3TBWA

Crystal structure of the murine class i major histocompatibility complex h-2db in complex with the lcmv-derived gp33 altered peptide ligand (a2g, v3p, y4s)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
274
structure length
274
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Conversion of a T cell viral antagonist into an agonist through higher stabilization and conserved molecular mimicry: Implications for TCR recognition
rcsb
source organism Mus musculus
molecule tags Immune system/agonist
total genus 63
structure length 274
sequence length 274
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tbwA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tbwA01
5HI4C 5HHPA 4JRYA 4WCYH 5DK3A 1QHOA 1JPTH 4LLYB 4G6MH 3KPTA 2V17H 4KDWA 1D9KD 3BP6B 5FO7A 1N64L 3BYYA 3THMH 3QULB 4M8QB 1RUQH 2BZDA 2CO6B 4KWUA 3RKDC 3G9AB 4CL7A 4K8RL 4M7JL 4PLJD 1F4AA 1LNUA 3LEYH 4FQ2H 4U1HA 1G84A 3U7YH 2AJXL 2IG2H 5F3HB 3B3IB 1W72B 3V52L 1IGIH 2IC2A 1HINH 3JVGA 4FQXB 1GCFA 4OBSA 1WZLA 3P11L 4LCCA 3FT3A 4GMTH 2QKIA 2EIZB 1CGUA 5D1XB 3W9EB 4ELMB 2BSSA 2BFVH 2XTJB 1S5HB 3QA3B 4F7CA 4N5UA 3PDDA 3HS0A 2Y1VA 3VFUB 1T3FB 4UUJA 4L4VE 4WHYH 2UZIH 2HFEB 3WS6A 4ZFGL 3C2AL 4AEFA 3BMWA 4ZOEA 4AIXA 3L5WB 5DK2A 1PKOA 5DO2D 2HFTA 5H94B 1F4WL 5T1MB 5GS0C 1A14L 1ZANL 2OJZH 4Z0XA 2HJFA 3EGSA 1FIGH 4FNLL 1IVLA 2FEEI 1RK0B 1K3ZA 5SX4I 4J3VA 1LO0H 4NZTH 4NOFA 4WEUD 1MJUL 5I1EH 3C6SA 2XZCL 1T2JA 3VFPA 3ZYOA 2OI9B 3IDYB 2NNAA 3RAJL 2PN5A 3UTTA 5JNYB 1AE6L 2LU7A 5EU5A 5IG7B 4TPRL 3G5YB 1KCVL 2FJGB 1ES0A 4MWFA 4KK6C 5F6HI 1FQ9C 2LU4A 2HJLA 4OZGE 4ODTL 4XP6L 4LKCB 4YC2C 2OXHA 2DWEA 4X6CB 5BVPH 3SKJH 5C2BL 3FHAA 2B0SH 1JGVL 4BSWA 4TNWF 4PJDA 1FO0H 12E8L 5T5FL 4APQB 5C07D 1ZLVH 1X6LA 2QSCH 3WKML 3TFKA 3A6CH 1T5WA 3EO1A 5E9DD 1JYVA 1FFNB 4K9EH 1MCWM 4FXKB 3L5IA 4H1LH 1AXIB 5KZCB 1CE1H 3RY4A 5CJQH 3QQ3A 1BLNA 4RX4D 4ELKB 4N5EC 3OR7B 5DC9B 1QRND 2DDQL 2FJHA 5JW4R 5D9SA 3MRIB 3CDCA 4WU5A 2Q8BH 4OLXH 3VXSE 1KJ3L 3BKJH 4Q0XL 4MAYA 4LOUD 3ES6A 1SJEA 1YNTA 1A1MA 2NY6D 5HHOE 3SGJC 5FYKD 1MUJA 3IDMB 3FQXA 1AQKL 1X44A 3VRIA 5TH2B 2VDOL 2XOTA 3QIBC 2O5XL 3WIHA 3UTSA 2APWA 1QLFB 1ZK9A 4NN6B 4B5EA 1I7ZB 4JVUA 4JFPA 3H42L 3P9LB 4DQOH 2I9LA 3TNMA 5CEXA 4JJ5B 1ZGLA 1DR9A 2VNCA 3AU1B 1N5YH 3QR2A 2H1PL 5CEYB 2ATPB 5AYUL 5ISZA 4NN7C 1C7TA 4B53A 2XY2A 4NQDB 3AM8A 1H0DB 3P4LA 1KCRL 1ZHLA 1YMMA 3TA3C 5EU3A 1A9BA 1T20B 1GC1L 2NY7L 1T21A 1FE8H 2XTLA 3VWKC 1KJ2H 3QUMH 5D6DC 4XVTH 1AGFB 1OW0C 1ACYL 3JXAA 4KVNH 1IAOA 3K74B 2P42B 1NDGB 2RJMA 2AJSH 3SKNB 4L9LC 1TZIB 3VG0L 3HZYA 4YIQB 4BUGA 3TH4T 3HE6C 1WBZB 2F58L 3N1GC 2BVUA 2XFXB 3I9GH 4I5BA 4AL8H 3T2PA 4JRYE 4AH2A 1I1RA 1NFDA 4P4RB 3IDNB 5I66B 3WFHA 4UV7L 4ZPTB 3QI9B 5DWUH 3QUYB 1F6AB 4OM0L 3MCG1 4MJIB 3IRZA 2F5BL 4HUWA 1BJMA 2DIAA 3TYGL 3MYJA 5E1HB 2VLKB 3IDGA 3VFWA 1P4LA 3S5LB 2Y06L 1QBBA 1RIHH 2V6HA 1P7HL 3WXWH 5DI8B 4JANB 3UZVB 1IAIL 1BWMA 5D8JL 3QDGB 1NEZA 1IL1B 2VYRE 2DI7A 1VENA 3BZEB 4BUHA 3ULUH 2WM0A 2GITA 1JBJA 4GKOA 1TZHB 5I75C 4U7MA 4P4KD 3WO4C 5HYSA 1VADA 4KMTH 4OI8A 2R1XA 3LKRA 4HBCL 2NY2D 5EZJA 5J12C 3B9VA 2R23A 4EI5B 4ZTPH 3SOBL 4YLQT 2DQIL 2ITDB 5C7XH 1BF2A 4XB8A 3EYQC 1F97A 1Y18B 4OGXH 1HQRA 4FA8A 2G9HA 1JYXA 4KTEL 2BY2A 5EBLB 4KQ4H 2X4UB 4OTXH 3WHXB 3F5WB 5GSVA 1RD6A 3STZB 5F7WC 1TVBB 4KHXH 2ITCB 3DBXB 4Z8FL 2W91A 4TTGA 4LK4A 5I0DA 4JG0L 4R4BA 3RA7H 3OGCA 4DUXA 4HGWA 4XC3L 2EKSB 2FATL 5DRWA 1KCGC 5B3NA 1XGQB 2M8XA 1KCKA 4Y19B 5MEQB 1QFUL 4JRXB 3IFPA 4YHIA 5JW3H 3QO0A 3GMMB 4MHHI 2X89A 4BH7A 2VR5A 1MI5E 5FAAA 3QUZD 4KJQD 4CNIA 3OKKA 4LAQH 4XMKL 5A43C 2EDWA 2I60H 5CKGA 5CP3H 2MCG1 4HUXB 5CMAB 2HVKA 5IVXB 3BJ91 1Q72H 4PJDE 3OKYA 2P8MB 15C8L 3WUWA 1A9EB 4MXVF 1F02I 3O8XB 3TJHD 3L7FA 1UVQA 1ZOXA 1DFBL 1VPOH 1X9QA 4PRIE 1JF1A 3KR3L 7CGTA 2DQTH 5EU4B 4Z7NE 2QQNH 3JWDH 4N5EA 3FB5B 1FVCA 1S7TB 2W07A 3I6KB 4M62L 1OF2A 4LVOB 4DZ8B 3NIDE 1TQCC 4L4JA 1IGTB 4QT5A 3OKOA 2DTMH 2R1YB 4Z7VE 2HT4D 1J8HA 3PWUB 1ULVA 4RGOH 4DGYL 4L3ED 1YEEL 1CVSC 1JGUH 1LO2L 3MV7E 2VDMH 4ZS6C 4YHNA 2FLBT 1I9JH 2HLFD 3B9EA 1RHHA 3QCUH 2EO1A 3BUYB 3SGJA 4RMRA 1OAYL 2E7HA 4NM4H 4U6YA 3MNWA 1I9IH 1FCGA 1TNNA 1MH5B 2Z8VC 1U42A 2P46B 1U58A 2OLDA 4HJGB 1G9NC 5D71H 2Y5EA 3KGRA 4DW2L 4MA3B 4PR5B 4DAGH 3MREB 5C0AD 1RUMH 1RIVH 2IANE 2X1WL 2XWBB 4MNGA 5HVGB 4WU7A 1UJ3B 5IB3B 1S8DB 1YEHH 1VFBA 2EC9T 3S4SA 5ICYA 2VXSL 4DZBB 1OP3H 5ISZE 5DZNA 2HAZA 4K23H 1KYOJ 4Q9BA 3BIKA 1YMME 3MRJA 5KSBB 4XMLL 3ROOA 1IAMA 3O81A 2EDTA 1YECH 4Y1AE 5DVNA 3VWKA 2D9CA 5DEZA 5B3JE 3MJ8A 3V5DA 4BFGA 1A6WH 3D0VB 3KPRE 2HT2D 5HHQA 5IVOA 1T0NA 5DVLA 5SWZE 2DWDB 4E9LA 3D0LB 4HK3J 1UH2A 1BQHG 5JUEH 2WIIA 2WUCL 1FNEB 4L9LA 5EZOH 2MPAL 1CD1B 4RA0C 3GI9L 1NL0L 3LKOB 3CX5J 2PR4H 2MHAA 1BEYH 3HE6A 4OLUL 4Q6IB 4XP4L 4K7FB 4O2FB 2BOBA 1OGAA 3FMGH 4JR9H 4K8RC 4U1NB 5FKAA 5C0EB 1NFDE 3DGCR 4Q2ZA 4JFHE 3VH8G 1R5VA 4PS4L 2FYYA 1XGTA 4GLRH 4MS8D 2CLVB 2HLAB 2AKRB 2QHLA 2AXFA 2UVEA 4YHZL 4RAHA 5EU7C 1EUUA 1SYSB 4DKEH 1AXTH 1IEBA 4AT6A 5JMOC 3G08B 1VFUA 4PJ8C 4PRPB 5E5MB 5F1NB 4X0KB 3R4DA 2XQBH 1WC7A 3R1GH 1WZMA 1GHFL 4L8SB 5CGTA 5IF0A 3MRPB 3MPCA 1OTUC 5DUPL 1IZKA 5BJTA 1ZSDA 1VA9A 3ILPB 1S9WA 3LSOA 3O9WB 3G5VB 1XR9B 4OBRA 4WI7A 3BI9X 3T2QA 3O6MH 4L4VB 5GS1C 4E41D 3TCLB 4PJHE 1BQHB 3OMZA 4AQ1B 3A6OA 1P4BH 4Y4KB 2AQ2A 2FB4H 2A9MH 3HE7B 1U95B 4XAWL 3IDJA 2V5YA 4LLUB 5BRZB 2A6JB 4KZEL 4UBDD 2MKLC 4QTIH 1ZHNB 4C55A 3VH8B 1VEPA 3BPNB 3O4LB 5D72L 2HWZL 4M03A 3QEUB 2M1KA 3U4BL 1BM3H 3NTCL 1U8PB 5F9DC 1BD2D 4LGRB 5HD8D 5IR1A 1T03L 1ZA3A 2CGRL 1IKFH 1N8ZA 3BQUD 4J2XA 3TPUE 2VQUA 3MGOB 4OZGB 1L9NA 3R06B 1FFRA 3MRQA 3LKNB 1RJLA 4YJZL 5C0GA 3ZKNC 4WO4D 3TNNB 3U6RB 1N5AA 4HGKC 2J88L 4FTVD 2VISB 5ALBL 4FP8L 3PP4H 3B6SB 4HF5H 3TZVB 2XKNA 2VTFA 1OY3B 3UBXI 4FQJH 1OD7A 4GW4A 2ZUUA 5L2KE 4EDWH 2YUWA 5GRUH 5EC2B 3RGVD 5D2NB 2OTWA 4GS7C 4XPHH 4FQCH 3B9KA 3INUL 4C83A 1Q1JH 5I1AA 3DX9B 1NANH 2OL3A 3LN9A 4N0UE 5D5MB 4YBHA 1PVHA 3MNZA 3QDJE 1BP3B 4NBZB 3R8QA 4XP1L 3G5ZA 1EV2E 2ICEB 1EPFA 5LGHL 3ARFA 5F6IC 3U36A 4IM8A 4MA8H 1XZ0A 1F2XK 3MO1B 3VWJD 3T4YA 3FQUA 4M7ZB 5FKPA 1MQ8A 4M9OA 5D1QB 3FT2B 1BIHA 4PB9H 5CP7B 1KYOK 4DFIA 3O2WH 3D39D 3VGEA 4NQEB 1V3LA 1WZ1L 1SMAA 5C3TA 1YPZF 4R26L 4YHMH 1DVFD 2W38A 5D93C 1FPTH 3G04B 5H37G 2CR3A 4S1RL 3OBAA 4RAUB 2NXYB 5T3XH 5BV7H 4RMTA 2ARWA 3FONA 3VDBA 5B8CB 5D1ZD 3QUXD 4M00A 1N3NA 2XG5A 2OZ4A 1JGEB 5EC1B 4N8CL 1GC1C 3K4ZA 3VGAB 2JKXA 3CX5K 2HFGH 4HWUA 1UKTA 1HXMB 1DQLH 3DHMA 2BNQB 2PXYB 1LK2B 4BKLB 1PKQE 1M7DB 4HT1L 4XXDA 2KQNA 4KPHL 5I1IL 1A6UL 2IBZY 1W0VB 3MJGX 1YMHB 1D9KC 4KMLB 3FKUS 3TBTA 5D7SH 2CKBL 2HVJA 3BJLA 5F1KC 3VXTB 3RWDB 2OXGA 3LDBC 1IGJB 4FQLL 1P2CA 3BH8A 3Q3GA 3TBVB 3NZHL 1J1PH 1UA6L 2EDQA 5HHPB 4JRYB 1KELL 2PYED 4ZNEA 4ODBD 3AAZA 1LEKA 4J3UA 1KPUA 4X4YA 1OGAE 3PWLA 4C4KO 1YYMH 5BMFL 5JLZA 1H3TA 1NCDH 4YDIH 4G9DA 3T2NH 5CJ5A 3SO3C 5F88A 3ZKQD 3RX8A 1LNUB 3CAFA 1GZPA 4NHCH 1VACA 4H25A 1XFPA 4U1HB 1TLKA 2VE6A 2Y9RT 2XN9E 4X9GA 2C3HA 5I8OL 1HXYA 5CSBA 5B4MC 1MRDL 4HS6A 2EDJA 5CZVL 5TF0A 3ARTA 4LSPL 2RGSA 4JM2D 1KJVA 1OLZA 5DO2C 4LCCB 3FT3B 4FRWA 1QR4A 2QKIB 1XGYL 4UOJA 5F9WB 3NAAH 3HG1E 4HS3A 4QGYA 3QWRD 1NCCH 2WV3A 4HZAA 3V0VA 1QSFE 3WYRA 2BSSB 4F7CB 1WTGT 3ZTNH 1XF5A 4TVPH 3HS0B 3LEVL 4X6FB 3OV6A 3T1FA 4UUJB 3TPKA 5GS1A 4K2UH 4KXZI 3NN8A 4TUKH 5C09D 2Z91A 3FN3A 4ODXA 5DK2B 4ODVH 3OKLA 4F7EA 1JNLL 1FL6A 4Z0XB 5JW4Q 2HJFB 3EGSB 3UBXA 1SQ2N 3FL7A 1SJXA 1HYSD 2A9NH 3ZE2F 3KJ4B 1E4XL 3C6SB 5EO0A 3VFPB 3P3YA 4X83A 43C9A 1IQWH 4UILL 1YEKH 3UTTB 3VXRD 5EU5B 4HIIA 1S9YA 5FK9A 4N0YL 1EFQA 5FYLL 3S3PA 1ES0B 2WZPD 4MWFB 4KI5D 2HJLB 2EH8H 3O2DL 3O0RL 4LFHD 2DWEB 2J8UA 2KPNA 5DJAB 4BSWB 4PG2C 4LCWD 4MQXD 4PJDB 3VFOB 2HMID 4ONFL 1XCTA 1H5BC 1I1AA 4G59A 1B4JH 2OK0H 2NY4B 3P0YL 2JIXA 4J3XA 3LKSA 3EO1B 5GZOC 1T6WA 4TOYH 1LO4H 5JHDA 4PRIB 1S3KL 2DQJL 2EYRA 4G6FB 3QQ3B 1BLNB 5I30L 1HDMA 8CGTA 4TQEL 4HQQH 2FJHB 2K9UA 3TN0D 5D9SB 1T1YA 4YXHH 4WU5B 2CR6A 2ADJA 2R9HD 1AGBA 3UTZA 4NKQB 1CFVL 3EYVA 4L1DA 4MAYB 3ES6B 3KHOA 3QCTL 3LS5L 1JFMA 4WUUD 1YNTB 1A1MB 1G6RB 4JB9H 2Z8RA 5F6HJ 3TC9A 1MUJB 3FQXB 2J5LC 3W0WE 3VRIB 5EDXA 4Z9KB 4KTYA 4WWKD 4AIZA 2W0FA 3UTSB 3V4PL 5BZDA 1XCQA 5ESQA 2E27H 4FFEX 2IANB 4JFPB 4M1GL 2I9LB 3TNMB 5CEXB 1ZGLB 1KBGL 3DARA 1VFAA 5ISZB 2DQCL 2AGJL 1PGRB 3JUZA 4TRPH 3LVEA 2NY3B 4X7EC 1DEEA 3SY0B 1ZHLB 4AM0A 1YMMB 3WFEL 3CDGA 4EQ2A 2IQ9L 3TBVA 5EU3B 1A9BB 1FNFA 3KNBA 3WUZA 4Y1AB 3BGFC 4ZOAA 1T21B 2VXQH 5HPMA 5KVFL 5KW9L 1KEMH 2X4OA 1UENA 1NEZG 1CIUA 4HAGA 4BFBD 5JIHA 1CXKA 4QXTA 4LPXA 1R3IL 3F7RA 1IAOB 5FEBA 4XVJL 4KJWD 2P43B 4NO0D 1ZVSA 1N0XL 1OT1A 1B0GA 4FFZH 5DLML 3E8UL 3QT2A 3C5ZD 5HYSG 4QOKD 4ZFFA 4IRZH 1A7QL 3BDBA 3HZYB 1A7NL 3CSGA 5FGCB 4Y8AA 4I5BB 3UP1A 4AH2B 1AC6A 1NFDB 3SDYH 3GJEA 1CFNA 5H37H 3TBWA 2XNAA 3VW3H 3NA9L 3WFHB 5HI5D 5FUOH 2YXFA 4QRRD 4L29B 4HS8H 2O61A 1D5ZA 1TVDA 4JFOA 1KEGH 5I73B 2F74A 1JPFA 4P4KC 3MYJB 3O3DA 4BQ9A 3ETBF 3MLUL 4TULL 3IDGB 4XX1E 1U6AL 2NY2C 3VFWB 1P4LB 4OV6F 3IU4L 4LVNC 1B6DA 5MHSD 5I1JL 3M1BA 3I2CL 4CDHA 4OLZH 5IFJA 1NEZB 2W59A 2VSCA 3DV6A 3MC0A 1F6FB 5LGKA 1U36A 2YD3A 2DQDL 3BD4A 1OAKL 3P9WB 3QDHA 2GITB 3T0EC 5JXAH 3WUWG 5HYSB 1VADB 2MQ0A 2R1XB 5EZJB 2R23B 5GZNC 4F2MA 3OG4B 5LXGL 2O5YH 3IAGC 2NTFA 1WQVT 4PJ7A 1KXTB 2G9HB 2I5YL 4HWBL 4YBQD 4M43H 4ACPA 2JJUA 3NCEB 2EDDA 5TQ0H 5GSVB 2D7QA 3QUZC 1P1ZA 2JELL 3QAZC 2VUYA 4OZFA 3GSXA 2AV1A 3MCLL 3MZTA 4YE4L 1DN0A 1G9MH 4O5LH 5HBBA 1YNLL 2XQYG 4OJFL 4R4BB 3OGCB 4MXQA 3ZT7A 4HGWB 2BVYA 7FABL 5DRWB 2ZKHL 4DCQA 3TJHC 4AEHH 4YHIB 2GUOA 3IFLH 2HKFL 3QO0B 4IOSD 1T1ZA 4BH7B 2QQKH 2XRAH 5HHMD 5CWSA 5K93A 4FFVC 1X5KA 2YRLA 2Y23A 1NC4A 4CNIB 2F8XC 2MSPA 3OKKB 5MENA 2J8UE 5IGXH 2XWTA 2HVKB 4KH2A 4PG2A 5HYJE 4PRHE 4GKSA 1SY6L 1H5BA 4ZXBA 3WUWB 2R2EA 2HT4C 3GMNA 4UT9L 1F4YH 4Y4HD 1C7SA 4FQIH 1J10A 4N0UB 3LD8C 3L7FB 1UVQB 3RZCD 4H0IA 3S4SG 1KB5L 1JF1B 1CLOL 2HLFC 2QR0A 4L3AA 3ARBD 3HMWL 5JOFA 4PJXF 1KJMA 3TWCL 1QZ1A 2DAVA 1E6OL 1FVCB 5KVDH 4K3DL 1OF2B 4LRNL 4JKPH 1MWAL 2W0LA 4QT5B 3OKOB 5T5NF 5EZLA 5DRXB 4KROD 1J8HB 4XNYH 1Z9LA 3PP3K 5LKNA 4KRMB 1JMZA 4YHNB 4M8VA 4U2YA 1NAML 1RHHB 2C26A 3EO0A 3FO1A 4JZJC 4X7SH 4U6YB 5C9KA 3MNWB 4G7YH 4M6OL 3T3PE 4KHTL 5DC4B 4K7PL 5T3ZE 3AB0C 3LIZH 3RY6C 1U58B 4F58H 5TF1L 3BIBX 3OR6A 3GDBA 2DD8L 4JE4B 3NPSC 4LLQA 3HC4H 4H20L 4MNGB 4UT7L 2OTPA 4WU7B 5MERA 1MOEA 1I3RA 4JKLA 4X6DF 4HFWA 4JY6A 1VFBB 3L1OL 1L7IH 4JHWH 5ICYB 3NH7H 5I6XC 1ZT1A 4NN7B 2BDNL 4K3JH 4YHKL 1KCUH 1DBJL 1XMWA 3BIKB 4HCRL 5KG9A 3MRJB 3ROOB 1CLYL 4XMPL 3PIQA 2ZNXA 1UM5H 3VWKB 1GGUA 4BZYA 2FBJL 3MJ8B 3ZDZE 3V5DB 4WHTA 4H8WL 4BFIA 2GCYA 1WF5A 2X09A 5HHQB 1AFVL 4HWEL 1T0NB 2V9TA 4OSUH 1GPOL 4MS8C 5ALCL 1LP9E 2VDNL 1IAKA 4JFYA 2WIIB 4L9LB 3PGFH 4XP9L 2VIRA 3LN5A 5F9OL 1CGSL 3KYNA 1CU4L 4XB7A 3GSNL 2ZUWA 1HWGB 3MTRA 4MHHG 5CGYC 1G7IA 3HE6B 4J7RA 4CN4A 3ZHDA 5I17A 2BOBB 1OGAB 1BVKA 1PBYA 4Y16A 5FKAB 1J0HA 1DBKL 4BJLA 5C6WH 4Q2ZB 1EHLH 2JLLA 3JWOH 4NC1E 1R5VB 2FYYB 1XGTB 3SJVD 3WMSA 3OZ9L 1XIWD 1MCNA 3L9RA 4PJBF 2AXFB 5DQJA 5E8DH 3N85H 1JUFA 3MFFA 1ZLSH 4MGXA 1A7PH 4ZO8A 1IEBB 2AQ3A 4AT6B 3F62A 4P4KA 2YPVH 3MLXH 3PWPA 1T6VN 5IW1A 5KJRH 4GH7B 4P2OD 4YHOL 1WC7B 4PP1C 4X98B 4X9IA 5T1DL 1J8KA 5IF0B 5TE4L 3WSQL 5JOEA 3N50A 4KKNA 1GGTA 2BY3A 2JB5L 4PD4K 3HZMA 2ORBH 5BJTB 1ZSDB 4CMMA 4N90D 1ZKAA 2WSKA 1S9WB 3LSOB 3S3JA 4M9PA 3STLA 1AKJD 4M61A 5I75B 3T0EA 4GRWH 3WO4B 1BJ1J 3LRSA 1OM3H 3FOMA 1PLGL 3ARQA 1U41A 3ZL4H 3F58H 3IDJB 4J4PD 4P3CL 5EWIH 5FYJU 3AROA 1U8QA 4XNXH 1MY5A 4QO1A 4WO4C 2FBOJ 3FO0L 5MI0B 5EO1A 1R5IA 4O2EA 3CFEA 1CI5A 5DR5L 1KCLA 2G5RA 1RSFA 3BN9D 2W65A 2R29H 3G6AA 1ZLUK 3UXFA 3SE8L 1UM4H 3C8HA 5IR1B 5GS0H 1ZA3B 2BY1A 3TVMD 1N8ZB 4Z0BH 5I1DA 1NCAL 3R0MA 5E4EB 1ZGLM 1X5GA 2W9LA 3MRQB 1RJLB 4RZCA 2BSRA 4MNQD 5C0GB 1N5AB 3NGBC 3BHBA 5C0DA 5I8CA 4LL9A 1GL4B 1E4XI 1F3JB 2AV7A 5C0BD 2XKNB 4RWYL 1MRFL 4OV5A 2X1OA 4DN4H 1A7BA 3KPOA 4GW4B 5EU6D 2DJUA 5C0CE 2OTWB 3M07A 2OBGA 3CH1A 5E0QA 4EN3D 4YX2H 3B9KB 2EDEA 5I1AB 4C83B 2OL3B 1BOGB 2GJ6D 1IRAY 3MNZB 4JFED 4GG6A 3G5ZB 2ESVE 4WY7L 3MV9D 1DVFC 3ARFB 3SQOH 3U36B 4R7DA 5AEAA 1BVZA 3NCJH 2V5MA 3PG2A 1TQCB 3FQUB 3NFNA 5FKPB 5HI3D 1C08A 3PUCA 1BFVL 5D1ZC 3QUXC 5FUCE 5C0AA 2AAVA 3AVEA 4Q7DA 1LWRA 1FRGL 2DM4A 1AQDA 4NZUH 2VDQH 2A6KA 1OL0A 2YKLL 3L3JA 1HHJA 4NBYB 5K9KA 1HZHL 4WHCA 4JGMA 4Q58C 3RWGA 3E2HA 4YZFF 4ZQKA 3JV4A 4YR6A 4PYGA 3RY6A 3DYOA 1T7ZA 3FONB 4V1DD 3E3QA 1NGQH 4L8BA 1UACH 1TETH 1N3NB 4UV4L 2F54D 1J5OH 3IRPX 5GISL 1N59A 1B0RA 2X4SA 3ROLA 1IGYA 4AG4L 2ZUVA 2NR6D 1CXFA 1BZQK 5DA0B 4TSBL 3UTPE 3RVXC 1IFHL 2VO5A 4XXDB 2VDRH 3KHQA 5I8KL 2IMMA 5E2TH 2ZCKL 2R4SH 1K9TA 5F96L 1HQ4A 3TBTB 1YEGL 4EJ1C 2CUHA 4XCFH 3T1WA 5C0ND 1KGCD 1Z3GH 2C3WA 2HVJB 1VGEL 5GRVK 2P5ED 5D7IE 4JDTH 1YY9C 2R56L 1P2CB 4OB5L 4WFGD 3BH8B 3Q3GB 5D7LE 1MCOL 3TCXA 1QRKA 2PETA 3EOTL 3AAZB 1I9RL 1LEKB 1NUGA 2VXVL 4K7PX 4A6YH 1KPUB 4X4YB 1HHGA 5IHZA 3PWLB 1DSFH 3KPLA 3UBXG 3SBWC 4RCAA 4ISVA 5F88B 1A4JA 4CADA 4XTRD 1GZPB 1VACB 3C60C 4ODUA 2AW2A 1DL7H 1MFCH 4H25B 4QHUA 4BZ2L 2VE6B 5HDBE 3J7HA 4GSDH 4FZ8H 3MX0A 1HXYB 5LWYL 1ND0A 4RIRA 4HS6B 3OF6A 4I3SH 2EYSA 5ITBH 1MREL 4O9HL 5J7CC 5DUMH 1KJVB 4I77H 2VR9A 3VFMA 4FQXD 4ALAH 1QBML 5C8JA 4HS3B 1EHXA 2D0FA 3HR6A 3V0VB 1HYSC 2IGFL 4I48A 2ZUYA 1XF5B 5D1XD 2VDKL 2CK2A 3T1FB 2XTJD 4ODSH 2AEWA 1QBAA 5GS1B 1W2KT 3U2SA 1CTOA 4X5LA 4J12A 3BESR 3NN8B 5ANMA 1JV5A 2Z91B 4ODXB 2ZG2A 2HJKA 3OAYH 3OKLB 2KQMA 4OCXH 4F7EB 2ADFL 4IDJL 1YC7A 3LKQA 3LQAL 1FL6B 3OAZK 1KSRA 3UBXB 3ZSSA 4U2ZA 3VXUA 5EORL 2DF3A 5I15H 1JCKA 4MQXC 2HMIC 5EO0B 2OYPA 4IS6A 2VLRA 3RRQA 2CXKA 43C9B 4JN1H 4FXLA 3O2DA 3QUKA 1S9YB 4HIIB 5FK9B 3WKNA 1P84K 2GTZA 2M2DA 1ZT4A 1A02N 3QEQA 5CSZA 3VD5A 3SDXA 3ILQC 1QKZH 2J8UB 2WBJC 4UTBH 1UXSA 4KVCH 4QHLB 5CIPA 4WEBH 3DVIA 3TN0C 3MR9A 3VGDA 1DDHA 4PRHB 3I3DA 1XCTB 5DT1L 3MLWL 4HW6A 1I1AB 3OHXA 1S7VA 4NCC1 2JIXB 3LKSB 4APQD 3RBGA 4B50A 5JHDB 1TTUA 1PZ5A 2EYRB 2QQLH 3WIIL 3S88H 5KZCD 4X4XA 1HDMB 4U1JA 2Z35A 1RFDL 4ZFZA 1T1YB 1NCBL 4WWKC 1WV7T 5CLTA 4BZ1H 3MLRH 3RL1A 2DM3A 4UOW1 2QADB 2ADJB 5IOPA 1MFBL 3F7VA 1AGBB 2P1YA 3UTZB 3EYVB 1KN4L 4EBQH 2BC4A 3ZKXB 2VQTA 1GGBL 5IQ7H 4AMKL 3CMOL 3GB7A 1I7TA 3DUSA 5L88L 2MQ3A 5AD0A 1EJ6A 2PTUA 1UCBH 1BFSA 2EIDA 2H9GA 4KV5E 3O6LL 4NNYA 5CSGA 2F53E 5D93B 4AIZB 4YXKH 5HSFA 4TSCH 2W0FB 1EMTL 5BZDB 1XCQB 5GRXG 2DYPA 5ESQB 3WFDH 1IGCH 3Q6GH 5IWLA 2LV4A 4F80A 1T0PB 2AXGA 1UH4A 4B7IA 4WUKH 4NWTH 3GJFA 2VABA 3MUJA 4HIXL 3QXVA 1VFAB 2NTSP 1G9NH 4KJWC 4WENB 4ZODA 4AM0B 4OCWL 1DEEB 3A67H 4X6EA 3CDGB 2OZ4H 4NQDD 3KNBB 3HNSL 3EFFB 1LK3H 4BH8B 1TFHA 4R8WH 4YHYB 4ZO7A 5HPMB 2YN3A 3VXMA 3H9YA 1JPSL 3QWQB 1FORL 3BRDA 2X4OB 1JZ2A 2QL1A 3DOSA 1QP1A 1G7QA 1KTLA 4QXTB 1Z9MA 2YD2A 2DQUH 4HXBL 4LASH 3K81A 3L3GA 3KPSE 5TE6H 4RSVA 1ZVSB 3VFGH 5HI5C 3ZE0E 1NBVH 1B0GB 3QWOA 4K07A 3RWHA 4XAKD 4ZFFB 5KANI 5EUOF 1JRHH 3QQ9D 4LPTA 5FUZH 1VSCA 2AJVL 2BNRE 4X5XA 4XWGL 4M6NH 3AS3A 1C5BH 2APXA 3GJEB 1CFNB 4OD3H 3TBWB 1VESA 2XA3A 4XNQA 1SVZA 3SBWA 4Z7VF 2A1WL 4OZFG 4JQIH 2O61B 1F3RB 1D5ZB 3QI9D 3CH8A 3BWUC 4JFOB 2D0HA 3QUYD 2F74B 1JPFB 4MJID 3C60A 3O3DB 3HMXL 2V2TA 2G5BA 5SV4A 5EN2A 4HUMB 2VLKD 3RGHA 5E2WL 3M1BB 4EUPA 2WWKO 4P9ML 3V52H 5IFJB 4UT6H 4QRPE 2V9QA 1LE5A 3DV6B 4YBQC 5GJSH 3QDGD 3RWIA 1PYWA 5AAWA 2R1WA 3OB0K 3TO2A 1PY9A 3L5HA 3RPKA 2J8HA 3ULVD 5D96C 3IAPA 1SEQL 3MLSH 4DN3L 3ARSA 4U0RC 1K3IA 3QP3A 5I1LA 3IXAA 4HH8A 4HWBA 4F2MB 5IB4A 5FCUH 2NTFB 4PJ7B 4EI5D 4JFZL 2B2XH 3C2AH 1F90H 2W9EL 1KOAA 3GSWA 5E6ZA 4DVRL 4U3HA 4WW1A 3GSOA 1FZOA 4MA7L 1BGXH 3ZLQC 3AS0A 3WDJA 1P1ZB 4FNLH 2IBGA 3GSXB 2AV1B 4OZFB 5ITFA 5A1AA 5KN5A 2P49B 5F93C 5FYLE 1GVIA 1D6VH 4KK5C 5H8DA 1MRCH 2VLRE 5DMIH 4Y4HC 2Z4QA 4P46C 2H8PA 4DCQB 4RMWA 2GUOB 4XNZC 1CQKA 4M93C 1QSEE 3QEQE 1T1ZB 3ARBC 4JRXD 5CWSB 2AEQL 1OD9A 5IHUL 2VDLH 4Y5XC 4JFDA 1SY6A 4MMZC 1A3QA 3D3VE 4P99A 1NC4B 4OCLC 3FB8A 2WBJA 4N1CA 5MENB 4BA8A 4IJ3B 2UZYB 4O51A 3P0GB 1SBBA 2XWTB 3K2MC 1FJ1A 3WBDA 2HN7A 3O3BA 4Y89A 4F9LC 1LGVA 4GKSB 1KB5A 1H5BB 3ZHLA 1CGTA 4ZXBB 4KROC 2R2EB 2X10A 1H3XA 2Q3AA 4Q97A 1SBSL 4W81A 5KSAA 5F21B 3ESUF 2J1KA 2QR0B 3O8XD 1MLBA 4M7KL 2ESVB 4UQ2A 5I1HL 5JOFB 1KJMB 4PJ5E 4QRQA 2RIKA 2X5PA 4MZ3A 5SWSE 5CEZE 5EZLB 2OMBA 1NAMA 1D5XA 2R15A 1CXIA 4KUZH 2PF6A 1H3PH 1XAUA 2EDXA 1PEZA 3ARGD 3WL9A 4MNHA 3SGEI 4J3OC 3EYUH 3MLZH 3TJEL 2R2BA 3EO0B 4M1CD 4PJHF 5T3XD 1FGNL 3FO1B 3CFKA 3S9DB 3VA2C 3F7PC 2BK8A 1E6JH 4GAYA 1YUHA 4OFYD 4POYA 1NAKH 4L3CA 5FYJD 1INEH 4R90H 4JFFA 5I9QB 5ACZA 2O5XH 4PGJA 5JIPA 4EXKA 3OR6B 1NFIB 2R4RL 4NHUA 4LLQB 1FZMA 2J4WL 1SJHA 4Z76A 4HJJH 5MERB 1I3RB 2FH6A 2Z9TA 4C54A 4HFWB 4JY6B 4HCRA 5A3ID 2W0PA 1BZ9A 1ZT1B 2LVEA 4TYUA 1MEXH 5KG9B 3GBNH 3PIQB 1GC1H 3HRPA 4LMQI 3V5HA 2E7LA 4LARL 5DQDL 2VXTH 1QNZL 4WHTB 5FM5M 2GCYB 5DD3L 4BFIB 3U0PA 4PJFF 1WWCA 4KTDL 3UJTL 1XIWC 3GSNA 4N1EA 1SMOA 4JFYB 1IAKB 2XKUA 4WV1C 4NUGH 2VIRB 3LN5B 1AIFA 3KYNB 5CJOL 1NH6A 3T2OA 1G7IB 4DTGL 2CIIA 2W92A 3MSPA 1BVKB 4Y16B 3VXPA 3GIVA 2HTKD 4P2OC 4JAMA 3UMTA 1F8TL 1JWSA 4LCYA 1YYLL 3TT1L 3IVKB 1KB9K 3FB6A 3W39A 1I8MA 1IEHA 3CFIC 1OP5H 3MRCA 3L9RB 5J0BA 1L8JA 4EKXA 4HZLA 2GK0A 5DQJB 1JUFB 4JQVC 3MFFB 1W0WA 1SM3H 3W5NA 4I4WA 1NGWA 1KULA 4P4KB 4M6ML 3PWPB 5DRNA 5IW1B 3DMMA 3ZKMD 4LVNB 2N7BA 1JHKH 3GMRA 4OD1H 4BSJA 3C08L 3OKNA 2CXGA 4XH2A 1RZJC 5C86A 1TJIL 4TVPD 5D8JH 4BK4A 3HZMB 1RZKC 4XPAL 4CMMB 4KK8D 2E7MA 2FSEA 3STLB 4XPFH 1GH7A 3H9SE 5HGGS 2JCCF 5IMOA 4M61B 3O9WD 3PWJA 3T0EB 1G0YR 1A64A 2XZQH 1TVHA 3LRSB 4J6RH 4L4VD 4KGLA 4RMUA 3LQAC 3FOMB 1B2WH 3TVMC 2MCPL 1KC5H 4Y4KD 4N0CD 4LSUH 3M8OL 3D48R 3HE7D 3MXWL 3U4EA 1ZTXL 5BRZD 5EO1B 1G6VK 2ADIA 1R5IB 5HHMA 4O2EB 3RU8H 4YHLH 5IB1A 3CFEB 2F9BT 2W65B 4ZO9A 1EO8H 3G6AB 3V7AE 1DCLA 4ZAKC 4EN3C 5I1DB 4Y4HA 4P46A 4OZFH 4Z7WF 1JIBA 1UWXK 4CU7A 2YD8A 3H3PL 1CR9L 4RZCB 2BSRB 2IF7A 5IEHA 1LO3H 1JGDA 3BHBB 5C0DB 5I8CB 3T0XA 4Y5XA 5MP6L 3GRWA 2X6MA 3NCYS 1FNGA 3BGMA 3QQ4A 3OKEA 3KPOB 3TZVD 4F9LA 5LQBL 5F1OB 4KAQH 1KN2H 5HI3C 1U8HA 3CH1B 1KIUA 1EO7A 4HC1L 5DJ2A 1KLGA 1N6QH 5KS9F 1DFBH 2OP4L 2WUBL 3PHOA 4GG6B 2NW3B 1NDMA 2NMSA 3NIFF 1U8LA 4R7DB 1WWAX 4M62H 4LIQL 3NFNB 4ONOA 2YK1L 4PGBA 2B1AH 4EEEA 1ZEAH 5KVMC 5FYKH 1C08B 2PW2A 2HKHL 1OSZA 4OZHE 4N8PA 4HLZG 4ZG1A 5J9PA 4RISH 5D1QD 1AO7A 1AQDB 2FO1A 1A1NA 3MZGB 5I74B 2CMRH 2P4AB 2A6KB 3L3JB 4DOHE 5K9KB 3ULUF 4NQED 5F7DA 4OI9A 3UC0L 3RWGB 1T22A 3E2HB 1OAYH 3JV4B 1WBXA 2MTPA 1NC2A 4YR6B 1MF2L 4ZUTA 4V3DB 4JFFE 1IAIM 2NXYD 3GMPA 4GAGH 4X99A 2D03L 1OAXL 4HIEA 1WICA 4L8BB 1T83C 3T65A 4G7VH 4NHUE 3UX9B 1URLA 1D3CA 2WBWB 3T4AA 1I1FA 3O2VL 1N59B 1B0RB 2X4SB 3ROLB 1IGYB 5C0NC 4S1QL 5I6XB 4R4ND 1A5FL 2H3NA 4XPGL 3LZFL 2BNQD 3CGTA 1AI1L 1S5IH 4DKDC 3BMVA 4WTZA 2PO6A 1DTUA 5GGTH 1HQ4B 2ZWLT 4O02H 5L8LB 3HNTL 1MAML 5JORA 3KXFA 4UDUA 1S7XA 4WV1A 5DK0A 5DZOA 2Y07L 3QRGH 3K1DA 3T77A 5K33A 1NL0H 3T0WA 4JRYD 5EBGA 1HHGB 5IHZB 1KFAL 3I3EA 3P0VL 4JO1H 4QWWD 3KPLB 4PLOB 1F45A 4NZRH 4RQQA 3ZHKA 4ISVB 4RFOL 4CADB 4DKAA 4KKLD 1HH6A 5D1XC 4ODUB 5CD5D 4XNUH 3CMGA 4FZEL 1RI8A 4QHUB 2X4PA 5DURB 4YEFA 2C1OA 3IGAB 2D7MA 3IF1A 1ND0B 2VC2H 4RIRB 2EEBA 4D2NA 2EYSB 4KKBC 4ZTOL 3V4UH 4MX7A 3VFMB 4G43A 3LS4L 3QHFH 5GGVL 1GHFH 5C8JB 1M7IA 3DIFA 3MBXL 4YWGH 3VXQA 4YDKL 3UPRA 3ABZA 1J0ZA 4I48B 1AD9A 4MVBD 4PJCE 1CT8A 4TTDD 3U2SB 3RWFA 5E5RB 4LP5A 3MACH 5IJVA 4L8CA 5ANMB 1P69B 2OI9C 2B1HL 5EOCL 3MNVA 3TVMA 1K2DA 1JV5B 3IDYC 1C16A 2HJKB 2YR3A 2NY0C 3Q1SL 4XAWH 5DJYA 1NSNH 4LPWA 2DL9A 3SHSA 3LKQB 4HKBA 4OGAD 3VXUB 4PJ9A 2YRZA 5F8QC 4TSAL 2HWZH 5EG6C 1YEFL 5E99L 4IS6B 4MB4A 1A3LH 2VLRB 4XGZB 3U4BH 3NOIA 3QUKB 3LKPA 4APQC 4ZAKA 1UXWA 4LNVA 4L5FL 4LU5L 2CGRH 2CRMA 2GTZB 3JTTA 4NJAL 3UTTD 1ZT4B 5C08A 3QEQB 2HYMA 5CSZB 1E0OB 2ZG3A 3SDXB 5GGQH 3BN3B 4FFYH 1TJHL 1UXSB 2X41A 1OSPL 3MR9B 3SDDC 1R3JA 4YQXH 5C2UB 5ALBH 1DDHB 1MELA 4FP8H 3UPAA 1E4WL 2LTQB 4WFEE 3OHXB 1DBMH 1S7VB 5IBLD 1INDL 1MJ7H 3MUZ1 3TFKD 2NY4D 3CNKA 1PZ5B 1CS6A 2UYLA 3SE9L 2YUZA 3BE1H 5FO8A 2F8VA 3A6BL 2UUDH 4PRID 4X5WA 3PGCA 4X4XB 4L4TE 1YEDA 2FEDC 4U1JB 3QSKB 3V6BR 2Z35B 4G6FD 4XP1H 2YN5A 4ZFZB 5IW3A 5LGHH 4JHAH 3RL1B 4D9QE 4QXGL 5IOPB 3F7VB 1IKNC 1UEYA 2BC4B 4NN6C 1GIGH 4MAYD 1DE4A 3GB7B 1I7TB 2BVEA 3BISA 3DUSB 1RUAL 5EFIA 5I16A 1AO7E 4XBGA 5AD0B 5TE7H 4HSQA 4GBXC 1VDGA 2H9GB 3FRPA 4NNYB 1T4KA 5IUSA 3LH2H 4R26H 5B38A 1QR1A 2CKNA 4LMQE 1MPAL 1S78C 2XI9A 3QFJA 2DYPB 3UTSD 5CUSL 4I9WE 4ENED 1LMKA 3EYOA 2FHFA 1T83A 2AXGB 2IAND 3QXTA 1JHLL 2YWZA 3GJFB 1S7SA 2VABB 4QYOA 2D4FA 5ISZD 3L3DA 4X6EB 4EI6A 2Y7QA 1ZVYA 1FH5L 4FG6D 5IBUG 2NY3D 2P5EA 1YMMD 1CXEA 1Q0YH 3VXMB 4Y1AD 3AMLA 5FHAH 1F4HA 4EUPG 4J3SA 1G7QB 1KTLB 3MJ9L 3W11D 2CH8A 1RQ5A 5ACMA 5ICZA 3L3GB 3P40A 2BHYA 2PW1B 1YN6A 1WJ3A 3HC3L 2DKSA 3QWOB 3RWHB 1HHKA 4WI8A 1P5UA 3W82A 4KKAD 4M7LH 1JFQH 2VXUL 2BHZA 3MCKA 3QI9C 3UZQA 4ZMAT 3QUYC 1B6UA 4HLZH 1NKRA 4X5XB 1MCPL 1RU9H 3NZHH 5F7NC 1Y6NR 3VXOA 5DF0A 3QDAA 2ED9A 5HI4D 5F9JA 3IJSA 1IC4H 3R0NA 1H3WM 1VCAA 1MHHA 4XNQB 3KYKL 4LFHG 5F8RC 3V6OC 4HG4J 3HMXA 4S1SH 1REIA 5HHXL 4OM1H 1B3JA 4JY5L 1Z5LA 3C60B 5IBUB 2IJ0C 5KVEL 2G5BB 1CDCA 4JFXA 5EN2B 3HI5H 2YPLA 5ETUA 2DL2A 5E08L 1RURL 1V7NH 3FO2B 1JYWA 1G7LB 1Q9WA 1YPZE 4TNWK 4EI5C 4EUPB 1MRDH 3DWTA 3UYRL 4JPVL 1LE5B 2CK0H 4MQSB 2RHEA 3QBTB 5B22A 1XGYH 1PYWB 4PB0H 3RWIB 2R1WB 3H9SB 3TO2B 3AY4C 1KIRA 4DEPB 4CU6A 5I19H 3H3KA 4GRLA 4JCMA 5F7EL 3LEVH 5I1LB 1EJOL 3IXAB 4NKIL 1JZ5A 1FC2D 5IB4B 3A0OA 5AAMA 3ALPA 1UM6L 1MFEL 4XC1H 3GSWB 4AEIH 4GQPH 4QHNA 4WW1B 3GSOB 4Q9RH 1FZOB 1PEWA 3HR5A 5DQ9A 4ZS7L 5ITFB 5GS0D 3PQYE 5GHWL 3ZDZF 3ZKSD 5KN5B 5AZEL 1I8LC 3NBNA 4JPKL 2AABL 2XKSA 2Z4QB 2H8PB 4IIQA 3T0BA 4UILH 3HI6L 1LP9F 2VL4A 5IT2H 3QIWC 2PKDA 5JQHC 3O4OC 1VERA 5KOMC 4QF1A 3DVNA 2Q86A 3O2DH 4JFDB 4KK6D 1PFCA 4PBVC 4YUEL 2R0ZH 3FB8B 2WBJB 5EIIA 3RDTC 2BJML 4O51B 4P9HL 3SDDA 3WJLC 5JR1H 1FJ1B 5C07E 1CN4A 2HN7B 3O3BB 3S37L 4MAUL 1KB5B 5DD5L 5E2VL 4G8IA 4X4MA 2N56A 3DI2B 4LVOC 4M4RA 4ONFH 5E9DE 5A2KH 1RZ7L 5CIPH 5IROC 5KSAB 3ARGC 1MNUH 1MLBB 3OXSA 3OAYK 5KANG 4XHQA 3B2VL 4UQ2B 1QRNE 1S3KH 3WIFA 4M1CC 3RX5A 1RUPH 4V3EB 4LQ1A 4N5ED 3O6KH 2Q76A 3WXVL 4NOBA 1NAMB 1D5XB 4PJGE 2AK1L 3LHPH 1IKNA 1U3YA 2ZPKL 1C8PA 2D7TH 4H88H 1FYTA 1JL8A 1J8HD 1NLBL 4JLRA 1AR1D 3B9DA 3EFDH 4NO2A 4MNHB 5FYKE 3WL9B 3LS5H 3NVQA 25C8H 4DOHB 3Q5YA 3CXDL 2R2BB 3KYMA 5A3IC 1CD9B 3TT3L 3CFKB 4JJ5A 4YXLL 3ARVA 1NLDL 4PGCA 1IGFL 1YUHB 4GAYB 4GBXA 5IJKC 4L3CB 2YD1A 4JFFB 3VFVA 5ACZB 5M94B 3MODL 3JZ7A 5DGRA 1G1YA 2EE3A 2GIYA 4NHUB 1C1EL 4NQVA 3UO1H 2GJZA 1FZMB 1XGPA 1SJHB 4Z76B 1N0LA 4OFDA 4JG1H 5J4MA 3FT4A 4P2CG 4LSRH 3ZE2E 3O6FD 4HK3N 1P53A 2CDEA 1BZ9B 2OR7A 3OJVC 2XZAL 5DTFA 1HYRC 2DMKA 3GJFH 5IP4A 4KRLB 1OB1A 1E4JA 3BPLC 4M5YL 4XXCC 4NGHL 5CBEA 5J6HA 1MLCA 1PG7H 3BRFA 1DZBA 4XVSH 1Z6JT 4I0KA 3VWKD 4P59L 1FNSL 4UB0L 5B39A 5LAXA 1NUFA 3U0PB 5GJTH 2VJXA 4UNUA 1EGJL 5LCVH 5T33H 3GSNB 1FDLL 3LOWA 4QHMA 3MXVL 2APTA 3P4OA 5LJYH 1AIFB 1OWWA 2YC1A 4WCYL 3WHE0 4IEFB 1OAZH 1F6AA 1JPTL 3I75A 4G6ML 2V17L 3M17A 4PJXA 1B90A 2CIIB 3THML 1GOHA 1RUQL 3GIVB 3FZUC 3KPNA 3TGXA 3HE6D 3VXPB 2EE2A 4JAMB 1JWSB 4LCYB 4LEXH 1QD0A 1OGAD 3FB6B 5AWNL 3W39B 2DBLH 3QNXA 1I8MB 1FNHA 4IRSC 2DB8A 2YA1A 1U3HA 3LEYL 3MRCB 4FQ2L 3BFOA 4R2GC 1L6XA 5K59E 4KK8C 4P2RA 2NY5C 2GK0B 4HZLB 3QIUC 5ECJE 1W0WB 3O9WC 3U7YL 3VRLE 5JDSA 4I4WB 1LEIA 2IG2L 1NGWB 1U3ZA 2FGZA 1HINL 2WP3T 2XN9D 3VFSA 5DRNB 3MLUH 3DMMB 4GMTL 3IU4H 3GMRB 3RQ3A 4NNXA 1AGCA 3OKNB 4P0DA 3V6FA 3QDMA 4N0CC 4XH2B 2AJZA 3I2CH 2ITDA 2BFVL 1UGNA 3IJHA 1QSFD 5A40E 2EC8A 4PJIE 5IMOB 2UZIL 3AY4A 2GT9A 4EUPH 3PWJB 1S7WA 4WTWA 5DD0H 4PUBL 1KENH 4X6DA 1TVHB 3X13A 1J1OH 3RUGE 5ADPH 4XWOC 3DBXA 1H8OA 1EEQA 5A2FA 2DIBA 5IKCA 2OJZL 2QBWA 3PWNA 1FIGL 4CVWA 3Q0HA 2I5YH 1EEYA 1LO0L 2ADIB 5HHMB 4CRPA 4NZTL 4WGVB 5I1EL 3CZJA 5IB1B 1W8OA 3QCVL 1J9CT 3HNVH 4S0SD 4G42A 4OCSH 4G5ZL 2AK4A 4M4PA 1MJJB 4Y4HB 4P46B 4WW2F 5D2NC 4NKOB 5D7IF 5IM7A 4XNZB 4BSVA 3QIWA 3KPQA 4S2SA 4M93B 5BVPL 3CFDA 3SKJL 5IEHB 2B0SL 1JGDB 4U7SA 3LCYA 3DGGA 4Y5XB 1FO0L 1T7VA 3RIFK 3EIFA 1FNGB 3BSZH 4GUPA 3BGMB 3QQ4B 4D94A 4MMXC 3CU7A 3RDTA 2QSCL 3OKEB 4ZO6A 4D0BA 3A6CL 3F7QA 4HC1A 3TO4C 1IBGL 2W60A 1U8HB 4X4ME 3R8BB 1WZKA 35C8H 1FC1A 4PJBA 5CJQL 3CZFA 5D1QC 3DUUA 5DJ2B 3B9KD 1KLGB 3ARGA 3OB8A 3H9HA 3PHOB 1KB5H 2AVGA 1NDMB 2EXYD 2Q8BL 4OLXL 1FN4A 3FFCA 2BP3A 3TWCH 4X6BA 1KUMA 2KH2B 3ARFD 1MFDH 2VWEE 4PGBB 4L3EE 5JW5A 2NXYC 5D70H 4WTZG 2PW2B 3O3EA 4YFLI 1YC8A 1OSZB 1CDHA 4HMDA 5J9PB 3OXRA 5E7FA 1AO7B 1BIIA 2ZUTA 3RWCA 5B8CC 4MD5A 2VZ1A 4ZS6D 3H8NA 1NAMH 1IGMH 1P6FA 5F7DB 3IJYA 4KKCD 1WUNT 1T22B 3T0VA 5DMYA 2P47B 4R4NC 1ZHBA 1NGPH 1WBXB 5IJKA 1NC2B 1R3KA 1MHEA 4KHTH 4ZUTB 1YEIH 4DQOL 1UYWH 3GMPB 4X99B 4HIEB 4NPYA 2VOTA 4YPJA 1N5YL 3T65B 1ZAGA 4Z7UE 5J06A 5FGSA 1CFSA 3S37X 3T4AB 4C59B 1I1FB 3MRLA 2V5SA 4X80H 5I18H 1JI2A 2H3NB 1FE8L 1Q9LA 2NPLX 3WNKA 2DM2A 4NSKA 3QUML 4XVTL 4XMPH 5E95B 3BZ4B 4KVNL 5EOQH 2PO6B 3BAEL 1CD1A 1UKSA 4QWWC 1Z9OA 5JIIA 5CJXC 2XT1B 2CLRA 2AJSL 5JORB 3KXFB 4UDUB 5JXEA 3GFUA 3LEXA 1S7XB 4WV1B 5DK0B 4OGYH 3DNKA 3I9GL 3T77B 1JTTA 4AL8L 4F8TA 5DMJB 5F9OH 1MY7A 3UJJL 3HFML 4OAWA 3PL6C 2R0WH 1OQXA 4OGZA 2IFGA 3MOBL 4NUJA 3JVGC 5DWUL 1DJSA 4K8RD 3RVVC 5T1LA 1UKQA 4IRSA 4RQQB 3BX7C 5F9WC 2CO7B 1WCBA 2DLFH 5IVZB 4P2RE 4K3EH 1I3GH 1HH6B 4MVBC 3QIUA 4ZUSA 3V5KA 1VEOA 1RIHL 3CLFH 2AXHA 4I18A 4TTDC 1SJVA 2X4PB 3WXWL 1ADQH 2C1OB 3HN3A 4KZDH 1JPGA 4L4VA 3IF1B 1YPZB 1ROWA 3OQ3B 4G43B 1F3DH 3QDME 2YA0A 1M7IB 3DIFB 3ULUL 3VXQB 4Y88A 3UPRB 2BNUA 1TTGA 1OTUD 4KMTL 1AD9B 3I84A 2GW5A 3V4VH 3C9NA 4ZTPL 1CT8B 4R4FH 5HGDA 3KJ4C 3RWFB 5C7XL 5IJVB 4LSSH 4L8CB 4OGXL 3MNVB 1K2DB 1H8SA 2P8LA 3KDMA 4KQ4L 4OTXL 1C16B 2P7TA 4NQCE 3IFNH 5EIVA 5DJYB 3UEZA 1RZGA 3HAEG 3PV6A 4HKBB 2CQVA 4KHXL 4F57L 3PQYB 2BSED 2BVQA 4PJ9B 3HI1A 5JHLH 3RA7L 4YK4B 1BD2E 2VISA 1BQUA 5EUKA 2KUTA 5IBLC 1TXKA 3SE8H 3LKPB 2YOCA 5JW3L 3ZE0F 4ZAKB 1WFNA 2EECA 1UXWB 5HVFB 2NY4C 3JTTB 5C08B 1DQDH 4LKXA 3U7WH 2Q87A 1XR8A 3FRPG 3DX9A 4LAQL 5B38G 4LSQL 5BS0A 1YN7A 2EO9A 2JTDA 1Q72L 1R3JB 4B7LA 3ZKND 1P7QA 4NNPH 5EA0H 5I76A 2ICEA 4I2XE 5IMLA 4ZPVA 4PRHD 3TO4A 4LHUA 4P48A 3VXSA 1VPOL 1I1AD 3GRWH 2JIXD 2JJWA 2DQTL 2UYLB 2HT3C 2F8OA 4IRJA 1NMAH 4POZD 5FO8B 2GY5A 2YS4A 2QQNL 4X5WB 5JHDD 4WWID 3PGCB 3D85A 2WK2A 1YEDB 5HHOA 3S34H 3SGEH 2ZSWA 3DROA 4LIQE 1T80A 4P3DA 3C2SA 2DTML 3U9PH 4RGOL 3GNML 1JGUL 4LSVH 1FGVH 2VDML 1TCMA 1GZQA 2QADD 1I9JL 1QYGL 1OAUH 1EIBA 3D39E 1DE4B 1KTRL 2F5AH 1J18A 1LHZA 1I8KA 5EFIB 4NM4L 3VFNA 4XBGB 5GRVL 4C58B 1PG7W 4UNTA 4BQ6A 1JPST 1T4KB 5DHVA 5B38B 4O58H 5D71L 4GRWF 3AM8C 2NY3C 4DAGL 3DTXB 3QFJB 5C70A 5HPOA 1RUML 1RIVL 3VMNA 5C92A 4OQTH 3DX6A 1JNHA 2XA8L 1YEHL 1LQVA 2VKXA 3EYOB 2EIBA 4AENA 4OFVA 1S7SB 3W11C 3Q6FA 4K23L 4QYOB 5IFAH 3KYOA 3L3DB 4EI6B 4LQFH 2I24N 5ADOH 1CLZH 2Y7QB 4KKAC 2ZCLH 3WEXA 4GO6B 4NYLA 2P5EB 1OCWH 5F7KC 2QJDA 3ZYZA 3MJ9A 4U49A 1A6WL 5HGHA 4MJ2A 4LSTH 2E7CA 5JO5A 5ICZB 3BEVA 1CGXA 1XF4A 1VGKA 1YN6B 4X7TA 5CJXA 5JUEL 32C2A 1HHKB 1TJGH 4DVBB 5EZOL 2EICA 3VGHA 3MCKB 4P49A 1BQSA 2A83A 3DJ9A 2PR4L 1BEYL 4EIGB 1MCSA 2PYEE 1NUDA 4JR9L 3FMGL 4OB5H 5I73C 1ZLWK 1G0DA 1XH3A 5KVGL 2ICCA 2AXJA 3VXOB 4OKVA 3PL6A 4FABL 3LQZA 2GI7A 4U3XA 1IM9A 1JTOA 1IT9H 5F9JB 3IJSB 2WY3A 2BVPA 1MHHB 4MDIA 4U1SA 1Q94A 3IDXH 5TJWK 4DKEL 1AXTL 1Z5LB 4MVBA 2XZZA 5DHXB 2A77L 1M6OA 4JFXB 4JHZA 3R1GL 2YPLB 4U1KA 5ETUB 3UTOA 4X6FA 5ERWA 1TDQA 4QGTA 1U8MA 1Q9WB 1DN2A 1I4FA 3LRGA 3BXNA 4YZFE 1F58H 5B4MD 5BO1H 4CUCA 1IARB 4U3CA 5JDJA 3O6ML 2FIKB 1ZV5A 2FDBP 2Y36H 4GRMA 5FOJA 5I2IA 3MRGA 1KIRB 4GRLB 1A4KA 1JNNH 3RI5K 1P4BL 3H0TA 1K85A 2FB4L 2A9ML 1RZJH 4MLSA 5C09E 5I1KH 1RZKH 3L5XH 5DS8A 4QTIL 2NY0B 4QHNB 4LPYA 1IC5H 2ZCHH 3TH3T 4PJEE 4UAOC 5BVJA 3HR5B 3LQAH 1MI5A 5DQ9B 4NM8H 9CGTA 1HWHB 3ARPA 3VXRE 1IKFL 3JV6A 1RIUH 5AUMA 5DJAA 4HFUH 3RWJA 3VFOA 3RVWD 4IIQB 3S36L 4MXQD 4KI5E 1XGRA 3HA0A 1BJ8A 2A73A 5TFSH 3BO8A 4Z7QE 5EUOA 4EQ3A 3PP4L 4PRIA 1WK0A 4QF1B 2CDFA 4MB3A 3DVNB 4HF5L 5FDYA 2Q86B 2DMCA 4U1GC 1L7TH 5EIIB 1L4IA 4FQJL 2VH5H 5BS0E 3SDDB 4IMLA 4EDWL 5KTEL 4RGNB 1DLFH 1NC4D 1A22B 4LCUA 5MEND 4ODHL 4FQCL 5CILH 4G8IB 1Q1JL 2AJYH 3MLWH 4C56A 3WFCL 2ZOKA 4Z7VA 3L3IA 4ZXBD 1AR1C 3VE0A 5GZOD 4D3CH 1X7QA 3MV7A 3OXSB 3WIFB 2RCSH 4MA8L 1G6RA 1MFAH 2ESVD 5DMKA 1TZGL 5F3BA 3U7AA 1EHAA 2AP2A 4U1MA 2Q76B 3CFCL 2VZ3A 1A3RH 4PB9L 3S35H 2VLJA 2ARJQ 4WUUE 3F12A 3EO9H 5B39G 3D9AH 1FYTB 4JLRB 3WD5H 3HAEH 4CMHC 2F19H 5FECA 5T3ZL 4NO2B 5IQ9B 3GUTB 2NW2A 2IANA 4O4YH 4YHML 2AI0H 3CMOH 5TGBA 3KYMB 3O6FC 3WHE1 2H32A 4PGCB 4GBXB 5BV7L 4O2CA 3VFVB 1CBVH 4PBWD 3LV3A 3SY0A 4M3JA 1QBLH 3SEPA 1RULH 4NQVB 2GJZB 4Y1AA 1XGPB 1IZJA 3S5LG 3UYOD 3FT4B 5C0IA 2HFGL 1DQLL 4JO3H 1NKOA 4HXAL 1UEMA 2CDEB 1UB5B 3KPRA 3FRUA 2OQJB 3QXWA 2X42A 5SWZA 5DTFB 3DURA 3QG6A 4M7LT 4X9HA 1OB1B 3QZWA 5CBEB 5J6HB 2B5IC 1MLCB 1EGJA 1Y6KR 3HB3C 5B39B 5LAXB 2HA1A 1YJDC 2BVOA 3OAUH 5D7SL 1RMFH 4Z5RB 4I0PA 2WIMA 1BPVA 1ORQA 4QHMB 2YD9A 4QOKE 5C0RH 1CF8H 3P4OB 3BPOB 4UNVA 5IV2B 3QHTC 1J1PL 2YC1B 3JTSA 3I75B 4L29A 3STBA 1S9VA 2EDRA 3M17B 3P9MA 4PJXB 5D7LD 2H2SC 2HP4A 3KPNB 3H7LA 3WN5C 4YDIL 3C5JA 1A6TA 4K3GA 2ENSA 4PRBA 4MXWH 4Y16D 3T2NL 3QNXB 1U3HB 4QRRE 3DYMA 4NHCL 5CZXC 4P2RB 5DFVD 4LSDA 3KLHD 2X70A 2A1WH 4DJMA 1E4KA 4OZHF 4D9LH 4PDCE 5JDSB 1LEIB 3HC0A 2YD4A 1T0MA 3ZTJH 1W72H 3BYTA 1YA5A 3JV5A 3VFSB 4PJHA 5MHSE 1A7RL 2DMBA 3PWPD 4NNXB 1AGCB 1NEUA 3V6FB 3NAAL 3QDMB 2AJZB 1NCCL 3QRFM 1KF9B 4G6JH 3ZTNL 1PX3A 3IJHB 3PHSA 1IJ9A 4LDOB 4BQCA 1FYHB 1T2QH 2GT9B 4FQ1H 1S7WB 5MI0C 1K4CB 4K2UL 5A2LH 2YMXL 4TUKL 4X6DB 3X13B 1QFWL 3T0ED 4U1IA 4E5XA 4MB5A 3MGTA 1K6QH 4ODVL 2PNDA 1SHMA 4NQCB 3DRTA 5IKCB 5GZND 1C5DA 2GEEA 2C4FU 3PWNB 3TPUA 5E4EC 5K9JH 1QQDA 2A9NL 5M95B 1EEYB 2FGWL 5F1SA 4PIRF 1IQWL 1YEKL 2VZVA 4G42B 5EOTA 3VG9C 3TESA 4W6XB 4RBPK 3RPIA 1M05A 1T04A 4PJFA 3U0TA 2OR9H 4NWUH 1HNFA 2AK4B 5L2KA 2B7DT 3V0WH 2EH8L 1FO0A 2G60H 1Q38A 3B9KC 5IM7B 4JCLA 4BSVB 3QIWB 3KPQB 4N0UA 4S2SB 3CFDB 3O4OB 5EUOE 2EXYC 3QDJA 3DGGB 4H1LA 5CKAA 3MJ7A 2B4CL 4GUPB 3RDTB 1UWGH 1B4JL 2OK0L 4FFVD 3ARFC 4D0BB 4RDQF 1OP9A 3RBSA 3GEWB 2W60B 4TOYL 1LO4L 1CTNA 4C56E 3JV0A 1MCIA 4PJBB 5DRXA 3CZFB 4K7PY 1CFTA 3DUUB 3N1FC 3ARGB 3WDHA 4P2YA 3H9HB 1U91A 4HQQL 1WVZA 8FABA 4YXHL 4M7KH 2DIJA 4XPTL 1FN4B 3FFCB 1U0QA 4KKCC 3ORJA 4X6BB 3FB7A 5E94A 5CHNA 4KY1H 5JW5B 4LVEA 2JJTA 2OTUA 3O3EB 4GXVH 5GGSY 4JB9L 5EOCJ 2VLJE 4P23C 4K94C 3OXRB 3DSFH 1BIIB 1MCWW 3RWCB 5D6CA 4MD5B 2JCCA 4NCC2 1KT2A 3RIFF 1RJYA 4PJCF 3O6FA 3IJYB 3DX7A 2Y6SD 3S36X 3NABH 1ZHBB 4GOSA 1R3KB 3U48A 1MHEB 2E27L 3SDAA 4KJYA 3AS1A 4XCCH 1HCVA 1PKQA 1GXEA 4Z7OE 4NPYB 4YBLB 4TN9A 2DI9A 3DX8A 2UWEF 2WWKT 2WWMC 1CFSB 4NO3A 4HPOH 1OARH 4TRPL 3HUJF 3MRLB 3REVA 4AZ8A 2GAZA 4PRDA 2VXQL 1FNLA 3NCFB 1Q9LB 5EPMB 4Z7WA 1KEML 4NSKB 2DQGH 3BPLB 1JGLH 1BFTA 1MAJA 1F13A 5F71A 3GO1H 1XF2A 3ZDYE 4LCIH 2CLRB 3MRHA 2RR3A 1EK3A 3QXAA 4IRZL 1UH3A 4KTDH 3LEXB 4P5TA 4JEGB 2DN7A 3BDYH 1XT5A 3SDYL 1R3LA 4OAWB 3OKDA 2E7BA 1JNJA 3T04D 2XN9A 3K4DA 3WE6A 3VW3L 1YEJH 5CGYD 5DVMA 1QTYT 5F70A 5FUOL 3SJVE 3WN5A 4NUJB 3TT1H 5T1LB 4HS8L 4IRSB 4X98A 5HDQL 2VITA 1KEGL 4R2GB 1WCBB 3HG1A 3IS0X 3N9GH 5GRJH 4D8PA 1QSFA 3QIUB 4ZUSB 3V5KB 4NQSA 2V2XA 4I18B 3NACH 1JPGB 2ZP0T 4OLZL 2DTSA 1QOKA 5DURD 4KK9C 2DICA 2IPUK 1KTKE 3OF6D 3ULVH 4PP1D 5DJ8A 3CUPA 5EO9A 2BNUB 4PTUA 5JXAL 2EH7H 2LE9A 3HLAA 5K9QI 3C9NB 5HGDB 1I3VA 5KOVC 3D2UD 2P8LB 3KDMB 3U79A 2P7TB 3I6GA 4GKZA 3BD3A 1IC7L 1RZGB 5DJDA 3FN0H 1HK6A 3PV6B 2DQEH 1J87A 4PG9A 2BVQB 1G9ML 4O5LL 1KLFA 3HI1B 3SGKA 3VXUD 1A6AA 5EUKB 5FYLD 1R24A 1F3JA 4PJFE 4LGPB 4AEHL 2VLRD 5IHLB 1I1AC 3IFLL 1A7OH 3L3KA 3VD9A 4N0FA 4IMKA 5CP3A 1OPGL 1HCFX 4ZUWA 4MNQE 4POZC 4LKXB 4OUUA 4LAJH 4W6WB 4Y5VC 1XR8B 3QEQD 5IGXL 3H3PH 2XV6B 2OSLA 5L7XH 1GGCH 1BOGA 5BS0B 1HNGA 1YN7B 2EZ0D 4GFTB 1P7QB 5FCSH 3D25A 5I76B 3QPXH 5EU6E 5IMLB 1F4YL 4ZPVB 4FQIL 3MMEA 3TO4B 4LHUB 3VXSB 5IMKA 2QADC 1KXVC 1WT5A 2GJ6E 4JFEE 3O45A 4IRJB 3ZKXC 1S7UA 3D85B 4HC1H 5KVDL 1GGYA 5EBMA 5HHOB 2HH0H 5ELIA 2OP4H 2DRUA 2ZSWB 3DROB 4P3DB 3W0WA 3EKCA 4YDJB 4ZNCD 4XNYL 1UWEH 2VB5A 1NANI 2IQAA 5F7UA 1BMGA 2V5RA 1GZQB 2YK1H 4QXUH 1QO3A 4P23A 4CVUA 2HKHH 3L6FA 5GIRA 5DFTA 1I8KB 4X7SL 1ITBB 2HTLC 5FYJH 3VFNB 4G7YL 1QPPA 2JCCE 1JN6A 4J1UA 3DO3A 2P8PA 5DHVB 3CSPA 3MOAH 4F58L 1JHTA 5JA8B 2NXZB 1EDQA 3HC4L 5CCKH 4JM4H 1O0VA 3DX6B 1JNHB 5FA3A 4NC2B 2FR4A 2AJUH 2DYPD 4YGAB 4YHYC 2D03H 4HPYH 1S7RA 4AENB 1L7IL 2EIEA 3AREA 2B8OT 2F54E 3K2UH 3QISA 3Q6FB 2JK5A 3KLAA 4K3JL 1KCUL 5D7JB 3KYOB 3ZT5A 4HDIA 4NQXA 4U6HA 3WEXB 4NYLB 2NY1C 4TNVK 1UM5L 4Z7WE 2L0DA 3LZFH 4Y7MA 3EJZD 3F8UB 3RVXD 3PV7A 1DQMH 3VXMD 5HGHB 1VFMA 3K7UA 5IESL 5JQ6H 5JO5B 2VUOA 4OSUL 3BEVB 4ERSH 1HKLH 1I7UA 1KGCE 3HPLA 1XF4B 3KS0J 1D5BA 1VGKB 4NC1C 1AP2A 4X7TB 32C2B 4BM7A 2XPGA 2A83B 3NCCB 4MD4A 3CLEL 4UINH 1HN1A 5E2UH 3SCMC 1XH3B 1YY9D 4QY8A 5KS9E 2Q8AH 1EHLL 4OKVB 4CN6A 1Q9OA 5AG8A 3JWOL 3CC5A 3PL6B 5JOPD 3LQZB 3NIGE 2EYTA 1IM9B 3NIFE 1A1OA 3DVGA 2BVPB 3TEUA 3P0VH 4MDIB 5E8DL 3N85L 2PUQT 4U1SB 4QRUA 5KAQG 3KPMA 4PJGF 1ZLSL 1Q94B 4EIZC 4G8FA 1A7PL 2QSQA 2OCFD 1EA9C 2YPVL 3MLXL 3TP4A 1Q9KA 4URTB 5KJRL 1M6OB 5DDHA 3C60D 1KLUA 4OF7A 4U1KB 1VB9A 3VRJA 5ERWB 1T2XA 3DLQR 1U8MB 2NY5H 4N68A 1I4FB 3ULUE 2ERJB 3BXNB 5DXWA 3GKWH 4DUWA 1IAII 1P7KA 2APBA 2CDGA 5I1CH 3LS4H 2R0KL 4D0DA 3QEGH 4GRMB 2FEEL 4ELME 4YDKH 5I2IB 3MRGB 2V7NB 2QHRH 2XTJE 3FN9A 4OLYH 1FFPA 3H9SD 4OZ4A 4R0LC 1A4KB 1OM3L 1QLEH 3H0TB 1H3GA 4PYHA 5CFHA 3ZL4L 4PBXA 2C3VA 3F58L 2DLHA 5EWIL 3RVWC 4MXQC 5DS8B 3PGDA 4XCNA 1Z0NA 3ARRA 4WI9A 5BVJB 2R29L 1MI5B 1KG0A 1D5IH 1WAAE 1OQOA 1QHPA 5J11C 4R3SA 1QFWI 3JV6B 4IJ3C 1MIEH 4IOIA 4QHLA 4XCEA 5AUMB 3HTLX 5HYJA 4Y2DA 4PRHA 3RWJB 4ORGA 4I8DA 1X4XA 2B4CC 4ZXBC 3S98A 1XGRB 3QPQD 4U6TA 2WP3O 3X12A 2H26A 2A73B 3BO8B 1BAFH 1X5XA 5EUOB 3OTTA 3GI8H 3PDGA 4Y5VA 2CDFB 4DN4L 3RI5F 3BT2H 5E6IA 4JFDD 1C5CH 4IMLB 1J1XH 2FX7H 3ILQD 2WBJD 4LCUB 2R8SH 4YX2L 1E4WH 4C56B 2ZOKB 3I02A 4Z7VB 3L3IB 5K59F 1OWRM 2HRPH 5J8OA 3EDJA 5BOZG 1ED3A 3OX8A 3VE0B 5FUCC 4GQ9H 1Y6MR 2BERA 1X7QB 3MV7B 5KSAD 3MLYH 1CVRA 4XPBH 3VRLF 5CEZL 3BW9A 4ONGH 1IQDA 1MAKA 5DMKB 5F3BB 5JPMA 3NCJL 3U4AA 3VGBA 4U1MB 3GBMH 5HYIA 3QZWG 4Y4FC 4KQ3H 2VLJB 5I9QC 3BGAA 3F12B 4KU1A 2A74A 2EDOA 4NZUL 5FECB 2IFFH 2VDQL 4YO0A 2NW2B 4PJIF 4LLAA 5TGBB 3KJ6H 2A6DA 1TPXB 2H32B 2Z31B 3RUGF 5E8PA 4ZFOL 2JJVA 5I1GH 3VI3E 3PXHA 4YGVA 5F7MC 1OTTD 4O2CB 3BKYH 3H9ZA 3LV3B 1UACL 4RMQA 2H45A 1MIMH 1TETL 3VD4A 4JFFD 1BF8A 3EFFA 5HGBA 4BH8A 4PTTB 1EBPA 1X5YA 5DHVH 2NQCA 3MV8A 4EOWH 4DGVL 2VRAA 5C0IB 5CAYB 2VDPH 4UOW0 2IPTH 3KPRB 3FRUB 1Z0MA 4NQDE 3B83A 5SWZB 4WW2C 5E03A 2FO4A 1EBAA 3DURB 1LP9A 3QG6B 2I9TA 1ORSA 4KC3B 2VDRL 2Y72A 3QZWB 5E2TL 2R4SL 4UQ3A 4LGSB 3MV01 5GS2H 1I85C 2BVOB 3UDWC 3P4MA 1CL7L 4Y16C 3OPZH 4I0PB 5CGMA 1KV3A 4HLJA 4O00A 1ORQB 4A2MA 4XAKE 5HDLA 4FQHA 2FD6H 5DFVC 4G6KL 3KLHC 3HC3H 2Y25A 3RX7A 4HBQA 3BUTA 3JTSB 3IFOA 1S9VB 5L2JA 3P9MB 1CLCA 3TV3H 4A6YL 3SCMA 1ZA6A 4D9RD 3C5JB 1A6TB 2Z93A 4PRBB 1FVDA 5F7FA 1DL7L 2X70B 5CZKA 1MFCL 5TDOA 4FZ8L 3HC0B 3NA4A 3B43A 1T0MB 1PSKL 3VFTA 4JN2A 3BDXA 4I3SL 2VLKE 4JY4A 5ITBL 4PJHB 2E9BA 4I77L 3HRZA 4ALAL 2D4DA 1RURH 3DMMD 4NBXB 3QDGE 4H1LG 1NMBH 4Z95H 3FJTA 4JO2H 1WEJH 3ULVE 4M1DL 4ODSL 5L6YH 4Z7UF 1JK8A 3F7YA 4R0LA 3GSVA 3CJJA 4WI4A 5LBSH 4GKNA 4U1IB 5CINH 4E5XB 3AUVA 3MGTB 4RNRA 1EJOH 3DRTB 4OCXL 4PD4J 1J0JA 1C5DB 4DKFH 2AS5M 1MSPA 1MFEH 1QLRA 3TPUB 2ICWI 1QQDB 3HZKA 5I15L 1I7RA 4UAOB 3G6DL 4CAGA 4JN1L 5EOTB 4M5ZH 1UZ6F 1HOCA 3RPIB 1M05B 1T04B 1HIMH 4PJFB 3U0TB 1P6AB 1SVCP 5E24E 5L2KB 5KSVA 2W9DL 4KK5D 3GHEH 5C0CA 1AHWC 5L9DH 1FO0B 3M45A 4Y19E 4JO4L 3HI6H 4JRXE 2YRPA 1QKZL 2YEZA 4P46D 5DJ6A 3TH2T 4UTBL 4KVCL 1O7SA 4WEBL 2ZUQC 3QDJB 4H1LB 3MJ7B 5IHBA 3ELAT 3V79C 4M48H 2ESVA 4U1GB 5HVHC 2CJUH 3TM6A 4NFDA 1XGUA 3B9AA 4HKXA 4PY7A 4XZUA 3EOBA 2QQLL 1RK1A 4U6VL 1CFTB 3DVFA 3QHZH 1U91B 8FABB 1RVFH 1MQKH 2Y6SC 5I74C 3MLRL 4BZ1L 3CVIL 4HK0A 4JQXC 4OCYL 1FAIH 3FB7B 5GXBB 3E2HC 1IMHC 5E94B 5CHNB 4EBQL 4Y4FA 1G6RH 5IQ7L 2OTUB 3E3QC 4CMHB 1ZLVK 1NFIA 4GAFB 1EVTC 5D6CB 2JCCB 5T3XE 1AY1H 1KT2B 1RJYB 1AO7D 4I3RH 3O6FB 4YXKL 3WIHH 3DX7B 4TSCL 4MA1C 5LGJA 2VZSA 3PDOA 3HPJA 1B4RA 3WFDL 3SDAB 4KJYB 4YNYA 5TPWH 3Q6GL 4WFHD 1NC2D 1TTFA 1ZT7A 1PKQB 3MODH 3FQTA 2V2WA 2CUMA 4I9WD 4NWTL 4RA3A 3P2TA 3DX8B 1BREA 1G9NL 2FIRT 1LDPL 4NO3B 3MV8E 4X9BA 5CD3A 5DA4A 3A67L 2D9QB 1J11A 2OZ4L 1BQLH 4PY8I 1LK3L 3REVB 2GAZB 3BIAX 4PRDB 4R8WL 4WW2A 1P4IH 5KSBE 2X4NA 4Z7WB 4MLIA 5D7IA 3EZJB 1A6VL 3MLVH 4RFNC 1RUKH 2B5IB 2DQUL 4JZOA 2LAGB 4LASL 2NZ9D 5D7LA 1F6LL 3EYFA 4PJAF 1R0AH 3EJJX 5E70A 3VFGL 2MMXA 5CBAA 1XF2B 1I85A 3UDWA 1NBVL 2PO6D 3ARYA 3MRHB 3QXAB 1R5WA 4ZD3H 3IVKA 1JRHL 1J0KA 3LMJL 4P5TB 2X4TA 5FUZL 3KXFD 1PQZA 3MXVH 4P3WA 5EB9A 1RY7B 4M6NL 5KS9B 1R3LB 3C6LA 3HCVA 3RTQA 1C5BL 3OKDB 4OD3L 4OLVH 2XN9B 3WE6B 1T5XA 2VN4A 3MYZA 4G9FA 2R69H 5IFHH 3WN5B 1MJ8H 1CZ8L 2YD5A 3U30C 3X17A 5AWNH 4JQIL 4XT1C 2VITB 1ODAA 1RJZA 1MFNA 3WFBH 2PCPA 3HG1B 4JKKA 5L8KB 4D8PB 1NCWL 1QSFB 4NQSB 4AYFA 2YXMA 4BQ8A 2V2XB 4OLWH 3MBEC 5CJ8A 4PRPE 3D18A 4UT6L 2ICWA 3JUYA 5SX4H 4HIJA 4OFPA 3OWEA 5GJSL 4TVPE 3U0WH 4TUOA 3GHBH 5DJ8B 2X44D 3CUPB 3P30H 1NGXA 5EO9B 4OF0A 4OCRH 4PTUB 3MLSL 4X7CC 3HLAB 2N7AA 3EZ8A 4GJTB 1UADC 5ENWA 5FCUL 4PUBH 3KG5A 4FS0A 3SKUD 3UTQA 2B2XL 1F90L 2QSTA 1FLRH 3W9DA 2WQRA 5TDPA 3I6GB 4GKZB 4U4BA 1BGXL 5BRZE 5E5UB 5DJDB 4XP5H 1FG9C 5J6GA 3O4LE 4PG9B 4QHKJ 2EZ0C 2UZXB 5JZ7D 1D6VL 3GSRA 3S96A 1MRCL 3PQYD 3QG7L 3QCVH 4PJ9D 5DMIL 1A6AB 3PP3H 3VG9B 1R24B 3EOYG 2LTQC 1UB6B 4G5ZH 3L3KB 2UVFA 4N0FB 4NRYA 5HY9A 1IILE 3PHQA 1AHWA 4ZUWB 4OUUB 2VDLL 4ZAKD 1JWMA 1LD9A 5C08D 1X4ZA 2EC9U 2OSLB 3GK8H 3T3ME 2ZJSH 4RRPA 3D25B 2NW3A 4P2QA 3MMEB 1W8NA 1P84J 5IMKB 5D2NE 1IBGH 2WANA 3U83A 3O45B 2GFBB 1S7UB 1EUTA 5D5ME 5EBMB 3CK0H 3OJ2C 1AC0A 1F4XL 4OZIF 3EDFA 3W0WB 3L7EA 3EUUA 4JM2F 4JQXA 2HFFA 3NPZB 2F53A 4KUZL 1GYAA 1H3PL 2IQAB 3BKCH 3NZ8A 3FQNA 1DEDA 4U31A 2WNGA 3EYUL 3MLZL 3EYSL 5ICXA 1QO3B 4P23B 5GIRB 3L6FB 2IPKA 5IWLC 4NQEE 1E6JL 5E7BA 3ARDC 1NAKL 1GGIL 1JN6B 2X4QA 4J1UB 1INEL 4R90L 2P8PB 1JHTB 4MD0A 1MHPL 4YH6A 1BBDH 4XX1G 2FR4B 4HJJL 3QFJD 5FA3B 3EJZC 1ZMYA 1DLHA 4PJEF 1S7RB 1WFOA 3AREB 1V7MH 1IE5A 4UIKL 5K9QG 2JK5B 3KLAB 1KCSH 2CKBA 1MEXL 1BZ7A 4NT6A 3KPSA 2D7PA 4OKDA 4HDIB 4NQXB 3V8OA 3GBNL 4U6HB 1AH1A 2BNQE 4KI5F 1D6EA 5FV1L 2VXTL 1CK0H 1I1YA 5DD6A 4Z7QF 5EZIL 1KNOA 2BOCA 4E0RA 1CWVA 2BNRA 3N1MC 5JPNA 3BAEH 2MWCA 3K3QA 2E3VA 1I7UB 3HPLB 1RZFH 1D5BB 2BRRH 1AP2B 2FX9H 4NUGL 3SN6N 2IH3A 5DMGC 5GGUA 2XPGB 2CSPA 3I50H 1YJDH 1OP3K 1SYVA 4MD4B 3VGGA 4X8XA 5GGVY 3MA9H 4QY8B 3EOAA 1Q9OB 3UJJH 2UY6A 3CC5B 3HFMH 2DJ4A 2KL6A 2EYTB 3H7BA 1CL7I 1A1OB 3DVGB 3IGAA 4G9FE 3MOBH 4XI5D 4QRPA 5IVNA 4QRUB 4OIIH 3KPMB 4TNVF 1SM3L 2DQHH 4G8FB 1JMXA 1NCNA 1ZLUH 4BK5A 1Q9KB 5AZ2H 3E0GA 1Z2KA 2FZ3A 3D5OF 4DEPC 1T66D 5DDHB 1JHKL 1KLUB 4OD1L 2MJWA 3VRJB 1EFXA 3Q5TA 4UTAH 3MBEA 3ISWA 2YPLD 1JZ8A 3D2UA 1EZVX 3LPWA 4PPTA 1P7KB 2CDGB 4KKBD 1MHCA 4HUUA 4NP4L 4XPFL 1TITA 4D0DB 1HH9A 4NFCA 1OOAA 4X7DC 2XZQL 4W68A 1FFPB 4OZ4B 1ZGLP 4J6RL 5D7KD 4NRXA 1E27B 1B2WL 5F44A 4GRLD 2C3VB 4DGIL 3QFDA 2E5EA 1KC5L 4LSUL 5HHVH 3QXDA 2GSGA 4DK6A 3PABA 3H6JA 4XGZA 4MQ7A 3QPQC 1FLTX 3FFDA 3PGDB 4XCNB 2WMPA 3RU8L 4YHLL 4PGEA 3WNOA 4GAJH 2NY0D 1QSEA 5J1AA 1EO8L 4WFFD 1KG0B 3FCTA 4F57H 3D3VA 1V3MA 1D5MA 4R3SB 4IOIB 2ID5A 4XCEB 3EHBC 2A38A 3W2DH 4Y2DB 2K7PA 5E56A 4ZYKA 5F7HA 4ORGB 3UTTE 5HYJB 2O5ZH 4Q6YA 5C1MB 3ZT6A 2Q1EA 3X12B 1LO3L 2H26B 5KSAC 4U0QB 1XEDA 4Y5VB 1L0XA 4LSQH 5E6IB 4PJ5A 2GY7B 2GQHA 4KAQL 1KN2L 3NCMA 3UAJC 4P2QE 3SDDD 4RGND 3I3BA 1N4XH 2OL3H 4WI2A 3I02B 5SWSA 1N6QL 4NZJA 4W4NA 5DD1H 1ED3B 2A2QT 3OX8B 1AJ7L 1HSBA 3CU1A 4L1HA 4QNPE 3BW9B 5FGRA 1IQDB 2R0LH 1YQVH 5JPMB 5KSUA 2FEDD 1OTTC 2B1AL 3IXTA 1ZEAL 5FYKL 3ECBA 5ILTH 4LHJB 3IU3A 1CXHA 3GNMH 4RISL 3TIEA 2A74B 3RNQA 4DFHA 1BFOA 2CMRL 2DLTA 2ZUXA 1QYGH 4YO0B 4ZFOA 5BV7B 1FYTD 2D7OA 2A6DB 2P5WA 3ARDA 5E8PB 4YGVB 3QIBA 2DS4A 2E8YA 4GAGL 3BH9A 4G3YH 4K94H 5DVOA 4GBXD 3WFZA 3UTSE 1DBBL 1BVLA 1CGVA 4G7VL 4EXPX 1S78D 5HGBB 5TQ2H 4H8WC 5ID0A 2XA8H 2E7LC 3MV8B 2VKWA 1BJ1H 2WQ8A 5DEGA 3PXJA 3TA3A 2FRGP 2FO4B 1S5IL 2FJFA 2PW1A 4JPWL 1LP9B 2I9TB 2NY1B 1ORSB 3X3FH 3W81A 1ZHKA 3CFJA 1KTDA 1FBIH 1U3JA 3O41A 4UQ3B 3T0AA 5GGRA 4J23A 1WWBX 4ZSOA 3PJSB 5GGTL 5D6DA 1DBAL 2APFA 3P4MB 1OW0A 4O02L 4K3HA 4G6AD 3TBYA 4FQHB 3QRGL 4A6YA 5JTWA 1N64H 1EEUA 4HJ0D 1H3UA 3IFOB 1ERNA 5L2JB 5FM8A 4K8RH 3RVTC 3UZEA 4M7JH 2NYYC 3IKCA 5FGCE 3SCMB 4JO1L 1ZA6B 2VLLA 5HHNA 5KVGH 3KLSA 5EULV 3DMMC 4FXGA 2Z93B 4NZRL 4FABH 5BW7C 3CD4A 3OAZH 1P5VA 2VZUA 2AJXH 3FO2A 1G7LA 4I1NB 1JRHI 1FVDB 2C9AA 4XNUL 1U3HD 5TDOB 1QFOA 3P11H 4P2RD 3D1MC 2E6JA 5FXCH 4XNMA 4HUVA 3H9SA 3VFTB 4JN2B 2VC2L 2K7QA 4JY4B 2A77H 1MCJA 3V4UL 1KB9J 4RAVA 4PLKD 3HRZB 3WLBB 1RZ8A 1I3UA 3QHFL 4ETQA 4YWGL 1LDSA 2GYSA 1DQQA 4ZFGH 4GRWE 3QDMD 5IB2A 1R3HA