3TBWB

Crystal structure of the murine class i major histocompatibility complex h-2db in complex with the lcmv-derived gp33 altered peptide ligand (a2g, v3p, y4s)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Conversion of a T cell viral antagonist into an agonist through higher stabilization and conserved molecular mimicry: Implications for TCR recognition
rcsb
source organism Mus musculus
molecule tags Immune system/agonist
total genus 14
structure length 99
sequence length 99
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tbwB00
3T08A 4O4YH 3F6LA 2EIBA 3FOLA 4R7DB 4K7PL 4C56A 2C3GA 1YZZA 1ZGLA 2EE6A 3BEWB 1OGAA 1EA9C 5HYJA 1F4YL 2YRZA 1FFPA 1NDGB 4OGAD 4PGDA 5AUMB 1TZGL 5HYQA 4WI5A 4ZXBC 3HS0B 1BQHG 1BF8A 5HVHC 3KPNA 4W4OA 3BVNB 3FO0H 4LU5H 1TIUA 5KS9E 3RWGA 3LEYH 3MBXH 4MX7B 5DHVA 4TPRL 4NQXA 4YDIH 2EICA 2NX5D 1FE8H 1WFUA 2VXSL 5K9OA 1T5WA 1IEHA 1CXFA 5HXMA 1GGUA 3AY4C 4YEEA 5KSBE 5BVJA 3SDDC 5JOEA 2AJZB 2XQBL 4H25B 5KS9B 1H8SA 1VGKA 4BSVA 1KTLA 3BN3B 5F96L 4PBXA 4X7FC 3PGCB 3C6LA 1MFBH 5C0DA 5MEND 3JV4B 5L88H 2HJFA 5DJ2A 3O6ML 2YWYA 4UMGA 5IB2B 4KZDL 2P46B 1DEDA 2AV7A 2W9DL 3FCTA 5KSBB 3D39A 5IR1A 2HJKA 1A6TA 1KBGH 4EQ3A 1F11B 3S97C 12E8L 3O41A 2X4SB 4M03A 5I8KH 4KI5F 3C60D 4HS6A 4PTTA 3VW3L 1VA9A 4L8BB 1BF2A 3QG7H 4XP6H 2P5EE 5L2KA 1TQBC 2ARJB 3O3EA 1ETZA 4GMTH 1ZLUH 4FA8A 3L6FA 1V3KA 4UTBL 5K59E 4Y4HD 1H3GA 3SKJH 1XZ0B 1IGJB 3UYRL 5F8RC 1UFUA 1ZVSB 2BNUA 2EZ0D 3JSSA 3VXSA 1JHTA 3Q6FB 5GISH 3MNZB 2M1KA 3BKYH 2CR3A 4OIIL 5D1QB 1RHHA 1HQ4A 2P5EB 3SCMB 2VYRE 2XQYK 2EE2A 3D18B 4RMWA 2FRGP 4JQIL 4XI5D 3L3JB 2EKSA 3U1SH 3P9LB 1U8MB 1CG9B 1Z9OA 1GZQB 2CKNA 4KV5F 2BY0A 2YPLE 3L7FB 4JRYB 5ITBH 1O0VA 2C9AA 4MCZA 3MLSH 1EEQA 3BDXA 1J8HA 3PWLB 2MOVA 2R0LL 4ODSH 4CVZB 2DYPB 4G9FA 4U1GC 4ZD3L 1OTSC 1M6OA 1A7QL 5C2UB 3MUZ1 1NCNA 4K3EH 3DETC 1RUQL 4XCFH 4DKDC 4I0CC 1HIMH 4YWGH 1CCZA 4NKIL 5DEFA 1CFNA 2YPLB 4EOWH 1EEZB 3MOAL 4FQXD 5CSGA 1X5IA 2AS5M 3LPGA 3RBGA 2HFGL 2G2RA 3WIFA 4R90H 3KPOB 2G9HB 2B0SH 5IG7A 3QA3A 5FOBA 2X1QA 3GSQA 2VDOH 1YA5A 3WFHA 3C9NB 1B0GB 4JRXA 4OZFB 4Z7UF 1RI8A 5TFSL 4ZUUA 4RIRB 3F5WA 1RZIA 4Y1AE 2Q20A 2A83B 2YSSB 3QIUD 2F74A 1HDMB 4NZRH 4XXCA 3SGKA 4NHUA 3IU4H 1I9IL 2OX5A 1NH6A 2J5LC 3C8KB 1KIQA 3ARSA 3AU1A 1XGQA 2V7NA 3VWJA 4IDJL 5SWZD 1CGSH 5EUOF 4U1NB 4ELKA 5J06A 3C5JB 4QXUH 1GSMA 4Y1AB 1AHWC 1P7QA 5KVDL 3SDCB 1R3HB 1QNZL 2YUZA 4K94C 5HHVL 4FQ2H 2AXJA 3EYQC 1RUML 4OCYH 4QGYA 3EO1B 3D25A 4KU1A 1UEYA 4JJ5A 2CLVB 4OFIA 2CJUH 2E5EA 3VH8B 4NQTA 4L9DA 4XBPA 1SEQL 5IBLC 4NZTL 2X42A 1QACA 4RBPK 3HNSL 3D69B 3HE7B 1EO5A 3JVGA 1KOAA 5LWYH 4WWKC 3IDIB 4QNPE 5F7EH 1NQBA 5GRVL 5KSVA 1KB5L 4MJID 1I1AA 3GBML 1Z5LB 1MUJB 1OTTC 2C3HA 3SGEI 1EFXD 3ALWA 4FXKA 4PJ5E 1M05A 3I2CH 4LCWE 4NNXA 5I6XC 3KPRD 1ZEAH 4JM2B 1NDMA 1DBML 3OL2A 4K9EL 1H3TA 2A9ML 2QL1A 3AREB 4OF5A 3VFUA 3WHE0 1CVRA 2VL4A 4Z7QE 4WFEE 1J18A 2OBGA 1OAKH 3IDNB 3BMWA 2AJXL 3MRRB 1DQMH 1S7RA 3B9KA 4LCWB 5F9JA 4LNRB 5EIIB 1I7RB 4KGLA 4JFPB 2CDGB 4IRZH 4JHZA 4X7TA 4HKBA 5L8KB 5D5MF 4AYFA 3CD4A 3H7BA 3S37H 4U31A 2GW5A 3VXTA 4NKMB 4ZPVB 4L4VE 3CJJA 4XAKD 2HT2C 3U6RA 3AFLA 4XNQA 1IM9D 5CHNB 2V2WB 4CADB 5DR5H 2R9HC 1MIML 1S8DB 3QEGH 2RGSA 2YUXA 3KYMB 1U93A 1NCWH 3FJTA 1RZJL 3GSWB 3HMXA 4OCWH 3W39A 4PJBE 5J57B 4G80B 4OIAA 4Y2DB 1RFDL 3SDYL 4L4VB 4LLDA 2NTFA 5D1ZC 5LXGH 1FNFA 1HINL 5LGHH 3UX9B 4EIZC 5B22A 3O6FD 2HG5A 5B38B 1UYWL 4JZJB 4GG6A 3WLWD 3KHQA 5IVXE 1KENH 4GLRH 4LLVB 4HWBL 1MRFH 4OFDA 1FLRH 5D7KD 2GT9B 4WUKH 5TQ2H 2BDNH 3JZ7A 4IJ3B 3PWPA 4NO2B 4P2RA 2GK0B 4S1SL 3RWDA 3ULUE 1ZAGA 1MRDH 1HNGA 2F5BL 1CLZH 2DMCA 4TOYH 3MQIA 1G6RA 5AWNL 4KK6D 4HK3N 4PR5B 4ENEC 1AR1D 4YO0A 4PP2B 3MRFB 1RIHL 3RUGF 3ZT5A 1Z2KA 5CUSH 3O6KH 4J3VA 3P2TA 3SKMA 1T5XB 4DEPB 5GRJL 1T7YA 2J6EA 1ZV5A 3OX8A 1UQSA 2IPTH 2DJSA 3C5ZA 4ZNCD 3BISA 2EH7H 1H8NA 3C87A 3RZCC 3TWCH 2A74B 1RUPL 2BOBB 1JWSA 2P8MA 3ARXA 1U3HC 5AG8A 5EPMA 4WW2F 5DHVH 1Q72H 3L3IB 4KQ4H 4E42A 2P5WD 2GHWB 2LVCA 4YNYB 4XNUL 1HOCB 1HSBB 1KCRL 1PQZB 1LO5B 1KIRB 1F45A 2W92A 1A6PA 2NY7H 3RWIB 5GZOC 3KXFA 3RJDA 2P8LB 3OZ9H 3SPVA 5DD0L 4R97C 4GRMB 2X4UA 4FTVE 3MO1B 3QP3A 3IJYA 4F57H 1YJDH 5EOQH 1NAKH 1MJUH 5K9KA 1ZHLA 5DJAB 1DTUA 3L3KB 4Y16D 5D1XA 4G6MH 4P9HH 1DBBH 4XPGH 5EWIH 3LMJH 2R0KL 4OZGF 4WTWA 2H1PH 1PX4A 1WFOA 4NNPH 4QRUB 1FIEA 4Q6IA 4JFHD 4PJ8D 3GMMB 4ZFFB 3O8XC 1Q9OB 4KI5E 5T1MA 2EXWC 3KPMA 3HN3A 1MCHA 4CNIA 4N0YL 3GSUA 4WGVB 4A6YB 5J6HB 4HDIB 1EGJA 3RPIB 4BSWB 4D9LH 3QWQB 4X6BB 1RZ8A 1SJEA 2F15A 4G7VH 4OIBA 2D7QA 2CKBB 4URTB 2F54D 3JV6B 5J1TC 4PJ9A 4Q2ZB 2GITA 2YC1A 3VXNB 1JNHA 4W6WB 1U8OA 1OD9A 4JREC 4UT9L 2OR9H 2VXUL 2X41A 1S7WB 1SM3L 2AJYH 1QEWB 4OD1H 5EFIB 3DUSA 5CD3B 1BBDH 3UTPD 1MCBA 1VADA 4U1JA 1AY1H 4NC1C 3U36B 3MLRH 3DHJA 3HE6A 5DRWB 1N5AB 3QDME 5C0BA 2QQLL 4NUJB 4XP1L 4J4PA 1F4WH 1JHLL 4KV5E 1RJCA 1BEYL 4LRIA 4NQUA 1T1XA 3MRNA 4OM0H 1WBXB 3KGRA 2QQNL 3VD5A 3T0EC 4J8RB 2Y9RT 4ZSOA 4K94L 4YHNA 1CFQB 4NCC1 4HEME 1HH6A 1FV1B 1NAMA 4YFLF 4H8WH 4KROC 1K8IA 4YHZH 3FQXB 4U1KA 1TCMA 5DD1L 4R7NA 2ZZUT 4JY6B 1UM4L 1G7JA 3TJEL 1QP1A 2B1HH 3WNPA 3FT2A 3QQ4B 2DLFL 1OF2A 4HZLB 3GSOB 4Z7UE 5JXAH 3WKNA 5EZLA 4R96B 3I6LE 2PNDA 2E7CA 1JRHI 4PY7A 4F80A 2IGFH 2JE8A 5D7JB 4YHPA 3T2QA 3CGTA 3ARZA 4P2OA 1EEYA 4CVXB 2KL6A 4XMPH 1CU4L 4EVNA 5I76A 2ZKHL 3CFKB 4Z7UB 4M61A 2Y36L 3CC5A 5T1LD 4YQXH 1B4JH 5EUOE 2XRAL 1WFTA 1D7FA 3S4SA 4IIQA 5IB1B 3LZFH 2XZZA 1QLFA 1ROWA 4HFWB 5E8OB 1XT5A 2XA8L 4M7KL 3SGJC 1TJIL 1OAXL 1A14L 3GEWB 3TNMA 1KLUA 3D85A 1T7VA 5FUZH 3NCFB 1LEGB 4P2QA 3WO4C 2HA1A 5EUOB 3GGWB 4L4JA 4NN6C 1QA9A 1WTGT 4IEFB 4U1LB 2ICWI 5FGSA 2P43B 4DFHA 4OI8A 4XVSL 2JCCA 3OKKA 1SJXA 2IPKA 2MJWA 5GJTL 2DQEH 3T4YB 3CX5K 2BVOA 4P5KA 1IAIL 4XXDA 1YC7A 3JTSA 4XTRC 4G8EA 2PXYB 1N2RB 4M8VA 5I1LB 3OR7B 4XX1E 1G7QB 1DSFH 5IT2H 3NACL 1A7PH 1Y18B 1JRHL 1J05A 4YHYB 3TO2B 3RAJL 1YN6B 1S5HA 4OV6F 2H2PD 1MAML 3ZTNH 3V4VH 3KYAA 3RIFK 5E08L 3TO4A 1WITA 1N0XL 2JJWA 2NX5E 3EOTH 4JKWA 5DMGD 3FB5B 3FQWB 2BVPB 3RTQC 2Q6WA 5BV7H 2H41A 5ICYB 5JXEA 4HH8A 4KHTH 4NBZB 5FCUH 1R5VB 4R7DA 1WZKA 3BEWA 3F7VB 4XNMB 5E70A 3TC9A 4N0CC 1I7ZB 1IGFL 1TJGH 4CUCA 3ARGD 5DQDL 2NX5B 1NDGA 5E2VL 3TBYB 5AUMA 3FB7B 5D5ME 3HS0A 5DRNB 1C5DB 3BVNA 2XXCB 1WLHA 4MX7A 1YEFH 3ZDZF 1QLRB 5MENB 3EZJB 1MHPL 2F58L 2HKFL 3CVIL 4U0QB 5D5MB 1MCCA 3RIFF 4HWZB 2AJZA 2NY1C 3HMXH 4NN5B 2HYMA 1P5UA 3IXAB 4X80H 5C8JB 5KS9A 1ZMYA 3RX7A 3I02B 3JV4A 2EDDA 2P48B 2PCPB 3C60B 1CDYA 4UUJB 3S36X 5GGQL 4LSUL 5IB2A 1DUZB 2BRRH 3RDTC 2HMIC 5E5UB 4IMKC 5KSBA 3VFVB 1Q0YH 4Z7WF 5TQ0L 4F7TB 2QBWA 1F11A 1AD0B 4Y4HB 2X4SA 1Q38A 1UJ3C 4FNLH 1OGTB 1AE6H 3FT4B 1G6RH 2DQTH 3VFGL 4L8BA 3X3GH 3RUGE 4TRPL 5L7XL 2ARJA 2DQCH 1BQUA 5AYUL 2QHRH 4J6RL 2YWZA 2J6EH 1XZ0A 2XNAB 1IGJA 3SBWA 3OKYA 1ZVSA 1A9EB 3IDXL 3Q6FA 5B39G 3MNZA 5D1QA 2NR6D 4KHXH 2P5EA 3SCMA 1CE1H 3D18A 3P4NB 4I18B 3EIFA 3NIGF 3L3JA 4JQXA 4RAHA 3MTRA 1G7HB 1U8MA 3P9LA 1CG9A 4K23H 1GZQA 4FHBD 1WICA 2O5YL 3L7FA 3JBG7 1XMWA 4JRYA 2GFBB 5DURD 1IBGL 4FQXB 1SY6L 5CSZB 4WW2B 5A2LH 3PWLA 4CVZA 2DYPA 1EO7A 1JYWA 3PL6C 4IS6B 1QD0A 1YEEL 2L0DA 4OCXH 1KB9K 2APFA 5GZND 5F9WC 2YPLA 5SWZE 3MCLL 1EEZA 1FNSH 5D2LF 3E8UH 5HI4C 3MOBL 2LTQC 3QIUB 3VRIB 3KPOA 2G9HA 1FN4B 4EZMA 3LN4B 1LO3H 2IFFH 3C9NA 4XP5L 3MYZA 4N0UE 4OZFA 1EGJH 4GS7C 4GKZA 4J3XA 3WNOA 2KH2B 4OZGB 3VFSB 2CDEB 1G9NC 4HUNB 5SWZB 4RIRA 4DTGL 1EO8L 2A83A 2AABH 2YSSA 5ADOL 3HAEG 2WQRA 1X4XA 3CSPA 1HDMA 3MRDB 4HUKB 1G0DA 2FX9H 3K46A 1RZKH 2OZ4A 4N9GB 4LPWA 1C1EL 3C8KA 4HLJA 3L7EB 4FP8L 2YS4A 4G5ZL 5L8JB 3QHTC 5KG9B 3VFWB 4U1NA 1VESA 3C5JA 4LGSB 4MJIE 4RZCB 4Y1AA 4CAGA 4JKLA 3CFEA 3SDCA 1R3HA 1UKQA 4OF7A 4YHLH 4GJTB 2FX7H 3EO1A 4XNZC 4MA3B 3KPRE 1A1NB 4R4FH 2FHFA 5IB4B 1AGFB 2CLVA 1TITA 3NGBB 4HIJB 1CD1A 4YX2L 2B4CH 5IBUB 3UP1A 3B43A 3VH8A 2X5PA 4MJIB 1NAMH 1M4KA 2VWEE 4NQED 2DAVA 2XTJD 1EFXB 4BQBA 1XCQB 3D69A 3HE7A 2HVJB 3KPRB 4UOW0 1IGCH 4XT1C 3VCLB 3IDIA 2ARJQ 5KSUB 2V5MA 4XGZB 1G7MB 1NC4D 1BP3B 4LVHC 4WHYG 3F7RA 4X98B 1Z5LA 1MUJA 1E6JL 1V7NL 5LBSL 5D8JL 1E4XL 2A6JB 4XAKE 2H45A 4JM2A 3OBAA 2DM4A 4JPWH 2VQTA 4U3CA 5FGCE 3WJJA 5F7MC 2X9XA 3AREA 4BH7A 4Q9RH 3HC3L 3IDNA 5DJ8B 1HZHH 3BE1L 5ECJE 1CZ8L 3MRRA 4LCWA 3WV0A 4LNRA 1IM9B 1MFNA 4JDTL 3ARYA 5EIIA 1I7RA 4KY1L 4TSCL 2VDML 4JFPA 5FGCB 1A7RL 2CDGA 5FECB 1KSRA 1B2WH 4JG1H 4YHOH 5GJSH 5D7KE 4UDUB 2ZCLL 4NKMA 4ZPVA 3ZYIA 5GGVL 3A67L 2ENSA 2Q1EA 1MFCL 2W0FB 3S8WA 5CHNA 1OTSD 2V2WA 4CADA 5JW3L 3O6FB 3DETD 3GFUA 4YHMH 5GGSY 2I5YH 3GSNB 5TF1L 4BZ2L 2PYFB 3KYMA 4PREB 3INUL 5D70H 1YYLL 3CFCH 3UMTA 1U2HA 4G80A 4Y2DA 1NCAH 1CVSC 2J1KA 4L4VA 3NFNB 4R6UA 5B38A 4JZJA 2V9RA 5EU7E 3ZHDA 4NBYB 4LLVA 1VFMA 2P5WE 4UU9B 5I15H 4WO4C 2GT9A 3LKQB 1MCPL 4PJBA 1P1ZB 4NO2A 1GGBH 2GK0A 1ZOXA 3MLZL 1NBVH 4OLUH 2IF7A 4L8DB 1LWRA 4X6CF 4PR5A 1IGMH 4PS4L 5ALBH 3LEYL 3MBXL 3MZTA 3JXAA 4PP2A 1FCCA 4YDIL 1X6LA 4WFGD 5HDLA 2P5WB 1T5XA 2N56A 5KVEL 4P5MB 5DD3H 2W65B 1H9VA 3BESR 3EYQD 2A74A 1JYVA 2BOBA 4JFHE 3ZDZE 1LE5B 1IZKA 1I1FB 4O5LH 4X8JB 3L3IA 5F7KC 3B8SA 5L88L 4YNYA 1HOCA 4Y16B 1HSBA 4KVNH 4KTYA 1PQZA 1LO5A 2BJMH 3GMLB 4N90D 3RWIA 5IBLD 3DI3B 5CBAB 2PW2B 2QSCH 2P8LA 2K1MA 5MEQB 1ZT1B 3QDJD 4GRMA 4PJDF 5CLWA 1KBGL 3MO1A 3ZE2F 3U0PB 2F54E 5I74B 1FH5H 1NCBH 3B5TA 3BQUC 3HFMH 4PJ8B 5I8KL 5DJAA 1HHJB 3KNBB 3L3KA 3U9PH 3H3PH 1ACYL 1DQLL 1IGYB 1HNFA 3V7MA 3UTPE 4R4NC 4XBEH 5DC9B 2NY2D 5DD6B 1F2QA 4GMTL 4ODBD 4Z7WE 4QRUA 4FTVA 2C4XA 3SKJL 2F54B 1BQHB 3GMMA 5ID1B 4ZFFA 1Q9OA 3PIQB 2PN5A 3KPPB 4BM7A 2HLFC 3LQZB 3BKYL 5J6HA 3U7YH 4HDIA 3RPIA 1YMHB 1WCBB 1I3UA 3TA3C 4N0FB 4BSWA 4JQVA 4X6BA 3LV3B 1DL7H 1KGCE 3U1SL 4Z7WB 4R3SB 2CKBA 4OJFH 3JV6A 3LIZH 1NPUA 4Q2ZA 5FM5O 4M00A 5ITBL 3MRMB 3EFFB 3TNNB 4LASH 1CGWA 4ODVH 1S7WA 3MLSL 1QEWA 4C54A 5EFIA 3MUGB 5CD3A 1MQ8A 4P59H 3SY0B 3LRSB 5GGUB 3KYOB 5GSVB 3U36A 4ODSL 2HT2D 5DRWA 1L0QA 1N5AA 4NUJA 4K3EL 4I3RL 1XF2B 4MXWH 2Q76B 1HIML 2R9HD 3BKML 1LE9B 5J13B 1VACB 4EOWL 1NFDE 2CLZB 4BZYA 5F1NB 1KIPB 2JELH 4LLUB 3BPCB 4M7ZC 2B0SL 1BPVA 4J8RA 2FH8A 1WISA 3EAKA 3KYNB 4YXHH 1CFQA 2AJSL 2VQ1B 3FHQA 3VMOA 1R3JB 1FV1A 4KFZC 3FQXA 2R29H 4M1CC 1ZS8B 4JY6A 5DT1H 3V0WL 4KDWA 5D2LE 3HNTH 2D0HA 1YEJH 5FAAA 3TH2T 3VJ6B 3AGVA 3IDJB 1IVLA 1NMAH 4NZRL 2Y6SC 3MA7B 5GS3A 3QQ4A 4GT7A 5I8OH 4Q97A 4HZLA 3GSOA 5E95B 4OZFH 4ENED 4R96A 3JTTB 4S1QH 5T1LB 1I1YB 5EOCJ 5D2LB 4QXUL 5D7JA 2FECL 1WZMA 2Y1VA 4NWTH 1AR2A 4M4PA 4CVXA 3QIWD 3RZCD 4LSDA 2OZ4H 4KJWC 1OB1B 4OCYL 5D72H 5E2TL 3CFKA 4Z7UA 1PEWA 4RMVA 1U3HD 2XWTB 2CJUL 5IB1A 1KCVH 5JIKA 3EYUH 4HFWA 2ZPKL 5E8OA 2AQ3A 4TNWK 4ZMAT 2DTSA 2KQNA 3EDDA 5LWYL 2GTWB 1UZ8B 1LEGA 4O2CA 5D2NC 5EUOA 4DAGL 3GGWA 5JOPE 4PJGF 4U1LA 1QTYT 3WUWG 4UV4H 4S1RH 1QSZA 3ZKNC 1Z6JT 3T4YA 3BP5B 5JW4Q 5I18L 3I2CL 4QXTB 5EOTB 1QZ1A 3KLHC 3H9ZA 3A6BH 2PXYA 1N2RA 1ZEAL 5J3HC 1J1OH 5I1LA 3OR7A 5CWSB 1JCKA 1G7QA 4Q6YA 4QKXB 1KCUH 3O8XD 5BMFL 1Y18A 1P84K 2EXWD 3CMOH 4RMTA 3TO2A 4U6YB 1YN6A 1OAKL 5I0ZA 4CU8A 1RK1B 3NOIA 2ZUWA 1HWGB 1EMTH 4OI9A 1BQSA 5EU3B 2X9YA 4PTUB 3RNQB 3ARGB 3RA7H 5D6DC 3FB5A 4PLKC 4L29B 4IRZL 3FQWA 2BVPA 3VG9C 4TNWF 5ICYA 2Y06H 2VN4A 3S37L 1R5VA 1ZHBB 4HMEA 3BD3A 4C4KO 4XNMA 2FCBA 3F7VA 4DWHA 1T1WB 4JAMB 4YBLC 1FFQA 1CXKA 1I7ZA 4ORZC 5DR5L 2NX5A 3SE8H 3TBYA 1TVDA 2EDYA 3QEGL 4FQQB 4RDQG 3FB7A 3LEXB 5DRNA 1C5DA 4OCWL 1NCWL 3M07A 3V9FA 1H3WM 3DVFA 3P0VH 3F6IA 4QTHA 1U36A 4KXZI 3T0ED 1N6UA 3GK8H 3CDYA 1QLRA 1MI5E 3MFFB 5MENA 2XG4A 4WTZG 1A2YB 2VL5B 4KROD 4XPBH 1KENL 1MRFL 3S3JA 5IJVB 5D5MA 3NCYP 1F3DJ 4HWZA 2ERJB 2BDNL 3IXAA 5TQ2L 3REWB 4M6MH 5C8JA 1Y6KR 1MRDL 1CLZL 4GXUM 1E27B 3I02A 2EEBA 1MI5B 5FO9B 2PCPA 4TOYL 5EU6E 3C60A 2J8UF 4UUJA 5I1AB 2BVQB 1DUZA 4MVBC 5E8EB 5CUSL 1CL7I 3O6KL 2HFTA 4O2FB 4U33A 3VFVA 4AY0A 2IPTL 4F7TA 1N8ZB 1AD0A 1F3DH 2EH7L 1Q94B 1X7QB 5EBLB 3CK0H 4HAFA 3SHSA 4LEXH 4X6CE 1OGTA 2C1OB 1MOEA 3FT4A 1TFHA 4H0GA 2JK5B 1MCDA 2I27N 4AEFA 1Q72L 1BZ9B 1JHKH 4XMLH 4NJ9H 5KOVC 3IRPX 2NY7L 2XNAA 2HTKC 4O9HH 3ULUH 4LCIH 2GYSA 1GAFH 3OZ9L 4MWFB 1E28B 5DURB 4X6CB 4F57L 1YJDL 5EOQL 3UTQB 1NAKL 2WINB 3EO0B 4OI7A 1MJUL 3RUGA 3P4NA 4I18A 4WTXA 3S9DB 4KRLB 4P9HL 5C0AD 1G7HA 3PDDA 25C8H 4M6AA 3LMJL 2GFBA 2Z9TA 4XTRD 4PJDE 4XHJC 2MWCA 3BIBX 4FQXA 4NNPL 3ZE2E 5CSZA 2FZ3B 1REIA 4WW2A 2ZUYA 3WUZA 2PUQT 2MCG1 3FAWA 3Q3GB 1TZIB 3K8MA 4IS6A 3TPUB 4LSRL 3SE9H 1YUHB 5ESQB 4D9LL 3EJYC 4DGVH 3RVVC 4G7VL 4PJDB 4J1UB 4HF5H 1OP3H 3QIUA 2JIXD 4TUOB 3VRIA 5TE6H 2RIKA 1FN4A 4ODUB 3RTQD 3LN4A 2W07A 1RUAH 3DOSA 5HVHB 1NCTA 1BBDL 5MHSD 3NZHH 5SX4H 1AY1L 1HWHB 4BSJA 3U7AA 3MLRL 4OZGA 5DRZB 3T4AB 1L9NA 2CDEA 2QLVB 5SWZA 3VFSA 4CVWA 4N0CD 4ZTPH 2CKBH 4UT6L 3MRDA 4DKEL 4NQEE 1DBJH 1MCNA 4OM0L 5ADPL 3K1DA 5I1GH 4N9GA 1JI1A 3BAEH 1CICC 4GMSL 3L7EA 4MA8H 4D2NA 4DVRH 2LAGB 5KG9A 3VFWA 3NFSL 3BXNB 2JJSA 4H8WL 2R0ZH 4KQ3H 4NQEB 1LDSA 3T04D 4Z7OF 3VWKC 2XTJB 4LQ1A 2BOCB 4MA3A 5SV3A 1FG2B 3MFGB 2NY1D 2GY5A 4C4KT 1A1NA 5IB4A 4MXQC 1AGFA 4HBQA 4HIJA 1NC4B 4M4RA 3ZHKA 3MLYH 4MJIA 5JXAL 2D7NA 5J1AB 4JO4H 1EFXA 1IILE 3RDTD 2HMID 1XCQA 1CF8H 2QEJA 1TQBB 2IGFL 2HVJA 1BAFH 5KAQG 2E9IA 3KPRA 4BFGA 4K07A 3VCLA 5KSUA 4XGZA 1G7MA 2H3NB 2H32B 2FATH 4WEUD 2OTWB 1GOFA 4G7YH 4X98A 3EOAB 3FB8B 1QFUL 3TBVB 1A6VH 4AQOA 4YQXL 1B4JL 2P8PB 5IW1B 3TBWB 2A6JA 2VO5A 2Z8RA 2A6KB 1P4IH 2IAMC 3ECBB 1LK3L 1TMCB 2CPCA 1S7QB 1EBPA 2Y72A 1ZA3B 4K7FA 2D0GA 3PHSA 4HQQL 1SVCP 3BDBA 1TTUA 2V2XB 4QF1B 5TE4H 1QFWI 3LRHA 5DJ8A 5FUZL 1G9EA 3OKOB 5IWLA 2N7AA 3HNVL 4OLVH 3EYVB 1TZHB 3QUXD 4M6NH 4LSVL 1IM9A 3O3DB 4U1GB 1ZA6B 4FZ8H 1YEGL 2DQEL 2R2EB 5KN5B 3NPSC 5FECA 5DWUH 5DJYB 4KAQL 3TYGH 1FCGA 1S9VB 5IT2L 5DFTA 4E5XB 5CAYB 4PJGE 3VFOB 1A7PL 5I2IB 3ESVF 3DYMA 1A1OB 2W0FA 2VLJD 5FM8A 1FAKT 1NLBL 3O6FA 3GSNA 2PYFA 4PREA 4WFGE 5HHMD 3EOTL 5DEGB 5HI4D 1NGYB 5KVMC 4PJGB 3UC0H 1OAZH 1NJ9B 2UUDK 5DMKB 4LK4A 3NFNA 2J5LB 5IMMB 3OB0K 4FQCL 2EO1A 4UU9A 1TJGL 4I0KA 4M6OH 4GW4B 3RNKB 3LKQA 4ZPTB 1JTPA 1AHWB 1P1ZA 3ZT6A 1JPTH 4LSPH 3TT3H 2Z91B 4L8DA 3QDJE 1MWAB 2YXFA 4IRJC 5FYKU 4PG2A 4G3YH 1YEFL 2J8OA 1OARH 2P5WA 3AAZB 4R8WH 1MQKH 3TF7C 4P5MA 1JNJA 2W65A 3KDMB 2NY0D 2E6QA 4RAUB 5CZVH 2UWEF 4OUUB 5ENWB 5GS2D 3HMXL 4R2GC 5CMAB 3QDJB 2XPGA 1A4JB 4PD4K 3WO3B 4NOBA 4MSWB 2ICCA 5F7UA 1LE5A 1I1FA 2JJUA 4X8JA 3DURB 3FQRA 5IKCB 5BVPH 3GMLA 2MHAB 3T0DA 4MXVF 2BRRL 2VAAA 4AMKH 5CBAA 2PW2A 3V0AC 2NY2B 4WNQB 1G7PB 1I7TB 1ZT1A 5MEQA 4RBPH 1FZKB 5I6XB 1Q0YL 3V6FB 3U0PA 4PJ8A 1HHJA 3KNBA 2Z35B 4FNLL 5D4QA 3BSZL 2DQTL 1IGYA 1LGVA 4KPHH 4P9MH 1D9KD 1BLNB 3X3GL 2CK2A 4P49A 1JZ2A 2DQCL 2RFXB 5DD6A 2QHRL 4ZO8A 2J6EL 3GMNB 4XCNB 3VFRB 2F54A 5MP6L 1BQHA 5ID1A 1GXEA 1MCJA 2ADGA 3TCLB 3PIQA 3KPPA 4TSBH 1H5BC 2J8UB 1A0QL 3LQZA 3QYCA 4UZGA 1YMHA 1PG7H 1WCBA 4KHXL 4N0FA 4H5SB 2YA0A 3LV3A 2OK0H 3IYLW 1PZUB 4Z7WA 4R3SA 5JUEH 4K23L 5DUML 3VD4A 3MX0A 4AEIH 3MRMA 3EFFA 3TNNA 5C3TA 3QFDB 2I07B 4Y5VA 4LSSH 3MUGA 4FQPA 1EX0A 3SY0A 3LRSA 1A5FH 2OSLB 2V9QA 1IC7H 2EIEA 3KYOA 1A3RL 5GGUA 5E8PB 3N1QC 5GSVA 3MJ8B 3QPQC 2KPNA 43CAB 4KMTH 1XF2A 3PP4L 2Q76A 4OCXL 3W11C 1LE9A 5C0RL 4ZUWB 1I3VA 1VACA 2CLZA 4F9LA 5F1NA 1FP5A 1KIPA 1KCSL 1S5IH 5JPMB 5IHZB 3VXPB 4LLUA 2FWOB 2I9TB 1N3NB 3BPCA 3CLFH 5GRWA 3GZKA 1ZE3C 3ZKXC 3PG2A 4X9HA 3KYNA 2VQ1A 2CUMA 5DZLA 1R3JA 2ZUSA 4ODHH 1LO3L 3HC4L 1QRND 1EGJL 4LLQB 3WDIA 4NP4H 5JOFB 2ICWB 1ZS8A 4ETYA 1FVCB 1NFDA 3C8HA 2IH1B 4XVTH 2G60L 4DJMA 2AABL 4PJEF 3VJ6A 3IDJA 4WO4D 4PV9B 4QXGH 3MA7A 3AS1A 1RZKL 3BKJH 3EOYG 2BC4B 3QIWB 3RZCB 4HEPG 5B39B 5KSAC 3I6GB 4U1MB 3S7GA 3JTTA 4EN3C 1I1YA 1U3HB 1JF5A 4MAUH 5BJTB 5D2LA 4OQTL 3IKCB 3BGFC 3FQUB 5IEKB 4HK3J 4AIOA 1OB1A 1QRKA 4YHLL 2FX7L 3RU8H 5IVZB 2IEPA 4CRPA 5KVGH 1D3CA 4PJXF 5CCKL 3QRGH 4R4FL 4JKKA 5KVFH 2VUYA 2FR4B 2C3WA 1I3GL 2XWTA 2B4CL 5E1AB 4MQ7B 4NNYB 1NAML 3F7PC 5ILTH 3BZ4B 5F1IA 4F9PA 4Z7OE 5DYOB 2HRPH 3B9DA 1B0RB 1NUFA 2B2XH 2GTWA 4WFFE 1UZ8A 3PP3K 5EO0B 3BQUD 3O8XB 5K93A 4OLWH 3LKNB 5DMJB 3X17A 3L3HB 1IARB 1L6ZA 4JN2B 3R8QA 1XR9B 1GC1C 3BP5A 3QI9C 4QXTA 5EOTA 4NC1E 4X9IA 3HAEB 1QBAA 1XR8B 5CWSA 2O5XH 2COQA 4JPWL 1GOGA 4QCIB 1MPAL 5C9JA 4U6YA 4WU7B 4WRLA 3IF1B 4TUJB 2HLFD 4P4RB 4X4XB 1HZHL 3AS0A 4M9OA 1RK1A 3T0EE 3TA3D 2E6PA 3N06B 1B4RA 4JFQB 4G8GE 5EU3A 4PTUA 3RNQA 5GRYA 2NY3C 4IBLT 4L29A 4N1EA 1B2WL 3CFBB 3D0LB 4JR9H 4JG1L 4PG9B 2HJLB 3DIFB 5GJSL 1ZHBA 5AAMA 3SE3A 1WC7B 2PW1B 3T0EB 4C59B 3RI5K 1T1WA 5LCVL 4JAMA 4G6JL 3IRZA 4G8GB 1J5OH 3QCTL 3E1F1 4LSTH 2I5YL 4KROB 4FQQA 1I8KB 3GB7B 1JGLH 3LEXA 4M3KB 3CFCL 4HMDA 5D9SB 2GI7A 4ONGL 3D87B 1I85A 1FGVH 4D0DB 3VXOB 4U3XA 1FL5B 3MFFA 1QFOA 3VGGA 4BK5A 2Q7YB 1A2YA 1Z9SA 3HRPA 2V17H 3FKUS 2ID5A 4M1CD 5IJVA 3GSNH 4NWUH 1GHFH 2D7MA 4P0DA 3OKLB 3REWA 3FN0H 1GGBL 4RDQF 3D3VD 4PB0H 4OLUL 4PJ7F 3MV8D 4LPVA 3S4SG 1MI5A 5FO9A 1IGML 1OD7A 1CE6B 5ALBL 5I1AA 1DQQB 3B5GA 3UJJH 2BVQA 4OLXH 1UG9A 5E8EA 4X4YB 3JWDH 2AEPH 3HR5B 2VISB 4O2FA 3RI5F 4M7JH 3DVGB 3PNWB 4G6KH 5C0AE 5DD3L 2MCPL 1Q94A 1X7QA 4YJZL 1IC1A 5EBLA 4G9FD 4KJWD 4XH2B 2C1OA 3E2HB 4ZFOA 4JB9H 5AD0B 1K6QH 2JK5A 3WO4B 1YEKH 2HAZA 4NN6B 1BZ9A 3BI9X 1OPGL 1I9RH 3HCVB 2BJML 5LQBH 3CX5J 5C0AB 2HTLC 1ZLWK 1VFBB 4F7MB 3QEUB 2QSCL 4RAVB 5IEHB 4MWFA 2GEEA 1E28A 2HH0L 4X6CA 2RCSH 3PUCA 3UTQA 3UTZB 2WINA 3H8NA 3EO0A 4AH2B 4Z0BH 1F6FB 5CGYC 3U9PL 3H3PL 2DRUA 5J12C 1KJ2B 1KEGH 3IU3B 1BFOB 1N26A 1M7IB 4AEHH 5I1HH 3ZKND 5MHSE 4KDVA 4OUOA 2UWEB 3KLHD 3ZKMC 5BW7A 3OKDB 3MCG1 4QOKD 5J3HD 5JR1L 4FABH 4MJ4A 2FZ3A 2JIXB 1BWMA 4F7EB 3Q3GA 3RTQB 2AEWA 1WJ3A 3TPUA 4KKLD 3U7YL 1YUHA 3QEQD 1FNEB 3S36H 1E4JA 4I8DA 3JV5A 4PJDA 4J1UA 5DA0B 4R4BA 4LLMB 1G0XA 3DTXB 4PLKD 4ODUA 4LPTA 3GSVB 3BIAX 4GKNB 4LASL 4ZXBA 2QJDA 3UAJC 4LEOB 2WK2A 1CGVA 1CGTA 5GGRY 3QCVH 4WFHD 5DRZA 1HXMB 1P7KB 3T4AA 1NGPH 1Q0XH 4MXWL 4MQTB 2ZUUA 1LEKB 3QCUL 4S0SD 5AZEH 1O7SA 2JELL 3AY4A 5IESH 5DJCB 2DQDL 5EZJB 3TJHC 2NY1B 3U7WH 4ODWB 4YXHL 3BEVB 5EO9B 1FC1A 1B90A 3BXNA 3QPXH 5AZ2H 1CXHA 4NQEA 3PDGA 5DT1L 3RDTB 3HNTL 1YEJL 2BOCA 1FG2A 1NKOA 1NMAL 3BPOC 3IDGB 3J8F7 1R3IL 3LKRB 1NC4A 5I8OL 1UJ3B 5CZKA 4TULH 3SDXF 5J1AA 4S1QL 5FHBL 5I1CL 1XGUB 4MVBD 5B8CC 4PJEE 5CZXD 3HHRB 1V3JA 3AS3A 4NWTL 2H3NA 5JDSA 2ENYA 5TDPB 2OZ4L 2C4FT 2H32A 4TPRH 3QXTA 2OTWA 1UXSB 2NY4C 3EOAA 5ACZB 3FB8A 3TBVA 2VXSH 2P8PA 2R39A 4I77H 5IW1A 1HHGB 3TBWA 1X5YA 5FDYA 1CWVA 5D6CB 2VLJE 4PJEB 2A6KA 3QUXB 2XQBH 3ECBA 1UT9A 5DS8B 3GNMH 1YNLL 3MLWH 3O0RH 1S7QA 1ZA3A 5CILH 1B9ZA 4CGTA 1URLA 1FNGB 5KAQF 4PJXE 2V2XA 4QF1A 5DJZA 5HHME 3O6MH 1QLEL 3OKOA 4KZDH 1L7IH 1RMFH 2W9DH 2ADJB 2EO9A 3EYVA 1TZHA 1S7SB 5EO1B 2VLJB 3O3DA 4S1RL 1ZA6A 4QXWA 1KB9J 4NRXB 5KN5A 12E8H 3VGAC 4NUGL 5F9WB 1NGQH 1T0PB 1J1OL 3VW3H 1S9VA 4PJXB 2R23B 5HHMB 4E5XA 3RGVC 3QQ3B 2LTQB 4Z95H 2LU4A 5I2IA 1A1OA 3MRGB 4CJ1A 3CMOL 3SKOB 3TM6A 5DQ9B 4JO1L 2FL5B 2VH5H 1WTLA 5BXFB 1V7ML 3UYRH 2J8HA 3EJYD 3TP4A 3RVVD 3KPSE 2CXKA 5DEGA 1XGRB 2ATPB 3ME0A 1NGYA 4M62H 5H2BB 3RA7L 4PJGA 1NJ9A 1PLGH 4PRBB 2Y06L 5DMKA 3RWHB 5I17B 1EUTA 4MMXC 4JQIH 4BYHA 4Z9KB 1DANT 1KF9B 2Q3ZA 3GO1H 3FB6B 5IMMA 1YEDB 2IMMA 3HPJB 3BWAB 5DI8B 4GW4A 4ZPTA 3SE8L 1AHWA 4YGVB 5ESVB 4EI5C 1EXUB 2NY0B 2AEQH 3P0VL 1A7QH 2Z91A 3TVMC 1MWAA 1CICD 1C5BL 4LHUG 2GTZB 4UT7H 3GK8L 4OD2B 3WUWB 5IFHH 2OR7A 5IHUL 1J12A 4DKAA 3S5LG 1J88A 3MSPA 3AAZA 4W4OC 5EU5B 3S96B 2YD5A 3RIAK 3KDMA 1FZJB 3VWKD 1EK3A 4G42B 2J4WH 4RAUA 1XFPA 5ENWA 4OUUA 3QDJA 4M6ML 1A4JA 5HYEA 4HS3B 1FRGL 1IRAY 4MSWA 4WWKA 5I1KL 5KANI 3BO8B 4MXQD 3TEUA 3DURA 4XPFH 3U9UB 5IKCA 4LVHB 5INCB 3PXJA 3WNMA 2MHAA 1D9KB 4OF3A 1M1SA 5F7NC 4WNQA 1G7PA 1I7TA 3QUYC 1FZKA 2OTUB 4S11A 3V6FA 3ZMRA 3BDYL 5GRUL 3CH1B 1UKTA 4OM1L 2GSGB 3CCHB 3CK0L 4PJ7E 1H3XA 4XC3H 2YN5A 2Z35A 4Q74A 4UNVA 6FABH 1BLNA 5DTFB 2RFXA 1RUMH 3GKWH 1LEIB 1JHKL 4TTDC 4MDJA 4XMLL 4YIQB 3BW9B 4NJ9L 2IAMD 3GJEB 1T4KB 1AD9B 4XCNA 5IVOA 3VFRA 4O9HL 3TCLA 3RIAF 1GAFL 4PJ7B 5C0NC 4J12A 3BUYB 1SEQH 4Q9QH 5HHPB 4H5SA 4NZTH 4XWOC 2ZG3A 1QRNE 1B0WA 1WWAX 2FEEI 25C8L 4K3JL 3RWCB 4ONHB 3QFJD 3QFDA 1LO0H 3U0WL 4WW1B 2OSLA 5E8PA 1CFSB 4DCQB 5HVWA 3MJ8A 1I1RA 43CAA 1Q9LB 3SE9L 1NCCH 1QRNB 1X5AA 1R5WB 1DBMH 4ZUWA 4K9EH 3WMSA 3KG5A 4HF5L 4WI9A 5JPMA 5IHZA 4P3CL 3H42H 3VXPA 2FWOA 2I9TA 1N3NA 4MNGB 4WO4B 1IGIH 3A6CH 4TVPD 3HRZB 2AJXH 5TE6L 5C0CE 5INDA 3Q6GH 3C6SB 4JFYB 4KTEH 4TNVK 4JKMA 3QT2A 4NZJA 1LO2L 2YR3A 4AZ8A 3NZHL 4GW5B 4LLQA 4M93B 2XIDA 5FYJU 2PYED 5JOFA 3BD5A 2ICWA 2YD4A 1FVCA 1UWXK 1KYOK 2IH1A 3D85D 4ZTPL 1FSKB 1FHGA 1F13A 1NLDL 4PV9A 5IMLB 2BSED 5T1KD 3NCYS 1DBJL 3GRWH 3RVTC 5I1GL 2BC4A 3QIWA 4K2UH 5IQ9B 3RZCA 1W8NA 5B39A 1WEJH 4HXBL 5A2KH 3I6GA 4TN9A 4U1MA 1WV7T 5FHAH 5HDQH 4MA8L 1MIMH 4OV5B 1N5YL 1M7XA 2FB4L 5KANG 3CSBA 4F3FA 1U3HA 3EGSB 5BJTA 5MEPB 1RZJH 4KDTC 1BOGB 4XWGL 4YUEH 3RL1B 2DTMH 2ZOKB 3PGFH 5IW3A 3SGEH 2R0ZL 3IKCA 2W0LA 3FQUA 5IEKA 3WIIH 1VSCA 1T83C 3QJFB 3TBSB 5IVZA 5D71H 4R2GD 2YA1A 4XPTH 2PR4H 4L3ED 2FR4A 4ELMF 5J6GB 5E1AA 3BQUB 1P6FA 5GSRB 3H3BC 4X8XA 1T6VN 4KK8D 4MQ7A 4NNYA 4HBCL 2DBJA 2NMSA 4CJ0A 3FONB 4TNVF 3BZ4A 1BQLH 1I8LC 5TDNA 4WI4A 2F5BH 5DYOA 4I0PD 1KN4H 1B0RA 1BAFL 1IJ9A 3LSOB 5E0QA 1G6VK 3L95B 5EO0A 2OL3B 3O8XA 2FATL 4X99B 3SDXE 3LKNA 4G7YL 1K9TA 3L3HA 5GRJH 4JN2A 5HYSG 3CFDB 1A6VL 1XR9A 5BS0D 3TA3B 4OCNC 4JN1H 3HAEA 1RUPH 1XR8A 4QCIA 4KGJA 5HYIA 2H32H 4XNUH 3WNNA 2VIRB 4WU7A 3SDXB 5TE4L 1KCRH 3IF1A 4X4XA 4P4RA 3ZKQD 1E0OB 2NW2B 4NKDB 4FXLA 4KKCD 1UB6B 4OLVL 4M9PA 4M6NL 5BV7C 1SY6A 4UOW1 4FZ8L 3VFNB 3O41B 3HPLB 5DWUL 3CFBA 3D0LA 3TYGL 4PG9A 5FA4B 2HJLA 3DIFA 5C0JB 4NO3B 1WC7A 4C57C 4OF6A 2PW1A 3T0EA 1FO0L 1AQKH 3D3VE 4M7ZB 5T5NG 3QPQD 3HZVB 3MV8E 1OQXA 1FNLA 4G8GA 3W11D 1P4BH 3QNXB 1I8KA 3GB7A 4ZOAA 5FM4A 4UILH 5D9SA 2ZNXA 2ZOLB 1JI2A 3WN5C 2MPAL 1OT1A 5M94B 3UC0L 1OAZL 2EEDA 3D3VB 4D0DA 3VXOA 1FL5A 3VE0B 3MV8B 2Q7YA 3O9WC 1ZTXL 5ERWB 2X7LB 3ZYJA 3UEZA 4XMKL 4LHJB 5HHNA 3QHZH 2R1XA 4GAYB 4M6OL 4PLNC 3OKLA 4PPTA 1KXQE 1JPTL 2PKDA 4G9FB 1ONQB 1GIGL 1M6OB 4OGYL 4ERSH 2XQYG 4XP1H 3U4AA 1JHLH 5KSAD 3N1GC 1CE6A 4JHAH 1DQQA 4G3YL 1IKNA 1BEYH 1KTRL 3IXTB 4X4YA 1GGIH 4EN3D 1OARL 5D2NE 3HR5A 2VISA 3DVGA 1SJVA 3PNWA 5GRXG 4R8WL 4JKPH 2KDGA 4H88H 2ZUQC 4K94H 3IKKA 3U46B 3GSQB 5CZVL 3SGJA 3S35L 4LVOC 4LCUB 4XH2A 3S6CA 4QOKE 3BMVA 1MWAH 3DXAD 4HIHB 5AD0A 1N59A 3RWEB 1KC5H 4ZUUB 5D2NB 1UM4H 3D1MC 1R3LB 3PE9A 5BVPL 3TJEH 3HCVA 5C70A 1I7UB 1VEMA 4I3SL 5C0AA 1QBMH 1VFBA 4N8VB 4F7MA 3QEUA 4AMKL 3QEQE 4RAVA 5IEHA 2EDLA 4QOKB 2E9JA 3UTZA 1P84J 4XB8A 4HLZG 2GIYA 4AH2A 1X9QA 5E2UH 1FLTX 3IGAB 3NPZB 3CX2A 1YN7B 5EUKB 1KJ2A 2K3TA 3IU3A 1BFOA 4KPHL 1M7IA 5C0EA 4P9ML 4WFHE 4EUPG 3DVNB 1K2DB 1DQDH 3QI9D 2A73B 2FNBA 2UWEA 3QEQB 1BFSA 1NGWB 3OKDA 1CU4H 1U8KB 1FORH 4G6AC 3SO3B 3ZO0A 2D3VA 2PO6C 2Y36H 2A38A 5B3JF 2JIXA 3AMLA 2XRAH 3I85A 3V5HB 4WDIB 1U92B 4TSBL 3RTQA 3VG9B 5EORH 1HYRC 4M5YL 3ZKSD 1PG7L 2B7DT 2WUCL 3OF6D 4M7KH 1TJIH 1FNEA 1OAXH 1A14H 2OK0L 1IC4H 1W0WB 2XZAH 1PYWB 4JFZH 4YBLB 4UB0H 5JUEL 2NY3D 4MQSB 4LLMA 5ISZD 3DTXA 2VSDA 3GSVA 3MJ9A 4GKNA 4OGXL 3LH2H 4LHUD 5I73C 4LEOA 3DMMC 4LSSL 5GJTH 1IC7L 1M05B 3IB4A 5GHWL 1HXMA 1P7KA 4PJ9C 2YRPA 4KMTL 3NMEA 1UWGL 3PHOB 1Y0LB 3NACH 1LEKA 1JRHH 3RQ3A 3RAJH 1FC2D 2V9TA 4WUUD 3QUZD 5DJCA 5EZJA 3CLFL 1T04B 2IPUG 3F7YB 1DVFC 4O2EB 1RY7B 3BEVA 4ODHL 2EDEA 2YRLA 5EO9A 5CINL 3UZEA 2ICWJ 4PBWD 2Q87A 4KMLB 3ES6B 4NP4L 3RDTA 3MRPB 4IMKA 2X40A 1NKRA 5I8CB 4PJ5D 3L3OB 3BKJL 1KN2L 4HPYH 1NFKA 3LKRA 1NANI 4XNQB 2OJEB 2XXMB 1UJ3A 1ITCA 1ITBB 5E2VH 5LVEA 1YNTA 2VDLH 2HLAB 1XGUA 1U8JB 1WK0A 3ROOB 2R8SH 5HHQB 1QKZL 3SE4C 2LU3A 5TDPA 1K85A 5E03A 3RU8L 1UXSA 4LLYB 2E7BA 2I26N 2Z8WC 1MHPH 5ACZA 4PUBH 2P1YA 3QRGL 5KVFL 2R1WB 1N7MH 3O2DA 3OKEB 1HHGA 5FYKL 5CJQH 1NEUA 1UWEH 3BHBB 1T1YB 4PP1C 4PJEA 3QUXA 2C5DC 2V7HB 5ILTL 5DS8A 3E3QC 2HTLD 5GIRB 2HRPL 2LVEA 3UPRB 1FNGA 3RVUD 4J3OC 2B2XL 5E5MB 1QSED 5DZNA 2XTLA 3HI1B 4ELME 1VB9A 4LSUH 4OFKA 2CH8A 1OHQA 1ZK9A 2ADJA 5CGYD 4OLWL 2FBOJ 1S7SA 2VLJA 5TQ0H 1G84A 4NRXA 3ILPB 4RWHA 5KW9H 3O3AB 2DI7A 4PJXA 5F9AC 2O5XL 2R23A 3TIEB 4FG6C 3QQ3A 2HFFB 4ELMB 2X2YA 5C6TH 2GUOB 3MRGA 5F7YC 5MERB 3SKOA 15C8H 5DQ9A 1EBAA 2HWZH 2FL5A 5BXFA 3RKPA 5IIEB 1T1ZB 3ARBD 5EDXA 4HJ0C 1XGRA 4ONOA 2ATPA 1CLCA 2X4NB 5H2BA 5K9KB 2NCMA 2VITB 4PRBA 2H8PB 3RWHA 4CDGC 3ARFC 1IQWL 1YY8B 4UV7L 1IC5H 1CICB 1CK0L 1D6EB 2O5YH 3FB6A 1YEDA 3HPJA 1ERNA 3BWAA 3KPSA 5DI8A 5JORB 4LSTL 5HD8C 4YGVA 4RSVA 5ESVA 3BGAA 2X1OA 1AXTH 1EXUA 1JGLL 1ADQL 4TSAL 3VWKB 4B0MM 4HMCA 5I1JH 4HJGB 1HILB 3CU1A 2GTZA 3TJHD 3V6ZB 1FGVL 4OD2A 5BRZE 3WUWA 3MCLH 3QR2A 2VR5A 4FTVD 4FFVC 2V6HA 1XGYL 2MTPA 2EDXA 5JO5B 2XY1A 3MOBH 3RWJB 2GCYB 5EU5A 3S96A 3NAAH 1FZJA 2V17L 2ZWLT 4MCYB 1U8OB 3MUJA 4G42A 4BFIB 2NY5C 4LARH 1GHFL 2X10A 4LLWB 3FN0L 4HS3A 3TPKA 4PB0L 3BO8A 3TN0C 5C09D 4WHYH 2VDRH 3U9UA 5L0QC 5INCA 4GBXC 5ADOH 1U2CA 4U6TA 4ZODA 2PTTB 2BERA 1D9KA 4U1IB 2CRIA 5A1AA 2AEPL 3L3DB 3IAQA 4KMQA 4QWWC 2IC2A 4M7JL 2OTUA 5EN2B 1VPOL 4G6KL 3IFNL 3CH1A 2IAMB 5ANME 5I30H 2GSGA 1B6UA 3CCHA 4EXKA 4KI1A 1HN1A 3EW3B 1HH6B 2IMNA 2MQCA 5LAXB 3QFJE 5GS0C 2NY4D 4JB9L 2YA2A 5DTFA 5ABDE 1LEIA 1R6VA 1JIBA 4E41D 1YMMD 4I5BA 5CEZL 1I9RL 4YIQA 2YHGA 3BW9A 4JANB 3GJEA 4WWID 1A7NH 1T4KA 1AD9A 4QNPF 5ANMB 4Y89A 2DS4A 3T3MF 4PJ7A 3NPSB 3QDMD 2FBJH 4YX2H 1OF2B 3QFJB 3BUYA 5E4IA 1VENA 4N5EC 1VEOA 3ZT7A 5HHPA 4TVPE 1UZ6F 4Z0BL 4OFYD 2EIDA 4WTZA 2YD1A 3S3SA 4Y88A 3SBWC 1KEGL 4LNVA 2W9EH 5DJXB 4DOHE 1FL6B 4XNXH 2PYEE 3RWCA 4AENB 4QO1A 2RB8A 3I9GH 4FABL 2YPVL 4WW1A 5J4MA 5LBSH 3RGVD 4R0LC 2VR4A 2ICEA 4DCQA 3MLXL 1D5IL 3TLRA 1RUKH 1KJ2H 1Q9LA 1S78D 1QRNA 3ZDYF 3HKFA 1R5WA 4DOHB 3QB7C 3DX7B 4O58L 2PYEB 1SBBA 4JGJA 1JFQH 3D85B 2A6IB 3K2UH 5B3JE 1M71B 4N8PA 1JPGB 4WO4A 3V0VB 3HRZA 4RA0C 5T1KB 1KLFA 1CGUA 3C6SA 4JFYA 3H6JA 2BHUA 4F15C 2UUDH 5FGBC 5JW4N 1UEMA 3HMWH 3QCVL 4ISVB 4GW5A 1TVHB 4KY1H 4TSCH 1A7RH 1L0XA 3DUHA 4L3EE 1UB5B 1NGPL 1ULVA 1Q0XL 2VDPH 3OB0H 4PJBF 5IMLA 4D3CH 3A67H 1ZXQA 5AZEL 3MJ9H 5IQ9A 3AVEA 2N1KA 4PD4J 5IESL 3TVMD 1KG0B 4R2GB 5DLML 4OV5A 4MZ2A 4RRPG 4OKDA 4L3EB 5IVXF 3EGSA 1RJLA 3EYSH 3INUH 2BY3A 3DSNA 1BOGA 1Q1JH 3OKNB 3RL1A 2ZOKA 4HWNA 5I75C 4OCRH 5AZ2L 5BS0E 4NC2B 4HC1A 3T1WA 4I0PB 3QJFA 3TBSA 1EV2E 2B8OT 2XY2A 2XWBB 4WHDA 4M48H 3GMOB 1HXYB 4F8QA 4LIQE 1NC2D 1G1YA 5J6GA 3BQUA 5GSRA 1CXIA 4TULL 1ZHKB 3FONA 1MCPH 1IE5A 5BS0B 3MLZH 4NT6B 1CDJA 4JZNB 4PJAF 3QUYD 3K0WA 4PS4H 2YZ8A 3LSOA 4P23C 1TNNA 4OBSA 1G1CA 3L95A 2OL3A 1V3LA 5JW4R 1ZWIB 4X99A 4JO2H 3ZTJG 2V5TA 4JGMA 1H5BB 2HT3D 3CFDA 1S7XB 5KVEH 1RZFL 4I77L 3TA3A 3SEPA 5F6HI 4P46C 4R26L 4RNRB 4KWUA 5BOPA 4HIXH 4U05A 2EDWA 3GNML 5BCAA 3MLWL 3O0RL 5CILL 1X5HA 3BZEB 5C0ND 2VIRA 3SDXA 3WE6B 3ULVC 1YDPB 4ZOEA 2NW2A 1L7IL 1RMFL 4NKDA 3O2DH 2EDQA 1UB6A 1E6OH 3DUUB 2FSEB 3RL2B 3VFNA 1VHPA 3HG1D 2DDQL 2MFNA 1QR1B 3HPLA 2ZG1A 2SEBB 4OSUL 1NGQL 1PJ9A 3QNYA 5FA4A 2VC2L 5C0JA 4NO3A 1AKJD 1GH7A 1ACYH 1DQLH 4WEBL 3NIFF 5HGDB 5K9JH 4Z95L 3W0WD 1F6AA 3FT3B 1BHGA 1UC6A 4WGWB 3ZKXB 3HZVA 3TCXA 5HJ3B 2XWJB 1KT2B 1A1MA 1E4KA 1F4AA 2VH5L 5F7DB 3QNXA 1NSNL 4MJ5B 3QXUA 1ZANH 3M45A 5JW5B 4NN7C 4HS8H 2J12B 2ZOLA 4M62L 3GI8L 3D9AL 3P0YH 3D3VA 1PLGL 3FO1B 4BUGA 3VE0A 3MV8A 1TJHH 1FZOB 2NY5L 5ERWA 2X7LA 3DXAE 3GO1L 5KSAB 1MREH 1P2CB 2APWA 3H9SD 5T5NF 4EN3B 5TJWK 4QEGA 4GAYA 2O26U 4WV1B 4LP5A 3IETB 1RD6A 3RVTD 3BGFB 4J3SA 1U3ZA 5FKPB 4NZUH 1ONQA 2AEQL 1GJIA 4I3RH 3PV7A 4ZFZB 3DXAB 4UT7L 3BKMH 2R69L 3IXTA 4IJ3C 1IQDB 5IFHL 1IAIM 2NW3B 3DVIA 5GGTA 3MZGB 1I8IB 2AEIT 4MJ6B 5DFVC 1EEUA 4NHCH 2J4WL 3U46A 2AJSH 1S9YB 4LCUA 4KKBC 5GS2H 4F37K 4HIHA 1A8JH 3V8CA 4GKZB 2XV6B 3RWEA 3V0WH 3L1OH 4XPFL 7FABL 5D2NA 2YUVA 1R3LA 1H3VA 1I7UA 4N8VA 2JLLA 5HDBF 3S88H 3QI9B 5C07D 3K4DA 2EYRB 4QOKA 1MHHB 2F5AH 5ISZE 3VMPA 3PP3H 1IM3B 4XC3L 1JYXA 3IGAA 3HB3C 3C8DA 1EVUA 1MFDL 1YN7A 5EUKA 3CAFA 3CFEB 1BVKB 6FABL 1SMOA 3F58H 4TUKH 3DVNA 1F00I 4ACPA 1K2DA 1WAAF 2A73A 3GKWL 3QEQA 4KK9C 1NGWA 1U8KA 5E2TH 1LK2B 3HUJE 2NY3B 5FYKD 2V5YA 3ARPA 5D6DA 5ISZB 1CD1B 3LKSB 3V5HA 4WDIA 2VLKD 1U92A 4LHUB 4WUUE 4ZFOL 1NL0H 4Q9QL 3K2MC 2ZPKH 3QH3B 4F37F 3J7HA 5FUCC 2FHCA 3S5LB 1W0WA 3QUKB 3HZMB 5FF6B 1OOAA 1PYWA 1RULL 3T3ME 4PGEB 4AL8H 4DAGH 2AGJH 2IPUK 1R3KA 5CGMA 1LO0L 4U6XB 3GMRB 3E6HB 4WUUB 3QUZB 1UZ6E 5I18H 3K3QA 4LGRB 1PVHA 3OG4B 2VDKH 3HLAB 3MRKB 2QR0B 1NCCL 3OV6A 3UROR 4M1DH 3PHOA 1Y0LA 3DECA 5BMFH 3H9YA 4BH7B 1KFAH 4I2XE 3H42L 3W9EA 1T04A 1IGIL 3A6CL 4EI6B 3WKMH 3F7YA 4IOFC 4PJ5B 2UZIH 1Z0NA 3Q6GL 2QSTA 1UCTA 4KTEL 4O2EA 5EBGA 5JIHA 3BH8B 1LVEA 3O9WD 3ZDYE 2ITDB 3PWNB 4WI2A 3BRFA 3ES6A 4B5EA 2Y5EA 3S35X 4YPGB 1KPVB 4JM4H 4I2XB 4RFOL 1WCQA 3MRPA 4Y5XC 4LDOB 3QG6A 4IMLB 5I8CA 3L3OA 3GRWL 3QWOB 4AIXA 1DN0B 4K2UL 3CNKA 5JQ6H 3KWWB 2OJEA 1NCDH 1WEJL 4N8CL 4GSDH 1BGXH 5FHAL 5HDQL 1A6ZB 3VD9A 1QSEE 2HLAA 1KUMA 2P44B 4WENB 1U8JA 3ROOA 4FMKA 2EYTB 1KXTB 5HHQA 5TDOB 1BWWA 2MSPA 2YBRB 3CZFB 4OBRA 4YUEL 2YK1H 2DTML 3I50H 3PGFL 5H37H 2Q3AA 4QRSB 3WIIL 2OCFD 1YEIL 4YC2C 5ALCH 4IOIB 1UM5L 5D71L 4YK4C 3NTCH 4LLYA 3V52H 4XVJH 4XPTL 2PR4L 4J3TA 1QSEB 1K5NB 2R1WA 3OKEA 3STBA 3BHBA 1T1YA 1W72B 3LRGA 4XCEB 2V7HA 4PJBB 1BQLL 5J12B 3GBNH 3IJHB 1ZLWH 5GIRA 4HWEH 2X1PA 2QQQA 4HC1H 3UPRA 1KN4L 1YYMH 5T3ZD 2V2TB 1XF5B 2P42B 1PG7X 1A6UL 2XT1B 5E5MA 3O6LH 3HI1A 5IVXB 4Z77B 4XP4H 1G7LB 1T0MB 3OJDB 5CJ5A 5FKAB 3R0NA 1AC0A 3ILPA 1IMHC 3O3AA 1T2QH 3FO9B 4PJAE 3T77B 4X7CC 4H0IA 3BX7C 5FXCH 4JN1L 4ZS6C 1NBYB 3ARBB 4G6AD 3TIEA 1U8QB 4BUHA 2HFFA 4ELMA 5CEZD 2OL3H 4RFEB 2GUOA 1X4ZA 3T0WA 2MMXA 5MERA 4KXZH 4AQ1B 1QHOA 2WP3O 2P47B 1K4CA 3QAZC 4K8RC 4PJAB 4MZ3A 1UADC 5E94B 3B2VH 5IIEA 1T1ZA 2KQMA 5EB9A 3V79C 3QJHB 4NQVB 2X4NA 5HHOD 4RX4A 2VITA 5I71C 2H8PA 3VDAA 1DZBA 1YY8A 3DMMD 4GRLD 1E4WL 1CICA 3DNKA 1D6EA 3I3BA 1AQKL 4OGAC 5C09E 3KVQA 3OXSB 3LCYA 4X7DC 4FTVB 5JORA 1BECA 3G5XB 1P4BL 2EDRA 1CL7H 3DBXB 4YDVB 3VWKA 4UILL 3NIFE 4HJGA 4D0CB 4LSRH 1HILA 2VDQH 4PRPD 3V6ZA 1DVFD 1JNNH 5C09B 5IFJB 5HYSB 4FQHB 4DGYH 4L9LC 3RWJA 5JO5A 1JWMB 2GCYA 1S7TA 4TYUA 4MCYA 2C1PB 4BFIA 4MNQD 2AI0L 4E41E 1YMME 3QHZL 5E56A 5B8CB 4D0BB 1S9KC 4LLWA 1LO4H 5EU4B 6CGTA 4LDEB 5IHBA 1DLFL 4Y8AA 1QSVA 4ERSL 3ET9F 3S3PA 4OQTA 4UT6H 2NY4B 4JHAL 4DKEH 2W0PA 4CN6A 2PTTA 4U1IA 1GGIL 3TZVC 5ADPH 3FQTB 3L3DA 4RMUA 1FYTE 3P77A 3GMPB 1FDLL 4E41B 1YMMB 4N68A 3NA9H 3P11H 5EN2A 4GMSH 4JKPL 2IAMA 4H88L 5CP3A 2QTEA 5LAXA 3QDMB 3L5WA 1KGCD 1AFVL 3NFSH 5IVNA 1MWAL 4FFWC 3MUHL 3JUYA 5EC2B 1KC5L 4POUB 4Y4HC 4PBVC 2Y4SA 2F53E 5GGTH 4PP1D 4JANA 1GL4B 1CYGA 3QO0B 1QBML 2EZ0C 3MA9H 3BP6B 5ANMA 4DK6A 1LDPH 3QFJA 4JLRB 4XI5C 3RGVB 5E2UL 1TXKA 1WT5C 2WWKO 2O61B 1X5KA 2CGRH 3G04B 4E0RB 2OQJB 3MLVH 4JPVH 4NCC2 5DJXA 4HW6A 3FZUC 5HDBE 1FL6A 1DQDL 2VDNH 2BRQA 4GAFB 3MJGX 4AENA 1CS6A 1FORL 1MAKA 3VXQB 3MRJB 4HJJL 1QFUH 4FG6D 4FFZH 3MC0A 4HX1B 3ZZ1A 5EORL 4JDZB 3VRLF 4FQXC 4QHNB 1LK3H 1WAAE 3DX7A 4W6XB 5GGSB 4ZUSB 2PYEA 1IC4L 3BH9B 4HQQH 2XZAL 4JFZL 5DA4A 3GUTB 2A6IA 4UB0L 2WIIA 1M71A 4HJ0D 4YHKL 4LLAA 1JPGA 4O2CB 3P9MB 3V0VA 3QXAB 1FO0B 1KJ3L 2CDFB 4XPAH 5T1KA 3HNVH 1CFTB 3LH2L 3VFMA 1MCRA 4LSVH 2YUWA 3ARFD 1MSPA 2LV4A 3TVMB 1YEGH 4ISVA 3WJLC 1TVHA 4JY5H 4IRJA 3VRJB 1UB5A 1JL8A 4KAQH 4I1NB 5E99H 5HD8D 1CQKA 4DN4H 5JA9A 1KNOB 3T8XB 3MGOB 4YGAB 1MHCB 5ICXB 1OSPL 4UTAH 3EBAA 1KG0A 3K81A 1NLBH 4G6FD 4NSKB 4CN4A 1CTNA 1AGDB 2GY7B 4L3EA 1NC2B 4YHIB 4RFNC 3GHEL 4FFVD 3OKNA 1D5MB 4EUPB 4QRRD 2Y25A 1A7BA 4KC3B 5JOPD 5B21A 4I0PA 1X5GA 1X4YA 3RY6A 3S98A 2XWBA 1UXWA 4S1DC 4PGBB 3QUYB 3WS6C 3GMOA 1HXYA 3CZJA 4J3UA 5F6IC 2EH8L 4ZOCA 4HPYL 3IS0X 3TN0D 4FQCH 1N64H 1QFWH 4GBXD 4CMHC 1ZHKA 2VDLL 4OD3H 5C0FB 5BS0A 3AROA 2X05A 1F6LL 2O5ZH 2R8SL 4NT6A 4JZNA 2D2OA 3OWEA 3AM8C 4QTHB 3L5HA 1CD9B 1JZ5A 3HG1E 4C83B 4DQOH 2GJZB 3KAAA 1ZWIA 2OMNA 4JO3H 3UCRA 1UCBH 3ABZA 1H5BA 2WQ8A 4PUBL 1S7XA 3BZFB 4HT1H 4NO5B 4F8TA 1N7ML 5CJQL 3W0WE 1UWEL 2M8XA 1NUNB 2X44D 4RNRA 4U0RB 1KJVB 3R8BB 1RJYB 4CDHA 2H26B 3HG1B 3WL9B 3A0OA 3OJ2C 4K8RL 1CR9H 5DUPH 3BZEA 1PX3A 3WE6A 1AKJB 1YDPA 4N5ED 1LNUB 3W0WB 3DUUA 4MA7L 2FSEA 3DSFL 3RL2A 5E00B 3R06B 1MFAH 2YD2A 1IAMA 5KW9L 2AKRB 3H9SE 1I75A 1QR1A 2SEBA 1MI5D 3WFEH 2AJUH 1O5DT 4JVWA 1FFOB 1ZT4B 3BSZH 3HA0A 3DWTA 1A02N 4BQ8A 5HGDA 4QT5B 5E2WL 5DMYA 3FT3A 2WSKA 4ZAKC 5C6TL 2NZ9C 1RU9H 2FO1A 3U2SB 1HQRB 15C8L 1UH2A 2F19H 5HJ3A 2NYYD 1F58H 2XWJA 1KT2A 5MP6H 2HWZL 1KYOJ 4QRPD 3HZYB 1RQ5A 5F7DA 3H9SB 4MJ5A 5EU6D 5JW5A 1A0QH 3MRCB 3B9EA 3KR3L 2VMFA 3RUGB 3FO1A 5DK0B 1FZOA 4S10A 1IC5L 4Y8DC 5KSAA 5DUMH 1P2CA 3OXRB 4EN3A 1NFDF 3QQ9C 4OB5H 1UWXH 4OZIF 4WV1A 3HI6H 4LVEA 2DLHA 1V8HA 2CUIA 1AXTL 3IETA 1XIWC 3EHBC 1A3RH 5FUOH 5FKPA 3T09A 3OMZA 5C07E 1UH3A 5I1JL 2PTVA 3JWDC 1C5CH 1BBJB 3PP4H 4ZFZA 3DXAA 3V7AE 2DL2A 5C0RH 2IBGA 1IQDA 3KS0J 1X5FA 1KCSH 2NW3A 1WUNT 1I8IA 3OAYK 1MRCH 1S7VB 3NAAL 1YPZF 4MJ6A 2E7HA 4PG2C 2IQ9L 4LARL 1OAUH 1S9YA 1EZVX 3HC4H 5C07B 5F1SA 1F8TL 2D31A 3MBEC 1EHAA 2A2QT 1DQJB 1P5VA 5FYKE 2UVFA 1KEMH 3GKZA 3KLAB 2VDRL 2EC9U 2VLKE 2G60H 5JZ7C 3H3KA 3VD7A 3KS0H 2RHEA 5CD5C 1Q9WB 1GZPA 4ZXBD 4BFEA 1GPOH 3QI9A 3MCKB 2P45B 4GKOA 4PGCB 2NXYC 3W5MA 2EYRA 4FQ1H 1ED3B 4N0UB 5I30L 4Y16C 5LJYH 1C8PA 1MHHA 4P23D 3NN8B 4EDXB 1IM3A 3WBDA 4YXLH 2VLKB 1N4XL 4UIMB 1BVKA 4OQTH 3ZDXF 2VAJA 2XZQH 4QRTB 3B9AA 5I74C 3OF6A 3ORJA 1MAJA 4P46D 3SDDD 1LK2A 3JV0A 4PGJA 1A7NL 5CCKH 5CP3H 5CGTA 1I3GH 5ISZA 3LKSA 2FBJL 1WZLA 4JZOB 2R2CA 4LHUA 4CN1A 1L7TH 3QH3A 2W91A 1NFIB 3UJTL 3OAUH 4JFXB 3MV9D 3S5LA 3QUKA 3HZMA 5FF6A 32C2B 3Q48A 2W9EL 4U6HB 5IM7B 4PGEA 4XNXL 1B88A 2OP4L 2VN7A 1FNHA 4MD4B 3PDOB 5JIIA 3I9GL 4U6XA 1LP9F 3E6HA 3GMRA 4WUUA 3QUZA 1Z0MA 4L4TD 2ITCB 3GMQB 3WN5B 5IB3B 1ZGLM 3S34H 3RHWK 1CT8B 1QFHA 1EPFA 1RUKL 3HLAA 1KJ2L 3MRKA 4JHBA 2QR0A 4LVNB 3O9WB 5TPWL 1MPAH 4K7FB 1JFQL 3K2UL 2B5IC 4X6DF 4EI6A 1T89C 1ZHNB 4PJ5A 4TVPH 4CW1B 3GI9H 3VRLE 1KELH 3BH8A 3HMWL 4P4KC 3STLB 4RGOH 2ITDA 3B6SB 3PWNA 2ZCKL 5SWSD 2VOTA 2BXZA 4YPGA 5A43C 1KPVA 4I2XA 2VDPL 2DQHL 4LAQH 4RQQA 4IMLA 2ICES 4ESKA 4D3CL 4Y7MA 3QWOA 1DN0A 2DBLH 4Y2OA 3MJ9L 2D9QB 2I9LB 3KWWA 2ZUQB 1JGDB 4N0RA 5LCVH 3WNKA 5T3ZE 1U8HA 2VLRD 4G6JH 1JGVH 4LVOB 3AB0C 3QCTH 4LP4A 1A6ZA 2BSSB 4U7MA 5IOPB 3VXUD 2Z8VC 2EYTA 3EYSL 5TDOA 3EZ8A 3CZFA 3RHWF 2YBRA 4H1LG 2BZDA 1Q1JL 3ETBF 4ONGH 4OCRL 1INQB 4QRSA 5DFVD 5C08D 3QNZB 1NMCB 4IOIA 3HI5L 4KKBD 1YECL 4M48L 1QSEA 1BM3H 1K5NA 2FD6H 3UDWC 4PJCF 5CEZE 2VR9A 1W72A 2D4DA 4XCEA 3VDCA 3G5YB 1J8KA 2X4TB 5T5FH 4OAWB 3IJHA 3QULB 3OR6A 4F58H 3I3DA 4HXAH 2V2TA 1XF5A 1L4IA 3WHXB 1IEBB 3IFOB 1BREA 2EDTA 3GSXB 5FYJD 4Z77A 5IVXA 5E4EC 1DEEB 5HHOE 1G7LA 1T0MA 3OJDA 4JO2L 5FKAA 1DBAL 3HB3D 1P9MC 2MCPH 5E8NA 3FO9A 3T77A 4KK9D 4P57B 1WZ1H 4HIXL 1NBYA 3ARBA 2XPGB 1U8QA 2AK4D 4RGNC 4KUZL 4YAQB 2I60H 1X6NA 4RFEA 4LIQH 3K1KC 5HHOB 3FQRB 1OPGH 5I73B 3CXDL 1OY3B 3DMMB 4Z76B 4GRLB 4PRPE 3O2DL 4L8SC 2VAAB 4PJAA 1E6OL 5E94A 5IJKC 3BKCL 2HH0H 4XVUC 3L9RB 4AM0A 3QJHA 4WWKD 4NQVA 5DVNA 1WGOA 5DJ0B 3CDFA 4OF0A 1QQDB 4MNQE 1ZVHA 3BT2H 5F70A 1OTTD 1II4E 5K9JL 2UV3A 4PRPB 3ARGC 3K80A 1DVFB 3F7QA 5IK3B 1JPST 2EDNA 3OXSA 3P3YA 3CH8A 2APBA 2CIKB 4L3CB 5JR1H 4YPJA 3JWNC 2A9NL 3G5XA 2ADGB 3TH4T 2Y5TB 3DBXA 4X4ZA 3WSQH 4YDVA 1ZANL 3B2UC 4MNQB 4HS8L 4D0CA 2X4PB 4UOJA 3RX8A 3OSKA 4IOFD 3MNVB 3P0YL 4BJLA 3T3PF 5C09A 2O93L 1TJHL 5HYSA 4FQHA 4BKLB 3QUMB 2E7LC 5IFJA 4JCMA 1JWMA 3BIKB 1MREL 3IDMB 4UNUA 2C1PA 5SX5K 1G9NL 5B8CA 3DO3A 4Y5VB 4D0BA 1VERA 5F1KC 1JYNA 1F4XL 2FGWH 3U79A 5EU4A 1WBYB 3E3QE 4XCCH 2OM5A 1MCWW 3LDBC 4U4BA 4NZUL 4FZEH 1R0AL 2VZOA 1A47A 2UZYB 4UIKL 1P4LB 3QCUH 1TPXB 3FQTA 5FO7B 3CSYB 4EIGB 4OZIE 5LKNA 3GMPA 3W5NA 4E41A 1YMMA 2DQDH 5GS1C 4GG8B 4NHCL 3MV01 3GHBH 4NQDD 4JY4B 5D1ZD 4QTIL 1BIHA 3QDMA 3WS3A 5EC2A 2LE9A 2RQ8A 3L1OL 1NFDB 4OFYA 4OZIB 3RBSA 4RWYH 1RV6X 1HSAB 1YPZE 3B3IA 3QO0A 4HKXB 3BP6A 3NIDE 2AVGA 5JDJA 1R3IH 1HEZB 3S88L 2NR6C 4KVCH 3ARDC 3BUTA 3G6AB 1S9WB 2VXQH 2NXZC 4H26A 2VXTL 4JLRA 4YZFF 5FHBH 5I1CH 2F5AL 3DHMA 3V6BR 2H6PB 3RGVA 3O2WL 2O61A 3KJ6H 5D7IF 3G04A 4E0RA 2OQJA 2GK2A 3F58L 4TUKL 1YPZB 1MCFA 1QFWM 1SYVB 2CMRL 3EYOB 1GC1H 3LKOB 1RIUH 5HGGS 4ZS6D 1DR9A 3VXQA 4LCCC 4XHQA 3MRJA 4OT1L 3SDAC 4PLJC 4CL7A 3DGCR 3VMNA 1IGTB 2HN7B 3HZKB 4HX1A 4K9EC 1CGXA 3ZDXE 4JDZA 1K8DB 3ARFB 1NL0L 1N6VA 1X5ZA 1AIFB 4QHNA 5F1IB 3MXWL 1AC6A 1YNLH 5GZOD 5CJBA 4K8RD 2UYLB 1BVLB 5GGSA 4ZUSA 4BA8A 3BH9A 4IHOB 1OW0C 3GUTA 4JFDD 4QRRE 1QLEH 3P9MA 3QXAA 1AXIB 1FO0A 4AL8L 5IV2B 2CDFA 1BMGA 2AGJL 2EE3A 4EI5A 1CFTA 1YEHH 3MRBB 2CO6B 1KCLA 3TVMA 4G6FB 3VRJA 1WAAA 4YBQC 4NUGH 5GPRA 1BZ7B 5IFAH 2XI9A 4X5LA 1AH1A 2VDKL 4M1DL 2LQRA 4QRRB 3RWFB 1OAYH 1KNOA 3T8XA 3MGOA 1KFAL 5C9JB 1MHCA 3ESUF 5ICXA 1Z3GH 1BFVL 1LP9E 5L6YH 4QHLA 1RZJC 4NSKA 1C16B 3WKML 2UZIL 1NBZB 4JO1H 1AGDA 1V7MH 2FEDC 4MAYC 1NC2A 3KJ4C 3TN0B 4YHIA 4WFFD 3WFBL 1D5MA 3W82A 4EUPA 5L0QB 2D7TH 4GBXB 4HV8B 2E8YA 2W60B 5F9OL 4APQC 4LAJH 4JM4L 1OP5K 1FYHB 2AP2A 1LP9B 4X6DE 2OI9C 2XZCL 4PGBA 3QUYA 1AI1H 1OWRM 5JQ6L 5E6YA 1NCDL 3D48R 3FRPG 2XTJC 4GSDL 1BGXL 2DI8A 5DGQA 1Q9KB 2VLMD 2YEZB 5C0FA 3WXWH 3TZVD 2FO4B 4P2YA 3UYPA 3MXVH 2YK1L 3C09C 3I50L 4X6DB 2XYCA 1C5BH 2N7BA 4C83A 4JPIA 2GJZA 3L3GB 3V52L 4G8GD 5ALCL 5IHUH 4PY8I 3NTCL 5KJRL 4FFWD 4XVJL 3BZFA 4NO5A 5D96C 1NEZG 2DM3A 4BQ9A 5C86A 1VCAA 2R2HB 1HKFA 4JRYE 1KJVA 1RJYA 2H26A 1FRGH 2IJ0C 4KRPC 5I1KH 3GBNL 3HG1A 2W38A 2DIJA 4HC1L 4HWEL 4QRPE 3WL9A 4BFBD 1YYML 4LSQL 1MCQA 1PKOA 1T21B 3FFDB 4NM4H 1AKJA 3O6LL 1LNUA 1MCOL 4IDLA 4PJCE 1J0IA 4XP4L 4R0LB 3W0WA 4RISH 1W72H 2BP3A 3CVHL 5E00A 1WIPA 3R06A 3BDYH 5IB5B 5GRUH 3IAPA 4PRID 4OM1H 3LQAC 2AKRA 1T2QL 3FZUD 3QZWA 5MEOB 4QRPB 4AIZB 1ORQB 1FFOA 1ZT4A 3SGDI 1JZ6A 2EDOA 4HFUH 5EU6B 4ZFOB 5IF0B 2WM0A 4QT5A 4LBEB 4PJCB 2OL3L 5CJXA 3SQBA 3U2SA 1HQRA 4F15B 1X3DA 1V5JA 1EHNA 2IAND 4K3DH 5H37G 1GYAA 4NO0D 3ILQC 3MR9B 1RURL 3HZYA 3H9SA 3JWOC 1QHPA 1MVFA 3B2VL 1ZSDB 3Q0HA 1F42A 3MRCA 1I4FB 3LN5B 2EYSB 5DK0A 5JHLL 1XF4B 3VI3F 4K3JH 3OXRA 4GQPH 3MOQA 1FZMB 4PB9H 2Q8AL 3K74B 3U0WH 4KDTA 4POYA 5I75B 1CL7L 3MRQB 1EERB 1J7VR 1T83A 1A64A 2PF6A 3ARQA 2VDQL 1BBJA 1K4DB 2VXVL 1MLBB 4K3HA 2A77L 3QDHA 1JNNL 1Z9LA 4I9WE 1ES0B 4DGYL 1RPQA 4R4BB 4P3CH 2XICA 1S7VA 3R1GL 1U42A 1QYGH 1FG9C 2NTSP 1I8LA 2Z0BA 3F62A 4ZXBB 1LO2H 5C07A 4S1DD 4GAGH 3KPLB 1LO4L 1DQJA 3T3PE 4P23B 3KLAA 3Q2CA 4U2YA 4O00A 4Y5YC 3FN9A 4ZUTB 2HT4C 5EZIL 1W0YT 2BNQD 5IP4A 3ULVE 1NLDH 5ESAB 1Q9WA 2MNUA 1AO7D 3MCKA 1INDH 2GAZB 3MV9E 1FJ1B 4PGCA 3NA9L 4P46B 1T22B 3P11L 4HXBH 4NGHL 4UNTA 3SDDB 5C2BH 1ED3A 4N0UA 1UA6L 4AEEA 1N5YH 2G5BB 2FB4H 1UM6L 3NN8A 4EDXA 5BZDB 1QBBA 4D94A 2VLKA 1FFNB 3KLDA 4N1CA 4XWGH 4UIMA 2NY2C 2DIAA 2X4QB 4L4TE 1VEPA 4QRTA 2YD9A 1YC8A 1HH9B 4Y4KC 4W81A 5DF0A 5GGTL 3MV9B 4EQ2A 1R24B 3MA9L 3V4PL 2YN3A 4NFDA 1U8NB 1LDPL 4JZOA 1EAPB 1XAUA 2WAHA 1PSKH 4HBCH 1XEDA 3T2NH 4QHUB 5DHXB 4NCDA 1NFIA 4L4TB 1VDGA 4HG4K 2BVYA 4JFXA 2CGRL 5FV1L 3ZE0F 3MLVL 2BCKB 32C2A 4OZHF 4JPVL 5DDHB 2UY7A 5F7WC 4U6HA 1JNLL 3WLBB 5JDSB 1JZ4A 1VFAB 4KJYB 5IM7A 5SWSE 4G8IB 2VDNL 3SOBL 4MD4A 3VGHA 3PQYD 5DUBB 3PDOA 4ONFL 5FEBA 5H35B 4KH2A 3FFCD 4YZFE 4HIEA 4NN7B 1WIUA 2ITCA 3GMQA 3WN5A 4FFZL 5IB3A 5D7IE 4ZAKD 2NZ9D 1CT8A 4X5WA 4N9OB 2VLRE 3ULSB 3O9WA 5HVGB 5J7CC 2WNGA 2YOCA 4HCRL 5SWSB 3VXUE 5J9PB 3Q5OA 5C7XH 4DK3A 1EZVY 4J3WA 5DJZB 2VUOA 1EFQA 3AUVA 3JUZA 5CIPB 4XPAL 1ZHNA 3VFPB 5C08E 5D7IB 2YPKB 4CW1A 3TFKC 3QDAA 3PWJB 2EDJA 3STLA 4HUVB 2VLRB 3B6SA 1CFVL 4JY5L 1JJUA 2YXMA 4EEEA 3VXUB 3WFCH 1A7OH 1ADQA 4G43A 1SEBB 3QQ9D 5LG1A 5E99L 3E6FB 1FAIH 2AJVH 4DN4L 5TE7H 1FO0H 2YZ1A 1XIWD 3EHBD 1HE7A 1DCLA 2I9LA 5EBMA 5C08B 5ACMA 1JGDA 4UTAL 1S3KL 3PL6D 1DE4B 1VFOA 4ZTOL 2ZSVB 2BSSA 3CSGA 3DRQB 5IOPA 2B20A 1CBVH 4N8VG 5FYJE 3GIVB 2OXGA 1YQVL 3QIWC 3C2AH 4PRNB 2A6DB 1R5IB 1INQA 2MPAH 4R9HA 4GXVH 3QNZA 1MIEH 1OVZA 1ZTXH 3MBED 4HLZH 2AK4E 4XMKH 2DQGL 1TCRB 2EDHA 1CN4A 2GJ6D 4M5ZH 4JGUA 2FJHB 3K4AA 1N64L 3G5YA 1QFWL 5JZ7D 3X3FH 2X4TA 1G0YR 2XOTA 4EUPH 1NCUA 5CD5D 4OD3L 4OAWA 5T3XL 5JPNB 2O5ZL 3QULA 2DL9A 4YR6A 1LQSR 5E9DD 1GIGH 5ITFA 4OGYH 5FUCE 5HGBB 2NXYD 3WHXA 1IEBA 3IFOA 1MH5A 2AK4B 2PO6A 3GSXA 4DQOL 5A16B 2Z31C 2E27H 1DEEA 3LQAL 1JGUH 3KPSD 4JO3L 1AQDB 1HHKB 1UCBL 4HT1L 3V6OC 3WIHA 2R4SH 2WUBL 4CBPA 3S35H 4W70A 4P57A 1FVEB 3FL7A 1CQYA 3C5SB 4NOFA 1A22B 5D7SH 3RP1A 4WWKB 4YAQA 2C26A 1CR9L 3MUY1 5DUPL 5HHOA 3JWOL 4WIQA 4I3SH 2XACC 4Z7VF 3DMMA 1TQCC 4Z76A 4RRPA 4GRLA 2CLRA 5T1DH 2R4RL 2IH3B 3L9RA 3UPCA 3P30L 3U83A 1MFAL 4PRDB 4W4NA 4HWUA 5DJ0A 3NH7L 3WFEL 5BOZG 2AJUL 1FL3B 1QQDA 5CJOL 3MLTB 2AW2A 4LOUC 1W0VB 1T7XA 5I0DA 4IRSC 5GGRB 2EIZB 4PRPA 4P3DB 3V95A 4HULB 1RU9L 1DVFA 5IK3A 4LKCB 4MDJB 1FPTL 1JPSH 2CIKA 4WJ5B 2F19L 4L3CA 4XP9L 2JJVA 4GUPA 1F58L 2FH6A 2Y5TA 3UBXI 4U1SB 1SHMA 4LPYA 1WWBX 4JDVB 4MNQA 5J11C 4Y5XB 2X4PA 4FQJH 4M5YH 4YDLC 4D8PA 5F9DC 4KJPC 1GGCL 2WUCH 2AXGB 3MNVA 4NQDE 2Y23A 35C8H 4M8QA 5FCSH 4BKLA 3QUMA 4HAGA 4ORGB 1N6QL 1SMAA 4P4KD 1U8IB 3BIKA 3IDMA 4YFDB 4OGXH 3N1FC 4OB5L 1RZ7L 4BZ1L 3HI6L 1IAII 1D5BB 2VNCA 3G6JF 4J23A 3SE4A 1WBYA 2Q8BH <