3TBWA

Crystal structure of the murine class i major histocompatibility complex h-2db in complex with the lcmv-derived gp33 altered peptide ligand (a2g, v3p, y4s)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
274
structure length
274
Chain Sequence
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAPWMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSGCDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQSGAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/agonist
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Conversion of a T cell viral antagonist into an agonist through higher stabilization and conserved molecular mimicry: Implications for TCR recognition
rcsb
source organism Mus musculus
total genus 63
structure length 274
sequence length 274
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tbwA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tbwA01
4TTDD 4P59L 3V4UH 4K7PX 4NPYA 2JCCE 3WKML 4S10A 4AG4H 3MNZB 2YUWA 3DUUB 3KJ4B 4R0LA 1QRNE 3SCMA 1NFKA 3WFDH 3MLTA 5EUKA 4U3XA 2OZ4A 5HYFA 1ZSDB 4OCYH 3PABA 3TH4T 3GMLB 4YIQA 3WJLA 1MFBL 4X9HA 5ACLA 4NGHH 2JJTC 3E8UH 3GMRB 4PV9B 5L2KD 5LQBL 1T22B 5HY9A 1RVFH 3ELAT 4N0YH 4NQVA 4POZC 3U0TB 1X6NA 3HUJB 5DUBB 2CDEA 2DI9A 4XP6H 2APXA 4MJIA 4XNXL 3V95A 5F9WB 1IC5L 1S5HA 1TNMA 4MQTB 4EOWH 3HI1B 2OTPA 5IESL 1ZVYA 3KLDA 2ICWI 3EKCA 4H8WL 5EBLA 4Y16D 3RWEA 1A9BB 3KWWA 3MRCA 3PHOB 1LE5B 4RISL 5JOPE 4XVSH 1RURL 4RQQB 1N3NB 4LSSH 3ZTNL 1H15B 3VJ6B 3MXWH 3OG4B 4XB8A 4GRLD 4U6TA 3GRWL 1UWEH 2V9RA 4GG8B 5F7KC 5HD8C 4KI5C 1HXYB 4NT6A 1I9EA 1R24A 2Z31C 1S78D 4PREB 4E9LA 1E4WH 1MWAA 4CNIA 2RAMA 4E5XB 4WO4B 3TIDA 1EAPA 2EH8H 2IANE 2W0KA 1JNJA 4R8WH 3SE3A 3BPOC 2HMID 3DVFA 4QHLA 4LIQH 3RI5F 3I6GA 4OBRA 1OY3B 4IHOA 3DXAB 5ALBH 3L3JA 1VSCA 4QY8A 4UTBL 5FUZH 4MCZB 3V5HA 3CIQA 3GK8L 2PTVA 4WHDA 2ZCKH 1T21A 2Q7YB 2ZNXA 3ZE1E 4WI3A 3SKOA 2F19H 2L7UA 1GXEA 3ZKXB 1JWUB 3BP7A 4OFKA 2X41A 4G6FD 2AJUL 3P30L 3GM0A 3BDXA 5I8EA 3MTRA 3NABL 5IVXB 2ED7A 1X5LA 1RUQH 3O6FB 4OF7A 4EI5D 3OL2A 5ESAB 4LEXL 1Q9KB 4PJDE 3VXNB 3GBNH 1HYSD 2DMBA 4KJQC 3UBXI 3VW3L 1MCIA 2PXYC 2BVQB 4C56E 1A7OH 3ALPA 4JANB 3C5ZC 1SM3H 5FKPB 2C4FT 2YPKB 2ZPKH 1I7RB 2MQ3A 4ODXB 4RGNB 4OZHE 4XC1L 5HGHA 3VWKA 5JW4R 5DJZA 1NCBH 3IDUA 4IOFD 4RMQA 3UTZB 4F7MA 5ICYA 3LEXB 2F5BL 4JEGB 3WUWB 4OCSH 5AEAA 3TYGH 5GGQL 1FIGH 4KY1L 2VJXA 3U36A 3HFML 2C9AA 3LRSB 3EDJA 1OW0C 3ARQA 4M48H 2VXQL 3NA9L 4RMVA 4OAWA 3LCYA 3MYZA 1QFOA 1NAMH 4HV8B 5B39A 1XCQA 4XCCL 4G6MH 1HZHL 3VGHA 5IV2A 4OCRH 3P4NA 1GGBL 1TENA 1KELH 2VC2L 1K4CB 1MFAL 1N0LA 1MEXH 1NUFA 4NN7B 3REWB 3S4SB 3REVA 3G6JB 4G8FB 3L5HA 2HLFD 4G3YH 3WIHA 2XKUA 2NLJB 1DLFL 4PLJD 5GJTH 2VH5L 3BOVA 5E70A 5CLWA 4NUGH 2UWEF 4LCUA 3X17A 3B2UC 4KKBD 4G6JL 3G9AB 3LMJH 3C6SB 2CRYA 1URLA 1MCOH 1S7RB 4WFED 1KLGA 3EIFA 3UO1L 3FKUS 1AC6A 3OPZH 5C6TL 4HC1L 4S11A 1WLHA 1ZHNB 1MJUL 2EDYA 1P2CB 5KSUB 1MI5D 1T2QH 1DZBA 1UXWB 4M7JH 3W81A 4XMKL 5IMLA 4ZS7H 3I6LE 4RGMB 3Q6FA 3JVGC 3U7YL 2M8XA 1D9KD 4JFOB 1I4FA 3GSRB 5I0DA 4H25B 2YEZB 3SDCD 3NCCB 2EKSA 3TNMA 1J0ZA 4N9OB 3UTSD 5TDNB 1G7PA 3KYKH 3Q3GA 3M45A 3SO3B 3P4MA 3RIFF 3IAQA 1BM3H 1S7XA 3UDWC 3JTSA 4HPOL 3SDXF 4DFIA 3CSPA 2A74A 1KJ2L 1MHHA 4TN9A 4PGBB 3RU8L 1J0HA 4YUEL 4D3CH 3QJHA 4NQXB 1J88A 3WD5H 3X3FL 2YPLA 1F4XL 3LVEA 5T5FL 1X9QA 5E8NA 3PQYE 4FQXD 5H2BA 4U0QB 4QRQB 1WJ3A 3EYVA 3O0RL 4GKNA 3TT3L 1PX3A 1MHPL 1CICA 1CLOL 1H8NA 2OTUB 1OTUD 1WITA 3O3BB 4KTDL 3S3SA 1R3IH 4P4KA 3S88H 5GS1B 4MZ3A 1T7XA 2QSTA 3ZT5A 3B4NA 1TVHA 4KK9D 3H2WA 4NWUL 4HUNB 4OCYL 4P2OD 3B9KD 4RIRA 3QNYB 4NQDA 4I0PB 5CUSH 4NGHL 3U1SH 4XNMB 4R2GB 2QSCL 3X11B 4TQEH 5L9DL 2Z8VC 3H9SA 3BQUB 2J6EA 3IKCB 4G42B 4PJAF 5FHAH 2Q76B 1SYVA 2WIMA 4Q9RH 4WI7A 1TZHB 4JZOA 4XWOD 3BDYL 4YXHL 4QOKD 1S7SB 1IAIM 3MJ7B 3SPVB 1T1YA 5I8CA 5D7IB 1PEZA 2WUBH 4DKDC 4W6XB 3U46A 4WY7L 2XZQH 3OAZK 5FK9A 2ITCA 3DV6B 1BF8A 4OZIE 1OAQL 4HWEH 4OLYL 5JQ6H 3F5WA 2P47B 3R06A 3F7PC 2XI9A 1IFHH 1KJMA 3PGDB 2GFBA 1KN4H 5DUML 5DJ0A 4FQQB 2E9WA 4N8VB 1JV5B 5DR5L 2GK0A 5DC0A 1CLZH 3SE4C 1AQDA 1UYWL 1GGYA 4PIRF 1ES0A 1CF8H 4FG6D 3DX7A 3LEYH 4R9HA 4KUZL 1M7XA 4QXUL 3QISA 4RAHA 1NDMB 2ZG2A 1ZLVK 3V9FA 5JW3L 4YO0A 3BZEA 4WDIB 4ZNEE 4JFXB 3ZKMC 4KRLB 4KI5E 5C09B 5J4MA 2EH8L 3HG1D 1JGDB 3NTCL 1CLYH 2CDFA 3T1FA 4UV4H 3PXJA 1OGAB 4APQA 4QT5A 3O4LB 1FZKA 4KJYB 1HCFX 4Z7NF 3IGAB 4MNHA 3LPFA 4N0CC 2P8LB 3C60A 2ZCKL 1LP9B 2VDML 5I76A 3JUYA 1BQLH 1UADC 2F19L 3T08A 4JGUA 2DJ4A 4XVJL 1ZTXH 2EEDA 1FL3A 2PF6A 2R4SH 2GJ6E 3MBEC 1Z5LB 1B3JA 1JPSH 2YXFA 3CDGA 3GBLA 1K4DA 1BBDL 2XG4A 4DWHA 2ZUQB 4U1HA 4R26H 3HB3C 1AD0B 1R5WA 1RJZA 2VN4A 5C6PB 3HZYB 3ZTJH 3O81A 4AT6B 4D0BB 1LD9B 3QUYD 1A7OL 1MF2L 3CU1A 3ROLA 4YK4C 2B5IB 1NLDH 1FE8H 1Z9LA 1DUYA 1UGNA 4KMLB 5IMKB 2ZPKL 1TJIH 1TCRA 1MVUA 3NIFF 4S1RL 3DRTA 4YDIH 1GAFH 3TIEB 4O51B 1IGCL 1MCNA 5MI0B 1DVFD 5C1MB 4Y4KC 2AJVL 2ENYA 4NCDA 2DYPA 4F58L 3KR3L 3AS2A 3R1GH 2P8PA 1LO4L 4LSPL 5FYJD 4WI4A 4OLZH 1U8HB 3VXOB 1NFIB 3G9VA 4U6VH 4D8PA 3S37H 1MHCB 4U2YA 3QI9D 4NQEB 4R97C 1U3YA 5FV1L 5IROC 4KK6D 4MJ6A 5ADOH 1MUJA 4XBGB 3RHWF 4OZ4A 4JN2B 1S9WB 3WBDA 1HHKB 4LL9A 2XQBL 1BP3B 5HHME 4LP4A 3A6CH 5FYJU 4LEOA 5A2JH 5KVGH 4HD9A 1M7DA 4MVBA 5DD1H 1X5HA 1EHLL 3VDBA 2KBGA 4R90H 4ZOCA 5IHUL 2Y72A 4JY4B 3GMNA 4ZUSA 2V2TB 2DICA 2FATH 4S0UC 2BX5A 1Z9OA 4P2QE 4Q6IB 5IK3B 5EZIL 5HHPB 2H26A 4PRHE 5C08D 4OQ1A 1AKJB 3OPZL 3PDGA 1NMCB 1JTTA 1T6WA 3TNNA 2XN9D 2QADC 3B3IA 4M00A 3C8DA 4YBLB 4PB9H 1RJYA 3BRFA 3SGDI 2ICWA 3PDDA 5MEPB 3EDDA 5C0AA 4GG6A 4TTDC 4S0TD 5I1DB 1SVCP 4PS4L 4Z8FH 4YXKH 1X5XA 3F65A 2DTML 2CIKA 43CAA 4LRNH 2PNDA 3IYLW 4GAYB 1G6RB 2OMNA 2A1WL 4JREB 3GMQB 2VLMD 3T0VA 2R2CA 5EU6D 1UJ3A 1V7NL 1EUTA 2GI7A 5D1ZD 2B4CH 4JQVA 5E6IB 3U0PB 3C6LD 3UPCA 4YHYB 1BM3L 5KSVB 2F53D 3AREA 2YR3A 4NJ9H 3U2SA 2PTUA 3RRQA 1JYWA 1D5MA 2VXVH 4GW1B 3FQXB 4G8IB 4RNRA 3V5KB 3O8XC 1PKQB 1QYGL 2J5LB 4I77H 2YD1A 3OKLA 4MA8H 4WO4D 5F6HI 1N6QL 3UZEA 2OP4L 4XXDB 1QLFB 2UYLB 3VU2A 4NQSA 4OCMC 2GSGB 4N9GB 5FYLE 1T0MA 4JPIB 3BYTA 2DLIA 1YMMA 4Y16C 4E42A 3QIBB 3OGCA 1D5XA 3KPMB 4TUOB 4HQQL 1JPFA 2BNRE 1GOGA 1ZKAA 2DM7A 3IETA 1R3IL 3QDMD 1M7IB 3CLFH 5CJ5A 1UFUA 4FQIL 3SBWC 3FB7A 5HYSA 2GQHA 3ILPA 1S78C 1ZWIA 1DQLL 3U1SL 5CUSL 2E9IA 1VGEL 5B3JF 2CXGA 3GSNH 1MFNA 2NY3D 2A9ML 3FOLA 4X5WB 2W59A 1KCKA 3KPRE 5F7NC 3D0LB 3QNXB 2C3WA 1FVEB 4X98A 2HMIC 1MFEL 1MFDL 2K7QA 2J1KA 3MV11 5TFSL 1LO0H 3QIUD 4Z0BL 1I3VA 3DRQA 3NAAH 1FNHA 3UTTB 1WIPA 1XGTB 5DMGD 1S7TA 2BY2A 4AZ8A 1XIWA 1CZ8L 4YWGL 1Z2KA 3DV4B 4LAQL 3VXQA 4LDLB 5EOQL 3FFCE 1CFTA 3QHFH 2G60L 3FT2A 3PWPE 2BVYA 2NYYD 1NMBL 1JNHA 5DJCB 3L5WB 1CGUA 3FQTA 4PJ8A 3AC0A 3D85A 3RGHA 1CFSB 4HH9B 4NO5A 4XPFH 3KXFE 1A7BA 4NRZB 4EI5C 3MV7A 1DQJB 2IH3A 1KB9J 4XTRD 3VXUE 3BPCB 1JWSA 1RI8A 2XA3A 4H1LH 5E00B 3RVXC 3QDGA 3QQNA 2Z93B 1T2XA 2XKNA 1I3RA 4K71C 1H3WM 3DSNA 3KHOA 4RMSA 2AQ2A 2GKIA 3D25A 2HJKA 3MUY1 3MLYL 4ZFZB 4GSDH 4IOFC 4JM4H 5DJ8B 1T89C 2VWEC 3WFHA 1JF1B 1GIGH 5FO7A 5TF0A 2X42A 4HBCL 3SGEH 1GC1C 1U2HA 3KPPB 1ZAGA 1FZJA 1M05A 4HIJA 1KT2A 2R29H 1E4JA 1UA6H 1VDGA 2VDPL 1BVLA 3BJ91 4Z0XB 3RVTD 2ZUWA 1XF1A 4X6DF 3KYNB 1RZGA 3DX6B 5FFLA 1CVSC 3IXTB 4DVBA 1OOAA 2P7TB 5K9JH 4WJ5B 15C8L 2H8PA 5C07E 4Y1AA 4FQ2H 4OM1H 2EO9A 3VFWB 3FT4A 3SE8H 3GIZL 1FPTL 1MCQA 3HZMA 1I8KA 2HLFC 5TQ2H 1BWWA 1FE8L 3MRFB 1BAFL 5DYOA 4F7EA 4PLJC 3QSKB 4NM8L 3O3DA 2F15A 3BISA 4Y2DC 3TA3C 1JI1A 3MLRL 4PJEA 4PLKC 4KKBC 3B9AA 1WT5A 4HS8L 3ARVA 1U36A 4V3EB 5FOBB 4PJHB 4Q9BA 1X5ZA 4K7FA 3NZ8B 4JRWA 2OL3A 5ANMA 4E0RA 1DANT 5DGRA 3EFFB 2VLLA 4WUKL 3S9DB 3R1GL 2EYTB 2V2XA 3C09B 4B5EA 5SWSB 2R2BB 3HMWH 3ES6A 3STLA 2X10A 4FP8H 2I26N 2NY1B 3ARGD 3VI4E 3S37L 4QO1A 4M8QB 1U3HA 4RBPH 4WV1A 3KPNA 5GHWH 5M95B 2X4SA 4LCWB 3P9MA 5SWQA 4LSUH 4JFDA 1AO7E 1SEBA 3ETBF 4NRYB 1D9KC 5EU5B 3MREA 4X4ZA 5IHZB 4GXUN 2HFGH 4OFPA 3A6CL 4IRZL 4G80B 4PJGB 5DD1L 4A6YB 3LKRA 3DBXA 5C9KA 5DQJA 4LSVH 5BJTA 2W9DH 1YYLH 4R2GD 4PGCB 4P5KB 2NZ9D 4KTYA 5I1AA 1X5IA 4LHUG 4FOMA 4ZO6A 2CUHA 5F7EH 3M8OL 4Y5YA 5CSZB 2Z91B 4WNQB 2H9GB 3ARBB 5F9OL 2VDNL 1MCFA 1NEZG 3GSXA 3LOWA 5GGVH 4CU7A 5DQ9A 3MV9B 4DJMA 3QQ3A 4WUUB 4HWBH 4Z8FL 5D70H 4YXKL 2QQQA 5SV3A 1DLHB 1YEJL 2FGWH 5GGTH 4LRNL 3ALWA 2KZ1B 3N50A 2UWEB 3E3QC 4YHLH 3MUZ1 1X3DA 2JCCA 3B9KC 4HPYH 5C0FB 4OFIA 1NKRA 2WP3T 4WWKB 1QRNA 2AEQH 2PTTA 3GDBA 4I3SH 1MH5A 3CC5B 1G7MB 1X5KA 2C5DC 4KKLD 4XWOC 5DS8A 5J11C 2JELL 4WI5A 4IRSC 4I77L 4MA8L 2AABL 5JPNA 3TCXA 1G7HB 3MFFB 4PJXB 4Z5RB 3GJFH 3T2NH 5E5MA 3QXAB 2R1WA 5IEHA 2DI8A 3HLAA 5DD0H 4QRRB 3NFPA 8FABB 1OGAD 1YPZF 3LN5A 5JIIA 4L1HA 3TGXA 4JFFE 2ZG1A 5IWLC 4ZODA 4QXTA 1M6OA 4UBDD 1Q1JH 1U8IB 3VRIA 1JHTB 1BIIB 4JPKL 2JF1A 3U48A 3V6FA 2BFVL 3ULSB 4MD5B 3QEGH 5TDOB 1EXUB 4KKNA 3V7MA 4LPXA 2BDNL 4OD3H 4XGZA 3T65A 4JHZA 1N64H 1QRKA 2XZCL 3KDMA 1WFUA 2R0WH 3L3OA 4FG6C 3RGVA 2BVPA 5DMKA 1MJ7H 1T6VN 3GSNL 2MCG1 4YR6A 1TETL 2EDDA 1I1YA 3H3PH 3E2HC 5JPMA 5FECA 1CXLA 4P3CL 1SMOA 1EDQA 4UV7L 5E7BA 1IGMH 3O6KH 4JRYB 3RDTB 3ULVL 1JUFB 1YEGL 5JMRA 2C7UB 1AD9B 2IANA 3QH3B 3IS1X 3BW9B 3RL2A 3GSQA 3BGMB 1YYMH 1M4KA 3VFGL 4HX1A 2PO6A 4U6HA 2EH7H 3FT3A 3KPSB 5I71B 1A6AA 1RZ7L 2ADIA 2AJZA 3N0PB 4G6KH 4KRPB 1MQKH 2VZTA 1IM3B 1ED3A 4R0LB 2IADB 4Z7VE 4AIZB 5BRZB 2FH8A 1E6OL 2P44B 4MSWA 4PJAB 3IDJB 3C87A 2P43B 4GMSH 5DFTA 4P5TD 5C0BE 3F8UB 4XPFL 3Q0HA 3PP4L 3DVIA 2O61A 1AFVL 2ZNWA 1UACH 5JO5A 1YN6B 2VR4A 3QUYC 5A2FA 2GY5A 5T3XH 4K7PY 1A7QL 4X6BA 1KCVL 4PJDA 2OI9A 3FO9B 1G7IA 2GUOA 4C56A 1IL1A 3ZTJG 5CJXC 5I15H 3T77A 3WN5C 4OZFB 3LQAH 3TVMB 5ITFA 4J3UA 1VKXA 4OZHA 4LGPB 4LPCA 5I6XC 4DW2H 2AV7A 2R29L 4M1GH 2QQKH 1H8SA 1UA6L 3P73A 3U79A 1JFMA 1WAAE 2VWEE 1MCRA 4J3TA 4X5XA 1HXMB 4LARL 1WSST 4WW2F 3QI9C 1LQVA 4U1NA 4EN3D 3IRZA 1MLCA 3IVKA 2EIZB 1IQWL 3DGGB 4LVNB 1KEMH 2ATKA 4U0RC 1FCCA 3QR2A 1BLNB 1HKLH 5E2UL 4K3JL 1A0QL 1HHIA 1HH9A 1EAPB 5TQ2L 3KJ4C 2D9QB 1NCNA 5I2IB 5ID0A 1HHJB 3TBTA 3PWJA 4HK3N 2NXZB 2J88L 1OCWH 4L3EB 3ZYIA 1RK0A 2LAAA 4QY8B 5C70A 1I8MA 4I2XE 4J1UB 2Y36L 3S5LA 1P7KA 3RWGB 5I75B 4YDLC 1CFQA 1MCEA 3WL9B 4GKSB 4PUBL 5F9WC 4DZ8A 3TJEL 1FNEB 4JVWA 2FEEL 1NUNB 3PE9A 3HMWL 2DQFB 4IJ3B 4O4YL 1KULA 2D0FA 1BQSA 1OAYL 4JQIL 5CEYA 3BZ4A 32C2B 5AUMA 1LO3H 1EEYB 1X5AA 4TSBH 2OYPA 5ABDE 3CVHA 3QEUA 1QA9B 2HFGL 1P7QA 4LCYB 3WJJA 4OIAA 3I2CH 5INDB 4JY5H 4I18B 2YD2A 2W9DL 5IM7A 2QHLA 4OD2B 4JFHD 3BIBX 3EGSA 4EIZC 2W07A 1V8HA 1YN7A 1L9NA 2GSIB 2ICEA 2VZVA 4F9PA 1WTLA 4WO4C 2EEAA 1H0DA 3TO2B 3HE6A 2IPKB 5F7MC 2GW5A 1FNSH 3G5YA 2ITDA 3QB7C 4QHUB 1MJ8L 1T5XA 1UKQA 1CR9H 3ZE0F 2JJSC 2CLVB 3UTTD 4P46A 3U4AA 2WLZA 1CGXA 3PQYA 1OARH 5GRJH 4MZ2A 2QQNH 5D70L 5HHNB 4F8QA 4H5SA 1JMZA 1T03H 4UDTA 1T0NB 2FGWL 3VXRE 5HGAB 1A2YB 4DKEH 4G6AD 4PB0H 4RDQF 1FL6A 4CJ0A 1X5GA 5J6GB 4F7TA 3D2UA 2CR3A 3IU4H 4RAVA 4X4ME 1FLRL 4HGKC 5FGBC 2AEQL 5CEZD 3AROA 2NY3C 5HYEA 1BVZA 3DI3B 3R0MA 4YHNB 3HAEB 5K9QG 3E3QE 2OTWB 3CX2A 3O6FC 4IRJA 1E4XH 5IG7B 3FAWA 1QR4A 4GUPB 1BQHA 1R3LB 1UZ8B 3ILQC 3G6AA 1KLGB 4PJBF 2WK2A 3T2NL 3VFRB 1DTUA 1NFDE 1UT9A 5BQ7A 2WIIA 5DD0L 2ZUTA 3EFDH 3U4EB 3MRBA 4RX4D 3BESR 3BZDA 3ULVC 1JTPA 1TJHH 4HLZH 5F89B 4WVRA 1LDSA 1INDH 4W70A 3DURB 4RCAA 4OZIA 3SDDD 3L5IA 5CJQL 1S9XA 1T1ZA 2BY0A 2NYYC 2KPNA 4JKPL 2DIJA 3K74B 5EORH 3D48R 3DIFA 4JM2F 4JKMA 3CSGA 2R0WL 4LASH 4LKCA 5DQDL 3BVNA 4Z7QF 4YH6A 5GGUA 4A2LA 3PGFH 1KACB 4XTRC 1DUZB 3RWHA 4BFIA 4Z76A 2J8OA 2VZSA 4JO2L 4UOJA 3TPUB 3LPGA 5C9JA 1IGML 1B0RA 2GJZA 3W82A 5DRXA 5I1GL 4NN7C 3QDJD 2DQCH 4FZ8L 4ZNEA 3QIWD 4KJWD 4EBQH 2Z31A 1MHEA 4XP5L 5DZLA 2G9HA 4H1LG 2QLVB 2OR7A 1YYML 2B1HL 1KJ3H 1RUPH 5GPRA 3V52L 5ISZD 1OPGH 2WWKO 5I1CL 3WO3B 2X70A 4PRDA 5TE7H 5F7UA 4KROD 1R3KB 4I48B 1XEDA 3RVTC 2EIBA 3B9DA 4LOUD 4UB0L 5E8OA 5BMFH 3SKMA 4XCNA 5J8OA 2VUYA 4DVRH 1I1AA 4JO3L 3FQUA 2GJ6A 5KVDH 1BFOA 2R0LH 4F7CA 4RBPK 4WTXA 3CX5K 4Z77A 1WBZA 3MJ6A 3VFUA 3OWEA 5IKCB 1LEIA 2MOVA 3QWOA 1B0GB 1N59B 2WM0A 4KH2A 4Y8AA 5DJAB 1DE4A 4F15C 4DKAA 4KVCH 3D69A 5I15L 1TQCC 4XNYH 4LLAA 3SO3C 3O2WL 3LQAL 3FONB 4L9DA 1YUHA 4CVUA 5E5RB 1ETZA 3D3VD 4YGVB 1ODAA 1NGWA 1OQOA 1WCBB 1PYWB 3DUHA 5EC1B 2PXYA 4JFYB 3DLQR 1A5FH 2VDOL 1T4KA 1T1XB 4GQ9H 3WO4B 3ARGC 1E6JL 4YFDB 1C12B 5DJ0B 3OJVC 4G8EB 3EO9H 5CSBA 4XH2A 4ZFGH 2VDRL 3MLUL 1ES0B 4G7YL 3MV9D 1SHMA 5CBEB 2CSPA 1G6RL 1T20B 4PRBA 4WUUD 4Y7MA 5GS1C 3IFPA 3CK0L 4EIGB 3NCYP 5EZLA 1SEQL 5D9SB 1OW0A 2W0PA 1RJLA 1CDCA 4Q0XH 2W60A 4PRNA 2DQUH 5KSAB 5HHMA 5LWYL 1VEMA 2XTJB 4I0PC 5IB3A 5JORB 2EDTA 1GGUA 4R2GC 1RJCA 4YFEA 2NZ9C 2HT3D 3OZ9H 5IF0B 1B9ZA 3VFSB 5DRNB 3F58H 4QTHB 4LVEA 5EH1A 4LKXB 4P2QA 2PCPA 2H6PA 4PRHA 4AJ0A 3HUJE 4YE4L 4QRRD 1JHLH 3GMPA 4XVUC 1AGEB 3CDGB 1LO3L 2BRRL 4LLDA 4G9FD 1F6FB 3MRMB 4U1HB 2CGRL 3PWLA 4FXLA 3C5SA 2R0ZH 2ESVB 2GIYA 2K7PA 2O5ZH 3V7AG 2AK4D 4ZPTA 5DXWA 1JPTL 5HYIA 3OB0K 4N8CH 3GM8A 3GBML 1TXKA 2WBWB 4KKLC 2DLFH 1GZQB 2VLME 3JVGA 3N9GH 3RWFB 3P9LA 4RRPA 4MB4A 4P9HC 5T1LA 4KHTL 5I8OH 5JOEA 4ZPVB 2GHWB 3TLRA 3MRPA 4TNWK 4ALAL 3T1WA 4XHJD 3WLBB 2E27L 1FNSL 1LMKA 1IE5A 5FHBH 3PDOB 1E4KC 3BEVB 3FQWA 2Q8AH 3QBTB 2IMNA 4ENED 2WBJA 3PL6D 3UDWA 2NXYB 2W0FA 5GRJL 5MEND 2CRMA 3MQIA 4JHBA 4M7ZB 2BNRA 3KYOA 4YFLF 1HDMB 4LNRB 2RFXA 4OZ4B 2OZ4H 3DXAE 4GH7B 5IT2L 4NN5B 1XT5A 4KRPD 4UNUA 4WENB 1FVDB 3PUCA 1R5IA 1ZMYA 4AEHL 3PHSA 2PYFB 4M03A 5M94B 2E7BA 4PGZA 2YD8A 4JHWL 4ODHL 1ZANH 2ZUQC 3PXHA 4U1LB 4V1DD 3HZVA 4JDVB 3P4LA 1BJ1H 1L6ZA 2EO1A 5F97E 1LO5A 1OAXH 4RFEA 4C83B 2BVTA 3KPRA 2B5IC 4ODWA 5CWSB 5IVXE 5IIEA 5C0GB 1K8DB 3CXDH 3GRWA 1S7UA 3MRQA 5EO1B 1VCAA 4R96A 3EDFA 3MJ8A 4LDOB 4OGZA 1FL5B 5C0AB 5MI0C 4QYOB 4ACPA 4J4PC 4XXCC 4FQCL 2HVKB 1NDGA 2WY3A 4X6EB 1PG7H 5BVJA 4RGNE 2W65B 1DBKL 2A6DA 3X3GH 3Q5TA 2R39A 5EORL 1GOHA 3S35L 3AMKA 1G1CA 3ULVE 3FFCA 2VKXA 1Q9WB 5D1XD 3H3KA 1MWAH 3PWPA 4P5TC 2EC8A 4KJPD 1TMCA 1UJ3B 4B41A 2HVJB 3QDAA 1VGKA 3LQZB 2FZ3B 3PGFL 3HRPA 2H2PD 2XXCB 1J1PL 4U7MA 1WZ1L 5D93B 3KXFA 1YPZB 4N0UB 4RNRB 4YDJA 3DO3A 4W6YB 3VXUA 1YECL 2DQCL 4J2XA 4Q97A 5FDWA 3SE4A 4JY6A 2MTPA 5KVMC 4EBQL 1CGWA 3BN9D 2NXZD 4QNPF 1OSPH 3ZE2E 4GAGH 2WUCL 1K2DB 1OPGL 3OAYH 3GI8L 3G6JE 3UTQA 4D9LL 2BOBB 1S7QA 5ADPH 3VH8B 5I66B 3SQOL 4Q6IC 1HOCA 2AEIT 5J3HC 4GO6B 1BVKB 4PJIF 3KPOA 5I17B 1NMCC 3MODH 5FCUH 1NCDL 5KOMC 3PWVA 4YBLC 1FAIL 4M3KB 3TZVB 3AAZA 4GOSA 4N0CA 3ILPB 4X8JB 1ZT7A 3D18B 4K3GA 4O2EA 4ZUVB 2BHZA 4ELKA 4QRPD 1ZT1A 3ZO0A 4P57B 3L7EA 1EUUA 2B8OT 1C08B 4PGDA 4UUJA 5C07A 1X44A 2NW3B 3UBXB 1CBVL 4JREC 1WF5A 3H9ZA 4QLRA 4LHQB 3MBEA 5K9KA 1J05A 1V3MA 1PEWA 4XNYL 3BIKA 2V5SA 4XNUH 1OWWA 4YHYC 2Z35A 1I7ZB 4FTVB 4NM4L 2DOCA 2X4OA 1OQXA 5DRZA 2X7LB 2J5LC 4J3WA 2IGFL 4ZFOB 1MPAH 2LE9A 4GQ9L 3W39A 1PZ5B 1CFTB 3CLEH 3FT2B 2FO4B 2R23B 3EO9L 1MRCL 2X89A 1FFOB 5HYJB 4HIIA 3QIBC 4ZFGL 4HK0B 2APVA 4Y4KA 3MV7B 2A38A 2NR6D 4UTAL 4WW1A 3WIHH 1AO7A 3I3EA 2CLZB 5E95B 2LFGA 5F3BA 1YEKL 2A73A 2Y07H 5BXFB 5C8JA 3P77A 4X83A 4HC1A 4ZTPH 4WTZG 1I8IA 1A1OA 1D6EA 2BXYA 5IROA 1M71A 1ROWA 1KENH 3HHRB 4N0FB 3T3MF 1WZMA 5J0BA 1KNOA 2GJJA 1MCWW 2DM2A 4TOYH 3BP5A 3EO1B 3W2DH 5CLTA 3STBA 5DDHA 4F80A 1A7PL 4BH8B 5I1EH 4CW1A 4JZNB 4MQXC 4LSTL 4YHPB 4TVPH 2COQA 2ICCA 4U1JA 3OHXA 1QFHA 5EN2B 4YHZH 2B1AL 7CGTA 1R0AH 1JRHH 4G6AC 5D7IE 1H5BA 1FLTX 2R0ZL 4BKLB 1HE7A 3RKDD 4BYHA 3JWDH 5DHVA 2QQLL 5IVOA 3IDXH 3FQRA 4HDIA 1MCLA 1XGRA 1ND0B 4CRPA 1DBJH 4J3VA 4N8CL 3OKNA 3DHMA 4OLVH 3ULUF 4WU5A 5AZ2H 3N9GL 2XY1A 1J0YA 4TPRL 2NY5H 4PP2B 1QBML 4R4BA 1CE1L 2BNQD 4E41D 2Z92A 2V2XB 5GSVA 1UB6A 3QNZB 3LKSA 1PQZA 3MRHA 3S96B 5IW6B 3G5XA 3MRNA 3JSSA 2IFGA 5KANG 4NJAL 5C09E 4LF3B 1KYOJ 5DD6A 3O8XA 4JFFA 1DBBL 3JV0A 3SDDC 4YHKL 1OGAE 1DBML 3E6FA 3O4LE 4JR9H 4PJ5D 4NZRL 4L4TD 3S34H 3VXMB 4HLZG 5E8DL 5DRWB 4AMKH 4KZEL 1LP9E 3PG2A 5DGQA 1MCBA 5EIIA 1ITBB 2B2XH 2DLEA 2J6EH 3LKRB 4I9WE 4D9RD 3MLWH 4GRMB 1NGQH 4M61B 2FNBA 2X5PA 1Q0YH 2D9CA 3RNQA 1FFPA 2XWBB 3MLVH 3RWDA 1FGVH 4BH7B 1MY5A 4HMCA 2ZWLT 5JUEH 3BDBA 1OAXL 3SBWA 1HHHB 3KVQA 4KJWC 4OSUL 4YDKH 1XGUA 3MRRB 5EOCH 1F02I 1UWXH 3L7FA 5H8DA 1A6UH 2AV1A 1CXEA 2VDLH 1E28B 3QZWB 1XR9A 5HGBB 3VRJA 4KROC 4N90D 5DLML 5IFAH 2LU7A 2AJXL 5F7YC 5KW9H 4L5FL 5INCA 3EJZC 5L8LB 4LOUC 3X3GL 2HFEB 5L8JB 4U05A 2MHAB 5ITBL 2E7MA 4HCRA 4Z7VA 5J13B 2R69H 4QEGA 2Z8SA 3WHXA 1PLGH 4PJBB 3GHBH 2PYEB 5KAQF 5JDSA 4DCQA 5C0BA 1H3XA 4LPTA 3BD3A 2V2WA 3BWUC 5JW4N 1NCCL 4QHNA 1EX0A 4NQEE 4X7TA 1DSFL 4KVNH 1BBJA 1OSPL 3BPNB 4NZUH 4BSWA 3BH8B 2XRAH 1YNTB 1T7ZA 1UVQB 2XTJD 3QFDB 2X44D 4X9IA 3DJ9A 3PF2A 1CL7I 4JM2B 4NKIL 3T0ED 2NW2A 5F44A 3EYOB 5EFIB 1FFQA 1PX4A 5KOVC 1G9NL 1BIHA 3MODL 4XPBL 3OR7A 5FCUL 1QEWA 2IAMB 1UM6H 3ARBC 1KG0A 3NIGF 3RL1A 5HPMA 4O5LL 4GW4A 2EC9U 5GXBB 3IDYC 4PJCF 1WAAA 3WFBH 3RGVB 3MLZL 3AXLA 4OBSA 3W5MA 3HNSH 1FVCA 3MR9B 4QRTB 1JNNH 1E27B 1D5BA 2IH1A 2YC1A 3HC3L 5FGSA 4JAMB 4ZAKB 5I74C 3U6RA 3O6LH 2D7TL 3QCVL 5LAXA 1EGJL 4LCCC 2Q86B 2D7PA 4MS8D 3RIFK 3P11H 3AU1A 3HPLA 3N85L 4WWKC 3K8LA 5T3ZL 4UNTA 2YZ8A 4FQ1L 3V2AR 3HPJB 2VISB 1IAKB 1NBVH 3MCKB 5IBTL 1A6TA 4I2XA 4GKZB 3QQ9C 4HGMA 3BP4A 2ADIB 4GXVL 3LIZL 1EBAA 4YXLH 1JGUL 1FN4A 5L88H 4Y2DA 3TA3A 1JCKA 1B4RA 5C0EB 4PR5A 1PKQE 4JG1H 2HG5B 4K7PL 4N1CA 3ARDA 2YWZA 2NXYD 1S5IH 1WQVT 3T4YB 5IGXH 4UDUA 5JO5B 4LSRL 4LVHB 1EO5A 2EECA 2OJEB 1U58B 3WIHL 3AB0C 2UY7A 2VXSL 4YEEA 1ZA6A 1OD9A 5F7HA 2WLYA 3V0VA 3ARFB 5TE4L 3QUKA 1AP2B 1QR1A 2X4PA 2XPGB 4UT7L 4J8RB 4HULB 3KPQA 1AC0A 4OCWH 4W68A 2YD7A 4OZHB 3LSOB 5DTFB 1ONQB 4EDXA 2AV7B 4F37K 1J1XH 3RX5A 4NHUB 4JFHE 4K23H 5I1EL 1N0XH 3OAUH 2IPTL 2BSTA 4N5ED 1JVKA 4HH8A 3PL6C 4JN1L 4BELD 4URTB 3TBSB 4U1NB 1T3FA 2YRPA 5CAYB 4U1KB 5DEZA 1MJJA 2HP4A 5F3HA 3TJHD 1XF4B 3MCG1 3VWJB 3O9WD 1EO8L 5I71C 4KI1A 1PSKH 4KRPC 3LS4L 3UTTE 5HYQA 2DTSA 3HS0A 4XRCA 5B4MC 3VXRA 4KMTL 1OGTA 4NZTH 4XPGL 3RVWC 5GRVL 1DBJL 3LAFA 1NANH 2BCKB 3KYMA 5K59F 4X4MA 4B7LA 1HSAA 1QTYT 5FKAA 5AZ2L 5IJVA 5GGSB 1JFQH 1D6VL 3W11D 5CIPB 4D2NA 1P7KB 2PR4H 5DVNA 5FYKH 3E3QA 2H32A 1CFQB 1NC2A 2EIDA 1NGPL 1SBSH 4XX1E 2Z8RA 3B9KA 2BVOB 1P84J 4DZ8B 5EUOF 4MMXC 4P3DB 3MRDA 3FN3A 1RZKL 2NNAB 3OKEA 1NFDA 1VFUA 4K3DH 4PRPD 4O9HH 2LU3A 5CGTA 1F4WH 3TVMC 3T8XA 1LGVA 2ZZUT 4WHYH 4IRSA 3CMGA 4MDIB 5D7LB 1NC4D 2X4TB 4KTEL 4JR9L 2YA1A 2GAZB 1A3RH 3QEUB 3V6BR 1P9MC 3CFEB 2FJHA 2VL5A 5D1XC 3IU3A 3FB5A 1XF2B 2I9TB 2X4NB 3MOBH 3JTTB 4KJPC 3M17B 4HWUA 4LRIC 4ODSL 3TFKA 1AGDA 3QO0B 2B2XL 4P5MA 1CT8A 3HZKA 4XVTH 2VXTL 3TZVD 1KPUB 4PY8I 4ETYA 4LVNC 1OF2A 2ZOKB 1YEIL 2D4FA 2M2DA 2IG2H 4I0KA 2ZCHL 5CINL 1R3JA 3FQNA 1MELA 4MXQD 3BN9C 2CK0H 2NXZC 5ESQA 3ZZ1A 1LE9A 1GPOL 1JYVA 3U9PH 1T5XB 4UIMA 5HVFB 4HJ0D 1FRGH 2P8MA 3TN0A 2YBRA 3QPXL 1OWRM 1QNZL 3UAJD 3PQYB 4EVNB 3JV5A 3E2HA 5ICZA 3TESA 5I75C 4M8VA 1AI1H 1FSKB 5KW9L 1KFAH 2EYSA 4WFFE 4HKXB 4AEIH 1GGCH 4Y5XC 3O41A 1JNLH 4Y5VB 1A1NA 3X12B 4IJ3C 3EJJX 1PFCA 4PJHE 5ETUB 4Z18A 3TH3T 3GUTA 1KN2L 4XBEL 1W72B 3FAXA 1DDHB 5FA3B 5TF1H 4L29B 4S1SH 4YQXH 3EOTH 1GVIA 2X4RA 1MCDA 2R69L 3GHBL 4AIXA 2OQJA 1U3ZA 5SWZD 2YK1H 4OM0L 2NMSA 5DFVD 3WNPA 4LCWE 5GRYA 1YC7A 1DBAL 2VQ1B 4YAQB 2XWTB 4MDJA 3G6DL 1VHPA 2ID5A 1CQYA 3C8KA 2MFNA 4FQJL 3L3IB 3OR6A 4NQUA 1ITCA 4KKAD 2MJWA 1H3VA 3QUYA 4NP4H 1WC7B 1TLKA 2YKLH 2FBJL 3QG6B 4PJGE 2GTWA 5ENWB 3MO1B 3RWCA 5B21A 3VFMB 3OBAA 3T4AA 2XZAH 4PTTB 1S9VB 2OR8A 4HKBA 1QQDA 1U8OB 3OXSA 1G9MH 4CL7A 1PGRB 2CKBB 3AS0A 1LK2A 1MRFH 3RPIB 3WN5A 3WFBL 4HS3A 3FO1B 3U30B 3MC0A 5B39G 1C5CL 4EQ2A 2NR6C 2J8UF 4X7SL 4XCEB 5D6DC 4HS6B 4LDEB 3TYFB 1B0RB 3MV9E 4ZO8A 1KLFA 4WUUE 3HCVA 5FF6B 1NGXB 2HWZH 5J1AB 5DK0A 1N5YH 4OD1H 2OL3H 4X6FB 1QVOB 3QXDB 4PJIB 2UWEE 1KCSL 3C5JB 4N8PA 5A1AA 3MNZA 4ODTL 3UTPE 4JLRA 1Z9SA 3DUUA 3LN4B 5D7JD 5L88L 3DWTA 2D31B 1XF3B 3GMRA 5E4IA 1AR2A 4PV9A 1T22A 1IEBB 1A8JH 4CDHA 4QGYA 3BKCH 3U0TA 1ZV5A 3HUJA 5C3TA 4PJXE 1WZLA 4AM0B 2XWJB 3VD7A 1GHFH 4JPWL 1CDGA 3RKDC 4QRRE 4OLWL 5DFWH 5JHDD 4Z6AT 4Z77B 5C7XH 5T3XD 1RUML 3MMEB 3HI1A 2EKJA 1V5JA 2HYMA 3IJSB 4DQOH 4BSJA 3LS5L 4JO1L 1A9BA 4UQ3B 3PHOA 3PP3K 1XGYL 5ELIA 5EB9A 4RQQA 5CJOH 1N3NA 2KZWA 4OF8A 1QSFB 1IM9B 3C5ZB 3LV3B 4GG8A 1RV6X 1HXYA 2W9EL 3CSBA 4PREA 1QOKA 5E9DD 3L3DB 5EO9B 4IBLT 2R2EB 2AQ3A 4E5XA 1RZKC 4HWZB 4MCYB 4JRYE 4WO4A 1PKOA 1OT1A 3ARRA 4GBXB 4KK8C 3UJIH 2VRAA 3R8QA 2F74B 1IGYA 1S9KC 1RJLB 4XCYB 4DAGH 3DXAA 2OCFD 3IDNB 2JJSA 1RIVL 4MCZA 1P5VA 1LVEA 3KPSE 4KAQH 1CTNA 5DEGB 4OV5B 2Q7YA 3EJYD 5BRZE 2PR4L 4G7VH 3PWNB 3PJSB 4CVWA 4PJAE 1JWUA 4X0KB 3WNNA 5FGBA 2CJUH 1MIMH 3K2UL 4ZD3H 4F33B 1AHWB 1QFWI 5EBWB 3VA2C 4MNQB 2A77H 5IVXA 4DUXA 4AH2B 3O6FA 3O6MH 1F4WL 5ESAA 4DGIL 1Q9KA 4JHAL 3VXNA 5TGBB 5DC4B 2BVQA 4I4WB 1AGFB 4JANA 1A3RL 5F88B 5FKPA 1OAUH 3WO4C 1GSMA 3VRLE 3P0YL 2YPKA 3CVIH 4L8BB 1I7RA 2XFXB 1OB1B 2IAMD 2P48B 4ORZC 1INEL 3UTZA 3LEXA 4O02H 3G5ZB 3IB4A 4GRWH 4BZ2H 3H0TB 4HXAL 3LRSA 3KJ6H 1AQKL 3BPLB 3I50H 3QG7L 3ZYZA 5KSAC 1ACYH 1N7MH 4PRAB 4UU9B 2XTJC 4HV8A 2DQHH 5JZ7D 3QJFB 3U9UB 4Z7NE 5IW1A 5TPWL 4U1MB 4OCLC 2NY0D 3LKOB 1KFAL 3QYCA 1JNLL 4L3EE 3G6JA 4G8FA 3S4SA 5FOJA 1YEHH 4PD4J 3VRLF 3ZT6A 3ARZA 5AZEH 4G8GD 1FH5L 4YQXL 1UM4H 3B8SA 3C6SA 1YQ2A 1KJVB 3ARTA 4EUPB 5LKNA 1S7RA 2YK1L 3A6OA 4MS8C 4KDVA 3M1BB 4YX2L 1C5DB 3NCJL 3MX0A 1ZHNA 1AR1D 5CGYD 2DD8L 4QRPE 1P2CA 3T2QA 4HF5H 4Z9KB 5KSUA 1FDLH 3SKUD 5CS7A 1H3TA 2JK5B 1S7UB 2FIKB 3STZB 2X1XR 2JIXD 4RZCB 3VD4A 4XBPB 4PP1D 4JFOA 1RAMA 3GSRA 2AJSL 2GEEA 1S3KL 3QPQC 1HYRC 3SGDH 2C1OB 4H25A 2YEZA 2A6DB 2C3XA 4L8SB 4OIIL 4HKZB 1G9ML 5JNYB 5TDNA 5T3ZE 5T1MB 1J1OH 4JFQB 2NXYC 4M1DL 4WCYH 4Q9QH 3BSZL 4EDWL 2JJUA 4PGBA 4M7ZC 1F4YH 2L0DA 2YRZA 4NQXA 3ARGA 1QBAA 2XT1B 3VXUB 1WTGT 1RPQA 4X7FC 4ODBD 4QRQA 4GRWF 3QWRD 2OL3L 3PGCB 2LU4A 4K94C 2OTUA 3O3BA 2DQJH 4YPJA 4NO0D 4J3OC 5GS1A 5I19L 1JE6A 3IFLH 4PJCB 4JFED 1TJGH 4N5EC 1WBXA 1S7VB 1UKSA 3MV8D 3QNYA 4I0PA 4XNMA 3AY4C 1SQ2N 3X11A 5D72H 1EPFA 4NWTH 3CVHH 1TZGH 3BQUA 3IKCA 1JPST 4G42A 2Q76A 1KCUL 5KBNC 2FECI 1TZHA 1GHFL 1S7SA 5D7LD 5D7KD 1H9VA 5JW5B 3MJ7A 3SPVA 2IPUK 1RMFH 5D7IA 5IEKB 1Y0LB 2VDKL 3JUZA 5EZOH 2A9NL 5EBMB 3TBYA 43C9A 3O2VH 2E9JA 3T09A 3DV6A 4ONFH 1ORQB 3B5TA 3W0WB 5IFHL 5AYUH 3W11C 5FGCE 3PGDA 3MBXL 3AFLA 4Q2ZA 3VXSB 3HMXL 1YY9D 1OP9A 4LSQH 4TRPH 1MREH 4FQQA 1RZJL 4NQCB 4YK4B 4N8VA 1JV5A 1YZZA 4H20L 4PJFF 3ZDZE 4LCIH 4L8CB 1FBIH 4U6YB 3TPUE 3GSVB 4MJ5B 4X9GA 3WS6C 4EXPX 1TDQA 2AW2A 1NDMA 5E7FA 2R8SL 4WDIA 1VACB 4JFXA 5C09A 2R56L 1ZHKB 5TQ0H 1BWMA 3BKJL 1QBLL 5C0CB 1JGDA 1OGAA 2IPUG 3MLPA 3O4LA 4RA0C 4WHYG 4KJYA 1E4KA 4D9QD 5JOFB 2E8ZA 3H6JA 3TZVC 4P23B 5HYSG 2A73B 2P8LA 1KGCD 1RIUH 3ZMRA 4KAQL 3AUVA 4LGRB 1FO0B 1LP9A 5HDLA 3AM8C 4R97B 5B3JE 2OX5A 1EZVY 3MRLB 4QXGH 5EU7C 5IB2B 4Y19B 4QHMB 1KNOB 4U1GC 1OTTD 4MB3A 4MXQC 4N5UA 1LO2L 3P0VH 1D5ZB 2WP3O 4ZD3L 1Z5LA 3FTGB 1CDUA 4MHHI 1U6AL 4BJLA 4CW1B 4HJ0C 3QFJB 4NYLB 1NAKL 1AXTL 4TSAH 3O6ML 1K5NB 4WFGE 4DN4L 1AD0A 5DJYB 1U8JA 4IS6A 2ZUSA 5KVEH 4UT9L 3HZYA 4AT6A 4D0BA 1LD9A 2VIRA 3CFCH 4M7KL 1AGBB 2DL2A 2H3NB 1OAUL 3FN0H 1FORH 4LPUA 4P9MH 4XPHL 5IBUG 5IMKA 3CVIL 2QADB 4M6ML 3TIEA 2Y5TB 4RGOL 3FO2B 1NGYB 4J4PA 1QD0A 5EUOB 4XXCA 2LTQC 4JJ5B 2Y1VA 2OR9H 3RBSA 3DETD 4HMEA 1JZ5A 2HT2D 1A6WH 1U8HA 3VXOA 1NFIA 3CZJA 4P5TA 1MHCA 1N7ML 2Y06L 4U2ZA 2EC9T 1PQZB 3LKSB 5L2KB 2DQHL 4NQEA 1CG9B 12E8L 4KKAC 1BD2B 2E6PA 4XBGA 4JN2A 1AIFB 1S9WA 1HHKA 4WW2C 1NCTA 1JF5A 3SCMD 5C0RH 2XTJE 2GY7B 4OGYL 1T7WA 3S7GA 2FX9H 2V17H 4KZDL 4Y16B 5E2WH 5F6IC 4OQTL 4JY4A 2V2TA 2VN7A 2R1YB 1TVBB 4Q6IA 5IK3A 4MJID 1FFPB 4DGVH 5HHPA 3CFDB 4GRLB 4ZYKB 1N5AB 3GI9L 3WSQH 2HN7B 1ACZA 1TCMA 4HF5L 5F1IB 1J0JA 5MEPA 3GO1L 3NPSC 1KC5H 3D5OF 3MUJA 5C3LD 3VCLB 2ESVE 3GMOB 5I1DA 1J87A 3LZFL 3FMGL 3K7UA 3GZKA 5F72S 4GAYA 1G6RA 2BY3A 3GMQA 3T3PF 3QCTH 4PJ9B 3OKMB 5JW4Q 1X5JA 3U0PA 5E6IA 5IB1B 5KSVA 4QHKI 5JDJA 3D6GA 1JGVL 2Q8BH 4GW1A 2AJYL 5D4QA 3FQXA 4G8IA 3SGKC 3V5KA 2FO1A 1PKQA 2I24N 4HJJH 1KB9K 1JTOA 2KDGA 4P99A 4XXDA 1MRDH 4U3HA 1QLFA 2V2WB 5JQHC 2UYLA 3S8WA 2GSGA 4GBXD 4HXBH 4N9GA 4JPIA 3SHSA 5I9QC 2WQ8A 3QIBA 3KPMA 4TUOA 1BX2A 1FYTB 1NCWH 4EI5B 1M7IA 3DTXB 5EO0A 1HKFA 2VZ1A 1WK0A 3GKWH 1O7SA 1IC4L 1TJGL 4K71B 1A02N 1G7JB 3QQ4B 1F90H 5DUPL 5KSBF 4K8RL 1YNKH 3W9DB 4JFPB 1L7IL 2LAGB 3IDIA 4J6RH 2J8UB 4OT1L 5HVGB 1RZJC 4NWTL 4X5WA 3RTQB 1TZGL 4LSDA 4RFOL 2ZCLL 3DSFL 2IQ9H 3D0LA 3QNXA 4JQXC 1FVEA 1Z6JT 2H41A 5T33H 5HTSA 1RMFL 1TTGA 3KLHD 4O58H 5DHYA 4M7LH 3UTTA 4M43H 3UYOD 3B5GA 5C0AE 3VWKD 1XGTA 3JWOH 1QACA 3AMLA 5DO2D 5J13C 3DV4A 4PDCE 3EJYC 4FNLH 3O11B 2EXWD 4P59H 3UROR 3QHZL 3TCLB 2XYCA 1KIPB 1MLBA 1MREL 5DJCA 3L5WA 4NNPH 5FYLH 3OXRB 4YC2B 4R4FH 1FIEA 5IUSA 2OJZL 5ACZB 1CFSA 3BPNC 1IBGL 1CXKA 1YPZE 4N0UE 3JV6B 1DQJA 4NKMB 5TE6L 1A64A 4EI6B 4WFHD 1W72L 4M62L 4MQ7B 3MUGA 3NN8B 2Z93A 3KPLA 4XNXH 5EWIH 3K3QA 5BS0B 5E24E 1KXTB 2ENSA 2CUIA 2IAMC 1MI5B 3V8OA 3CDYA 3N1GC 4MD4B 4ZFZA 5IESH 4ZFFB 5DJ8A 3V0VB 3CDCA 1JF1A 3QUKB 5AWNL 3P0GB 3KPPA 4RISH 4QXGL 5JR1L 3WIFA 1KSRA 5FIEA 2E7LC 1D9KB 1RURH 3FCTB 3QWQB 3ZTNH 4LLQB 2ADGB 3P2TA 4Z0XA 3FO0L 3P0VL 4EDXB 4IDJL 3KYNA 3DX6A 3GRWH 3SDCB 3IXTA 3UTSB 5JZ7C 4WJ5A 5EU7E 2QKIA 2BSTB 4WIQA 4TVPD 4EXKA 4JDZB 4A2MA 3Q2CA 3VFWA 2A2QT 3VFTB 5C0ND 4DEPB 2ERJC 2CO7B 5F3HB 2CKBL 1NCAL 4QTIH 4Z78B 4X9BA 1B2WH 3MRFA 1JZ3A 3FN0L 1DFBH 1FORL 4JZJB 3CFJB 4NUJB 4FQXB 1OGTB 5BOZG 4FTVE 5FOBA 4PJHA 4UTBH 2NQCA 4WGWB 3KYMB 3NZ8A 5F7FA 2ARWA 2HTLD 3EFFA 4OLEA 3BMVA 4HGWA 5GRWA 5DSCB 1HINL 2EYTA 4LVHC 4WI9A 4KFZC 1N2RB 5HYJE 2R2BA 4EKXA 2XZZA 1AR1C 5CGYC 2YPLD 4P2OB 4X8XA 5DVOA 1MCSA 3T2OA 4M8QA 2QR0A 2AJUH 4H0IA 4KQ4H 4NFBA 3P30H 4LCWA 3RVUD 4MNGB 4O2CA 3T04D 1CICD 4GMTH 5CP7B 3WMSA 3NABH 1BJMA 4NRYA 4PP1C 5EU5A 4LEXH 3MLXH 5J11B 2A6IB 4QOKB 5IHZA 4NZDA 4OF6A 4OKVA 3VW3H 2V7NB 5L2JB 5JXEA 2N4IA 1UG9A 4G80A 4WEUD 4PJGA 3RX7A 4A6YA 4NQDD 3RJQB 4XC1H 5E2WL 2Q3ZA 3CZFB 1QLEL 4P5MB 3H9SD 4PGCA 4H0HB 4P5KA 4M02A 2F5BH 4UQ2B 2FWOA 4KPHL 5GGQH 4KY1H 4Q74A 3WFCL 3WNMA 2EDXA 1QLRB 2F8VA 2Z91A 4WNQA 2H9GA 3ARBA 3QUXB 3CCHB 2VXQH 3NA9H 1ZLVH 1PJ9A 1LE9B 3MV9A 4WUUA 3DYMA 3EZJB 4LGSB 1HZHH 2C26A 1DLHA 3OB8A 1GGBH 3D1MC 1T66C 1MSPA 3HG1B 2UWEA 1AY1H 3S5LG 1MFAH 3QCTL 3VXSD 1W0WB 2DAVA 2XNAB 4WWKA 1DLFH 1MVFA 3CC5A 1G7MA 3H7BB 2VLJD 1BZ9B 4G6JH 4K8RC 4HJJL 2W0LA 2E3VA 1G7HA 2N7BA 3MFFA 4PJXA 2B0SL 5E2JA 2H1PL 4WI2A 4Z5RA 2I07B 3QXAA 5HDBF 3SE9L 3UO1H 1CGYA 4XMLL 5C0CD 4APQD 2BNUB 5K9QI 5C6TH 4QRRA 8FABA 4NC1C 4TUKL 2VO5A 4HC1H 4WHCA 3L1OL 4KDTC 3VFVB 2G2RB 2HJFB 3GSOB 3E6HA 3C60D 4P23D 5E6ZA 1U8IA 1NLBL 4QHKJ 4JGJA 5JLZB 1JHTA 1BIIA 4XMKH 4R3SB 3VXME 1DQQB 3MRJB 3B6SB 3DVGB 5D2NC 5TDOA 3U7YH 1YY9C 3IS0X 1EXUA 3QUYB 2Q87A 3UYRL 4WRLA 1IKFL 1F90L 3EOBB 4HKBB 3OXSB 3N1MC 1YMHB 1LK2B 5JHLL 3ZE0E 5I1IL 1DVFB 3MA7B 3ULUL 3GSWA 1MFCL 4HPOH 1A6VL 3BKML 3V79C 5DHVH 1FSKC 2OM5A 3RU8H 4Y5VC 4JRYA 5T33L 4YUEH 1JUFA 3FZUD 4NKOB 4O58L 2C7UA 1AD9A 4NKQB 1F4XH 3QH3A 3BW9A 3PL6A 5JIKA 3QI9B 1HCVA 3BGMA 3MACL 4AQOA 3BXNA 5DK0B 3TT3H 1MHPH 3MV01 1CLOH 3SOBH 7FABL 2F5AL 2A0LD 4KTDH 5LCVL 3KPSA 1Z3GL 2DYPD 1OTTC 1I3UA 3RNKB 5IMOB 4JLRB 1IM3A 2IADA 4AIZA 1BQHG 1CDIA 5BRZA 4NNPL 1C1EH 5FYLL 3GB7A 3RX8A 1JIBA 4NWUH 1UXSB 4PJBE 4PJAA 4R4FL 3IDJA 2PYEE 4OB5L 3KS0J 2QSCH 1UENA 2QHRH 4XPTL 5L9DH 1BD2D 1YN6A 4GT7A 4YDLB 1EHAA 5C08B 3LPWA 2WINB 3BDYH 5EWIL 5DJXB 4YXHH 4YHML 3FO9A 2XN9B 4WEBL 2O93L 2AXGB 3RIAK 3RBGA 4WY7H 4OZFA 3TVMA 3U30C 1OAQH 4MWFB 4OLYH 4Z7QE 4JVUA 2F54B 2MWCA 3RWIA 4PJFB 2RCSL 4LLYB 5GSRB 2HT2C 1P9MA 5DUMH 1VPOL 3TF7C 1HXMA 2L4OA 5FUOL 5EU6B 3DPBA 4LRIA 1LHZA 5DR5H 5D1ZB 2DKUA 3C6LB 1UYWH 1AJ7L 4OGAD 2EIZA 3DGGA 2F53B 2V7HB 3GIVB 4OUUB 4DGYH 4KUZH 1VEOA 4QXUH 1BLNA 5JW3H 1Y6NR 4QTIL 3RY4A 3O2DL 4CVZB 1B2WL 4YLQT 2D03L 1DFBL 1HHJA 4UILL 1SJVA 3NTCH 1EERB 1IGYB 1LEKB 5F96L 4L3EA 1IARB 4PJ9D 5D7SL 4J1UA 1X4XA 4AL8L 5CILL 4J23A 4H26B 3QDMB 2QSQA 3RWGA 1T04A 5T1DL 2VITB 1KIUA 2VDMH 3WL9A 4GKSA 3CU7A 4Y5XA 4WWID 1FNEA 2DQFA 4XVJH 5HGDB 1EIBA 1LK3L 2IFFL 5FYKD 3UJJL 1U41A 3H42L 3WUZA 1KTKE 1G9EA 4KQ4L 32C2A 2NY3B 4ONHB 3UC0L 4GMTL 4QRPA 1EEYA 1RZIB 1BBDH 1KB5B 1FYTD 4F57H 3MLXL 3SQBA 2R9HC 1QA9A 5B38B 2W9LA 2V5RA 4LCYA 1MF2H 1NL0L 4M6NL 5FYKU 1NBQA 3QIUB 5INDA 4I18A 1XMWA 1IEAB 1EGJA 2CRIA 1C5BL 1CU4L 4OD2A 2GCYA 4IMKC 5GS0L 4S1RH 2GSIA 1JPGA 1IGCH 3RTQD 4NHUE 3LKPB 3U7AA 1QKZL 2AJVH 1CFNB 4F58H 3TO2A 3KR3H 4GBXC 2IPKA 1ZGLM 2HH0H 1LO4H 4LSPH 3R0NA 3RAJL 4QHUA 5F7WC 3DUSA 1HWHB 2CLVA 1CQKA 2B7DT 1INQB 1UH4A 1XIWD 3OF6A 3I02B 5HHNA 1FYHB 5IW1B 1T0NA 1YA5A 3BE1L 5HGAA 1A2YA 2RBLA 3IJYB 5HVHB 1AY1L 4LPWA 5J6GA 3QUMB 2XQBH 2UUDH 3NH7H 3NZHL 1HK6A 1JZ6A 1LNUB 4LU5L 4P2RB 4PJ8D 1AHWC 1X4YA 1UB5B 5DVKA 1QHPA 3HNVH 4YHNA 3HAEA 1EHLH 4WI8A 3WLWD 3ZYOA 1Q9OB 2OTWA 5DMYA 5IHUH 2CLRB 4YPGB 5IG7A 2ORBL 4GUPA 3HC4L 5DVMA 1R3LA 1UZ8A 3QRGH 2HFTA 1B4JL 5FA4B 3SDAD 4RWYL 1RUKH 5EZIH 3VFRA 3KLHC 3ULUC 1FO0L 3EBAA 5ALCL 1KBGL 3V6OC 5BS0D 3U4EA 1WUNT 2ATPB 2VQUA 5D7LE 5D7KE 5F89A 1OSZB 3K46A 4GAJL 3DURA 5J06A 2NY4D 3QUZB 4OCXH 4PS4H 3Q6GL 3RP1A 4ZTOL 2DTMH 2WWMD 1BOGB 4RRPG 2Z4QB 3DMMD 3LD8C 3KHQA 3BPLC 2XA8H 2A1WH 5KJRL 2CO6B 2VLRB 1I9IH 4F15B 4AK1A 4M1CD 1V7NH 1TQCB 2O5YH 4L9LC 5GGRY 1DN0A 1DUZA 3EYQD 4M9OA 3TC9A 1KLUB 3ZT7A 3TPUA 5DT1L 1QYGH 1N6QH 1V7ML 2HKHL 1A7NL 5CD5D 5KG9B 2OP4H 2VZ3A 2DMKA 4G5ZL 3VGAB 2BVUA 3ARGB 3V5DB 4ZG1A 3CXHJ 2DKSA 1VB9A 3HTLX 1LEGB 4HQQH 2FHFA 3SOBL 2H32H 1TNNA 2PETA 1IEHA 1R3KA 5KSBB 4NHCH 4I48A 4YZFF 3JV4B 1U8MB 4CKVX 1KGCE 4ODVL 3ZL4L 2IF7A 5ECJE 1C1EL 4FQIH 3CFKB 3BH9B 2VABB 5DJ6A 1WBXB 5A2IH 1DQLH 2P5EB 1VGEH 4JFDD 2QHRL 4BUGA 1Q38A 2A9MH 3LKQB 5C0NC 1GL4B 2E8YA 5IKCA 4FZEL 4I3GA 4XNZB 1B0GA 1N59A 2AP2A 1MFEH 1MFDH 5DJAA 1WFOA 4L8SC 5TFSH 4Z0BH 1CFVH 5I1KH 3TBYB 43C9B 5CCKL 3FONA 2EDWA 1NUDA 1CZ8H 4YGVA 4YWGH 4ELMB 1T7YA 2EDBA 1WCBA 4LAQH 1PYWA 4G9DB 3K80A 3OKOA 3B5HA 5EC1A 4JFYA 5EOQH 2BJML 2E5EA 1T1XA 3VDAA 4CADB 4Q2ZB 4CU8A 2ZKHH 2G60H 2YD6A 4JE4B 1C12A 3OJ2C 4G8EA 4F2MB 1NMBH 5E8EB 3RVUC 3QUXD 3CUPB 2BSSB 3EZ8A 4Y2OA 2DBJA 3GHEL 1KCRL 1MAML 4QNPE 5CBEA 3D9AH 1T20A 4DGYL 4BSVA 1F4HA 4GS7C 1WWWX 2RIKA 1ZHBA 3VD5A 5D9SA 3L3GB 5IHBA 5IFJB 2FL5B 1H3PL 5EBGA 1P1ZB 4HCRL 1HN1A 1F11B 2ZJSH 5KSAA 1JZ2A 4PJIE 3L6FA 5JORA 4UINL 3MLYH 2UVEA 5IF0A 4HUUA 2VERN 3VFSA 3VFPA 5DRNA 2R2HB 4QTHA 4HBCH 5GS0C 3MGTA 1A47A 4LKXA 5T1KB 3N1PC 4DN3L 2VDPH 3E0GA 5I30L 3EYSL 4OGXL 5GGRB 2OSLB 3NFSL 1I3GL 4RMWA 1AGEA 1R6VA 25C8L 2R1XB 5HPOA 15C8H 4X7EC 1VADB 3MRMA 5DD5L 1EHXA 4F57L 1SJEA 2ZUYA 3C08L 4JJHA 1U8JB 4IS6B 2ESVA 4MS8A 3U0WL 3GIZH 1FPTH 5JOPD 2VIRB 1BAFH 2BC4A 2MCPL 1IAII 1EJOH 5CZXC 4NM8H 4NNXB 4PG2C 5HGGS 4ZUUB 2L7JA 1GC1L 3MLRH 1YEFL 4HS8H 2AK1H 4OLXL 1GZQA 5DEFB 3RWFA 1HQRB 1QSFE 1TVDA 1A6ZB 2DIBA 4X4XA 4ZPVA 4HT1H 4WUKH 3VG9B 3WLBA 3RFZC 2HH0L 1FFNB 2FBOJ 4ZUWB 4OF0A 3TV3H 2YPVL 3PDOA 5AG9A 3BEVA 5F9JB 3BO8B 4Q6YA 4NRXB 4P5TB 4P23C 2A83B 4UI2A 4KKCD 3RZWA 2Z8WC 5C2BL 4XWGL 1E4XI 2PO6D 3VI3F 4JPVL 2C4XA 1HDMA 4LNRA 5J6HB 4H1LA 5SX5H 3NH7L 1FVDA 5E08L 1RU9L 4IRZH 2YOCA 2PYFA 3OX8B 3F7QA 1A6PA 2DN7A 3HNVL 3FB8B 2H2SD 4U1LA 1YJDL 4JDVA 3QRGL 4ISVB 4LFHD 1RUKL 4C83A 1Q8MA 4MAUL 5CWSA 3NCYS 1A9EB 4MNQE 5C0GA 4YHOL 3M8OH 4N5EA 4C56D 3AY4A 1K8DA 2VDNH 4YHIB 5F9OH 4EN3B 2P46B 3SY0B 2CMRH 5EO1A 1OVZA 1A4JB 2DQEH 4BZ1L 2DLHA 3EW3B 1A14L 2A0LC 1FL5A 3O45B 3CD4A 4QYOA 4CJ1A 1DEDA 3ULUE 4OCXL 2HVKA 3U83A 2F54D 2F58H 2IALB 4XNQB 1YEJH 3V6OE 4HUVB 2BMKB 4X6EA 4CAGA 2FGZA 2W65A 4GW5B 5DJ2A 2XA8L 5E8PB 1Q9WA 4FQLL 1I9IL 4W81A 4DUVA 2HVJA 5HI4D 3LQZA 2FZ3A 2O5YL 3UJTL 2AEPL 4I5BB 1YPZA 9CGTA 4N0UA 2F9BT 4XT1C 2FJGA 5MHSD 2JELH 2GK2A 2O26U 1KEGL 2AABH 2C4FU 2LABA 4U7KA 4FABH 2ZSVB 5ICXB 2A6KB 3UYPA 5D5MF 4Y4HD 3C2SA 4WFHE 1K2DA 3LEVL 1BX2B 2BOBA 3VH8A 5I66A 4JPKH 4NHCL 5EO0B 4V3DB 4MXWH 2BFVH 1BVKA 4GRLC 1I7TB 2QL1A 5I17A 1R5VB 2P5WB 1ZVSB 2FJFB 2BDNH 4YDVB 3RUGF 3TZVA 2EDFA 1BZ7B 2XZCH 4X8JA 3ROOB 3D18A 1CL7H 4UIKL 3IDIB 4ZUVA 3AM8A 1CD0A 1H3UA 5F1OB 5EZJB 1HI6B 4P57A 1TETH 3S3PA 1C08A 4JVPA 5GJSH 3I6LD 4P3CH 2NW3A 4MXQA 4UV7H 3UBXA 3WE6B 1P7QD 3S36L 3WXWL 3LRHA 3ULVH 4PJ9C 4M9PA 4JQVC 1YEGH 1CFVL 5DHYB 5BV7B 3X13A 3UZQA 5I1KL 1CGSL 2APWA 4YFLI 2NX5B 3QXUA 1CD9B 1I7ZA 5E2TL 1OAZL 4HWBA 1DL7H 4FTVA 4HG4K 1HHGB 2X7LA 2X1WL 3VFGH 4ZFOA 2FR4A 1CCZA 3B2VL 5GGTA 3MZTA 3MA9H 3HE6D 1PZ5A 1RZ7H 2ZKHL 1A1MB 4ZS6D 1MLBB 2FO4A 2R23A 2DDQL 1FFOA 5HYJA 1E6OH 5LGJB 4P46D 1J0IA 1Z0MA 4OZGF 3D9AL 4HK0A 3PP4H 4HIEA 1AFVH 1KYOK 4IMLB 5EU3B 1HYSC 4MLSA 5BVPL 2BERA 2CLZA 3MUGB 1X5FA 3TBVB 3KPLB 1A7QH 2ZJSL 1KCVH 1RK1B 3IF1B 1Q72L 2UV3A 2X1OA 3T0AA 1F6LL 4JDTL 2DQDL 1A3LL 5BXFA 3UXFA 4P2RD 2VR9A 2UUDK 1PY4A 1CI5A 4MXVF 3RTQC 4PJCE 4IRJD 4N0FA 1QSEB 2JTDA 5B8CC 1FNAA 3SDDB 4OLUL 3WIFB 3EO1A 5GIRB 3EUUA 4EZMA 4GQPH 4MA3B 4BH8A 4JZNA 4YHPA 3I3BA 3KYAA 4LARH 1BGXH 5EN2A 2BXZA 2QKIB 1IQWH 1CN4A 1RZFL 1F2XK 3HI6L 3QUZD 5E2UH 1U8NB 4BKLA 2UZXB 4K3JH 2Y7QB 4JG0L 3QDJB 3WDHA 1A0QH 3QIWB 4X80L 1ND0A 4I13B 4YJZL 4TNVK 1EJOL 4W6WB 4YC2C 3W0WE 1ZXQA 2J88H 2VLRD 3ORJA 1YY8A 3WLWC 3MROB 2AK1L 5ISZB 2HA1A 2DBLL 5FYJL 3VXSE 3ZHDA 1S9YB 5A40E 4NQCE 4KROB 2Y36H 4HT1L 4PP2A 3SDAC 4OFYD 3ARWA 1U8LB 3JBG7 1IGTB 4HGWB 3UEZA 2VLJE 4PUBH 1YJDC 1A21A 3TJEH 3TV3L 3BUTA 3QNZA 5I1HL 4O4YH 2D3VA 2Z31D 4RMUA 3S96A 3VD3A 5IW6A 4F7PB 1OAYH 1HH6B 4JQIH 2QR0B 4X6CF 4LF3A 3UP1A 4PBWD 2IBZY 4O2CB 5C0CE 3SGKA 2NY4C 1WGOA 5E4EB 3ARUA 2WWMC 2C3VA 1NJ9B 3C8HA 3DMMC 3L5JA 3P4OB 3VXMA 1I7UB 4OKVB 5DRWA 5CGMA 3SDCC 4M1CC 2EE9A 2MNUA 1CGVA 1I1AD 3EYQC 4M61A 1K6QH 4GRMA 4Y19E 1VESA 3F7RA 2GJ6D 2P5ED 3D3VB 5EPMB 4N0RA 2XWBA 3FN9A 1XGQB 2NY7L 4BH7A 4DEPC 3NGBB 5CD5C 2FWOB 2YXMA 5BZWB 5C86A 1HHHA 3MRRA 3QFJE 4JZJC 4K9EL 4TTGA 4FQXC 1F3DH 3WFEL 3HMXA 1MJ8H 1E28A 2CMRL 2VQTA 3QZWA 2X9WA 3IDYB 2DQEL 1F45A 5HGBA 3WXVL 3EAKA 1FV1B 1P4BL 4M6AA 1OTUC 2WBKA 4KRMB 1NSNH 5K59E 3L3KA 4JQXA 2F58L 5CD3B 2YN5A 1RY7B 5I74B 4ZDHB 4KK9C 2HFEA 2QJDA 4LCCB 4P2OC 4PV8B 2FX8L 2MHAA 4AEEA 1FLRH 5EUOE 1ZS8B 4CDGC 1YEEL 5BZDB 3QO1B 4PJBA 3DNKA 2PYEA 5TH2B 3O3AB 2VDQH 4TVSa 1AE6L 2FDBP 1A4KB 4I3RL 1ERNA 5L2KE 4FABL 1BD2E 2Y4SA 1DQTA 3PWUB 1XGPB 5FM8A 3BH8A 1YNTA 1UVQA 4FFWD 3QFDA 3E6HB 4G9FB 5TDPB 2I5YL 1G0XA 4JM2A 3UX9B 5CHNB 2BHUA 4CBPA 3QCUL 3EYOA 4O2FB 2AXJA 4MXWL 4RAUB 4X99A 5EFIA 2G5BA 3AB0B 2AK4B 3OB0H 5CJQH 3EDEA 4P2QD 4JKPH 3OKDB 2IAMA 3V4PL 5T1KD 1F6AB 1HQ4A 3QUXC 4PRHD 4EEEA 2F8OA 1TTFA 4F8TA 2MQCA 3SDXB 4CN1A 5DQDH 1CL7L 1NBYB 1IGIL 4HLJA 1X4ZA 1UM5L 4XB7A 3IAGC 4AIOA 3MR9A 3WDJA 4QRTA 1E27A 1K3ZA 2X4UB 3AS1A 3MCLL 2E7LA 4JAMA 5IQ7L 6FABL 4ZAKA 3GSWB 3EO0A 5GJSL 4JO2H 3RY5A 1J5OL 2Q86A 5I1GH 4S1QL 2MPAL 4FZ8H 1MAKA 5LJYH 2JLLA 4XP5H 1NGZB 2HKFH 3PL6B 5HI5D 5HHOB 3HPJA 1U95B 2YS4A 5MENB 2VISA 2B1HH 1IAKA 1NAMB 3BXNB 4UMGA 1DL7L 3V52H 5T1LD 3MCKA 5I1CH 3INUL 1CDBA 3DECA 2Z9TA 1CLCA 1WEJL 4GKZA 2VYRE 3MA9L 3MRKA 4MAYD 3U4BL 4UB0H 3LRGA 3GB7B 5C0EA 1KXVC 2D7MA 2EYRB 2HG5A 2WBJD 4EJ1C 4JO3H 4V1DB 1QUNA 3QUML 3T4YA 5E1AB 2MQ0A 4HJGB 4IIQB 5C2UB 4OQTA 2OJEA 1U58A 2UZIL 1MQ8A 2CIIB 5BOPA 4FHBD 2HTKD 1PAMA 3CSYB 1FYTE 2EDKA 4K2UL 4PRIB 4BA8A 3ARFA 1WFTA 3UPRB 1AP2A 5SX5K 2XPGA 4J8RA 3CNKA 3O2WH 1DVFC 1JRHI 3LSOA 5HXMA 5DTFA 1LP9F 1ONQA 3LN9A 3RWIB 4LLVA 3IFOB 5IMMB 3Q5YA 4R7NB 2J8UE 4NHUA 4NKDB 2VDOH 2OLDA 3KPRD 3ECBB 5D1XB 1MCJA 1Q94B 5IW3A 1E6JH 5AD0B 1BGXL 5IB5B 3TBSA 5DMJB 2NY6B 4LHUB 2VDRH 4U1KA 1KPRB 4KK6C 3MLUH 4G7YH 3BWAB 3V6ZB 1XF4A 2DLGA 1G6RH 1OT2A 4MD0B 3VWJA 3K81A 4PY7B 1NEZB 3CK0H 2YSSB 3NFNA 4WI6A 4CMHB 1SEQH 4TNWF 3QWRA 3PWPD 1J11A 2BCKA 5GRUL 5E03A 4W4OA 5LWYH 1ZEAH 4UT6L 2V9QA 4D0CB 1ZT4B 2BK8A 3DROB 5GGSA 3T0BA 5KS9F 5CIPA 5CSGA 2HRPL 3KXFD 1T04B 4L4VD 3A6BL 4Y5XB 2BVOA 3BD4A 3HKFA 5GRXG 1KF9B 4P3DA 3DX9B 1SJHB 1WWAX 2NNAA 3NCMA 3O3EB 5IB4B 1DQDL 3OJMB 5F1NB 3N1QC 1BF2A 5J12B 4YE4H 4WFEE 5IQ9A 4K9EC 2BRRH 2F8XC 4QRPB 5F9DC 3NPZB 5BS0E 4MDIA 5D7LA 2X4TA 2CGRH 1K9TA 3BGFC 2GAZA 3MGOB 3P3YA 1MI5E 3CFEA 3GJEB 4Z7UF 1XF2A 2QSVA 3BGAA 2I9TA 4KDTA 2X4NA 2P5WD 2X9YA 3JTTA 3M17A 5HI4C 5D1ZC 3QO0A 1JPTH 4P2CG 3C6LC 1KPUA 1K6QL 1O5DT 1CD1B 2HLAB 3GBMH 5FM5O 2DWDB 2ZOKA 2GCYB 3G5VA 5IR1A 4GKOA 3MGAA 1JPGB 4KHTH 5C07D 2AI0L 1KTLB 4M3JA 3UTSE 1BJ1J 4ALAH 1HSBB 2E27H 3MBED 4Y4HC 1NUGA 1JK8B 3DUSB 1YEDB 5L6YL 1JN6B 3BP6B 1JGLL 1KIQB 2NX5D 1NSNL 4EVNA 1NBZB 4OUOA 5ID1A 3RWJA 1EEZB 2LQRA 3PV6B 4YNYB 1IQDB 4HKXA 5D6CB 4FXKB 4Y5VA 3X12A 5ETUA 5IT2H 1P6FA 3GSUB 4QGTA 1W72A 1DDHA 5FA3A 4L29A 4AEHH 3ARSA 4P9HL 3MJ9A 2C3GA 3IDMB 4Z7WF 5GISL 4JHWH 4ODHH 5ACMA 3SJVD 1FC1A 1ZOXA 2VDQL 5LGHH 2P42B 1T1WA 2KUTA 1AO7D 3THML 3WJJC 1QSVA 3OV6A 4HHAB 4MNGE 2VQ1A 4YAQA 3QIUC 2XWTA 3WHE1 1U8QB 2HFFA 3HC0B 1I8LC 2JJTA 5DMGC 3L3IA 4QOKE 1GGTA 2X4QB 4TUJA 4U6XB 5ESVB 1QSED 2YMXL 1ZLUK 1WC7A 1GOFA 3QG6A 3HE6C 4PJ7F 4FQCH 4U1IA 3MO1A 5ENWA 3WUWG 4ZS6C 5CP3A 3VFMA 3ZDXF 1P4LB 4JFZL 4PTTA 1S9VA 1CGTA 1DBKH 5FGCB 1U8OA 3S35H 2CKBA 4P46C 3RPIA 1TZIB 1UCBL 5I18H 3FO1A 4ESKA 1P7HL 1DN0B 1KTDB 5CJ8A 1J1PH 1J0KA 5HVHC 3OGOE 4KWUA 4XCEA 1RUAH 1WZ1H 3QEHA 4HS6A 2D4DA 1JGEB 2BNQB 5D5MB 3TYFA 4E41B 5C0DB 3C9NB 3TF7A 3FHAA 1YECH 2IJ0C 3S4SG 5FF6A 1NGXA 5J1AA 1Q9LB 2HKFL 1AGCB 4X6FA 4XAKD 1QVOA 4PYGA 3SKJL 1Z9MA 3QXDA 4IRJC 3HG1E 2WUCH 4PJIA 1X7QB 4U7SA 3C5JA 1A22B 3VG0L 1JBJA 4FMKA 3GI8H 4D9LH 3MJGX 3RUGB 4PJ5B 4L4TB 1Q0XL 3LN4A 3SQOH 1RHHB 2Y23A 2D31A 1KPVB 3DVNA 1XF3A 3HE7D 5I16B 1NCDH 5F9AC 5DJ6B 1HILB 5ILTL 1FAIH 4OI7A 1OL0A 3FB6B 5H94B 1IEBA 4XP1L 2VAAB 3WKNA 1EA9C 2BVEA 3O8XD 3EYUL 4JFFD 4AM0A 5DWUL 2XWJA 1UZ6E 3QUZC 4LLMB 5C71A 1V05A 4PG9B 5H35B 4A6YH 4DZBA 1CBVH 3MMEA 3GNML 3IJSA 5IVNA 4MLIA 5SX4I 4CMMB 5I1LB 3RA7H 4UQ3A 3MRGB 4C4KT 3L3HB 3QRFM 3DHJA 1F3JB 4NM4H 5IP4A 3OKOB 2IGFH 1QSFA 2EDNA 2J4WL 5D2LF 1HEZB 1IM9A 3C5ZA 3LV3A 1ZHLB 4OZGB 1V3KA 4M5ZL 3VGAC 2ADFL 4HIXH 1YQVL 1MRCH 1NANI 4IMKA 2Q1EA 3L3DA 5EO9A 2R2EA 4GRWE 5E2VL 3LKNB 5FYJE 5FV2A 4HWZA 4MCYA 3ZSTA 4FQPA 4BSVB 4GBXA 5M7QA 4UTAH 1ZHBB 2F74A 3L9RB 3BT2H 1P53A 4XCYA 4PD4K 3IDNA 1I1AC 1YEKH 5C92A 1ZEAL 3L6FB 5DEGA 4BQCA 2ADJB 1JI2A 4OV5A 4JRXB 1FZMB 2APTA 4ZUTB 4PJHF 3BKYL 4ZSOB 1QBBA 4HUUB 5C0BD 3T0EB 4X6DB 1D7FA 3VFPB 3PWNA 3PJSA 3ZYJA 2EDQA 5J9PB 4X0KA 4XNZC 3MGTB 5KN5B 2RR3A 1A7PH 4F33A 1AHWA 3KG5A 2DM4A 1MCPL 5EBWA 4MNQA 4LSTH 4M6OL 4AH2A 1N4XL 2Q3AA 1U92B 1UCTA 5C08E 1OP5K 4JCMA 4MJ4A 3GSNB 2LVEA 4NZJA 4HW6A 2B1AH 4JKLA 5TGBA 3RVXD 2XN9E 1SJEB 4I4WA 1AGFA 2DQIL 5F88A 1QFWL 2QQLH 3V6OA 1N6VA 4L8BA 2NZIA 2MSPA 2XFXA 4KUCF 1OB1A 1QO3B 2YN3A 5JIPA 2BC4B 2F54E 3MNVB 4N8VG 5D1QB 1IAOA 4LQFH 1EEQA 4PJFE 5D8JL 4PJGF 4XCFH 1L0XA 4DKFL 4WGVB 1JJUA 3G5ZA 4L3CB 3BHBB 3H0TA 1RZ8B 4X4XB 5EU6E 4TPRH 1QBMH 5BV7L 1CE1H 4NO2B 3I75B 4X6CB 4JB9L 1ZLSL 2F53E 1U8KB 2ARJQ 1F5WA 4AYFA 5EOCJ 4PRAA 4UU9A 3BUYA 4FFWC 4L9LA 5MHSE 1Y18B 3QJFA 3U9UA 3PNWB 5GGVY 4UBDC 5HHOD 4U1MA 4NJAH 1UH3A 5D96B 2EDJA 3LKOA 4S2SB 1DBBH 4YHKH 3B83A 1DBMH 4M5YL 4P4RB 5CEZL 1RFDL 2X1QA 3QA3B 4NZRH 3VFOB 4H1LB 1B6DA 1OTSD 4DK3A 4Y2DD 3TA3D 2R4RL 1NEUA 2IC2A 4PLKD 1BJ8A 5E8DH 3QDME 3ALXA 3S97C 4KZEH 5HDQL 5F8RC 5MERA 2P45B 3ARDD 2FHCA 4L8DB 1KJVA 5JIHA 4EUPA 1I9RL 2OK0L 5LGHL 3NVQA 3J8F7 3M1BA 2HT4D 1C5DA 3FRPA 2DWEB 1K8IB 5HSFA 4OSUH 2DB8A 3EOAB 4H88L 4OZFH 4PJXF 3D39B 4TSCH 5HI5C 2WZPD 4PRID 1FZOB 2C1PB 2JK5A 3VXPB 3JWOC 2FIKA 4KQ3H 3KNBB 3STZA 4RZCA 4XBPA 3O9WB 5DLMH 4ODUB 2CXKA 4MQSB 4HFUL 2AJXH 2VZOA 3RPKA 3DX8B 3VG9C 4MAYC 4L5FH 5D71L 2C1OA 5HHXL 5FO8A 4L8SA 5DJ2B 4HKZA 3SO5A 3WNLA 5JNYA 2WBJC 3O2DA 4K3EL 5T1MA 5I18L 4JFQA 5ITBH 5F70A 2NY6D 1OHQA 4LHUD 3ZLQC 3FJTA 2VNCA 1RUAL 2FJGB 3VXRD 2HTKC 2VAJA 1NCCH 4GLRI 4RFNB 4DTGL 5DD3L 3V0WH 1DSFH 5BO1H 3PGCA 4PRPB 1J8HB 3VGDA 3V4UL 4AG4L 4H8WC 1NC4B 3WFDL 4NKIH 1NC2D 4PJCA 4F9LC 4P2RE 4LBEB 4CVXB 3W5NA 3TO4B 3E8UL 1G9NH 3MNWB 3WS3B 1S7VA 4KXZI 4XPBH 1A3QA 1RVFL 3ZDYF 4EN3C 2ZSWB 1AXSB 1QFPA 4O5LH 1U8PB 4N0YL 2EDOA 1I9JH 4XP6L 3MLZH 1SY6A 1ZLWH 3FHQA 4IRSD 2NY2B 4D0DB 4HBQA 2P49B 3L95B 1F42A 3HC3H 5JW5A 2HAZA 4HZAA 4A6YL 4EOWL 4U1GB 2D7TH 1Y0LA 2OBGA 1CXIA 3QCVH 5IEKA 1EGJH 3MYJB 4F37F 5E6YA 5EBMA 3T3PE 3RA7L 3TFKD 3N85H 5T3ZH 1ORQA 2FECL 4XVSL 3X13B 3H9YA 3AGVA 4FQ1H 3W0WA 4R7DB 4LSSL 5E94A 3MXWL 2QBWA 3CH1B 1UWEL 5L8KB 2VLRE 3VXSA 5IBTH 2AJ3B 5BW7C 2FR4B 4RWHA 4NQCA 2BSRB 1ADQA 1JP5A 2G75B 4GXVH 3LIZH 1QZ1A 4HIXL 3KS0H 1TPXB 1JGUH 2ICWJ 4G43B 4PG2A 1E4WL 4L8CA 2VLJA 4U6YA 5KZCB 2PW2B 3GSVA 4PFEA 4MJ5A 2FX7H 3TN0D 1EZVX 4K7PH 5LGKA 2CDGB 5SWZB 1IMHC 1VACA 4R8WL 4HIEB 2ED8A 2LTQB 1EH9A 1ZHKA 2GTZA 2WMPA 2J7LA 5C0CA 4LSRH 4LIQL 3O3UN 3BT2L 5ALBL 2VXSH 4FFVD 1FP5A 5FUZL 3GJFB 3HAEH 3OKYA 5JOFA 4P23A 2Q6WB 3HN3A 5KSBE 5TE4H 1FO0A 5DZOA 5FGRA 3WHE0 4UT7H 3MRLA 5IB2A 3F12B 4Y19A 2X05A 4QHMA 5A3ID 4PGEB 4WW2B 1ZA3B 1XR8B 3S98A 4NSKB 2DJSA 2P5EE 1D5ZA 5C0IA 2J2ZA 3FTGA 5BV7C 1RUQL 2IPTH 3QFJA 4LVOB 4JN1H 4NYLA 5F6IB 1K5NA 4FRWA 5DJYA 3GBNL 1TFHA 1U93B 2NTFB 5EC2A 1SM3L 4Y88A 1EO8H 1JWMB 5I2IA 1AGBA 2H3NA 3LS4H 2B20A 2LVCA 2E9BA 4KMTH 1FJ1B 5KS9B 4XPGH 1NCBL 4ELME 4C57C 1T83C 4LQFL 4ZO7A 3NPSB 1UKTA 4LAJH 1YY8B 4XCFL 4XX1G 2Y5TA 3FO2A 4B7IA 1VFBA 4OCSL 1NGYA 3TYGL 2HJLB 5EUOA 5HJ3B 1FIGL 4TULH 3MLSH 3HRZB 4JJ5A 1I1FB 4HFWB 1D6VH 3RI5K 4M48L 1N26A 1F97A 4HZLA 1NGPH 4IOIB 5D7JB 2EZ0D 3BZFB 1ZGLB 1NAML 4Z7OF 1RZKH 4G6ML 5L2KA 4OCRL