA 1MI5A 4XCEA 3HS0A 2GY7B 4MVBC 4CW1B 4EBQH 1LMKA 5GIRA 1QRNA 1X6LA 5I1HL 1P4LB 2OJEA 3GJEB 2HP4A 3MRFA 2H32B 1BP3B 3JSSA 3MNZB 1T7YA 2GJJA 2VLJA 1I7ZA 1YUHB 1AFVL 4KROB 5FM5M 3G9AB 5I76A 3N50A 4PB9H 2P45B 5FA4B 2IANB 1W72H 4J4PA 3KDMA 4UOW0 5DK0B 3NACH 3RIFK 4UB0L 1D6VH 5GSVB 3M17A 3K4AA 1RJYB 3O6KL 2H3NA 4PS4H 1QQDB 4K3EH 2BSSB 4JFDD 1AGBB 3UZVB 3VXSB 3ULUH 4WW2B 5HYFA 1ZA6B 3T2PA 2VXTL 3BO8B 4NKOB 3EFDL 3DROB 1HH9B 2XY1A 2HN7A 5D7IE 3CK0H 5IBLC 1HHGB 3S36H 4P4RA 4YZFE 4GAJL 4WV1A 4LHJB 4FQLL 4RISL 4K2UL 2V7HB 2JIXA 2A74B 3GMRB 1KCSL 3VCLA 4ZPVA 4UTAL 1YEHL 1IM3A 4P46C 3N06B 3ARZA 3SHSA 4YLQT 2VITA 1Y6KR 2VDML 3HLAB 2DM4A 4AEIL 3O2DH 3HG1D 3T0XA 4NZUL 1YMMA 3MRHB 4JZJA 4RGOH 1OWRM 2V2XB 1XFPA 3MV7D 4LRIC 4OCWH 4OGYH 4KROD 4PGDA 1LHZA 2AQ1A 5F89B 2DM2A 1NBYA 2J8OA 1HHHB 3HI5L 4JHBA 1YEIH 4H1LB 4WU7B 5ITFA 4DKFH 4XCEB 3ULUF 1J88A 1VFBA 5B39B 3CAFA 1HXMB 1GGBH 3OXRB 3LKNB 4ZMAT 4QHMB 1UH4A 2BHZA 2QQNL 4UBDD 3GJEA 4DCQA 1I8LA 4DGIL 4EXPX 4JFEA 4TQEL 3MCKB 3RIAK 4X9BA 5GRXG 3O45B 3OXSB 2F8VA 4PJ7E 4HIEA 4C56D 1JZ6A 4ZFZB 2XY2A 5MEPA 1GGYA 3ALWA 5F3HB 4I9WD 1WBZB 2Q6WB 2DWEB 3JTTB 5CKAA 3ULUE 5F3BA 5L7XH 4JM2A 4NN7C 5FB8A 4HKXB 4R4BB 4MB4A 4DWHA 4YO0B 1XR9A 3O6ML 3M1BB 3C6SB 4UINH 3WD5H 2AQ2A 2ICES 3G5VB 4J1UB 3MOAL 4HW6A 2PTTB 3QIBC 3GMQA 1CWVA 2Z35B 4OD2B 1ZLVH 1IAII 4LP5A 1XIWB 2WWMD 4M43L 2VLRE 5DWUL 3A6CL 2VERN 4Y4KC 4F8QA 2X4UA 1BD2B 4V3EB 4PJFF 1Z0MA 3EDDA 3KPRA 3EJZD 3EDFA 4TN9A 1EO5A 1MPAL 1L6XA 4TNVF 1U8IA 3QUXA 4R2GD 1NMBH 3DMMA 2P5EE 5EPMA 5CZVH 5FYJU 5J8OA 5FYLH 1T1YA 5CGYD 3TWCL 3UXFA 3BX7C 1TCRA 2G60L 4LCWE 4LRNH 5D2NB 3UZEA 4D8PB 3F7PC 5ICZB 2VO5A 4B0MM 2DI8A 3MLTA 3PHSA 3BPOC 4L3EE 4Z0BH 3VI3F 2H2PD 4XVTH 3DWTA 5HYQA 4GS7B 1VERA 1QLEH 3LMJL 4OFKA 2WWKT 1FVEB 2FIKA 1T2JA 3FKUS 1N4XL 32C2A 4JO3L 4K94C 4HXAH 2E7CA 3P9LB 3VD4A 2X4RB 4XWGH 3ZKQD 4KRNA 3QUMH 3EFFB 4ZO7A 2W9EL 3PWNA 2UWEB 3KXFA 3FMGL 4FTVE 1NDMA 4L1HA 2FD6H 4N0UA 1NMCC 5HJ3B 4XAKD 3SGJA 3HE7A 2XQBL 1RUMH 3RVWC 2HT2D 1E4KC 4DKEL 2WUBH 4QRSA 4QTIH 2MQ3A 1BIIA 5GJSL 1QLFA 4BUHA 4QXUH 4NN5B 1OAUL 5D1ZB 4I9WE 1JF6A 5I1GH 4LAJH 3L3HA 4PRPA 1AQDA 2DN7A 2Z93B 1NBZA 3V4PL 4IIQC 1YDPB 2NY7H 2YPVL 2P5EB 1PX4A 1ADQA 3FT4A 2FJHA 1EEYB 8CGTA 3VH8B 4J4PD 4XH2B 1IZKA 3D48R 5T33H 3O3AB 1RJYA 1X6NA 1PW3A 1I7UA 1RZJH 1OLZA 2Q8AH 4TQEH 3UTQB 4ZOBA 4QHUB 4JFYA 5KSVA 3U7WH 4GKZA 3R8BB 4FQ1H 3PWVB 1YN6B 1HHGA 4RA0C 1XGUA 5IMOA 3CFKA 3IF1B 5BV7H 5FYKL 5CSZA 4TOYH 3VJ6B 2E6QA 5H35A 2MHAB 4W70A 4Z5RA 5CD3A 1ZHNA 2HYMA 1UWEH 3CJJA 4MQXC 3IJHA 4MJ4A 1UWXH 5JDSA 4M1GH 3SGKC 1S5HA 2K7PA 5FYKH 2BZDA 2CKBL 1ERNA 2VDMH 4LARL 4YBHA 2CUMA 3FB6B 2GUOB 3RGVB 3E6FA 3VRJA 3U7WL 3LCYA 4UNTA 1AO7D 1UXWB 5E8OA 3GI9L 4F9PC 3QO0B 5AG9A 1FL5A 4K2UH 4R7NA 1UKTA 3BD3A 5ETUB 5T33L 5BW7C 2D7QA 5KVDL 4ZOAA 4PJGA 2A73B 3PDOA 4FFYH 3E6HB 3ILPB 4AK1A 5IJKA 4RSVA 5F1OB 5GGRB 3P0YH 2C5DC 1AY1L 4X7EC 4WEUD 2CXGA 3MOBH 3JV4B 1I1AB 1MVUA 4X6FA 3FTGA 1Y6NR 3O3BA 1JN6A 4OZFA 1KCGC 1NEZA 5LQBH 1MLBA 5E8NA 2Z0BA 2J8UE 5F6IC 5IFHL 1JBJA 4PRAB 4WFHD 1PJ9A 2P24B 4G8GA 5GS2D 2IPUG 2W65B 4OBSA 3QXWA 1AFVH 2GKIA 4YDLC 2CIIB 3JV5A 1JZ2A 4PREB 2NY4B 4QCIA 4N1EA 3ZKXC 4IOSD 5IVXF 3D39B 4LCWB 5D2NE 5FO8A 4BYHA 4LF3B 4RDQG 4GW4B 5ISZD 3VE0A 2D7TH 4Y16D 5I66A 3UYOD 5SV3A 1AO7B 3DO7A 1CF8H 2XXMB 3FCTB 3VJ6A 3MLYL 1GAFL 1E4KA 5E2UH 1I8IB 2LU3A 5T3XE 2R0WH 3FN0H 4G3YL 4M48L 1J8HB 4J8RB 3FN3A 4HJ0D 1INDH 5HYJD 3TV3L 1FCCA 3MUHL 1GXEA 4Q9RL 3NZ8A 3RNQA 2IADB 2WP3O 4C58B 1XMWA 3K8MA 2VC2L 1OAQH 4FG6D 3WXVL 4CDHA 2ADGB 2GAZA 1L8JA 2H6PB 1QLRB 1REIA 4J3TA 5KAQG 1AQDB 2BVYA 3B9DA 3AS0A 3IKCB 3WNOA 1OW0A 4CNIB 5CZVL 1EGJA 4N9GA 3SDYL 2B2XL 3FT4B 2WINB 2ZOKA 1MHCB 3T3PE 43C9A 3QDMD 5FA3A 1W0YT 4X6DA 1P6AB 5TJWK 4ACPA 5IQ7H 5EUOA 4H5SB 3A6CH 4YUEH 5IJVB 4L8SB 3GBML 4EJ1C 3KG5A 3D25A 3E8UL 4PJ5E 3G6JB 2QQQA 3I6LE 4R7DB 5AAWA 1RFDH 2WK2A 2A83B 3TA3C 3K1DA 1I1FA 3NH7L 2XKNB 4KTEH 5HYSA 3DUUA 2Y36H 4X0KB 4BKLB 1NCCH 5F70A 4QT5A 4TSBL 3QPQD 1AQKL 1LD9A 3ARQA 5LG1A 3KLHC 2VQTA 3N85H 4O9HL 4P9HL 4RMQA 2AI0H 1U8NB 1WEJL 4EI5D 5BW7A 5FM8A 2EDWA 4Z7OE 2XNAA 3LKPA 4AMKL 1VSCA 1P2CB 3U9PH 4Y8DC 4NRZA 3V6BR 1CTOA 4XZUB 4KKBD 4YBLB 1F02I 4DGIH 2OR8A 3QDJA 4HXBL 4DAGL 3VA2C 1J87A 4YQXL 1EERB 1UACH 2JCCB 3B9KC 3RTQB 2YZ1A 2NX5D 3BZEB 3MRNB 3WNMA 1Q0YH 1D5XA 3BPLB 5F1NB 5FUZL 4K7FA 3O2WH 5FGSA 5GGRA 2R56L 3BYTA 1B4JL 4OCWL 1CE6A 4QNPF 3X17A 2PYFB 3W11D 3RWDB 2DMKA 3RVWD 3BVNA 5JIKA 5HHXH 3GSNL 1CGTA 4ZPVB 2I9LB 1JGUH 5T5NF 1J1PL 3MO1B 2DLIA 5GSRB 4G6ML 4JFHD 5LCVH 5HPMB 3HR6A 1RZKC 4UTAH 2EDYA 5JDSB 3KHQA 3KPNA 3RWHB 4R90H 1YYMH 4GAJH 3GSQA 5C08B 2MCG1 4XAWL 1QQDA 2A6DA 1U3HD 2DLHA 4M6NH 1GC1H 5EZIH 5TDNA 4ELKA 2C4XA 2XN9E 3EYFB 4OFYA 3O45A 3ZDYF 4K3EL 4PS4L 3VG0H 4R7NB 4HBQA 5CJBA 4G9DA 2UZYB 2CDGA 2FO4B 4LKCB 3RTQD 4L5FH 1X5FA 4FABL 1RZ8B 2VQ1A 2BK8A 4PB9L 2APWA 2OI9A 1WAAF 4LCCC 1ETZB 1A1OB 1DEEB 4ZYKA 1B9ZA 1F3JA 1Q1JL 2WZPD 3AREA 4XCCL 1Y6MR 4GMSL 4Q2ZB 4R0LB 1T0NA 4XPTH 1MI5B 3HS0B 3DARA 5E2JA 5GHWL 3MMEB 4PJ7B 5F7KC 5DD3H 4TTGA 3TNNA 4EBQL 3WEXB 3A6OA 4HK0B 5JIPA 1S7RB 4P0DA 3UCRA 2KDGA 1NFIA 4X4XA 5J9PA 4PGBB 3FL7A 4AL8L 3HE7C 1ZS8A 4EDXA 1HIML 5C08D 1QACA 1HKLH 1AGBA 3OPZL 4JPKL 1HSAA 1U3HB 2FBJL 5I8CA 1DBKH 1YPZF 2HN7B 4JY5L 1NBVL 4PYGA 5HGDA 3AM8C 2KQNA 4MCYB 5B4MD 1X5HA 4UOW1 3ZE1E 2BDNH 4M9PA 5SWZD 1ACZA 4HKJB 3VXPA 4PRIE 3FO2B 5ADOH 3MNWB 1YEKL 4Y5XB 3F58H 3O6LL 5C08A 5GRWA 3IDXH 2HWZL 1WLHA 3EYSL 1DBBH 2X1PA 5TDNB 2VDNH 4NM4H 5E2TL 5ICZA 1JZ4A 4XVUC 3DXAD 3KAAA 1MFAH 2DQTL 1EHLH 4IOIB 4WGVB 3SGEH 4WRLA 2NCMA 5I9QB 3EJJX 3MZTA 4XMKL 2DBLL 5ESVB 2ZCLL 1P84J 4BH8B 4U33A 5SX4I 4OF5A 4CADB 1LEKA 5L88H 5E5UB 3QQ4B 4L3EB 3UC0L 4L8SC 1QFPA 4Z7WB 5JXAH 4KVNL 4X5LA 3TH2T 3RJDA 3U30C 3SGKA 3TA3B 2ED9A 3PWNB 3UBXI 5SWSE 1F58L 5DLMH 5C6WH 3T09A 3HE7B 5FO9A 2NY6D 5JQ6L 1IGCL 3ARBA 1ND0B 4JDTL 5E8PB 3QQ9C 2XACC 1TMCB 1G7LA 1IGIH 3PP3H 4JFPA 5T5FH 1P7QB 4KRPD 1EJOL 1T5XA 1XZ0B 4KPHL 4HMCA 4KUCD 1AC0A 4RDQF 4R4BA 4KUZL 1VEOA 2NY0C 4I5BA 2XI9A 3WXWL 3SQOL 3BEVB 1FLTX 5AUMB 1GHFH 1ZLWH 4WY7H 3JWOL 5I30L 2YD5A 5IB3B 3VH8A 1QNZL 2Z35A 3NIDF 3QUYC 4QEGA 3HI6L 4OCRH 3C60D 5D1XA 5J06A 5EO1A 1A3QA 1AGFB 3C6SA 1TTGA 5BZWA 4R96B 1CD0A 1JFQH 2BOCA 1YN6A 4NWTH 5D8JH 4MNQD 4RAHA 4TNWF 2N56A 5EPMB 3GRWA 1V8HA 4I2XE 3PP4L 4KQ4H 4PJCA 2H26B 5L0QB 2NX5A 4WY7L 3ZKND 3HNTH 1VGEH 5GGVL 1TLKA 1LNUB 2FHBA 3VXUD 1S3KH 2DQFA 1X44A 1IM9B 1KB5A 2F5AL 2JLLA 1QSEA 2OJZL 2VH5L 1T66C 1W0WA 4EDWH 3IFPA 2NR6C 4NO3A 3TFKC 1A64A 2EO1A 4LSSH 3JVGA 4G6AD 3LRSB 1U3HA 1N2RB 1V5JA 4OV6F 3LKOB 1JWMB 3EYOB 1FL3B 4NQEB 5F7DA 4LEXH 4UT7L 5BZDA 4FXGA 1C5CH 2A73A 3PDOB 4JFPB 4PJCE 4XP6L 4WNQB 4WFGD 1CGSL 5FUCE 1JWSB 1A4KA 2AVGA 3UJIH 1T5WA 2F5BL 4UAOC 3TVMD 4MXVF 3UC0H 3QI9C 3G5YA 3RJQB 4PREA 1QFHA 3AREB 4OGAC 3QIUD 5E9DD 4ZSOE 5BXFB 4PG2C 3QUZD 4APQB 2DBLH 4G8GD 4LF3A 1Q38A 3MMEA 4Z5RB 3ZSTA 2B4CH 1BAFL 3LVEA 1KLGA 1HZHL 2AERT 3MYJA 1XGQA 1KPVA 3QP3A 5CUSH 2FCBA 2EO9A 4NJAL 3SDCD 3EOTL 4Y4FB 3LEYL 5ANME 2FH6A 2QHLA 3SKJL 2V2TA 4UV7H 1AD0A 3L3OA 2C3HA 2VDPL 3GSNA 4NSKA 4S10A 4ZXBB 1WCBA 5C0JA 4WHDA 2DL9A 1MVUB 1YMHB 1YQVL 3MBEB 1EEYA 5E1HB 5DMGC 1SBBA 1QSZA 1DBML 2QSQA 3O6FC 4QOKA 2X4NA 3STBA 4QKXB 2AXFA 1C8PA 1I7UB 1T3FB 2BY2A 5HTSA 3ZDYE 3E6HA 3G6AA 4GRMB 4JPKH 4WHCA 5ID0B 5D93C 3QDME 2CK2A 4WWID 4Q6IB 3VGAC 1S7QA 1U8KA 4MAUL 4AT6A 1N5YL 1BQLL 4M6ML 1JE6A 3QIUB 3H9SA 4R4NC 2GUOA 5I76B 4O00A 4Z7VB 3VRIB 1CDJA 1MREL 5IEHB 3RNKA 3N1MC 5FA4A 2IANA 2P8MA 4L4TB 4NQCD 4JFEE 1S5HB 4KRLB 1SMOA 3VMPA 2FEDC 2VUOA 4PRHB 5T3ZE 3WV0A 1MCBA 2DQCL 4WFGE 5DF0A 5C0AA 4YHZL 1X5JA 1U8NA 3PV6A 4B7LA 1FN4A 1A7QL 2KPNA 3KYAA 3IU3A 3PWPA 4ISVB 4ODVL 1IT9H 4XCYA 5TQ0L 2ESVD 3KYMA 1P2CA 2EEAA 1P6FA 3L5HA 1LQVA 2Z8VC 2BFVL 4J7RA 5E4IA 2I60H 5E8NB 3VCLB 4LCYB 1TVDA 2XQYK 4YFEA 1KPVB 1ROWA 2PW2B 5EZIL 3H9SE 4X9FA 2BNRB 4XRCA 2ATPB 1MCJA 5HHVL 1ITCA 3NVQA 5CEXB 3PWVA 1IC4L 4DVBB 1MRFH 1UCTA 5F7LB 3TF7A 1UKQA 3C09B 3QNXA 3RVTD 3L5WB 4QY8A 2EDBA 3DUSA 3SPVB 4KZDH 5EIIB 5ACZB 2X4SA 1FC2D 3X14A 4Y4HD 5D5MF 4O02H 2DI9A 1CLZH 1QFWM 4OLXH 3W0WA 5F1NA 2PW1B 4NP4H 5E7BA 3H9HA 4LPUA 5IR1B 4M5YL 2AJUH 1VA9A 2A0LC 1W72B 1J10A 1UJ3B 3UTPE 2M26A 2C7UB 3RWDA 2XNAB 5DJZA 1AP2B 4WTXA 3MRIB 3MREB 4NQEE 5ICYB 4OD3H 5ALCH 4XZUA 2UUDH 3DI3B 3HRPA 3C6LC 4HHAB 3IETB 3VFWB 4YGVA 1ZWIB 5T1LA 1T04A 2DWEA 2ZSWA 2EXYC 5C2BL 4OI7A 3L3JB 4LU5H 2CO7B 1U9KA 1NFDA 3QYCA 3VXSD 5F8QC 5GS0L 1JNLH 4QF1B 5IVZA 3BWUC 5IG7A 4I0KA 4BZYA 1MF2H 1VEMA 5ALBH 4NCC1 4OGXH 2BNRE 4PLNC 5C0GA 1BFTA 1HHIB 5EOCJ 1RY7B 1OP5K 5SV4A 2PYFA 1TXKA 2ZG2A 4M02A 4YGAB 1I7RA 1UZ8B 3ZDXF 2RB8A 4H1LA 2BJMH 1IZJA 4NCC2 5IJVA 4OF8A 1KELH 3WKMH 4HEME 3QEQE 5DURB 3TJHA 4K7FB 1P1ZB 1HSBA 1RFDL 2F8OA 3FT3B 1ZK9A 2IALA 4JZNB 4Q6IA 3D18B 2X1OA 1S7TB 1KPRA 3UZQA 4ONOA 1WCQA 5DEFA 4OQTA 4ZFFA 1OTUD 5ENWB 2HMID 1A6PA 4LDOB 2MPAL 1TFHA 4K8RH 2WP3T 4R26H 5TH2B 1UJTA 1CFVH 1M6OA 3QH3B 3IFOB 1HDMA 1SMAA 4XGZA 1FZKA 1KB9K 1NCNA 4S0UC 1MFBL 1RUKL 2K1MA 2VC2H 3S96B 2X4TB 4JRYD 4V1DB 5EZLB 4LPYA 1E4WH 4F33B 1YEGL 2GTZB 1JV5A 4Q7DA 3FQXB 2DF3A 1FAKT 4OZIE 3PNWB 3QEUA 4G9FD 5DHVA 3IVKA 1A6ZB 35C8L 4UT9H 3FN0L 4G3YH 4M48H 1AGDA 2FEEI 5E2UL 1LQSR 1VFAA 1GAFH 4ETQA 1Z9LA 3MA9L 2AEIT 5JNYB 3TFKA 1T7VA 5DFVD 4WVRA 2EIEA 2ZJSL 3FO1B 3MNWA 1NEZG 3QUXD 1U36A 3KLDA 3RPIB 2PYED 3F12A 5I74C 1CFQA 4OI8A 2WBWB 2AJXL 3DSFH 2IFFH 2XA8H 4KDTC 3MV8B 2BNQE 15C8L 4HAGA 3QDAA 3QEQB 4FQ2L 1B6DA 2QEJA 1KBGL 3BUTA 1MEXH 1WC7A 2RR3A 1UM5H 3ARXA 5LQBL 1SM3L 3MA7B 1BD2D 2E9JA 2IAND 4X4XB 5J9PB 5L2JA 1AHWC 3W0WB 3DMMC 4G6JH 3MOBL 2IG2H 3GSQB 2PYEA 2DJSA 3SO3B 1Q9LA 4EOWH 5FM4A 4EQ2A 4JRYB 4V1DD 1ETZA 4R9HA 2L4OA 2MCPL 1FV1A 1UM4H 4X7SL 2XXCB 3RQ3A 4A6YL 4RZCB 5KVDH 1P7KB 1CQYA 1OD9A 4TVSa 3HE6B 3ZKMC 2CPCA 1UXSB 4M1CD 1YC7A 5C0CD 1HHKA 5FECA 4N5UA 2R29H 2D4FA 1S9XB 3NFSH 3QUKA 3RHWK 4P23A 3VXTB 2VLJD 5FYJL 3TNNB 6CGTA 4GXUN 4W81A 3IJHB 3PP3K 5TQ2H 5E1AA 3ROLB 5HHNB 3BP6A 4D0DB 1A6TB 5F6HI 2BVUA 4GRWB 1FDLH 2GTZA 2O5XL 2IANE 4WW2A 1FPTL 3SCMD 4OT1H 2X7LA 5DJ2B 4HK3J 5K9JH 1IEAB 4PGCA 2I07A 1KIUA 1S8DA 2J12B 4XP5L 1YQ2A 1TCMA 3ARUA 1JGDB 3D87B 2FJHB 3HUJE 1C7SA 3C60C 4KDWA 3W0WD 2UVFA 4JM4H 3IAPA 4HLZG 2ZSVA 1PD6A 1S5IH 1MIMH 5L9DL 3UTQA 2Q8AL 4JGMA 1EJ6A 4AJ0A 3NA9H 4HWNA 3GIVB 1AP2A 3VDAA 5HI5C 4YHPA 3B83A 1UVQB 1XGUB 3A6BL 5DFWH 4YJZL 4LGPB 4RX4D 4FP8H 3BP7B 4NHUB 1ZANL 5IMKA 5DJDA 5KANG 2HKFH 1JWMA 4U3HA 1HDMB 1IM9A 1UENA 3MBXH 3SE9L 3F7YB 3QAZB 2P5WD 5BQ7B 4YR6A 4GKNB 4ZFOB 2ZP0T 5GJSH 5CFHA 1CBVH 1U6AL 2B39A 1DQJB 4EKXA 2NR6D 3HC4L 2Y7QB 3H3PL 5BMFL 2FLRT 4DKEH 4HT1H 1U41A 1FNLA 1O7VA 1QBBA 4HIHB 3WSQL 4EVNB 4OZGB 4H1LG 1EO8H 5C07E 1ZVSB 3O81A 1DQLH 5IHUL 4PJEA 4BFIA 1TQBC 4PP8C 1CFSB 4XWGL 1FRGH 4JGJA 2R23B 3MYJB 4KK5C 2R39A 4YDJB 1TJHH 3UROR 2YWYA 1K8IA 3T2OA 3REVB 1N4XH 1X4YA 4OIBA 4XMPL 3OKOA 5DMKB 4APQA 3UTSD 1EIBA 1XF3A 3BSZL 2JJSC 3P9MB 2X7LB 5DJ2A 2HT3C 2BY1A 3MRKA 4RAVB 3CLFL 1OTSD 1FZMB 4Z0BL 5BCAA 4HV8B 3WKNA 3BMWA 4WO4B 2JB6B 4R3SA 4Y19E 5K59E 4YHMH 1XH3A 1KB5L 2V5RA 4P3CL 1T5XB 1XZ0A 3W2DL 4CVUA 4OV5A 5F72S 1DDHA 1OHQA 2N4IA 1HXMA 3OXRA 3KPRB 1G7PA 2YSSA 5BZDB 4KJPC 1NAKL 4X6CF 1NMBL 2VIRB 1ES0B 3RL1A 1LO4H 3QG6B 3MQIA 4Y16A 3TCXA 5JR1H 4GRLD 3T2NL 3R4DA 2G9HA 4HS8H 5MEPB 3IU4L 5JW4N 3ULVC 4JVUA 3FCTA 3CUPA 1FLRH 4CVZB 4L3EA 4XCFL 3LHPL 2MFNA 1CXKA 4I1NB 3RNKB 3RWCB 4CN1A 3K2UL 3O6MH 4QRTB 5T3ZH 2WANA 4FXLA 3I6GB 3HHRB 3HKFA 4PUBL 4WHTA 1BQHB 3CFJA 4GG8A 3U46A 1N7MH 1B88A 3F65A 1FFPB 3VDBA 4PV8B 2EEBA 4ZXBA 3QDMA 5DC4B 3NA4A 5F93C 4B7IA 3UPAA 1FCGA 4FTVB 4JFEB 4WFEE 1KTRL 4HGKC 4PB0L 5DFTA 4PY8J 1KEML 4CVWA 1OW0C 4OKVA 3LS5L 2QADD 3HNSL 3JWNC 2XZQL 2CO6B 1SYVA 4DKFL 2BSRA 4QY8B 4HPYL 4K23H 5IQ9B 5FECB 2X4NB 5ANMA 4H20H 4J3UA 5D1XD 1EVTC 5A2LH 3BRGC 2YS4A 1V3LA 2NXYC 3JV6A 4RGOL 3C5SB 1EH9A 2VTFA 2J6EA 5KVEL 3K0WA 3O2DL 2GQHA 5CBAA 5BXFA 2ADJA 3PG2A 1JZ3A 1WWCA 1JHKL 5DS8B 4HFWB 2B1HH 1G7JB 1YEHH 4Z7WF 1KCSH 5E4EB 4KJQC 1XGQB 3OKKB 3EOAB 4F3FB 2Q86A 3QXAB 1WF5A 1EEZA 3S36L 1KUMA 5DI8A 2XG5A 3PGCA 1LEGA 1WBYB 2IBZY 3SCMA 1LVEA 3UTSE 4E42A 1R5VB 3QZWG 4KI5C 1YY8B 1WVZA 4WCYL 4JHWH 4HX1A 4LSPH 4OB5L 2Y23A 4JQVA 1OCWL 1A1OA 4S1DD 4NSKB 4LLDA 6FABH 4L8BA 4MDIA 1XF3B 1BGXL 1N64L 4UUJB 1A7PL 1A9BB 5DJXA 1RK1A 2QADB 1FFNA 7CGTA 3P11H 2AV7B 1R24B 2GFBB 2A1WL 1UKSA 3AFLA 3AS2A 2N1KA 4WGWB 5CGTA 2CJUH 3WN5B 4Q58C 1FZJA 1EBAA 4UBDC 1KLUA 4P5TD 3BGFC 3G5YB 5GXBB 4ONGL 1A3RH 4MA1B 1HI6A 3MRLB 1MHPL 5DD5L 5HHOD 2F58L 4PJDE 1CDIA 4YAQB 4JO2L 5KSAB 2P4AB 1RZGA 1I9IH 4HIHA 3SE3A 1F97A 1D5MB 4HZLA 2EIBA 4GOSA 4HJJH 4KROC 4ODHH 4PBXA 3EZJB 3UDWC 5LAXA 4DKDC 1QUNA 3HI1A 4ZFFB 2V17L 3TNMB 3NABL 2D0GA 4YK4B 1TQBB 3CXDH 4OM1L 1T89C 4ELME 2W92A 4F9LA 2VXQL 5FDWA 1LE5A 1J0HA 3EHBC 5L2KB 1QR4A 1S7TA 3NBNA 2ORBH 2Y07H 5F9OH 1NFKA 4NUGL 3ARTA 1GOFA 2FSEB 2ZCKL 3LKQB 3TN0B 2A77L 3V9FA 2VL5B 4NQDB 5D1ZA 1L0QA 4JREB 3VRJB 4IIQA 3KWWB 4KHXL 2XN9A 4CUCA 4KUCF 4U6YB 1FO0H 3OL2A 1AE6H 2CK0H 1LDPH 2E6PA 1DN2A 1KCUL 4M8QA 4N0FA 3O3AA 5T3XD 1BFVH 4IRSA 1I3UA 4R6UA 2O26U 5BVPH 5L8JB 1X5KA 5E7FA 2OZ4L 4C4KO 1NLDL 3CVHH 3NZ8B 3RNQB 4JFYB 5KSVB 3FFCD 2FYYA 1BVKA 3RPIA 5JORB 3BN3B 4XCNA 4OCXL 1OSZA 2JB5H 1DVFC 5FM5O 5T5NG 3T4AB 3D3VD 4NBYB 1T2QH 2HMIC 5DRXB 1F90H 3K8LA 3BAEH 3CUPB 2OXHA 5EDXA 5C09D 4O2CB 3H9HB 1EGJH 5EOCH 3QUYD 2EH8H 2D7MA 3ESVF 3RGVC 3GMPB 3ABZA 3L3IA 3D25B 1NC2A 1DFBL 2DQUH 2I25N 1MUJB 4WW1A 2X70A 1FFRA 2ATKA 2NX5E 3PWUA 4NQDD 1I8LC 5B38B 3AS1A 4LFHG 3WHE1 1KENL 3MV8E 1CIDA 1XF2A 4S1RH 4K3JH 1HHIA 3U4BH 5CCKH 3EKCA 1QSEE 3B5TA 3WFHA 4C54A 3UYRH 4L4VE 4BJLA 3TYGH 2BNQD 3ZHLA 3LZFH 4ODUB 2J2ZA 5T1MB 5AYQA 1RUAH 2VITB 2QR0A 3BP4B 3RBSA 2IALB 5EIIA 4DGYL 2I9TA 4HUMB 5C2UB 4XTRC 1QEWA 4GG6F 1IGJA 3QT2A 3VXMD 2FB4H 3HPLB 4G7VH 1OP3K 2OI9C 5CEZH 4HWBL 4Y0GA 4MWFA 4XPBL 1DBJH 1L7TL 1YJDL 4NKIL 2OS7A 1CLYH 1LP9E 3TJEH 3L95A 4BM7A 2VLRD 5B22A 1RMFL 3QB7C 4M8QB 3P0VH 1IEHA 1CYGA 4APQC 1KIRA 1PKQA 4LVNC 4DOHB 2Q7NA 1VFBB 1FH5L 3JWOC 4BA8A 1JJUA 3MNZA 4KDVA 2UV3A 2YK1H 3S9DB 4DN4H 5GSVA 1FHGA 4JN1H 5C6TL 2DLGA 2E9IA 4ZNCD 3FZUD 3BW9A 5C3LD 5M7QA 4XNXH 3Q1SH 4RFEB 4YXHH 5KN5B 5JUEH 1XT5A 3G04B 2Y5TB 3P77B 5TPWH 3L7FB 1WBYA 4E42B 5TDOA 4OTXL 1JV5B 1IM3B 4GW5A 1IGML 1PSKL 5DO2C 3WO4C 2WIMA 3TPUA 1G9NH 4I3RH 4HKXA 4OLVH 4QXGL 4NOBA 4WV1B 4X6FB 3WFEH 1PEWA 5F7MC 2IMNA 3QIWD 4K71C 1Z3GL 3B8SA 3B43A 3EO0A 3HC3H 3JTTA 2DLFL 1NMCB 1P1ZA 5GQBA 1BZ9B 5JZ7D 1FGVL 3VD3A 1BOYA 3CFIC 4XX1E 1NGXA 2XYCA 2AK1L 3HC0B 4JM2B 3PQYB 2DQFB 4TSCH 4NHUE 3LDBC 3K7UA 5FK9B 1A5FH 5B39A 3QHFL 1EAPB 1FGNH 3KJ4B 2CLZA 3S7GA 4YHOH 2HFGH 4P2OA 3ULVL 3L7EA 2VDQL 4PJIE 1D5BB 4PR5A 5DYOB 4OUUA 2NY5C 4Z7VF 5C0JB 1I3RA 1XGTA 2XA3A 5GRZA 5I75B 1LE9A 3WUZA 2X4PA 4HS6B 3L95B 1Z3GH 4WO4A 3RIAF 3MRJA 3RRQA 4XP1L 4PRIA 3FQXA 1ED3A 3OB0H 4MNGE 5IK3B 1EFXB 2GK2A 2EE6A 3VGHA 4POYA 2QQLH 1NDGB 4LLQA 1ZTXH 1VFAB 2FIKB 4ODTL 1IGMH 3VXQB 1RUQL 4NRZB 5F96H 3V7MA 5BRZE 3CSPA 1NCWH 2ZUQC 3RL1B 4GBXC 1CL7L 3IS0X 2XTLA 5IB4A 4JFXA 3STLB 4XB8A 3OB0K 2P47B 1IL1B 1Q0XH 1S7XB 3Q6FB 1G7PB 4X6DB 3LS4L 4H25A 3VXOA 2ZWLT 1UQSA 1BD2A 4R97C 3QO1B 3WFCH 3T3ME 2W59A 3P4OB 3QIBA 1JIBA 4M00A 4DGVH 4DZ8B 1DEEA 4ZYKB 2F19L 3HMXL 2YK1L 2ENSA 5E00A 1FH5H 3O0RL 3X12B 1WGOA 3UYPA 5CJ5A 5AYUH 1RMFH 4I48A 3U6RA 5ESAA 2VMFA 4TRPL 1MFCL 1L7TH 1YJDH 3IFLL 3S34H 4XPBH 4KRMB 4KU1A 3ZO0A 4K55A 1TITA 4I0CC 4YK4C 3DV6B 3MODH 4NDMA 4FQCH 1CXIA 1BJ1J 3HB3C 4Y4FD 3EOBB 1XH3B 3HG1E 5J3HC 5JTWA 3L3IB 4LGSB 5CEXA 4UIKH 4YHPB 1BOGA 3MRQA 4QXWA 4BZ1H 1J0KA 4GRLC 3W5MA 1CXHA 5TGBB 2V5YA 3LZFL 4ELKB 1AO7E 2N7AA 3UPCA 3VI4E 1ODAA 5IHBA 3CFBB 2OSLB 3BQUB 1J0YA 1MHEA 3UTTA 4LCCB 4UIKL 1BLNB 2R2CA 1P84K 2X9YA 4KHTH 1MRCH 3DX7A 4L4TA 2APBA 3LH2H 1CIUA 3O3DA 4OF3A 3GFUA 5FCSH 4CVZA 5F7EH 3QAZC 2D4DA 4HJGB 1ZE3C 1ES0A 1A7OH 5C0AB 4HCRH 1P53A 4PTUA 3WS6A 2HFEB 2LE9A 5I8KH 3KLSA 4C56E 1T1ZB 5D6DC 3SJVB 1NCAL 5JMRA 1HH6B 3CDFA 2O5ZH 2X4OB 3IB4A 5H94A 1QKZH 2OK0H 4LSUH 5F71A 1XGYL 5AUMA 5IVOA 3STLA 3VWJD 5KW9L 2IQAA 3CXHJ 3KPLA 4HFWA 3BGMA 4GKSB 1PEZA 4Y19D 2EDDA 4XBEH 1K4CA 2BNRA 4TPRH 5ETUA 5HI4C 2J8UA 2H45A 5DVLA 2EYTA 4KJWD 2E7LC 4QO1A 3MRKB 5E00B 1KJ2A 5CJQL 3V0AC 4JRXE 3T1WA 1CZ8H 4Q0XH 1RUQH 3BWAA 5F96L 1FL5B 2HH0L 2HFFB 4HGWB 1XGPA 4V2CB 5D7IF 5GRJL 4LSRH 4NT6A 2QQLL 1FFNB 1AE6L 3QNZB 1FO0L 4N1HB 4MNQA 4H8WL 3U2SB 2BNRD 2BRQA 1C5DA 5TFSL 4P2CG 1E0OB 4POUB 3JTSA 1EFXA 1HE7A 3U1SH 5I0ZA 2PO6A 4W6XB 4EIZC 4EZMA 3CCHA 1UJ3A 4FN0A 1A9BA 1BBDL 2ORBL 1TTFA 4K3HA 3C5JA 1R24A 2GFBA 2PF6A 3FB8A 1D7FA 3VFNA 4APQD 4G8GB 3D1MC 5EO0B 3CX5K 4TUOA 3TZVB 1JPTL 2CIIA 1IFHH 3TIDB 3QUMB 1S7RA 3N0PB 2R2HA 4NO5A 1UCBL 2GSGA 12E8L 2OX5A 4AYFA 2VXSH 3ZE2E 4E41D 4EXKA 4QRRD 5ERWB 4Y5YB 1LE5B 1A3RL 5D70H 3SBWA 3GMOB 5I8CB 1UXWA 3MCLH 2FSEA 3TN0A 5KVGH 2EDHA 1EV2E 4L4VA 2C9AA 3TM6A 4OZFB 2UZXB 3TJHD 1VPOH 4LNRA 3CC5B 4P2QE 1EAJA 4JFFA 5K33A 5CLTA 1EXUB 3CMOL 4KQ3H 1A7PH 3ILQC 2L0DA 4J6RH 1A1MB 3QDGB 5IF0A 3F12B 5E5RB 5DSCA 4XC1H 5JUEL 5L2KE 3L3OB 4N90D 1K5NB 3SE8L 5JW4R 2BXZA 4G5ZH 1IAKA 2ZUQB 5ANMB 2APFA 5E6IB 5C6TH 4OKDA 5IW6B 5H35B 3T4AA 3TVMC 4OSUH 1D5IL 2P8PA 4RMUA 2O61A 1EEQA 3TBWB 4U1NA 3PF2A 4HG4K 3QXAA 4RWYL 3ZL4H 1LD9B 4YDLB 1JHKH 4AH2A 3SGJC 4OJFL 5BO1L 5GGUB 1DBJL 4NKIH 1A4KB 5BZWB 3DVGA 4L3CA 4QHKJ 4MJ5B 4KY1L 4NC2B 5KVEH 5FFLA 5FHBL 1GIGH 2J4WL 5BVJA 4RZCA 3QDMB 1NGPH 3PJSA 4M7LL 4P9MH 1SJEA 4H20L 3UTOA 1G7LB 1RULH 3OBAA 4XT1C 5CILL 3TYGL 3OMZA 4CMHB 3FONB 1MCHA 2D31B 3O8XD 1MHCA 1QZ1A 3QULB 3LS5H 1VADA 4XP9H 1W0WB 3PGDA 4ONHB 4H26B 2YHGA 4W4OC 3PWUB 1K85A 3HRZB 2OBGA 3IKCA 2EDXA 3VFSB 4N0CD 4PJ5A 4XPHL 4Z7NF 2VYRE 1FL3A 4NQEA 1YMHA 2Z31A 2LAAA 3QCTL 2ICWA 3BGAA 3PIQB 2WMPA 2WBJA 5DDHA 3TH4T 1NSNL 1VB9A 2J88L 4MCZB 4N0RA 5FUCC 2ARJA 1N6UA 1BVLB 1TIUA 2ZSVB 2MWCA 3GUTA 4HS3A 4PUBH 2P7TB 3RY5A 4LLMB 1PKQB 4NBZB 2XQYG 5I66B 5HYSB 2AW2A 1A1NA 1F11B 4Y4FC 2NZIA 4MXQD 5F3HA 2FX9L 3LQAC 3CVHL 4WFFE 4XNYL 3IRPX 4UMGA 2XN9B 5BVPL 4JO1L 2A6KA 3MJ9L 4TVPL 1NC4A 2F54A 3OZ9L 2C3WA 4JE4B 1CE1L 4Q9CA 4PBVC 4GG6B 2FO1A 2IFGA 4QRQA 5DXWA 2YMXH 3LKQA 2EYTB 3MJ9A 1MFEH 1PAMA 2ZG3A 3VXME 1JUFA 4N0UE 5EU5A 4OQ1A 4RGNE 3L5XH 1JPSL 4HG4J 1I3GH 2DKSA 4HDIA 1V7NH 2FHFA 1O7SA 3RU8H 3U0WH 4IRJB 4OZGE 2DQJL 5D4QA 1JRHL 1KB5H 4PRBA 4OD2A 3MGOB 3S5LG 5EIQA 1IKNA 1QOKA 5INCA 3WJJC 3BZEA 1E6JH 1FNFA 3CLFH 2PW2A 4I2XA 1TVHA 4XP4L 4F7CA 1CDBA 3SDDA 1WK0A 4P3WA 2HLAB 3BSZH 3CFDB 1VADB 4Z76B 3D69B 4GT7A 4KGLA 4K3DH 2SEBB 3L3KA 4I18C 4ODSL 3T65B 1NC2B 3V4UL 1FRGL 2ZUUA 3HI1B 4EDXB 5DK2A 3ARYA 2X4SB 3BP7A 1FZMA 1OARL 4G9FE 4ZFGH 4HK0A 4LLVA 3IJSB 4UIMB 5E5MA 3WUWB 1QO3B 3KPRE 3WSQH 2YRLA 4ZAKD 4HIIB 3R0NA 1OP9A 3HFMH 3KWWA 3DYPA 2IGFH 3CFEB 3CSGA 5DJZB 1CFBA 1BGXH 1N64H 3MV9D 3MRBA 3VXNA 6FABL 3R06B 4PJHA 2I26N 4YDVB 1LE9B 5E6ZA 2HKFL 4JHWL 2E7LA 1ZANH 3FB5B 4LCYA 4GAYB 1XR8A 2AV1B 3AS3A 5T3XH 1EMTL 3QG7H 3JUYA 2P5WB 5SWSA 3CDCA 3A6BH 4M3KB 5FO7B 3L6FA 3WEXA 1HYSC 4Y2DD 4MDJA 2ZCHH 3VXRB 1SEQH 4HIXL 1HHJA 1S5IL 3V5DB 1D9KB 2DBJA 1RIUH 5I15L 2EECA 1NC2D 5SWZB 3CX5J 2FATL 2IPTH 4PJ7A 1NAMB 5ADPL 1TZHA 3K4DA 1MIEL 4ZAKC 3KYOB 5KSBF 2P8MB 5K59F 3UDWA 3V2AR 3QEHA 1DE4B 1LK3L 4CKVX 3ARDD 3WIFA 2DTMH 3KLAB 4LASH 1UWXK 1ZA3B 5IBUB 3E2HA 1FPTH 4Y5YC 1FDLL 3MRFB 4S2SA 1CFNB 1RZIB 3ZYJA 3R1GH 4WW2F 3IU3B 2NY2D 1QFWH 2FWOB 4CU6A 3VMOA 2AABL 3RVUC 2EDJA 3CSYA 3L7FA 4PB0H 4L3ED 3DX6A 1G84A 2UYLB 3MLVL 3AUVA 2I27N 2NPLX 4LCUA 2GTWB 4IOFD 1ZLUK 4W6YB 2VXVH 5HGHA 1G6RL 1UM4L 4X7SH 4A6YH 2D7OA 3CPLB 5CEZD 1FV1B 1DQQB 1OAYL 4QGYA 3K3QA 5GGQL 4GQPH 2Y06L 3SKMB 1ZT4B 3VGBA 3FT2B 1JZ5A 4I18A 5JW3L 1KEGH 5D2LA 1TTUA 3C08L 2HVKB 4PTTA 2Q76B 2BXYA 2A74A 4H25B 3VXOB 3BP5A 3O2DA 2Q86B 1KBGH 3IDYB 3U0PB 2XRAL 1U58A 5IB5A 4PJGF 5I15H 2Z92A 5GRVK 2X6MA 5BJTB 1K4CB 2R1YB 4I4WB 5E70A 4WI8A 2ZCHL 2A38A 1TQCB 1ZHKB 1RU9L 4Y4KB 4NO3B 2CMRL 4P4KC 4Z7VE 3C60B 3QCVH 3R0MA 2VSCA 4Y4HC 2A0LD 3HUJF 2M8XA 5D72L 5EORL 4QYOB 1PG7L 4JG1L 4LLVB 1IL1A 3ESUF 4WEBL 1KOAA 3I9GH 3FJTA 2JJVA 4LBEA 5E0QA 4OQTH 5MERB 4YHML 3X3FH 2E7MA 3WE6B 5IVXA 4HCRA 2OMNA 2NXYB 3CFEA 1AGEA 5F44A 2CIKB 1NBQA 3KYKH 1QBLL 3OXSA 1IAOA 5DMIL 2OSLA 1DVFD 3WUWG 5SX5H 5D1XB 5E8DH 4QHLA 1ZVYA 2QSTA 3LRHA 4WNQA 4K94H 4JQXA 1BBJA 3G6JF 5C08E 1QRNB 4R96A 4GW1B 4P5KA 5DA4A 2HJLA 4KKBC 4JRXD 5IHUH 3WS6C 1R3IH 4HFUL 2VZ3A 3HZVA 3QNYB 2YBRA 4X4YB 1JTTA 3L1OH 3MUGA 1BOGB 1JYXA 5LWYL 3KYKL 4MJIE 4Y4KD 1DVFA 4QWWC 3E3QA 2VXUL 4HT1L 3I85A 3EJZC 1AR1C 3X3FL 5L0QC 1U6AH 3RDTA 4GLRH 3MZGB 4LSDA 3QDJE 1JRHH 3G5ZB 1E6OH 3TYFA 3AXLB 5EBMA 3AC0A 1AKJD 5C07B 2Y72A 1MF2L 1IC7L 2R2EB 3DXAE 4YDJA 5FV2A 4MS8C 1MFEL 2YMXL 5JO5A 2CMRH 2NZ9D 4ZO6A 4BSWA 5B3JE 3TF7C 3C5ZB 1MHEB 4LU5L 4WHYG 3NA9L 3SDCB 5AZEL 2DWDB 5DRXA 5HVFB 1JNHB 2FX7H 2EZ0C 3NAAL 4UTBL 5A16A 2CGRH 3WHXA 4Y5XC 4U2ZA 2FX9H 1MJ8L 4FQXB 1QR1A 5F3BB 3DTXA 4YFLF 1G7IB 4PTUB 4G9FA 2MSPA 1H3UA 4G8EA 2W0FA 1B6UA 2JK5B 3C08H 4Y4FA 4RWHA 1KEGL 3D5OF 2VL5A 4NQDA 5EG6C 3U30B 1OAYH 1OT1A 4NP4L 2P1YA 4PGCB 2VKWA 4LLUB 5DRZB 4N5EC 2XZAH 3DV6A 2VR5A 5CSBA 2X89D 1KN2L 2OP4H 3FO0L 2VLLA 4D9LL 4AH2B 1KPUB 3NFSL 2Z9TA 2F53D 4JAMA 5BS0A 3OR7A 4XX1G 4BFGA 1WZ1H 5DMYA 1RZIA 1A1MA 2NW2A 3TBSB 4G8IB 4GS7C 1QFWL 2GITA 5IEKB 4KKLD 4NQCB 3VXMA 4P2RD 3MV7E 3R1GL 2AJ3B 3FQTA 4EUPG 2DAVA 4MB3A 4JQVC 3ZKNC 1WBZA 1Q94A 2Q6WA 1RJZA 2BFVH 3MBEC 3EO1A 1SJVA 1CDCA 2W07A 4PFEA 1BIHA 1LK3H 3RVXC 3WIHA 5I17B 1NGPL 1AGCB 3Q3GA 5HGHB 1SVZA 3FO9A 2DL2A 4AY0A 1N3NB 3C5JB 5ADPH 3DUSB 1RZKL 2FATH 1S7UA 2IPTL 1H5BC 2VAAB 4U1SA 3D3VB 2KQMA 1FNAA 1A22B 3MXVH 15C8H 3FOLB 3ZL4L 4JY6B 1X9QA 1BJMA 1GGCL 4HIXH 4NCDA 4RFEA 2UWEA 3KXFB 3TIDA 1NJ9B 4E0RB 4UV4L 4BSVB 4XCYB 1A1NB 4N90E 1FYTD 2IAMA 3OAUL 4AIZB 1HK6A 1JPGA 2VE6B 2V2TB 1AXSB 3GUTB 4IS6B 2NXZB 1YMMD 5GZOD 2F53B 3LB6D 4N1CA 4GRWF 4HEPG 4JFOA 1VHPA 5D7LD 5FHAH 3X3GL 5FOBA 3QIWA 1AJ7L 3F7RA 1JWUA 1K5NA 4BZ2L 1K9TA 5KJRH 3O41B 1DBMH 3HG1B 5LJYH 4JFFB 1YQVH 2D2OA 1EEZB 2VOTA 3MGOA 1LP9F 1DLFH 3LEXA 2NY0D 2OTUB 3GJFH 3MV7B 2C26A 4JRYE 5LXGH 2PW1A 4R26L 1HKFA 3S6CA 4F7CB 5HYJE 1DP0A 1IARB 5DJ6A 4GG6E 5EOTA 3QUZA 3ZYZA 4OKVB 3ULUD 1ACYH 5FUOL 3EOTH 4TUOB 3X14B 3VXMB 4M7ZC 1GL4B 3MRCB 5CUSL 5GS1A 1I7RB 1UZ8A 3QHTC 5IQ9A 5D6DA 3ECBB 3EJYD 2WM0A 3DV4A 1BAFH 3QHZL 4ZS7L 5T1DL 4ENED 3E2HC 1C12A 1L6ZA 2XTJB 3DRQB 1KC5L 4WUUD 5A3IC 1QSFE 4YPGB 3C2AL 1GPOH 1GGUA 3LQZA 3V5KB 2W0FB 3TO2A 4RMRA 5HDQH 2GJ6E 3HCVB 3HZVB 3TT3H 5L8LB 4R4FH 4FFEX 2EDLA 3CZJA 3TN0D 4YXLL 4U4BA 4QF1A 4BK4A 1JPSH 1DL7H 1B0GB 7FABL 1FFPA 4JFHE 1JNLL 2GSIA 4M61A 4LSRL 3G5ZA 3O6FB 5GRJH 2HH0H 3C9NA 3O11A 1RD6A 4NM8H 5IT2H 4U1JB 2HT3D 4FQPA 4IRSC 3PWPE 3VD9A 3VFSA 3MJ7A 4LVHC 2ARJQ 1A6ZA 3MJGX 5D1QB 1W0VA 2NW2B 2OJZH 4JB9L 4MQSB 3LDBB 2QQKH 4XBEL 3NZHH 1P5UA 4GXVL 4R2GB 3HNTL 2DB8A 3VFUB 4NQDE 3VGAB 1HSBB 1TMCA 5TH2A 2OK0L 3D69A 5JMOC 4Y1AD 1NL0H 2BCKB 2O5ZL 1KPRB 1CGWA 4MSWB 4PBWD 1DQTA 5BVJB 1NKRA 1JFQL 5KSAA 1A7OL 4G8GE 4KZDL 3VXQA 4PJFA 3TA3D 4ZUSA 4GW4A 5T1KA 1SQ2N 3O4LE 4M93B 4LHUD 1T04B 1IGTA 4JDVB 1MRCL 5DRNB 2P46B 3P4LA 4FZ8H 2WWKO 3SE4A 1QNZH 2ICWI 3QXDA 1IC4H 5SWZE 1AIFB 5DK0A 4XP9L 1BF8A 1P9MA 2ZG1A 3H6JA 4G6KL 4O4YH 1UQSB 3VWJC 3WXWH 4KH2A 5GISL 4BZ1L 3MRMA 4P9ML 4U7SA 1MCWM 4CU8A 4JN2B 3BPNB 3JVGC 4HMEA 3EGSA 1KXTB 5TQ0H 3RFZC 1AC6A 1RUPH 2J4WH 5T5FL 3QUYA 1HHKB 5JPMA 3O4LA 4KJWC 3U6RB 1OGAB 3SDCC 3DETC 3IDYC 1MFCH 3MLSH 1RJCA 1NGZA 4RWYH 5GS0D 4G8FA 4LKXA 5ITFB 2H32A 3WNPA 3DBXB 3HUJB 3O0RH 2G5BA 4OZFH 2J8UB 3JUZA 4EUPB 4L8DA 4QGTA 4DGVL 4MAYD 4QHMA 1YUHA 1ZA3A 4KI5E 3WFCL 3GBLA 1WSST 4M6MH 3MLPA 2M2DA 3DV4B 3VFMB 1DZBA 4J6RL 5D5MB 4LAQL 1OAZL 4FFWC 2NW3A 2VDOL 2YPLD 5ID1B 5DJDB 4CMHC 4JHZA 3KDMB 2KKQA 4NQXB 3TCLA 4LLAA 2IADA 4HD9A 4KJQD 5DUPH 4Z7WE 3M17B 4U7KA 4W4NA 2FDBP 1MCOH 1YEKH 2MKWA 4P99A 3MRBB 3MCLL 5DJXB 3VXNB 3BO8A 4XP1H 1JWUB 1B0GA 1DEDA 4GAYA 2AV1A 1UM6H 5JDJA 1LO3L 4Q74A 1IEAA 3P77A 2JJUA 3VXTA 1QSFB 3KVQA 4YFDB 3WO4B 4OM0L 4JY5H 3RTQC 3GSXA 3FQUA 2EXWC 3R8QA 5IB2A 1IFHL 1HZHH 3D2UA 2VDQH 1I1RA 3ULVH 4K71B 2HTLD 2IQ9H 3IDJA 2R8SH 4YHOL 4J2XA 3TVMB 4X5WA 4IHOB 3BH8B 3FRUA 5EOTB 4EVNA 3L3GA 3ORJA 3TEUA 4OIIL 3ARED 3JZ7A 4FG6C 1QVOB 3MRCA 4NRXB 1FSKB 4WI3A 5DD3L 4QRPD 4TNVK 1FBIL 4XPTL 2W9DL 3KLAA 5JXED 2BC4B 4J12A 4PV9B 3L5JA 4H8WH 4JRYA 2ESVE 4XCCH 2GCYA 4A6YB 4Z78A 1LDSA 1YC8A 2Y4SA 4JPVL 1MCIA 1HEZA 2D3VA 4HK3N 4B41A 1UVQA 4LNVA 3C6LD 4HKZB 5KG9A 1UB6B 3BRFA 4Q0XL 5F9WC 2P8LB 1T03L 4ZO9A 3P30L 4N0CC 1I4FA 2F5AH 2VH5H 5TE4H 2B1AL 2VLKE 1ZHLA 4N0UB 4ZOEA 1ZVHA 1S3KL 3STZA 5HJ3A 1N6QL 5D1ZD 2GSGB 1U8JB 2OI9B 5EC2B 5IK3A 4QRPE 1VGEL 3DTXB 3H8NA 5DC0A 1FFQA 5AD0A 3PP4H 4F7EB 3MLRL 4YO0A 4U49A 3REVA 3SDCA 1J8HD 3DJ9A 4X6CE 3W9EB 4NJ9H 1MELA 3GJFB 4R97B 5IHZA 4FQXA 3SGDI 1C16A 2EKJA 2Z93A 2OLDA 3VFPB 5HPMA 4HWBH 2JB6A 2FB4L 1WZKA 4G8EB 5FYJE 1MLCA 4PJ9C 1EXUA 3QQ4A 4D3CH 1QLFB 2BSTB 4YHLH 1RUAL 2NQCA 5T3ZD 3OJMB 3A0OA 4GO6B 1YJDC 3L3HB 4PRPB 5FUZH 1C5BH 5ISZE 1Q0YL 1U8MA 1RURH 2YRPA 4J3XA 1AGEB 2AK4E 3RBGA 1BPVA 3G04A 4BSWB 2UVEA 3U4BL 5CCKL 2EZ0D 3RDTC 5D5MA 5DJAA 5ITBL 3PIQA 5J12B 4PDCE 2PUQT 2YSSB 3ARBB 5CMAA 4P3DA 3TIEA 4M4RA 1Q94B 4CJ0A 2FLBT 3GSOA 4XNUL 3OR7B 3VGFA 1JGVH 2H2PC 2ARJB 2E9BA 4EI6A 4CDGC 4O58L 3IFLH 1HEZB 5C9JB 3DIFB 4GMTH 4OD1L 5AYUL 2ESVA 5DQDH 1S9YB 4X6DF 1QP1A 4P9HH 1WIOA 4WV1C 3P9LA 2EH8L 2X4RA 2K3TA 4HPOH 4R2GC 3ZKSD 4EI5B 1BBJB 2YUXA 3BAEL 4U1GC 5ESVA 5CS7A 1SVCP 5L88L 1T2QL 2ZSWB 2Y36L 5GZND 2D31A 1MAKA 3QWRD 1I1AD 2ZCLH 1W8OA 2YBRB 4F15C 3VG9C 1MFAL 3E8UH 1Z9SA 3TGXA 1U3YA 2VDNL 4NM4L 5DVMA 1RVFH 1LEIA 1BFVL 1SEBB 2DDQL 5J3HD 4NQVB 3FQWA 3HNVL 1BFSA 2DQIL 5FDYA 4D9RE 3AXLA 5IHZB 1CVRA 3MCG1 3GHBH 2EC9T 4NKMA 4ORZC 2WBJB 3B9KB 2G75A 1QG3A 3QJHA 4XNQB 1YY8A 4PRAA 1VGKA 2HLFC 3CDGB 1HCVA 3J7HA 4NNXA 1P4IL 4HZAA 4NHCL 4ODWA 3LEXB 5DQJB 4M03A 4HKZA 5KG9B 3ARPA 4O51B 1ZT7A 2AJ3A 2FBJH 3MUY1 4HUWB 1LO0L 1U92A 5JQHC 3EO0B 1HIMH 3QEGH 4JFQB 3GI8L 2CH8A 3SY0A 4LSVL 5D7KE 3Q6FA 3RKDC 1R3JB 4G6FB 4Q6IC 4BQ8A 5DUML 1OAXH 4TSCL 5JOPD 2D7TL 1T7XA 3BYYA 3QO1A 3TH3T 1JHTB 1FGVH 4TVPE 4CVXA 1CFTB 1RHFA 1I9IL 3D2UD 4Z7WA 5DMJB 3OAYH 4J8RA 4QRRB 1MHPH 3RGVA 3VE0B 4ONGH 5TE6H 1Q1JH 4P4KB 3BKYL 3TBSA 4FXKA 1G9NL 4I3RL 4MD5A 1JYWA 2X41A 4N8VA 5C0BB 4IIQB 1VFOA 5IESH 1MCNA 1NMAL 5CD5D 3O41A 3P11L 5A3ID 3Q0HA 3NCJH 1GC1C 2APTA 4FQHA 1JNJA 4HX1B 2R2HB 4NO5B 4ODXA 5E99L 1VKXB 4JPIB 1NUFA 4KKAC 3FTGB 4LSPL 4OB5H 4FFYL 2I24N 3JBG7 4QRPA 1GC1L 3F62A 2I5YH 4U1IB 4JN1L 2EXWD 2VAAA 4U1SB 4XAWH 3D3VA 3EO1B 5IW1B 1A6AB 1I1FB 4Z7UA 2E6JA 3OF6A 3O3BB 1YYML 4HMDA 3IRZA 5CGMA 1NJ9A 1IGFL 4E0RA 3WS3A 1ZLWK 3GMNA 4NPYB 3GB7B 4PP1D 3CZFB 5HI5D 3TJEL 2PYEB 3IXAB 1B90A 1I1CA 5SWQA 2YKLL 5DS8A 2EEDA 1OVZA 1AHWB 3T8XA 4A2MA 4GBXD 5KSBB 4S1DC 4I77L 3WDJA 2RIKA 3LPGA 2CXKA 2NX5B 3VFUA 3BIKA 2R56H 4KK5D 4TOYL 3BGMB 1JF1A 4ZODA 3TZVA 4AIXA 1FZOA 1IGTB 5J4MA 3ZHKA 5BS0B 2D9QB 4QHKI 3KPMA 4JANB 4X80H 1NGQL 2B4CC 5FO7A 1J1OH 1QSEB 4YQXH 5IP4A 4JFOB 2NXZC 4DAGH 4RIRA 1KEMH 2R4SL 4MDJB 3FQRA 1KENH 4W4OA 2ZUVA 3PV6B 3OKNA 2WSKA 1MH5A 2ZOLB 8FABB 5DRNA 4N9GB 4WI4A 1K3ZA 4P4KA 4P2QD 2DQDH 1UH2A 4PGEB 3OKDB 5I1DB 3EGSB 4LHUG 4HGWA 4M61B 1QEWB 4MMXC 4NKMB 1C7TA 1WEJH 3KR3H 3O4LB 2NY7L 2R1XB 3CC5A 1R5WA 3ARGD 4WTWA 5BV7B 4JFDA 4OFIA 2BSED 1T80A 1A6UL 4R7DA 1XCQB 1T21B 4MD0A 1OSZB 3SOBL 1WT5C 1NCCL 1M1SA 4L8SA 3TO2B 5F1SA 1CFNA 2DQEL 5KOVC 1OGTB 5IMLA 2JELL 1U92B 4P46D 5EUKB 4HJ0C 3BI9X 4P59H 4XCFH 5T1KB 1NLDH 1G9EA 2ICWJ 1T83C 4JDVA 2E8YA 1XF2B 5IQ7L 4HS8L 4MSWA 1LDPL 4I3SH 4PJ5D 2E8ZA 2BY0A 2ILLA 5JR1L 5TDOB 4OF0A 3IXAA 1DQDL 2X40A 3F8UB 1X5GA 1CS6A 4KHXH 4KXZI 2K7QA 4WWKB 1PZ5B 2Z8WC 3EYUH 3RL2A 3T8XB 1UG9A 1Z5LA 2HRLA 3RI5F 3RUGA 3WXVH 3E3QC 2EDKA 1S9VB 2YR3A 4D9RD 2W38A 2Q76A 3KJ6H 1MQ8A 2A2QT 2DICA 1U91A 2DYPD 3CDGA 4FMFA 4OM1H 4GG6A 3TWCH 3ULVD 1OD7A 4JPIA 4C83B 5JOPE 3L5WA 4MS8D 3ECBA 2R4RH 1ZOXA 4BFEA 5FKAB 2F58H 4Z7UB 1MAMH 2VN4A 1AD9A 4JLRB 4OCYH 5EOQL 3F5WB 3SKUD 3QXDB 3S36X 4U1NB 4MA7H 3OJ2C 4UDTB 2H1PH 3FOMA 3UP1A 1F00I 5I1KL 4UINL 4ORGB 4P2OB 4PJFB 4HS3B 3DXAB 2ITDB 4Z95L 3WIHH 5CWSA 4KKCD 4L4TE 1CBVL 4ZQKB 1SJHB 3EO9L 3UJTH 4XTRD 1U3HC 3CVHA 1ZAGA 4YXKH 5C0BA 1OCWH 4WO4D 3I84A 5JXEA 3B9EA 3MOQA 1IJ9A 3P9WB 2A6KB 1I4FB 4O5LL 5K9OB 4JFXB 4FP8L 1A7BA 1JNNH 4GAGL 2GCYB 4A6YA 2AJZA 3QULA 4QRQB 3LKSA 2QL1A 1MCCA 1QBAA 3VFTA 4IM8A 3HZKA 2VQ1B 1LEKB 1PFCA 2E27H 3GI9H 3LIZL 1MIML 1JHLL 3B3IA 2QQNH 2B1HL 4J3OC 2VABA 3FFDB 3V6ZA 1I8KB 1NUNB 2BHUA 3GO1H 1PBYA 1BX2A 3KHOA 4LARH 1QSFA 4XPGH 5CBEB 1S7XA 1PLGL 2CQVA 3BKCH 5LGHH 2X89A 4Y7MA 1AKJA 5I9QC 1KCLA 1XGTB 2VLLB 3HN3A 1HINH 4M7ZB 4PGJA 4L9LA 2B5IB 2OJEB 4OT1L 4PGZA 4Z77B 2X4QA 1D5BA 1QVOA 4AM0B 2PXYA 4LLQB 3HNSH 4JKMA 5KZCB 3MNVB 2ENYA 4FQ1L 1T83A 3BEWA 1NGYA 3VXPB 1ZSDB 3HR5A 2GJ6B 1DN0B 4FQLH 4NZTL 1ULVA 5JHDD 4HC1A 3VH8G 4Z78B 3EZ8A 5E5MB 3NN8A 3QEHB 5JW5A 4OBRA 4S1SH 1JNNL 4GAGH 5GS2H 4PJ8C 5JLZA 5GZOC 2MCPH 1CCZA 1DQML 3KPPB 3DXAA 3LQAL 3V4PH 4MGXA 1RHHA 5GGTA 3DROA 3BPOB 4PJAA 3NIDE 5E6YA 4HUVA 3TESA 1H8NA 4G6JL 2QV2A 1RPQA 2VB5A 1OAUH 3HE6A 4UB0H 5J6GA 2IH3A 1G7JA 1GCFA 2NY4C 4YE4H 4IMKA 1ORSB 3DPBA 3F6IA 3HUJA 4ENEC 1NUGA 2G5BB 5I1KH 5DVKA 1GRWA 2OR7A 5HHNA 5C0CA 3DSFL 4OCYL 2VLKD 3QISA 1MAML 4NQED 3GEWB 5IBTH 5DQ9A 2KUTA 1KCKA 4NQTA 3WJLC 2IH1A 1URLA 5B3NA 3QFDB 5F7WC 4TUKH 3I50L 3MROA 3V4VL 5CP7A 3FQWB 4D0CA