3TBWB

Crystal structure of the murine class i major histocompatibility complex h-2db in complex with the lcmv-derived gp33 altered peptide ligand (a2g, v3p, y4s)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Conversion of a T cell viral antagonist into an agonist through higher stabilization and conserved molecular mimicry: Implications for TCR recognition
rcsb
source organism Mus musculus
molecule tags Immune system/agonist
total genus 14
structure length 99
sequence length 99
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tbwB00
3NTCH 4X7SH 5CCKL 1N26A 1YEIL 1T1ZA 2Z35B 1H8OA 3REVA 3VFSA 4X0KA 1MJ8L 4LMQI 3HKFA 3CFEA 4C59B 3IU4H 4U6YB 4O02L 4F57L 3PHQA 1JNLH 1GGIL 1F11A 3F7QA 5DVMA 1W8NA 5L2JA 4PLNC 2YR3A 1NAKL 3I3EA 1WQVT 3QHZL 3O6FD 4X9GA 4QRPD 4Z8FL 1FGNL 5IESH 1MNUL 3BSZH 4GKOA 2L4OA 4OZFG 3BZ4B 3D39B 4U6YA 4OFDA 5EBLA 5FF6B 5MEPB 5BMFL 4LOUC 5HD8C 4R3SB 5AYQA 4RGOL 1RAMA 1H9VA 4TULL 5F70A 1NFIB 2FD6L 4DVBA 5BRZD 1YEFL 2AJZB 1F00I 5KN5B 2VZTA 1NGYB 4BQ9A 4XPTL 1NDGB 3PDOB 3GSXB 1C5CH 3D39A 3TCXA 1I75A 5CP3H 1V3LA 3VXRE 5FF6A 5MEPA 5L6YH 1ZTXH 3LPFA 1H15B 1A2YB 5DA4A 3GBLA 4R3SA 4JB9L 1FVDB 1RIHL 4BSVB 1F58H 3DXAD 1MCNA 1K6QL 1RJLA 2F74A 5JO5A 1NGYA 4YE4H 3CDCA 5F6IC 4DKDC 4UINH 1XF4B 3PDOA 1CI5A 3GSXA 3AU1B 4PR5B 2VDRL 4KHXH 1IAIL 3KHQA 4NZDA 4WUUE 3WCYA 3SPVA 2JB5H 1A2YA 3TN0C 1YEHH 1XF2B 4M8VA 4CN1A 1F2QA 3QEGL 5L9DH 4OFPA 3C8KB 3WHXB 1O7VA 4LSUL 1FVDA 1MH5A 3N85L 2VUOA 4LEOB 4RGMB 1DLHB 4L8DA 4G5ZH 5DFVC 5C08E 5F3BB 2EDJA 5EUOB 2ED9A 3H3PH 4Z7WA 3QXTA 3TESA 1IC4L 1T80A 5E6YA 2WK2A 1XF4A 2NY1C 1IVLA 4QXUH 3MLXH 5FM5O 3AU1A 3FFDB 2IQ9H 4PLJD 4JFPA 4PR5A 1CL7I 1IE5A 2VN4A 3T0BA 1WJ3A 4UT9H 4E0RA 1VERA 4O00A 3RZWA 1NDMA 2YWYA 3IS0X 3C8KA 4LEOA 1DLHA 4M6OL 4MQXC 1R3LB 1XIWD 3MRDA 4XNMB 1CBVH 4ZTPH 5EUOA 2JK5B 3F12B 5I8OH 2DQEL 5L7XH 2ADJA 2C7UB 2J8UE 4G80A 1BOGB 2BFVH 3PWPA 2Q8AH 1JUFA 3U48A 4WJ5B 5J6HB 1WZKA 2EDBA 2X9XA 4ZYKA 4LAQH 1FSKB 3WDIA 1GXEA 4D9LH 5T1LD 1XZ0B 1DBKH 1SVZA 3PQYA 1YEGH 1IEHA 1KEGL 1IQDB 5D7KD 1KIRB 3LMJH 1KEMH 1KLUB 1R3LA 3ULSB 4XNMA 3PGDA 2JK5A 3TNMA 1FPTL 3EJJX 5MI0B 1BPVA 2C7UA 1BOGA 5HYJE 1HHHB 1QKZL 3G6JB 5EWIH 1MIEH 3X3FH 3KXFB 1U6AL 2HAZA 3BKCL 3RU8L 3VFWB 4EOWH 1ORSB 3EYSL 3SDAA 5GSRA 5CJBA 4W6XB 1OAKH 1AC6A 2J4WL 1KCUL 4YC2C 1KIRA 3SOBH 1KLUA 4X7EC 3MNVA 3K4AA 1FAKT 5F1OB 1MREH 1MWAB 1YY8B 2OMNA 1HHHA 3MXWL 4G6KL 3G6JA 4KMQA 5ALBL 5GJTL 1S9VB 2W9EL 1PGRB 4RGNE 3O6FC 1ORSA 3MJ9A 4YQXL 1BMGA 1C16A 3FAXA 1A6WH 1MY5A 5CEZL 1BF2A 5MENB 2NY2D 5C0AE 4TRPH 3F7YA 4UIKH 1EIBA 5I66B 4CADB 2CK0H 3NCMA 5DRNB 5ADPH 5KG9B 3ALWA 2XA3A 5DD6B 4NZUL 3GB7A 2IPTH 2Q76B 2F5AH 2DKSA 2PR4H 2ADGB 1K4CB 1QRNE 1RJCA 1S9VA 4S10A 1NMCB 4HWBH 2FHCA 5B3JE 4OZHF 1IGIL 1LO4L 1S7WA 4HZLB 3C5ZA 4FFZH 2Q7NA 3SY0B 4BQBA 4EXKA 2X9YA 1JGUH 3QDMB 4FQCH 5BXFA 4NQVB 2E7LC 1E4KC 5DRNA 3JV6B 3T3PF 3REWA 4PRIB 4CKVX 4CMMB 5DD6A 3OG6B 4ZO7A 2AJYL 5FM4A 1UM4L 4PJFF 5FM8A 1LO0L 3WIIL 2Q76A 3H7BB 2ADGA 3QISA 4MCZB 1T7XA 1ZOXA 2BNUB 5C9JB 3GM8A 4WVRA 2NZIA 3DV6B 2EIDA 2XQBH 4P59H 4MNQB 5HGBB 1IGJB 3SDXF 1OPGH 3QDMA 3PP4H 4NQVA 1PKOA 3HI5H 1DVFA 3JV6A 4ZMAT 4PRIA 4H1LH 4CMMA 1U0QA 3DX9A 1PVHA 3H7BA 2YN5A 4AL8H 5T5NG 4MCZA 4QXWA 5C0EB 2FSEB 3IKCB 5C9JA 4JPIA 2MQCA 1F42A 4HHAA 4XP1H 4I9WE 3WLWD 5KSBA 4HF5H 1BBDH 3DV6A 1T6VN 3C5SB 1OP5K 5HGBA 1IGJA 1BP3B 1I85A 4OFYA 2VITA 3BKJH 4ERSL 5J9PB 2GSIA 3GRWL 1DFBH 4PLJC 1PG7X 1ZLSL 2BNQD 4Y4FB 3OGCB 1MCKA 3G9AB 2AABH 1VADB 3MBXH 4MJIE 5EU6B 3RY5A 5I8KL 3RBSA 5C0EA 2CIIA 2FSEA 3DVNA 4KROC 4ONHB 3NABH 5GRUH 4GXVH 3WIHL 1MFBH 1TNMA 3C5SA 2D3VA 2HJLA 1OF2B 3I50H 5FO7B 4BZ1L 2KUTA 1BQHB 4ODHH 2XFXB 3DETD 4XBPA 5JIKA 4BK4A 4EJ1C 2AJSL 4N8CL 1VADA 1I9IH 4MXWL 4PGDB 2DJUA 1EV2E 4XPBH 5E08L 2CDFB 4ONHA 5IHBA 2R69L 1QSVA 3OKYA 4PV9B 5C07A 5I18H 5CBAA 5IW1A 4LGPB 4ETQB 3T2NH 4GAFB 1ZANH 5FO7A 3P40A 3NA9L 5L0QC 4RFOL 3IAPA 2XFXA 3MRGB 1N5YH 3B2UD 2Q86B 3E0GA 4U1HA 32C2B 5E8EB 2P8MA 4WI3A 4PGDA 1KB9K 1KTKE 3GMOA 2UZIL 4XNZC 5CP3A 5ERWA 3M8OH 1FLRL 2CDFA 2CGRH 3B3IA 2Y5EA 4OF3A 1ND0B 4XMPL 3FONB 3BWAA 3NZHH 4PV9A 3VA6A 3ZKSD 4IMKC 1C5BH 1EBAA 3QSKB 3K80A 1U8JB 4OIBA 5LQBH 4ETQA 1SMOA 2VLKB 1CD8A 4JG0H 2Y9RT 2R0ZH 2MTPA 4H8WH 3EYFA 1L6XA 3MUZ1 4UDUB 4QTIH 2Q86A 3O4OC 4FQLH 32C2A 2CQVA 2OI9C 4FQXD 2F54D 5DHVH 5HPOA 3FHQA 2VDNH 3SBWA 3C2AH 1ND0A 1OW0A 15C8L 1REIA 5FYJD 1NUDA 4ODUB 4RFEB 3S4SA 1U8JA 1K9TA 4K3JH 1GPOH 4JR9L 2VLKA 3LQZA 4U6TA 5CJOL 3QO0B 5DVOA 4GRWF 3ZYOA 1A7PL 4LVOB 1EGJH 1MRFL 5JA9A 4OD1L 5EO0B 2VR9A 4P5KA 3AB0C 4WI9A 1RHFA 2X89D 4FXGB 4YHKH 25C8H 4RFEA 3MNZB 3VG0L 4LCCB 4QGYA 4U7MA 4U6HB 4FQHA 3SE4C 3QO0A 1Z9SA 3H9SE 3C6LD 2ZNXA 1CFNB 3D85D 4L8SB 5I1AB 2OXHA 1UB6B 4P2QE 3SJVA 3KPSD 4XPFH 4JFFA 5D1XA 5EO0A 4K9EL 1G7QA 2XPGA 1TPXC 3H42H 3SGEI 1XEDA 4ZTOL 3MV8D 5DVLA 2WP3T 4FXGA 5ACLA 1IFHL 2QQNH 2O61A 4HBCH 1JFQH 3DUSB 4U6HA 4G8GD 3BZEB 1BJ1H 3T3ME 4UQ3A 5J6GA 3NZ8B 2AW2A 1TJGH 1IEBB 4X6CB 3WLWC 4DZBA 3RVUD 35C8L 4YHNB 2F58H 1NUGA 5FYJL 4AQOA 3B6SB 5SV4A 1CTOA 3DUSA 4MD0A 5LGJB 4G43A 3BZEA 4KRPB 3DWTA 3P4OB 4P49A 5A16B 1KNOA 3NZ8A 4JN1H 2VXSH 4KKBD 4M61A 4X6CA 1IAOB 1N7MH 5DJZB 2R2CA 3GM0A 4KMTL 5CJQL 1CFSB 3L5IA 1ZT4B 3HC3L 4DW2L 1MQKL 3DETC 1MIMH 4RISH 2ARJB 1C7SA 5L8JB 2B20A 1CG9B 1I9EA 3BE1L 5DJCB 2Y7QB 4XHJC 2A9MH 3P4OA 5ALCL 2W60B 5EORH 3WJJA 5IVNA 1DLFL 4JFDB 1AHWC 2YC1A 3M17B 5DJZA 4KVNL 3VWJA 4OB5H 2CLVB 3MODH 1EFXB 4HWBA 4RRPG 2ARJA 4HFWB 1DSFL 1CG9A 3B2UC 3IJHB 4OLVL 4CW1B 3FKUS 3ORJA 4U1SB 2Y7QA 4K9EC 1CLOL 5SWSE 5IMLA 2P48B 3P4NA 1RIVL 4JANB 5J7CC 4R97B 2NPLX 4AENB 1Z6JT 2QR0B 4JFDA 3M17A 1VFOA 1SBBA 2NY3B 3HUJA 3RA7L 1CQKA 2AV7B 2FECI 2GFBB 5F7WC 4ZUTB 3IJHA 3FQWB 1CGSH 4CW1A 3MA7A 4FQXC 4LPYA 5BV7B 3CVIL 3X3GL 1JYNA 1G7IA 3EW3B 4H1LA 4JANA 2CKNA 4LAJH 4YDIL 2GJZB 1T1WA 3HG1E 5CZVH 5E99H 4XNYL 2UUDK 4KH2A 5IB3B 1A4JB 2AV7A 1KT2B 1NANH 5DJAB 5JDSB 3PXJA 1UEMA 3DECA 4B50A 2GFBA 3DYMA 2EH7L 1MCDA 4ZUTA 1KCVL 2FIKB 3D0VB 1WEJL 4HK3J 4MQ7B 3OF6D 2H32H 3V7AG 5TQ2H 3VD7A 2X9WA 3CFKA 4NQCA 4C56E 4EIGB 5E94B 5C2BH 2GJZA 1A5FH 2Z92B 2YD5A 5SWZE 1F4XH 5IB3A 1A4JA 2E9BA 4F9LA 5DJAA 1DUYA 3ILPA 3MBEB 3FO1B 5JUEL 3C6LC 2IFFH 2XTJB 4XZUA 3WNOA 2Q6WA 2FIKA 4U33A 5DLML 2G60L 2PYEE 1QACA 4MQ7A 2V7NB 5IFHL 1XF5B 3A6OA 3INUL 2P5ED 5DTFB 3GO1H 3L3JB 4AZ8A 3MOBH 3NH7L 2Z92A 2QTEA 1I1AB 4X6DF 4HIHB 1QBML 1A47A 2VXTH 2ZCKH 3VCLB 3MBEA 3V4PL 3FCTB 5D1QA 4LNRB 5EZOL 2YBRB 3QDHA 4UAOB 1PQZB 3RVUC 4EXPX 4NP4H 4I77L 1XF5A 2AEPL 3NBNA 4PJDF 5DTFA 3RY6A 1NBVL 3KR3H 4G7VL 4PJCF 2GJ6B 1ACZA 5EOQL 1G7HA 2AK4D 4HIHA 2R2BB 4JHWH 2FYYB 5EBWA 1B0WA 4EI5B 4LNRA 3NACL 4CMHB 2YBRA 4KHTH 4KKBC 1PQZA 2BK8A 4UBDD 4XCYB 2XZCH 3SGDH 1W0YT 2B1HL 2GHWB 3BN3B 2RQ8A 3LS4H 5IJKC 2GJ6A 4OZFH 5H2BB 4UTBL 5T1KA 3GSUB 2OTWB 1MJJB 4KK6C 4PLOB 3R8BB 5IVXF 4F2MA 4JDZB 3WXWL 3DX6A 4EI5A 4YPJA 5CIPH 2JE8A 1CR9L 1U8IB 5FYLE 5HHOD 4QHKI 4R4ND 1VGKB 5IHLB 3RUGF 3WFBH 4FP8L 2C1OB 3BEVB 1P4IL 5FAAA 4PY8J 4ZFGL 3GSUA 2HFFA 4KI1A 4WFEE 4DTGL 5E5MA 1MJJA 1SBSL 2FHFA 4ZXBB 5HDQH 4FXKA 3FB5B 1U8MB 2OL3H 2NLJB 4UMGA 1D6EB 1RULH 1OAYH 1T89C 3CH8A 1MHPL 3WD5H 1U8IA 2FATH 4ELMB 3TJHD 2EDHA 4QOKB 3P11L 3GI8H 4H88L 3SN6N 2P8LB 1WWAX 2C1OA 4WFGD 3KPTA 1ZLWH 2G5BB 1WIUA 5FGBC 3GIVB 4OZHE 4ZXBA 4WHDA 3SKUD 3A6CL 1U8MA 2NLJA 3AS2A 1D6EA 2XZZA 4LGRB 5DJYB 1AQKL 3OSKA 3MGAA 4OIIH 3ZO0A 4EDXA 4LCWB 4QOKA 3AUVA 3K74B 3T3PE 3HNSH 1L6ZA 2P8LA 3BP4B 4PJFE 1S3KL 3VXRA 1EO7A 3OKOB 5E2JA 1RMFL 4K94H 3RX5A 3GIVA 4Q6IC 3GNML 3HZMA 5DJDB 1BEYL 4KY1L 1U9KA 2E7CA 3SQOL 5DJYA 1NUFA 1QYGL 3ARDA 3SDXE 1B2WH 1VPOH 4HULB 1UM5L 4LCWA 5D8JL 1KTRL 4F9PC 2X6MA 3NPSB 1XFPA 4ESKA 2OR7A 2IPUG 3OKOA 4PYHA 5M7QA 4K3EL 5ESQB 4M1GH 3L7FB 5DJDA 1PY9A 4D9QE 1HKLH 4AQ1B 5DRWB 4CVWA 1CE1L 3WIFB 2EICA 5D96B 4R9HA 2R1YB 1MHHB 2J8UB 1INDL 4JM4L 1G6RL 3IJSA 5GHWL 1ZEAL 5BZDA 4M7LH 4BELD 4DAGL 4K2UH 1EHLL 1IT9L 4KRMB 3SKOA 1NGZA 5FO9B 4DFIA 2C3VB 1EAJA 3WIFA 2AJUH 5C0JA 3EOBA 4ZUUB 5AWNH 2R1YA 3BKML 3T0ED 2J8UA 1KJ3H 5JORA 5GGSY 1MI5D 3I2CH 4NQXB 3UTSB 2V9RA 2L0DA 1UT9A 1IC7H 2Z4QB 3MRLB 4M7KL 3FO2B 1CLYL 1OM3H 1VACA 1T66D 1UWEH 5K59F 4UBDC 1YQVH 5FIEA 5I1KH 1HHKB 4TNVF 4HQQL 4I3RL 2MWCA 1LDSA 4KMLB 5HYJA 5I73B 4NQXA 5C0BD 1CGXA 4U1JB 1EK3A 1R3KA 2Z4QA 3MRLA 3WUWB 4AMKL 1O0VA 5E7FA 2FO4A 5D7IB 5KVFH 4R4NC 2VZSA 3OHXA 3ZKXB 3D2UA 1HHKA 2Y5TB 1YMHB 1QSEE 1HQRB 2NQCA 1E6JL 1SJXA 2H32A 2P5WB 5MERB 2R2EB 4U1JA 5C70A 3U0WL 3KJ4B 1OLLA 3WUWA 2FWOB 2DDQL 2UY6A 3ARQA 3TT1L 1EVUA 1Q0XH 2J88H 4H26A 5B38A 3WN5A 2D03L 1NLBL 5D7IA 3SE3C 1UFUA 3DURB 4KQ4L 3TJHC 4HX1A 1M05B 5C0AA 1BLNB 1LK3L 1YJDC 2Y5TA 3EFDH 1JZ5A 1YMHA 1MCEA 4DFHA 4PRHD 1HQRA 5TDNB 2P4AB 4C57C 4GRWE 4RWHA 2HFEB 2R2EA 1MRCL 1HNFA 1HINL 3KPMA 5BVJB 5CEXB 2PYFA 1QPXA 1RSFA 4JFYB 3DURA 4YX2L 1M05A 2LAGB 3HRPA 2JB6A 2XY1A 1MSPA 3QAZC 1QNZL 4JVWA 2NY5L 4BFEA 5TDNA 1QSFB 5I1JH 3T4AA 3FT2B 2HFEA 3VMNA 3S8WA 4YFLF 4MJ6A 5CEXA 4D2NA 4OFKA 4OZFB 4JFOA 4TUJA 5F8QC 3HMXH 4N1CA 5FYKD 2AV1B 4UILL 4ETYA 3C09C 1CICD 1IGTB 4WWKB 2EYSB 5CIPB 4HS8H 2YZ8A 3DYOA 4EN3B 4OQTL 3FT2A 1OVZA 4M7JL 2HLAB 1DBJH 3SO5A 5F9OH 4MB5A 4ZOAA 5IVOA 4LIQH 4OZFA 5TJWK 4JHBA 3V4UH 3DSFH 2LU4A 2Z8WC 2R39A 3B9EA 5CP7A 3C9NB 1IGTA 4WWKA 2EYSA 5CIPA 4LLWB 3ZE0F 4EN3A 3SDDB 3OPZH 2HLFD 4IRJB 4MJIA 5JLZB 1UVQB 2EYTA 1PBYA 4AIZB 3LY6A 4Y4KB 3F6IA 4HJJH 4P23B 4X8JA 4XNUL 3BXNA 1AE6H 5C0IB 3P4LA 3QCUL 5TE7H 5GQBA 5AAMA 2OL3A 1F4AA 3KNBB 2OMBA 3K46A 2H1PL 1S7VA 4LLWA 4HK0B 2VDPL 2EC8A 3NCEB 4WW2A 3UBXB 1O5DT 1T66C 4IRJA 5JLZA 1UVQA 2JJSC 4NUGL 1S78D 2VWEE 3BWUC 4U7SA 4P23A 5C0IA 5K9JL 2VJXA 3Q1SH 2NY5C 3MV7E 2VERN 3FN0L 5FYKL 4LVHC 1RU9H 4ZUSB 2P42B 3KNBA 3O8XD 1QFPA 2IBBA 4JZNA 3QBTB 2X1OA 1OOAA 3ARBB 1R0AL 2PO6B 1OGTB 5JHDD 3CX5J 4YHIB 4IIQC 3OAUH 5F71A 4MGXA 4BFGA 1RZGB 4TNWF 3ARFA 4Y4HD 5F89B 5J0BA 4ZUSA 2DBJA 3MA9H 3IFNL 1HH9B 1MCOL 4N1HB 2FDBP 3BZFA 3TM6A 1MELA 4QWWD 1I9RL 3UTTD 2OK0L 2DBLH 2P7TB 1LD9A 1DZBA 3ARBA 4OZGF 4PBVC 4XCNA 5KSAB 4YHIA 2XZAL 2DM3A 2HRPH 1YQ2A 5F89A 5FYLH 1IJ9A 5HPMB 3EOTL 4P2OA 2X1QA 3H9SB 1IM3B 1HH9A 2E9IA 3HI6H 3MR9B 5IMMB 3SDCD 3O11B 2DYPB 5MP6H 2P7TA 2W9DH 5B4MD 1AI1H 2XWJA 1T2QL 3QQ4A 2B4CH 3V9FA 5KSAA 3U9UB 1NFKA 3WLBA 5HVHB 1KV3A 5FOJA 4HT1H 4FHBD 4G9FE 5GS0H 5E2VH 4QT5B 2EDTA 1R3HA 2IALB 1G1YA 2DM4A 5HPMA 5DR5H 2V5MA 4XXCA 3H9SA 1IM3A 3MR9A 5IMMA 2BCKB 4P2QA 5JQ6L 2AVGA 2DYPA 3NFNB 5GJSH 4YHLL 2GY5A 1NMBH 1MY7A 1I3VA 3U9UA 1CICC 5INCB 5C71A 2ZG3A 4X6DE 2DIBA 1ZVYA 2CJUH 4ONGH 4S1DD 3OKLB 3G5YA 3KPNB 2IALA 3D39D 5IWLA 2H2SD 5DMIH 1OSPH 3KLAA 4WI7A 3T4YA 3MLVL 4PJDE 2ESVB 2BCKA 3WFEH 5I19L 3NFNA 3OXSB 4O5LH 4M5ZH 4PJCE 4JM2B 3DO7A 2FGWL 3UZEA 3RY4A 1A0QL 3O2VH 5F96H 1LO2H 5DVNA 3H0TB 3EDKA 2HLFC 4PUBL 4QRRB 3RAJH 3RWJA 3SHSA 5JNYB 4XVSH 2P46B 4HKZB 5EZJB 1ZKAA 2PNDA 2ITCA 2D7TH 4NQEB 5C0ND 3OXSA 3VFRB 5IOPB 4I0PB 4Y19E 1WF5A 4XP9H 5SX4I 1ZHLB 4N0CD 1JN6B 3GMQB 5IVXE 3QYCA 3RDTB 1ZV5A 4QHMA 3C8DA 2ZKHL 4YWGH 3WE6A 1PX4A 4QRRA 5JNYA 1TTUA 5DF0A 3Q5TA 1S78C 5SWSB 4KZEH 1MAML 3RUGE 4PBWD 3D5OF 5B22A 3PWUB 3VFRA 3N1FC 4KQ3H 4JVUA 1BZ9B 4HIIA 3EYUL 2EIBA 4IRZL 1DCLA 5EA0L 2BJMH 4OBSA 1JN6A 4F8QA 3VFUB 3RDTA 3R0NA 2WBWB 4FZ8L 4U6XB 4WU5B 2EC9U 4I4WB 2RBLA 5SWSA 1R5VA 4OD2A 1T04A 4HWNA 4YBQD 5T3ZD 4OLWL 1FFNB 4WNQB 8FABA 3CDYA 3PQYD 3MOAH 4Y4HC 4HMCA 1BZ9A 2EDQA 1DQJB 1X6LA 1BF8A 5AUMB 3J8F7 5IHZB 3VFUA 3R1GH 4PGZA 4QWWC 4WV1C 4YHYC 1KN2L 1W0WA 4U6XA 4WU5A 2YRPA 4I4WA 1T03H 5ITFB 4YUEH 3MLWH 4PJIB 2ATKB 1WIPA 4OLUH 2VIRA 4C56B 1KELH 1LO5B 3FAWA 3B2VH 3BP7A 4ZAKB 2P43B 5HYQB 4GW4A 3FN9A 5IHZA 3UJIL 3SDCC 1H3XA 2X4RB 1KPVB 5B4MC 3KXFD 5ITFA 1UENA 4YDJA 4PJIA 4QTHB 3CPLA 4C56A 2EDYA 5CD3A 5I8EA 4PV8B 5SWZA 3PWVA 4P2RB 3SQBA 3TNNB 1OAXL 4ZAKA 2NY0B 5HYQA 1NC4A 4EZMA 4YDVB 4XWOD 3VD4A 4UTAH 3QEQB 3RNKA 4X6EB 2PYEA 1KPVA 5DHXB 5FKPA 4GRWH 1JPTH 1J0HA 4QTHA 5T3ZL 3TBVB 3P30H 4F7PB 1EA9C 2EDLA 5I6XB 5I74B 3TZVA 4B5EA 5MEND 1I1RA 4JO4H 2CLZB 4KJWD 4V2CB 3TNNA 3RHWK 3EO0B 2H2SC 3EHBD 3OTTA 2IH3B 4GJTB 4QRPE 4OI9A 2HFGL 4CDGC 2AXFA 3QEQA 4HKJA 3MLUL 4HGWA 1J5OL 4PJ9A 3OKMB 4YAQB 3EGSB 1LEGB 4F7PA 4FMKA 2CLZA 2DIAA 3K81A 3T2OA 1U36A 3QDMD 1F6AA 5GRXG 1HWHB 4U1GB 3VXTB 1A6AA 1EHNA 5K59E 4PRID 1M7XA 4XNXH 4M4PA 3W2DL 3ZKMD 4R26H 3CDFA 5TFSL 4WI4A 3WFCL 5BZWB 3OKMA 4YAQA 2HT2C 3U9PH 4XX1G 3MJ9L 3HA0A 4N0CC 1LEGA 3UPRA 2Z93A 4WEBH 3CCHB 3MLRH 5IFAH 1LWRA 4PB9H 3UTZB 4MNQD 3H6JA 1JJUA 1MCFA 4Q9BA 1HQ4B 3BHBB 3VXTA 3K1DA 1MJ7H 1AGBB 3ZTNL 1MWAL 5GSVB 1CWVA 1KYOJ 1JK8A 1JRHH 5GGQH 1FHGA 5BZWA 1F3RB 1J88A 4QRUB 3EO9H 3CCHA 3TJEL 2QEJA 1XH3B 1I4FB 3E6FB 2VXQL 3BHBA 1JHLH 4UQ2B 4G8FB 4Q9QL 4Y4FD 4YBQC 5DD1H 3IDNA 5F3HB 3HS0A 4JFHD 2B1AH 3DBXB 5EU6D 1PZ5B 3SKNB 1T21A 4XC3H 2D9CA 4J2XA 5IB1B 4JRYB 3GDBA 1AD9B 3QXWA 1XH3A 5DI8B 5FCSH 4DVRL 1MJUL 4KGLA 4QY8A 1EXUA 1M6OA 5DJ2B 1E4XL 4JDVB 4UQ2A 4G8FA 4RAVB 1G0DA 2Y36H 3MLZL 1CK0L 2FR4B 1ROWA 5F3HA 2YK1L 1CDGA 3P0YL 1PZ5A 1G0YR 1H8NA 3QUZB 3SKNA 4PJFA 2E7HA 2DQFB 4CRPA 3TYGL 3RZCB 3NTCL 5TE6H 4BSWA 5DI8A 4OGZA 1VFAB 5D7KE 2I9TB 3EDJA 2OZ4H 5CKAA 3FHAA 5E6ZA 1OAQH 5TGBA 4KVCH 3IU4L 4I2XB 4I48A 2YXFA 4RRPA 3IS1X 5DYOA 4EQ2A 3L3OA 5IW3A 3D87B 1JNLL 3JV4B 3UDWA 2DQFA 2VSDA 1QLFA 3RZCA 2AJXH 2VLKD 4HFUH 5CFHA 1NL0H 5DSCB 2VL5B 2NR6D 1VFAA 3RWGB 3WKMH 2I9TA 3F5WA 3S35L 3B8SA 5IESL 2XKSA 4LQ1A 3ZE0E 3TVMB 1Q1JH 4A2MA 3JV4A 2MFNA 4MB4A 3EHBC 3PHOB 1QFUH 3Q6GL 3D18A 1DL7H 5DSCA 3WO4B 1CDIA 4KTYA 3P2TA 1NMCC 3TP4A 1FIEA 1LEKB 3D9AH 1C5CL 2HN7B 1DBMH 5LWYL 4L3EE 4U6VH 1NCNA 5JW5B 5L6YL 1J1XH 2EXWD 2VTFA 3LKNB 1DVFC 2IH1B 1RJYB 3ZKMC 4GMTH 1F58L 1NUNB 1IAIM 5E7BA 3KPRB 4YE4L 2EH8H 1LEKA 4MD4B 4UINL 1TENA 3RI5K 1KC5H 5E03A 1NCTA 5JW5A 1I85C 4U1MB 4HXAH 4KHXL 5HHQB 4OF6A 3LKNA 2JB5L 1RZ8B 1YEHL 1RJYA 5L9DL 4R0LA 2NMSA 3VFNA 3UTOA 3KPRA 3H3PL 4H25B 3DX8B 7CGTA 2YD1A 3CX5K 3L6FB 1LP9F 4MD4A 1QSEA 3ME0A 3ZDYF 4WHYG 4GUPA 5IG7B 2IQ9L 4QHUB 2DM2A 2FX9H 5AZ2L 4U1MA 3BZDA 3EBAA 5D7LB 2BXYA 1RZ8A 5D5MB 3BPCA 4UT9L 4LPTA 4OZGE 4Y4FC 5IBLC 2O5XL 3V0WH 2YD7A 4S1QH 4KRPD 5E70A 5DQDH 4ZTPL 1CDUA 3RVVD 5I8OL 5ITBH 2BNQE 5L7XL 3QI9B 1A1OA 2BFVL 2YA0A 3U4EA 5GGTA 4LFHG 2Q8AL 3IXAA 5IG7A 1A6VH 4J1UB 4LAQL 5D7LA 4D9LL 3UJTH 3WFDH 1DBKL 3FB6A 4JREB 4JKWA 5KVEH 3L1OL 4XX1E 3GBMH 2NZ9D 3HLAB 3LMJL 4TPRH 5L88L 1J7VR 2OQJA 4TQEH 3QI9A 4O02H 4JFDD 2A6KB 4K3HA 5EWIL 1ZSDB 1MIEL 1EMTH 3QCTH 1GGIH 3X3FL 3WNNA 5HHMB 1EFXD 4LLQB 4LEXH 3RBGA 1VEPA 1LEIB 1U2CA 3HPJB 3OX8B 1OAKL 3UYRH 5FDWA 2XWBA 1IBGL 2ZG1A 4GQ9H 5GS1B 2H8PB 5DFWH 3SOBL 4GRLB 4NQTA 2WBJA 2CXGA 3SBWC 1OW0C 5DD3H 5ICXB 5D1ZA 1ZAGA 4PJGF 4FN0A 2NY3D 2NR6C 3PABA 4LLQA 2A74B 2A73A 2J6EH 4EUPH 4RMRA 1A6WL 2FD6H 1LEIA 3HPJA 1Z3GH 4XMKH 3OX8A 5GGVL 5IW6B 5GGVY 1SHMA 5GS1A 4UIKL 4GRLA 2CK0L 4JFEB 2YUWA 3ULVD 1CD9B 1BFOB 1IGYA 2IPTL 3VDBA 1L4IA 5E2WH 2F54E 1TXKA 2F5AL 5L2KB 2G9HA 3IF1B 3WNPA 2IAMB 1TZHB 4HWBL 4ORZC 3HN3A 1F5WA 5KANG 1L0YA 1AR2A 1MCHA 1OWRM 4LVOC 4Y2DA 1JGUL 1BJ8A 4WEUD 3M1BB 1HN1A 4S2SB 1IILE 2Q7YA 2VNCA 4HLZG 2EXWC 1JHTB 1BFOA 2CUHA 1BREA 1IAIH 4LCCC 2Q3AA 4QHKJ 2VZUA 4KKAD 5L2KA 3IF1A 3GMNB 4JQVC 2A6DB 3NN8B 3O6KH 3N0PB 3MBED 2X4QB 3I6GB 4J3TA 3U0TB 4L8SC 2XTJD 3MCG1 4PP1D 3LRSB 2B7DT 1M7IB 2XQBL 4P59L 3D1MC 4MAYB 1OPGL 3U83A 3PP4L 4I18B 3RWFB 1N4XH 3W9DA 3HI5L 4S2SA 1V3JA 1AO7B 4APQB 2CR3A 1RZ7H 1ZMYA 4AEEA 3KPSE 5EIIB 3WS3B 1WWCA 1I1AD 4NN5B 1CD1B 4X6BB 5CAYB 3ZDXF 3QUXB 4AL8L 1KBGH 1S7QA 3GMNA 3NN8A 1T3FB 2NYYD 2X09A 4HKXA 1IC1A 4OV5B 2I9LB 2X4QA 4XP1L 2EDDA 5J4MA 3HR5B 4HF5L 1Y18B 1Q8MA 1HZHL 1M7IA 4MAYA 5BV7L 2XTLA 4PGJA 4R6UA 3BKJL 3RWFA 4NC2B 1KJMA 1DFBL 1M71B 4Q9RH 2ZUUA 4IDJL 1CF8L 3TWCH 4Q58C 3ULVL 1JZ8A 3MBXL 2AABL 4OLYL 5EIIA 2GJ6D 3WS3A 5T1KD 4X83A 1CVSC 1CD1A 1WFOA 3QUXA 1FNFA 1S9YB 1T3FA 4OV5A 5GRUL 4F37F 4EI5D 2JF1A 1UH3A 3RVVC 1S9WB 3HR5A 3WJJC 5FFLA 3ARSA 1FPTH 1S7RB 4HAFA 4X9FA 1Y6KR 2Y25A 4IOFD 4ODHL 1M71A 3VWJC 5ID0B 1CZ8H 1A22B 1I9IL 1ADQH 1IARB 2RIKA 3EYSH 4XPBL 3IGAB 1MPAH 1S9YA 4OZIF 5I18L 2CKBB 1KTDB 4P5TB 2CLRB 1S7RA 1QA9B 4QNPF 4M9OA 4UV7H 5DDHA 1N5YL 4H20L 5GRJH 5ALBH 1IZJA 2HJFB 4OLXH 5GJTH 2BC4B 1D5MB 4ZFFA 5HVFB 3IGAA 4YQXH 2CGRL 4ZXBD 3MJ7B 3NZHL 3KYAA 3VXOB 4L4VB 1KGCE 3MRCA 3G6AA 3OR6B 4P5TA 4R97C 2CLRA 4KZDL 4U2ZA 4JG0L 1QA9A 5DQJA 4QOKD 4H8WL 3Q6FB 4NDMB 4QTIL 2HJFA 2OSLB 5K9KA 3U79A 3E2HB 4PJDA 4YNYB 1IGIH 4AM0B 4HMEA 5BV7C 4Z77B 4PJCA 3VXOA 3CFBA 2R8SH 4NZRL 4K3JL 1GPOL 3ULVC 2AKRB 5IB5B 4LCWD 4J3OC 4PJBF 3Q6FA 1FG2B 4NDMA 4F9LC 1LO0H 3CXDL 1KJVA 3UPAA 3AREB 1XGYL 4WTXA 1IAKA 25C8L 4PJ8A 3MC0A 5CHNA 3C08L 5IVXA 5CZXD 1FBIH 1MCLA 4KKAC 4UB0H 4YBLB 4Z7VB 3MBEC 4XPFL 2XTJC 2VLJB 4PP1C 3ALXA 2MCPH 3RUGA 4UIMA 3AREA 3H42L 1P9MA 1KYOK 1UB5B 2VXVH 3RY6C 1ETZB 3H7LA 4M7LT 2VDLH 1JFQL 4HBCL 3ZKND 1GYAA 3TN0A 2X70A 5C09B 3OBAA 2GTWB 2P5EE 4Z7VA 1N2RB 2EKJA 1I8KA 1C12A 1PJ9A 1TJGL 2Y06H 1K5NA 5I8KH 2VLJA 5F97E 4F58H 4UAOC 3RWIB 3ECBB 4C54A 3VRIB 4H8WC 1YNLH 4GS7B 1ETZA 4OUUA 3CDGB 2VYRE 1EUTA 2OP4H 1RK0B 4YXLH 1KENL 4N8CH 1A3QA 5C09A 1N2RA 2VXSL 3MXVL 1A14L 1I8LA 5HYSG 4MS8D 4EI5C 4DQOH 1N7ML 2O5ZL 3G6DH 3LZFH 5I9QC 2AK4E 1LNUB 3HHRB 1Q72H 4U3CA 5D72H 3ECBA 3UTQA 1HDMA 3VRIA 4IOFC 2ICES 1N6QH 2VLME 2J6EA 2DQJH 4RISL 1GJIA 2GJJA 2NX5E 2XQYK 3CDGA 1TETH 2KQNA 5HDLA 3MZGB 3WJLA 4KK5D 4RMUA 3TPUB 2OM5A 5ESAB 3KYNB 2A9ML 1I1CA 4XBEL 4D94A 1AD0A 5EORL 3TO4B 1FLRH 3ES6A 4UV4H 2XG5A 4LK4A 1J87A 1I7TB 5CMAB 4OB5L 1LNUA 3MODL 1NCCH 3TEUA 5C0AD 3CVHB 5E0QA 1SM3L 1WBXB 2ADFH 4Z7OF 2A0LD 5I1HH 1OARH 5HHOE 3TPUA 2P5WD 4ELKB 2EC9T 1NLDH 3KYNA 4PGEB 4ZXBC 1RURL 1GRWA 4LLYB 4MJ4A 1UH2A 3TO4A 4MLSA 2AP2A 3BD5A 3V2AR 5E1HB 1QSZA 3GUTB 1I7TA 5CMAA 2APTA 2VLLB 5IF0A 3VXNA 5EPMB 2DKUA 3FFCB 2PXYB 5EDXA 3IU3B 2FHBA 1CGSL 3AMKA 3QJHB 1A1NA 3X12B 3N1MC 4WO4B 4PGEA 1U8NB 3UEZA 5DEFB 2X41A 4E42A 5EOTB 4WFGE 2R9HD 5K9OA 4LHUB 1FL3B 4PREA 4P5MB 5E99L 1T5XB 4MLIA 5I1IH 4JN2B 2OTUA 1C08B 3S37H 4NO2A 5EPMA 5EFIB 2HVJA 5AG9A 2PXYA 4F7MB 1C8PA 1QSFD 1WTGT 4NUJB 3X12A 3HC4H 4WO4A 3U4AA 4K23H 5E8NB 5TQ2L 2ATPA 1U41A 5TDPA 5EOTA 2E7LA 1E4KA 3L3IB 5C2BL 4ZTOH 1A5FL 4Z18A 4JN2A 3L95B 1C08A 2IFFL 4WWKD 3S34L 3NPSC 3G6JF 4F7MA 3S88L 3VWKB 4EN3D 5BQ7B 3JZ7A 1NCWL 2PTUA 4NUJA 4Q7DA 4HH8A 4F8TA 4Y89A 2DWDA 1ODAA 5JDJA 1LP9E 3S96A 3GO1L 4FQ2L 3ZDYE 4OV6F 1P6AB 2YEZB 3JWDL 3BT2H 1ADQA 2IADB 3H3KA 4K71B 3ZKNC 1GL4B 1U58A 2QLVB 4ZPTA 2ZCKL 2E6QA 5I8CB 2DD8H 2RHEA 4KDTA 5IKCA 1ZHKB 4HV8B 2B2XH 1TFHA 3SDDD 1F3DH 4NIKB 4NP4L 3R06B 1JPGA 4IRJD 4M6NH 1FZMB 3KR3L 4R7NB 1NCAL 4Y4KD 1BIHA 2ZCLH 1SMAA 2IADA 4P23D 5DEGA 3QQNA 1MQKH 2E6JA 4ENED 1UXSB 4JDTH 3QPQD 1R24B 4JHWL 5DO2D 3BE1H 5A1AA 4KHTL 1XIWA 4GKNB 4MS8C 1S5IL 5ALCH 1F6LL 4TUOA 2FLRT 3T0EE 3R06A 2IC2A 2HA1A 2ORBL 3LS4L 4LCUB 4MA1B 3BRFA 4KK5C 1SVCP 3LH2H 1L7TH 5I73C 3L3GB 4OLVH 1FZJB 1FGVH 5FUCC 1AGEA 3IRZA 4GKNA 3BX7C 3W11D 5GGUB 4M5YL 1SEBB 3HZVB 3WFBL 5C0BE 3SE9H 3ARBD 1CS6A 5GISL 2PO6D 2X1PA 2CUMA 4G6AD 4PJGE 5HI3D 2A0LC 4N68A 3PWJB 1YEKH 5HDQL 4X99B 4CUCA 1MUJA 1JBJA 3L3GA 4NGHH 4PG2A 4YBHA 1FZJA 4DKAA 4JFQA 3ARVA 5I1GH 3U36A 1RULL 3KJ4C 1OAYL 3MYJB 3JWDC 5GGUA 5DJ6A 5ANME 5F21B 1IEAB 3GI8L 3HZVA 3ZMRA 3ZYZA 5KSAD 3O4LB 4NCDA 4L3EB 2IPKA 4NSKA 3D69B 2YOCA 3PWJA 4X99A 1IGMH 4HDIB 5CBEA 3O3BB 3H9SD 3MYJA 1A1MB 2R9HC 4OIIL 4PRHE 4HS3B 3WKNA 1UZ8B 2BVQB 4B41A 2DYPD 3HNSL 1F3DJ 3TO2B 4FFWD 1EEUA 4FQIH 1I3GH 4NKDB 3O4LA 4L3EA 3LN9A 1SYVB 2B0SL 4AEFA 3CUPA 4WHYH 3D69A 3GJFB 4K94L 1YC7A 2XKNA 4RIRB 4NO5B 4HDIA 1P69B 5IFHH 3O3BA 2AEQL 4XCEB 1A1MA 1SJVA 1VPOL 4HS3A 2Z8RA 1UZ8A 4LL9A 4PJ5E 4I0KA 2BHZA 3TO2A 4D3CL 4WWKC 5B21A 1SYVA 4NKMB 1U3YA 3ZDXE 2J5LC 2VMFA 4PJ7B 4EN3C 4M1GL 5FYKE 1HKLL 3ROOB 2R56H 1YYLH 4MSWA 2AEPH 2H2PD 1P84J 5DJ0B 3BJLA 1TJHL 2ESVD 3G5ZA 4WI8A 2SEBB 4G7VH 3BFOA 1WUNT 4X4XB 4XNQB 4OZ4A 3NAAH 4JM2D 4PJHB 3S97C 1EVTC 3TYFB 5EOQH 4M7LL 1BM3L 4K2UL 3BH8B 1T1YB 4JEGB 3DHJA 4OZGA 8CGTA 3BMVA 3NACH 3GIZL 3H9YA 4HUMB 4IRJC 1G7MB 4QRRD 4Z5RB 3GMMA 4Y5VB 2AJUL 2JLLA 5DJ0A 4NQED 1K2DB 2BNQA 2B1HH 4P23C 5AWNL 1KJ3L 4G9DB 4ENEC 3T8XA 4GAGH 2WMPA 4PJHA 3QPQC 5GZND 2ENSA 4I0PD 4L1HA 5DO2C 3TYFA 4BH8A 5DK0A 4M48H 1JYXA 1GZPA 3OKNA 5I0DA 1R5WB 2FH8A 1OM3L 3WXWH 4N9GB 2Y6SD 4OZIE 3RDTD 3KPQB 1YQVL 3KDMA 4Z5RA 3I02B 2YA1A 4NM4L 3K7UA 4Y5VA 5SWSD 1QTYT 4YHPA 4QNPE 1FVCB 5HHXH 4D0CB 4FP8H 5BS0B 2GSGB 4G9DA 3T0AA 4K94C 5GPRA 3ARFC 2DRUA 5DMGD 3BOVA 1JF1B 2ILLA 1CDJA 3W11C 2V2XA 4U7KA 3KPQA 5KVFL 1E4JA 3EDFA 4JPVH 4ODTH 3I02A 3ARBC 1SY6H 3P11H 4G6AC 3P77A 4H88H 3DMMB 1FVCA 4BH7A 4D0CA 5HI3C 4OT1H 2GEEA 4UDTB 5D71H 5C6WH 3BDBA 1JWUB 5FO8A 1OLZA 4HLZH 5JHDE 1JF1A 4ODWB 1OP3H 1Q0XL 2J88L 5IT2L 4TTDD 1W0VA 1AQKH 3VU2A 1ES0B 3CZFB 4CN4A 5KSAC 3V5KB 3DMMA 4X6FB 4PJBE 4KXZH 4C56D 1N5AA 5KTEL 1INQB 3UTTE 2YA2A 1BIIA 2F54A 1JWUA 3NPZB 3QFJB 1X44A 4ZAKD 3BVNA 1BEYH 1II4E 2A2QT 4XXCC 1Z0NA 2WV3A 4TNVK 1CDHA 3QIWB 4FFWC 4QRQA 4WIQA 4D0DB 3MCLL 5HVGB 1G6VK 3PXHA 4X6FA 5HVHC 3AMLA 2ZOLB 1EEYB 4X4MA 1LGVA 2B5IB 3QFJA 3CIQA 4P2RD 2NY0D 3MRRB 1YEDB 2X89A 3RWHB 5E9DB 4YDLC 3QEQD 4R4FH 3GI9L 3QIWA 4EEEA 4D0DA 5FV2A 5IVZB 4X7CC 3D85A 1U93B 2ZOLA 1YJDH 1EEYA 3MLYH 5GHWH 1BFVL 4HS6A 4DAGH 4NPYA 4ZFZA 4IOIB 5F9OL 1QUNA 2C26A 4LIQL 4JVPA 1ZVSB 3B5GA 3V4UL 3RWHA 3DSFL 1HYSD 4LLDA 5IP4A 3D39E 4JM2C 3OR7A 2VB5A 1NCUA 2NTSP 4HMDA 5JZ7D 1P7KA 3OPZL 5DA0B 2JCCB 3U7YH 1CLYH 3R0MA 2CR6A 1MHEB 4HJJL 1FP5A 2H6PB 1ZVSA 1JZ6A 4NRYB 5TE7L 5BVPL 1IMHC 3DX7B 2CSPA 4HQQH 3ULVF 4I0PC 2WIMA 5B39B 1ZT7A 4L9LB 1QO3B 3KYOB 2WQ8A 1BQHG 4ZNEA 3RDTC 1Q94B 1MHEA 1RZIA 3IDYB 4OCRH 4ZQKA 3JXAA 3O0RL 5FM5M 3Q1SL 1R6VA 2D7PA 4NRYA 3PNWA 4MCYA 3DX7A 3NIGF 4Z7OE 1UGNA 4CVXB 1UCBL 4L9LA 5DMGC 3I6KB 1PEZA 3U0WH 3KYOA 4NKOB 3W39A 2X4UB 1WFTA 4GAYB 4M6MH 4NFBA 3DNKA 2YD4A 4OTXH 5FV1L 3OAUL 1ZGLB 2ADIB 5E1AB 4M3KB 4KKCD 3S36H 3W5MA 2J7LA 4I13B 2DQUL 3MA9L 4CVXA 3V0AC 3UZVB 1I3RB 3I6KA 1MRCH 4NKOA 4TSCH 5T3ZE 2OS7A 2X4UA 4TTDC 4JGJA 4JRYD 3TT3H 3KJ6H 2DBLL 4GAYA 4Q9CA 3VXSB 2EIZB 2LAAA 1ZGLA 3W9EA 2HRPL 2KL6A 2ADIA 5E1AA 3BYYA 5HJ3B 4LRIA 4R2GB 4PPTA 2EXYD 1N3NB 4ZAKC 3QUZD 3HI6L 4WGVB 1QFHA 2BY3A 3RZCD 1INEL 2W9DL 1AI1L 2B4CL 3BDXA 1QR4A 3J7HA 4UILH 2EIZA 4HT1L 3IDGB 5E2VL 1FYHB 4CU8A 4KJYB 3TZVC 3G6JE 5E2UL 2FEEI 3IDJB 3EOYG 3OF6A 1JWMB 3GJFK 3KXFE 4M7JH 3LQAC 1O7SA 4RWYL 4E5XB 1SJEB 4XAWL 4B53A 5C8JB 2QSTA 3TGXA 1HYRC 3C2SA 2VE6B 2DLGA 3IDGA 4XP5L 1QVOB 2VDKH 3VJ6B 5I6XC 1JGVH 5I74C 1N0XH 1FL5A 3IDJA 1NSNL 1P53A 5DMIL 3TVMD 2P5EA 4HUWB 4GSDL 4NKIH 3WFEL 3CFDB 4E5XA 4QRTB 4EVNA 4O5LL 5F7FA 1FFQA 2VO5A 5MENE 1HYSC 4ELMF 1G9EA 3O2VL 2NX5B 5JXEA 1S7XB 5F96L 3PGFH 2XZQH 5E2TH 4ORGB 4U1KB 4ZO8A 1SY6A 4XVUD 2D7TL 3B43A 4HUWA 3QDAA 4U1GC 4X7DC 3L5XH 4QRTA 1TQCB 2QKIB 1NH6A 3O6LL 2AK4A 1T83A 3FN0H 3QDME 5FYKH 5E6IB 3KPRD 5FA4B 4ODXB 2NX5A 1EEQA 3SGKA 2NW2A 4PRIE 2X4TB 5FCUH 3DJ9A 3SEPA 3GFUA 2QHRL 4ORGA 1U8OB 5GRWA 3U1SL 2B4CC 3BIAX 4V1DE 1FN4A 3T77B 4JRXB 1R0AH 3DYPA 1U3ZA 1UH4A 1B4RA 4MNQE 5IROC 2BJML 2R0WH 5E6IA 2ZUTA 4ODXA 5F88A 3RL2A 1OD9A 3DRTB 1N59B 4X7TB 2WINB 3IFNH 1MCOH 5HHOA 1U8OA 2YD2A 1I9RH 3OGOE 3VGHA 3MO1B 2OK0H 3HFMH 5D7LD 5E5UB 4JRXA 2WWKO 5DQ9B 4KKCC 3MOAL 1NKOA 3BDYH 4PYGA 5LCVH 1T0NB 3K1KC 2I27N 1AIFB 3QI9D 4X7TA 3DRTA 1N59A 3R1GL 4GO6B 4U1LB 2WINA 2A83B 4WU7A 4F7TA 5DGRA 2DQHH 3HZKA 4JFHE 5EU6E 3MO1A 2F8XC 1TITA 3P9LB 3MLWL 4FFVD 2GTZB 2XA8H 2GKIA 2WWMD 1T2QH 4OLUL 1KELL 5H37G 2D7MA 4U0RB 5DQ9A 2ED7A 3B2VL 2X7LA 2ZZUT 3VGFA 3QUKB 1TVBB 4F7EA 1P1ZB 2EXYC 1RV6X 3E3QC 3QUZC 2WBJD 1AIFA 1OP5H 4FXLA 2X5PA 5TF1H 2A83A 3MSPA 3RZCC 4M00A 3G9VA 5GGSA 1JGLL 4GLRH 4KTDH 5HHMD 5J12B 4L8CB 2ITDB 1F45A 3P9LA 1LP9B 3KWWA 3MRNB 1X3DA 1HSAB 2V2TB 2ZOKA 2E5EA 5JR1H 3QUKA 4GRLD 1NMAL 4UTAL 4G3YH 5GGTL 5EZIL 1JPTL 5I19H 4L8CA 2ITDA 1MAKA 1I7ZA 1LP9A 5EOCL 4NNXB 5D7IF 5DJXB 4ZSOB 3P30L 4NZJA 4LSVH 1N6VA 2FGWH 2V2TA 3VRJA 5ILTH 1P84K 1UA6H 3VMPA 4JO4L 1A0QH 1BJMA 3LEXA 1ED3A 3ILQD 2JIXB 2VDOH 2VQ1B 1MRDL 2D31B 3VGEA 4PUBH 4O2FB 2AXHA 1C7TA 5L2KD 1TQBB 2IAMD 3SDYH 3BIKB 4NNXA 5DJXA 4RDQF 4ZSOA 2VQUA 4LSSH 2JJTA 3DRQA 1AGDB 3MV01 3Q3GB 5JXAH 3MNWA 2VQ1A 3F7VB 4NYLB 5D7SL 4XVUC 4M03A 1V5JA 4O2FA 1D9KB 2RR3A 4XNXL 3UYOD 3KPPA 1T22B 4R26L 3T0EA 1MAMH 1OTUD 3QQ3A 3BIKA 1NBZA 3U9PL 2WBKA 4PJGB 3VFMB 4WEBL 5IFAL 3MLRL 5EA0H 4PP2B 1WZMA 4MAYD 1XGQB 3F7VA 2VLRB 2X4PB 3BD3A 5IK3A 3QPXH 1B6UA 1MJ7L 1AO7D 4APQD 1D9KA 5F7UA 1CFVH 1E28B 3RWDB 4K3DH 5ID1B 3V6OA 5I76B 3QUXD 1JRHL 5DMJB 4P99A 5C0BA 4AT6B 5A2KH 3ET9F 1CXFA 4PJGA 3VFMA 3EO9L 1AQDB 4PFEA 4PG9B 4YEEA 3EKCA 2WW8A 4HJ0D 5HYSB 1XGQA 2VLRA 5CSGA 5ESVA 2BY0A 2FEDD 1S7SB 1KN2H 1JHLL 1A21A 5DUPH 4IIQA 3QJFB 1SYSB 4ZPVB 1FNEB 5DD1L 3BP6B 5ID1A 2B1AL 5E8PB 1DN2A 3FQXA 2QSCL 4U3XA 2Q20A 4W4OA 4XC3L 4AT6A 5KVDH 5D7JB 3MROA 3QI9C 3BYTA 1AQDA 4PG9A 1KXVC 1JZ4A 1UWXH 5HYSA 3UJIH 5DUML 5I16A 1S7SA 2J8OA 3MQIA 1AJ7H 4FFVC 3V0VB 4KJPD 3QJFA 2WWMC 1CLCA 1SYSA 4KAQL 4TVSa 4ZPVA 1FNEA 2Y36L 1R3IH 1WSST 4H5SB 4PRHA 4PJ5B 4JREC 4MQSB 3BPLB 5E8PA 4NOBA 3ZYJA 1URLA 2FJGA 1KSRA 5D7JA 1F4YH 4KUZH 2MCG1 2WBJC 4N8VB 1OT2A 4OGAD 4OI8A 4P5TD 3V6ZB 5JHLH 3HNVH 1PDKA 2FECL 1HOCB 2GK2A 2AQ3A 3V0VA 1LDPH 1I9JH 1OAQL 4KVCL 4HIJB 4AH2A 4H5SA 4JFDE 1ZA6B 4PJ5A 3GHBL 5K9QG 3MCKB 5GS1C 3AAZA 4GRLC 4JPKL 4L4VD 2BSRB 3V6ZA 3EOAB 1YEEH 4HFUL 1HOCA 4IJ3B 4L8BB 3WKML 4LASH 3MLTB 1BVKA 4NT6B 3LKPB 4U4BA 1ZA6A 1B0RB 5EBMB 2IJ0C 3MCKA 4IHOB 3ILQC 1Q1JL 4NHCH 1KIPB 5FUOH 1D5IH 1GCFA 2BSRA 3A67H 3QRGH 1DL7L 3EOAA 4L4TB 2FX7H 5M95B 1L7IH 2EDOA 4L8BA 3NIFF 2IAMC 4RQQA 5CSZB 5FYKU 3LKPA 4K55A 3D9AL 2VWEC 4PLKD 2CO6B 43CAB 3ULVE 3WFCH 4IEFB 1B0RA 2CRZA 4BK5A 1DBML 1OP3K 3LKOB 3ZL4H 5JMRA 3ARED 5C0RL 4IHOA 3JTTB 1J1XL 1KIPA 4GG8A 2MSPA 3LN4A 4LDOB 3LKRB 4OZIA 4IS6B 2R15A 1MWAH 4PTTB 1OTUC 5CSZA 3X13B 2V5TA 4LKCA 2EH8L 5FECA 3NIGE 4LLUB 43CAA 1S8DB 1BBJA 3G5VB 2VLJD 2Q3ZA 1KC5L 1FVEB 4JAMA 4MAYC 1MF2H 2A1WH 1RZJL 3JTTA 1XF1A 4I18C 4OF0A 5KS9B 2I25N 3O2WH 1UADC 2XTJE 3B9KB 4TVPD 4LSPL 1S5HB 3LKRA 5CLTA 4IS6A 1GOFA 4NN5C 5C09D 2R0LH 3QUXC 3HCVB 1VFUA 4X80H 3KS0H 4GQPH 3V6FB 3O8XA 2G75B 2ZUWA 2GAZB 4PJBB 1ZLUH 1FVEA 3BD4A 2E6PA 1F90H 2FX9L 3TBYB 1EO5A 3ZT6A 4F3FB 2FEDC 1TZGH 5JHDA 1NEUA 2YSSB 4CVUA 2A6JB 3B9KA 3RPIB 4JCLA 3V0WL 1KLFA 1UYWH 2XRAH 3EZJB 3MV9E 1DQLH 5F1NB 4LF3B 5DQDL 3MLZH 5ITBL 4O2EA 3FB7A 3JTSA 2YK1H 5J13B 3P0YH 4K7FB 2W1NA 4JM2F 2DLHA 2G75A 2B39A 4PJBA 1L9NA 5KW9L 4M1CD 1A6VL 3UTTA 3TYGH 1GGUA 1QQDB 3GSRA 3UJTL 3WFDL 4Z78B 4KJPC 4RAHA 5FGCE 3RPIA 5KVEL 3GSWA 3GBML 4NNPL 4TPRL 1QBLH 4TQEL 2V2WA 1JYWA 3TO4D 4K7FA 4A6YH 4OGAC 3RI5F 4I5BB 1EMTL 4P5TC 3QCTL 5E8OA 3SDCA 5A2JH 3D3VB 1QLRB 4Y1AB 4LEXL 4XB7A 5T5NF 4J8RB 4Z78A 2Z35A 3UYRL 3L3DB 4GG6B 1EEZB 4Y16B 3S35H 2F15A 4GQ9L 1JPSH 4PGCB 4AG4L 3CK0H 1RZJC 5DD3L 2NY1B 3VFVB 3AM8A 4ZS7H 3EYVB 1SQ2N 3MRBB 4I5BA 4LSQH 4L1DA 3LQMA 3BAEH 3Q6GH 1QLRA 1IC5H 2J6EL 3MUJA 4J8RA 3FFCD 2PXYD 1RJZB 1Z3GL 4XMKL 1RPQA 3L3DA 1EEZA 5D2NB 4ELME 3E2HC 2Z8SA 4JKLA 4WO4D 4QOKE 2BDNH 3VFOB 3BZ4A 3LD8B 1QRKA 3FRPG 5LWYH 2PN5A 3HPLB 5E2WL 3EYVA 4PJ8C 3KS0J 2DQTH 2DTMH 4WCYL 1KJ2H 1NFIA 2AJZA 4C4KT 4FQ1H 4PLKC 5KN5A 3JWNC 5D2NA 4X9BA 3BW9B 5E24E 2DLFL 2L7JA 4LCWE 1NDGA 2P45B 3BH9B 4M4RA 4PJIF 2VKXA 3AREC 3VFOA 1P9MC 3BN9D 1MLBB 4Q97A 3HPLA 2RGSA 3SKMB 1FIGH 4YEFA 3KLHD 1H15A 4WHTB 2FJHB 3O6KL 3UBXG 4AEIL 4YBLC 3CVHL 4BSVA 4QHNB 4MX7B 4XVJH 1LE5B 2I60H 3VWKD 1YNKH 2AERT 3BW9A 4E41B 4J12A 3BH9A 1N4XL 4KKLD 1AXIB 5BJTB 1RZ7L 1AXSB 3QQ9D 5AZ2H 4G6FB 1BZQK 1XF2A 3CNKA 1KBGL 5AG8A 2FJHA 3QXAB 2O5XH 3WHXA 1HIML 4MX7A 1I8LC 4MZ2A 2WLZA 5F3BA 1CIDA 4OJFL 2HMIC 1DQMH 1HH6B 3LVEA 4E41A 4OCWH 4Q9RL 4KTEL 3I6LE 5F6HI 5IMKB 2FRGP 3TWCL 2XWTB 3FFDA 4GS7C 2HT3D 1N8ZB 3WJLC 4LKXB 3QB7C 5T33H 4Z76B 2ENYA 4XP4H 4WFHD 3QXAA 4PGBB 4EDWH 3L1OH 2LV4A 1U91B 1A6UL 1T20B 5L88H 3F12A 1HH6A 1FNLA 1MEXL 3TC9A 43C9B 4YJZL 3UTSE 4ZOEA 4M1CC 5IMKA 1CZ8L 5I75B 4WJ5A 2XWTA 3KVQA 5J6HA 1D5XB 1ADQL 1N8ZA 1DDHB 4Y2OA 4LKXA 4Z76A 5I15L 1MPAL 1XZ0A 1IQDA 1IBGH 1U91A 1T20A 3ULSA 4L3AA 1LQSR 3QULB 5EC2B 3TO4C 1HKFA 1BVLB 1HE7A 5E8DL 43C9A 4UV7L 4R4BB 1W2KT 5DD5L 4JHAH 5GRJL 5FUCE 4OLXL 3OJDB 4MDJB 4WW1B 5D9SB 1D5XA 3KXFA 1DDHA 3VFWA 4HWUA 5D7IE 4P46B 5GGVH 1ZLVK 4XT1C 3ZZ1A 2XT1B 2NTFB 2ZUVA 5HYFA 1YY8A 1MWAA 2P5WE 1HWGB 3RGHA 4R4BA 4PTUB 4YK4C 3FQNB 3O4LD 4R8WL 4L3ED 4H0IA 4OIAA 2PXYC 4JCMA 4F37K 3NCYS 4KROB 4P46A 5ECJE 4WO4C 5MENA 1WWBX 1ITCA 1BOYA 1WC7B 2R8SL 1XCTB 2HKHL 5I66A 4CADA 1HXYB 4YHML 5KG9A 2QSQA 1ZHBB 3O45B 4D8PB 2FBJH 4PTUA 3MRFB 2HJKB 3OAYH 1K4CA 4O51B 4V1DB 4NQDE 4HZLA 4Z7NF 3U82B 7FABH 3SY0A 1QHOA 4S0SD 5TDOB 5DRZB 3O2DL 1TTFA 3GMPB 3PL6B 1WC7A 4LLVB 3BN9C 1A7BA 1L0XA 4JKKA 2BVUA 1HXYA 5EO9B 4HUXB 1T5WB 1QSFE 4JRWA 1FBIL 1QG3A 3KLHC 1ZHBA 3O45A 4UB0L 3MRFA 2HJKA 3HNTL 1P4LB 2QQKL 4KDTC 1E4XI 4A6YB 4XNZB 4V1DA 3MFFB 2MCPL 2BNUA 4G8EB 3VWKC 1CT8B 4N90E 3QDGB 2VZOA 5LAXB 1HZHH 5DRZA 4EKXA 3QP3A 2VXVL 4MNQA 4KKLC 4LLVA 1EPFA 2DL9A 5BV7H 5H37H 2VDLL 5GS2D 5EO9A 3QQ9C 5KJRH 1MCBA 4IDJH 1CF8H 4JY5H 3ULVH 4OLYH 4HIXH 1OP9A 1DANU 2Y06L 3QEHB 4A6YA 1I3UA 3MRJB 3IKCA 4YXHH 2YD8A 1XIWC 1QBAA 4X5WB 4F58L 1CT8A 3AGVA 3DSNA 4I3SL 5LAXA 1YNLL 3C60B 3CSYB 1PZUB 4BFIB 2CDGB 5J9PA 1Y6MR 2HT3C 2YKLL 4GAJH 2DJSA 2OP4L 4Y4FA 1M4KA 4YXLL 3OGCA 2E7BA 3QDJB 4OCSH 5EU6A 4DQOL 3MRJA 3X14B 2BNRE 3G6DL 4X5WA 3LZFL 1FORH 3QXDB 1DEEB 1F4WL 1Q72L 5D72L 5FA3B 5IM7B 5FOBB 3P0VH 1N6QL 3CSYA 3C60A 2DQJL 1A6TB 1OF2A 1KJ2B 3TCLB 1TETL 4KUCD 1BQHA 4MA1C 4RNRB 2N7AA 4H20H 5BS0D 3KPLB 5SWQB 1LVEA 3UP1A 1OHQA 1A4KB 4PG2C 3CFCL 4UV4L 2N56A 5FGRA 4RBPH 4QXGH 1IGFH 1KLGB 1NCCL 2P24B 3BUTA 5LGHL 4KZDH 4R96B 5E4EB 1KJ2A 4GFTB 2ADFL 3MRGA 4RNRA 3DMMD 1OARL 5I1HL 3KPLA 1NLDL 1UZ6F 4NJ9H 5E8EA 5ETUB 3V95A 2I5YL 1A4KA 2NY2C 3NFSL 4NBYB 3DVFA 5DC4B 2UVEA 3FONA 4UUJB 4OM1H 2EDXA 1DUZB 1MFAL 1X5KA 2P24A 4NZRH 1RHHB 3T09A 4ODVL 2P47B 4MNGB 1YYMH 3NIFE 4UDUA 3AS0A 1CXKA 3BJ91 4BKLB 4MD5B 5ETUA 4UU9B 5D5MF 3IVKB 4OF8A 2BSSB 3QFJD 2CRMA 3CXDH 4PJXB 3DV4B 2GIYA 3PJSB 1XGYH 2VABB 5GRVK 5I1IL 4DN4H 4ODUA 1K4DB 4P48A 1RHHA 3S37L 1I7UB 3C08H 3QIWD 4JY6B 2NXYB 3HC4L 4MD5A 5AEAA 3IKKA 4K23L 1OGAB 4UU9A 4LSRH 3OAZK 1KCRH 4PJXA 4J3UA 1UWXK 2YHGA 2UVFA 1UACL 3WS6C 1K4DA 4OLZH 3VFTB 5E9DD 3MNZA 4LCCA 2AK1H 1FCGA 5JPNB 4MMZC 1FFOB 1T1XB 1YNTB 4JQVA 4M02A 1OB1B 3WO3B 5IGXL 1CFNA 4L8SA 4NC0B 5I1AA 1R5IB 3FO0L 1YC8A 1UB6A 5ADOL 2DN7A 3CX2A 5HGHB 3CLFH 1ZT1B 1DE4B 1JIBA 2W92A 3OJ2C 3BT2L 5JW4M 3UYPA 3VFTA 4ZUWB 1CFQB 5JPNA 2DD8L 4HJGB 3IDXL 2JJWA 1FFOA 1T1XA 3HE6B 1OB1A 2B2XL 1KENH 1B4JL 1WT5A 1DEDA 4DWHA 1R5IA 3MXVH 1A14H 2DICA 1IEBA 2ESVE 2FO1A 4M6NL 4LQFH 4OFVA 3EYQD 2O5ZH 3MRIB 3FOLB 4S1RL 1A3RL 2ZCLL 4YHNA 3AY4C 4Y5VC 3FN3A 4JDTL 3B6SA 5B8CB 2DI9A 5LGJA 4QRRE 5EU4B 3HE6A 5C0CE 2GQHA 5A16A 4XBEH 4NQEE 3S9DB 3UROR 4NCC1 1F13A 5T1DH 4BQCA 2Z91B 1IAOA 1N6UA 5IHUL 3MRIA 1JV5B 1P7HL 3N1GC 1HHJB 1CFSA 1ZT4A 1XMWA 1SM3H 1KGCD 3LH2L 1L7TL 1X5ZA 1FYTB 4MYWB 2EKSB 12E8H 1X5XA 5DJCA 1FGVL 3LHPL 1RURH 2GITB 2W60A 1KIQB 3I9GH 3SE9L 2APWA 1HHJA 2CLVA 1EFXA 1HILB 3QIUB 1DQTA 1X4ZA 4LFHD 3T0XA 4G8GB 3DMMC 1YEKL 4HFWA 2NY7L 4RFNB 4NGHL 3ZSSA 2EKSA 1M7DB 4U1SA 2R0KH 5I1GL 1FNSH 2QBWA 2EEBA 4ZDHB 4MVBD 5JOEA 2ZSVB 3Q5YA 4V2BA 4AENA 2QR0A 3G08B 1E6OL 5FK9B 1GAFH 2H26B 5J1AB 2DLEA 3U30B 3VXSD 4PJEB 3MFGB 4ZFOB 3QIUA 2A6IB 4LIQE 4JFXB 3B8YA 2R4RL 1J18A 3FQWA 1IGML 1YMMB 4LHQB 4R2GD 2YPLB 2HRLA 2OCFD 1EJOL 1ZLUK 1YPZB 5CEYB 1KACB 4JO2H 4PJIE 2OXGA 2OJEB 5FK9A 5J1AA 4FQIL 1I3GL 2PW1B 3KYKH 4GXUM 3QIWC 3CH1B 1KT2A 4ZFOA 1GC1L 2A6IA 1E27B 3MRMB 5JDSA 5BOZG 3S34H 1ZVHA 3S88H 2DI7A 3D0VA 2YPLA 1HSBB 4LVNB 1NCWH 1LE9B 2B5IC 3RX7A 3O3AB 3C5JB 3RRQA 2YUXA 4FQ2H 1U92B 3DGGB 4KI5D 3EAKA 3L5WB 2OJEA 5SV3A 3IDIB 4OSUH 5DURB 3JWDH 5E94A 1NC2B 4M1DH 3B4NA 3DROB 3GSNB 3QUMH 1GZQB 4P2RE 2ID5A 3STLB 1IZKA 1DQQB 3CH1A 4HUKB 3MRMA 3FO1A 4RMWA 5JXED 4G7YL 1IKNA 2ZUXA 2R56L 3QEQE 4IM8A 1YYLL 1HSBA 3MV9B 1LE9A 1G9MH 2V7NA 3QIBB 3O3AA 3C5JA 2APXA 1OQOA 1NEZG 1Z0MA 1NCAH 3L3JA 3L5WA 3IDIA 4U1IB 3SKJH 1NC2A 1SJHB 3NAAL 5CGTA 3RQ3A 1FNHA 1I1AA 3GSNA 5I2IB 1GZQA 1DQQA 3VCLA 4UT6H 2VLMD 3MREB 3QEUB 2NX5D 3FCTA 1AGCB 4JZOB 5FGCB 5EIVA 3VXUB 1S5IH 4UOW0 1A7NH 3GZKA 3MV9A 2X4NB 3EYQC 1MHCB 1KTLB 3QIBA 5DD0H 1I1FB 3O3DB 5MEOB 3O41B 2ORBH 4P4KB 5JPMB 1U3HB 4U1IA 4GAGL 5AD0B 1SJHA 5I2IA 4GKZB 4M48L 2R2BA 4HAGA 2XQYG 5E6ID 4NNYB 5BW7A 3MREA 3FZUD 2FYYA 1WLHA 2ICCA 4L9LC 1K3ZA 1AGCA 4JZOA 3C6SB 1A3LH 1U8PB 4M5YH 2X4NA 1MHCA 1KTLA 2NY4B 4XCYA 1I1FA 2Q8BL 3IDYC 5HHXL 5EC1B 2BVPB 3O41A 3F65A 4HC1H 1GC1C 4JRXD 4P4KA 5GISH 5JPMA 3RIFF 1KUMA 5AD0A 5H2BA 2OTWA 4DGYL 1H3PH 4GKZA 2YUVA 4NNYA 5F9JB 4JDZA 3JWOH 3TV3H 4CJ0A 3BQUB 5C3LD 3T2QA 4Z7VF 3C6SA 5KSUB 4JPVL 4ODTL 2PW2B 4TSBH 1QLEH 1SY6L 1VGKA 4MDIB 5B3NA 1FDLH 4ONOA 3G04B 5EC1A 2BVPA 2CDEB 4OT1L 1ZK9A 5D71L 4QLRA 3BEVA 2R2HB 5HI5D 1KIUA 4CVZB 4LRIC 1AC0A 3FB5A 3QRFM 3BQUA 4MVBC 3IETB 1UKTA 1SEQL 1WIOA 5KSUA 1F3JB 4ELMA 3BRGC 2PW2A 4TSAL 4GMSH 3G04A 4NN6C 2CDEA 2WUCH 3VXMB 4XCCH 3T08A 2G5BA 4JRYE 2B0SH 2R2HA 3P9WB 2OR9H 3EZ8A 2BOCB 1KN4L 4R2GC 4HWEH 4Z7NE 5TH2B 3OMZA 2N1KA 1X5YA 5ABDE 2AEQH 3CXHJ 1F3JA 4O2CB 5TE4L 3VA2C 3E3QE 4MXQD 4D3CH 1XGTB 3BP4A 1U3JA 4RZCB 3D25B 2C3WA 2WIIB 2BOCA 2PF6A 1AXTH 2HWZH 3TA3B 1FFPB 1NQBA 1RZFH 4KI5C 4I2XE 4R4FL 2AI0L 1EAPB 1TJHH 5F9WB 5IBTH 1XGTA 3KPOB 1YJDL 3MLYL 4JO1H 1NPUA 1GGYA 2EDKA 5JXEC 2WIIA 1BM3H 3QH3B 2CK2A 5ESQA 3TLRA 3L7FA 1MFEH 1D7FA 3GIZH 5DRWA 3TA3A 1FCCA 1A9BB 3MGOB 4OGXH 3WEXB 1OY3B 1MHHA 1HCVA 1T83C 1QFWH 4DK6A 5IQ9B 3KPOA 1TMCB 3MX0A 4WRLA 3U7YL 3SGKC 2E3VA 3V7AE 3QH3A 3RVTD 2JELH 3ZHLA 1U8HB 5FO9A 1D9KD 1K3IA 2C3VA 4NM4H 3ZT7A 3WEXA 1JZ2A 4ZUUA 3EDDA 4U1NB 3UTSA 4LARH 5IQ9A 5E6IC 3FO2A 1UM6H 4OGYL 2XG4A 1H3TA 2D7OA 1M1SA 4OCRL 2VLRD 1U8HA 3KPRE 1MCWW 1OWWA 1MCRA 3OAYK 3BIBX 2HFTA 1EBPA 2RCSL 1MFDL 3TH2T 4U1NA 1NANI 4XWGH 1CXHA 2X1WL 5DZOA 1UZ6E 3BP5B 2XXMB 1BZ7B 3FMGL 1HXMB 2UZYB 3QNYB 4M6ML 5T5FH 1W72H 3LS5L 3QUMB 5IT2H 2X4OB 4OTXL 4K8RH 2EE3A 1ORQB 1NCBH 1RUMH 2MNUA 4JG1H 3S36L 2FIRT 2ZCHH 1QR1B 4ZUVB 5HI5C 4OKDA 1DP0A 2P5WA 5MERA 5KTEH 3NA4A 5D7JD 5DS8B 4K07A 5D7LE 4YHZL 4TSCL 2APVA 4M3JA 4Z0XB 5D5ME 1BZ7A 3JVGA 2FWOA 3KJ6L 3QFDB 3TT3L 3K4ZA 3QNYA 1KG0B 4NQDB 2MPAH 3QUMA 1JNNH 2X4OA 2EDEA 1XF3B 4N0UE 2NNAB 1BLNA 5F7MC 3MCLH 2I07B 5IJVB 4U0RC 1QR1A 4PJ5D 4ZUVA 2C9AA 3U2SB 5C6TH 5JW3H 3VDAA 3Q2CA 2H45A 4Z0XA 5BVJA 4XB8A 5CLWA 3U6RB 1KG0A 4NQDA 3V4VH 4JFYA 2J3SA 2DS4A 5J12C 3NCCB 2NNAA 3GI9H 3VE0B 4LRNH 4L9DA 5E00B 4BYHA 3NIDF 2BP3A 3KYMB 1QSFA 4XMLH 5I1LB 1BFVH 3MLSL 2Q87A 5HHME 2HP4A 3GMLB 3MV11 1CGYA 2W65B 3U6RA 4RX4D 3U7AA 5E5RB 2AV1A 1T2JA 4GBXB 4BSJA 4NJAH 1RFDH 2VDKL 4N5UA 4Y8DC 1JGVL 2JJTC 1N0XL 1Z5LB 2IGFL 5I1LA 4RBPK 5J3HD 2HLAA 5DMKB 2IANE 3WNKA 4DZ8B 4NKIL 4HC1A 2W65A 3TPKA 4OLEA 2BNRB 4CGTA 1JI2A 3FRPA 4OF5A 3T0EC 5EU7E 2NCMA 4JFEE 5BVPH 3C9NA 4CNIB 3SE8H 5EUKB 3PGFL 2XZQL 5E2TL 1FQ9C 1Z5LA 3SDDA 4KV5F 3RVTC 5L2KE 1J0IA 1PEWA 5DMKA 2DTSA 3S3PA 4DZ8A 1CL7H 3L5XL 4AIZA 4Y4KA 1D9KC 4N9OB 3LQAH 2BNRA 3O0RH 3P0GB 3ARPA 5HY9B 3V6OC 2ARJQ 3L9RB 4CNIA 1QEWB 5FCUL 5GXBB 1UCBH 4HK0A 5HVWA 1J0JA 3UBXA 2PTTB 3QXVA 2BX5A 3HMWH 1EO8L 1V7NH 2NXZB 5I17B 2ZPKL 4NM8H 3BISA 5DHYB 3B9KD 3CMOL 1GHFH 4FZEH 2ZJSL 5EH1A 5HY9A 2R0WL 4KK9D 4W4OC 1RIUH 1AO7E 4JE4B 2DQUH 2IMNA 3L3HB 4U3HA 3PP3H 4JY4B 1AY1H 1J8HB 1DANT 4LOUD 4PJ7F 3HFML 4R7DB 2PO6A 1OGTA 2WANA 5DHYA 4W81A 4OCMC 4JFZL 3BDYL 5LCVL 2LABA 1RZGA 3T0DA 2WP3O 3IDMB 1HCFX 3TH4T 1U8LB 5D7JC 4PJHF 3BKYH 2DQHL 4Y8AA 3O3UN 3ROLB 1WZ1L 1J8HA 4KRLB 4OAWB 1FV1B 4HUUB 1INEH 2XA8L 3HAEB 4R7DA 3RTQB 5HI4D 3LKQB 4EBQH 3O6MH 3LEVL 3BPLC 1PG7W 1NJ9B 4LHUG 3IDMA 4WTZG 3VXQB 1U8LA 5E2UH 1UQSB 5IB2B 1B88A 2F53B 5TF1L 4RWYH 3ROLA 3O11A 4KTDL 1EFQA 2PTVA 4OAWA 1FV1A 3D3VD 4Y1AD 5CS7A 5J8OA 4XAWH 1JPST 3MRQB 3RTQA 5H35B 4D9RE 1VGEH 5IBUG 3LKQA 3BGFB 3CFJB 4Y16D 4KUCF 5JR1L 1PLGH 4XP5H 1NJ9A 4QT5A 3VXQA 5F7DB 4G3YL 3EJZD 3S3SA 1NSNH 1UQSA 2NY1D 5IB2A 3BGAA 2F53A 3IFPB 4GSDH 2LVEA 1KCSH 4IJ3C 1T2XA 3MRQA 5F6HJ 4LSVL 3ISWA 4L4VE 5ILTL 1HNGA 1UA6L 5INCA 2OJZH 1W72B 4HW6A 5B38G 1IGCL 2VDOL 3OKLA 3KPNA 5F7DA 5J3HC 4WV1B 3K0WA 4ZD3H 3AS3A 5C0CB 3RJQB 2ESVA 4HLJA 3SDYL 4C83B 4QCIB 3REVB 3VFSB 4HGKC 4JM2A 3O6LH 4LSSL 4NWTH 2HH0L 5JXAL 5CJXC 3EO1B 1W72A 4NO0B 3PHSA 1MCQA 2FH6A 3H0TA 2QHRH 4OFIA 1D6VH 1F11B 2F19L 3U1SH 4YGVB 5C0CA 4HKZA 1F4HA 5EZJA 4NQEA 4BUGA 4C83A 4HH9B 1BWWA 4QCIA 5IOPA 3KLSA 3CD4A 1LHZA 3F8UB 4I0PA 4O4YH 1A7RL 1NAMB 4UOW1 3O8XC 3EO1A 1ZHLA 4XP6H 4NO0A 3GMQA 4E41D 5EBLB 3TBSB 3QPXL 3B5TA 1PY4A 1PG7H 4Z7VE 2QJDA 1CFVL 3KG5A 1RUQH 4YGVA 1BX2B 4G6FD 4K3DL 2VLJE 4M9PA 3B9KC 4DVBB 4HH9A 3PWUA 4HSQA 4KK9C 2UWEB 1PFCA 2HT4D 2A9NH 4HBQA 1NAMA 1TTGA 5C6PB 2CIKB 1FE8H 4TVPE 4R90H 5GRVL 3TBSA 1S7UB 3F7RA 5C09E 5DUPL 4ONFH 1BX2A 2KZ1B 2D7NA 2VXUH 4L29B 2C1PB 4DEPB 1J9CT 2D2OA 1FFNA 2L7UA 4WNQA 5JQHC 2LU3A 5KVDL 1JZ7A 2UWEA 1RJLB 2F74B 2IEPA 5JO5B 9CGTA 5IEKB 5CWSB 1DQJA 5J13C 2VSCA 1NFDB 5AUMA 2CIKA 1F97A 4DK3A 5F9DC 1S7UA 1Z2KA 5I71C 1AJ7L 2JCCF 3SPVB 1E4WL 1JGLH 3QR2A 4HXBH 2R1WB 5HI4C 1R3IL 3SGJA 2OYPA 4L29A 4DUVA 1PYWB 2C1PA 1MH5B 2ATKA 2R4SH 4L8DB 2YPVH 5C0FB 3CXHK 2CO7B 1LO5A 1F4YL 4KUZL 4Z7WB 5C0DB 5IEKA 5CWSA 1V7ML 4AIOA 1NMAH 4ISVB 1NFDA 3AM8C 4W4NA 5JHLL 3HNVL 4JFPB 5GGTH 5EZIH 5I30H 5LXGH 2X4RA 1LDPL 2IG2H 1I9JL 4WHCA 4Z0BL 4E0RB 2R1WA 4ALAH 1NDMB 4P2YA 1J1OH 3M07A 1PYWA 5EOCH 4N0RA 4M8QB 5KAQG 4Y16C 4P46D 5C0FA 3MRDB 4S1DC 5SX5H 5C0DA 4PV8A 1VCAA 4P2RA 2ADJB 4G80B 3EJZC 2EDWA 4ISVA 3PWPB 1MRDH 1YEEL 4YDVA 2C4XA 1JUFB 3V6BR 2DQCH 4LPXA 4ZYKB 3RKPA 4LASL 1YEJL 2VZ3A 4X6EA 3VH8G 5CEZD 3PQYB 2AQ1A 4LSTH 4O9HH 4M8QA 3TBVA 5D2NC 3T0VA 4KROD 4NHCL 3SGEH 5FUOL 3PGDB 5FEBA 1D5IL 3TNMB 1IAMA 3EO0A 3LD8C 3A67L 3FFCE 1N64H 3QRGL 5D7SH 5HHNB 2IH3A 2FX7L 1L7IL 2IWGA 2GW5A 1DBBH 1JZ3A 5C0NC 3SDAB 5GSRB 4XCFH 4V1DD 3IFLH 3EGSA 3V52H 3ZL4L 5ISZE 3MNVB 2E27H 1CN4A 3VGGA 3PL6D 4PBXA 1G9NL 5HHNA 2RB8A 3PWNB 2X05A 4UNVA 4MB3A 4J6RH 4S11A 3F58L 2VDQH 2FNBA 1CE6B 1ULVA 2AXJA 3WSQH 1C16B 4RGMC 1QFOA 3B83A 1XR8B 3F7YB 1F2XK 4PRPB 3QDGD 1MF2L 2A1WL 2VZ1A 4AEHL 3UTZA 1MCIA 1VA9A 2XN9E 3O2WL 4OBRA 4B0MM 3GB7B 3QG7H 1HQ4A 2GY7B 4XI5D 3PWNA 1BGXL 2R29L 1AGBA 5GSVA 1JYVA 2R0LL 1CE6A 4KI5F 5IROA 4X80L 1S7WB 3C5ZB 2HT4C 2QSCH 2Z0BA 1FRGH 1IKFL 1XR8A 4QRUA 1F90L 4PRPA 2DQIL 5BXFB 2VH5H 5EOCJ 3C60D 1KXQE 4NC1C 1I4FA 1TZGL 3REWB 3E6FA 4DOHB 5DUMH 4MAUH 4QRSB 1UYWL 2XRAL 1FSKC 1T7WA 1DQLL 4KAQH 3QDJD 1WFUA 2O5YH 4CU6A 4MXVF 3DBXA 4ODBD 5JW4Q 5IB1A 4LPUA 4WFHE 4JRYA 3OB8A 5MI0C 1AD9A 1DVFB 4XPAH 1Q9LB 5F7HA 5F7LB 5I75C 5A2IH 5DJ2A 4XVTH 3DX9B 3WHE0 4QRSA 4JDVA 3ABZA 2HG5B 4RAVA 1QBLL 4TOYH 4MA8L 2MQ0A 2FR4A 1BWMA 3V5HB 3NIDE 4JPIB 5KOMC 2BERA 3GHBH 4HHAB 1IQWH 1WICA 4HKBB 5KSBB 4A6YL 1G9NC 3QUZA 1CD0A 1UWGH 3IB4A 4JPKH 4XWOC 4Y5YB 3ARWA 2NW3B 2VITB 4M43H 3TIDB 2GSIB 2Y07L 1Q9LA 4OUOA 5ACZB 2HG5A 2UZXB 1GSMA 1YDPB 4U49A 4I2XA 1JPSL 2CIIB 3CK0L 3DVNB 4P46C 3V5HA 4HKBA 4KJWC 4ZS7L 5F7YC 2HJLB 4LSQL 3PF2A 5LGKA 4Y5YA 4FG6D 3BAEL 2NW3A 3TIDA 3AC0A 1IC5L 4XBPB 2VL5A 2W9LA 3RWGA 5ACZA 1F02I 1T0MB 1WISA 3CAFA 1YDPA 4OCYH 2BDNL 5C07B 5CBAB 3O4LE 5IW1B 4KV5E 3TVMA 5C0RH 3PHOA 2DQTL 2DTML 2Y4SA 3T65B 2CKBH 1VFMA 1FAIH 1KJ2L 4U1HB 4FQ1L 1T0MA 2P8MB 4IRSB 3GMOB 4BJLA 1H5BB 4XHJD 3FQTB 5ERWB 2NXYD 1CDBA 4ZS6D 1LO3H 3B3IB 1OGAD 3NCJL 2W0LA 3BWAB 3OKDB 2HN7A 1CIUA 3PL6C 3WUZA 3MYZA 4LU5H 2E7MA 1RZJH 1Z9MA 3HE7B 1FIGL 3N1QC 3H8NA 2E8ZA 2IF7A 2IH1A 3T65A 5B39G 3EYFB 1NEZB 4LSPH 4XVJL 2I60L 4IRSA 4W68A 4WGWB 1YNKL 3RWEB 1H5BA 1FZKB 3PUCA 3FQTA 4FNLH 2LE9A 4LPCA 3OKDA 2BHYA 1CLZH 3S4SB 2Y23A 4Z7UF 3O9WB 3HE7A 5F1IB 5HHQA 3OV6A 3LQZB 4XI5C 4PJ7E 4JPWH 1NEZA 3HE6D 3JV5A 4N0UB 4H25A 3DX8A 4LHJB 1DQML 1FZKA 5DK3A 1XGUB 3RWEA 3L6FA 4OCWL 2DQDL 5DT1H 4P5KB 2OBGA 4D0BB 2AAVA 4PJHE 3C60C 2IBZY 4QHUA 3GBNH 4Z6AT 5KW9H 3O9WA 5F1IA 5T33L 1NGPL 4FQHB 3BPNB 4XP4L 5D5MA 5FUZH 2DMCA 2W38A 4EDWL 1RY7B 3SJVB 4NNPH 4N0UA 4JFFB 3IDUA 5D1XB 3MACH 3FJTA 1G7QB 1XGUA 4PRDB 1WTLA 2V17L 2XPGB 1XGPB 4LP5A 5D6CB 1J1PH 1CU4H 4ZOBA 3SCMB 4D0BA 3CSGA 4YR6B 2ZUSA 4KFZC 4ZNCD 2O61B 4BZ2H 4J1UA 1MFCH 5T3XE 4UQ3B 5J6GB 1FYTD 3VD9A 1Q9WB 4TVPH 2G5RA 2YS4A 1YZZA 3HLAA 1Y6NR 4DZBB 4AG4H 1D3CA 4CAGA 4PRDA 5BS0E 1XGPA 5D6CA 2A77H 5I1CH 3SCMA 2A6KA 4N0FB 4JHAL 1ZSDA 4FFYH 4YR6A 3UPCA 5KVMC 3VW3L 1JHKH 5E4EC 1MCPL 1LILA 3QIUD 2IANB 4MD0B 4G43B 2DJ4A 4QYOB 1KNOB 1Q9WA 1HHIB 3VMOA 2H8PA 4HPOH 3BESR 4M61B 2QADB 1ACYL 1H3UA 3LAFA 1RVFH 3RP1A 4OCXH 4I8DA 5ICXA 4FG6C 4N0FA 2BRRH 1FC2D 4NHUB 3ULUD 2A74A 2IANA 4J3XA 4WCYH 1LK2B 5EU5B 2M1KA 4QYOA 3MUHL 1X5IA 1U2HA 1YMMD 5IW6A 1HHIA 2YPLD 1S7TB 1JRHI 3PP3K 2DLFH 4JFEA 2WQRA 2YC1B 1A6ZB 5EBGA 3VWJB 4X4ME 5KOVC 2FBJL 1R3JB 4PB0H 4HK3N 3QFJE 4NHUA <