3TBWB

Crystal structure of the murine class i major histocompatibility complex h-2db in complex with the lcmv-derived gp33 altered peptide ligand (a2g, v3p, y4s)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conversion of a T cell viral antagonist into an agonist through higher stabilization and conserved molecular mimicry: Implications for TCR recognition
rcsb
source organism Mus musculus
molecule tags Immune system/agonist
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
total genus 14
structure length 99
sequence length 99
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tbwB00
2BVTA 4OTXH 1RZIA 1DQQB 1F4YH 1P53A 5HHNA 4MDIA 3P4MB 2EIZA 3OKDB 5EFIA 4BYHA 3TWCH 1DFBH 3ZTJH 4CUCA 4I0KA 3UTSB 2Y5TB 3MJ6A 5J1AA 3UTTA 2VXTH 1P84K 5C0EA 4UINL 4RAVB 3RNKB 1S9KC 1U42A 3QEQB 4RX4D 1ZHKA 2WNGA 2NXYD 1RUQH 2VTFA 2G2RB 1ADQL 4ODXA 4UZGA 3ARRA 3IFNL 4KAQL 3RL1A 3PDDA 4OT1L 1MY7A 2OJEA 1UVQB 3OKNA 3DO7B 5HD8D 4IRZH 3BSZL 3DOSA 1KCUH 1S3KH 2Y25A 3DVNA 3G5YB 4XVUC 2C1PB 1TENA 5E8PA 4IMKA 3QIUD 3CMGA 1VKXB 1NCTA 4ONGL 5MEND 3TT3L 3IDXL 3SCMD 3HZYB 1HXMB 4P2RA 1JUFA 4WO4D 1X6LA 2HH0L 3G5XA 3KR3H 1PX3A 3BXNA 4MAYB 3IKCA 2YPLE 5I71B 1HSAA 1NCUA 2C1OB 1W0WB 3MJGX 3D85D 2Z92A 4RGMC 2C9AA 2PNDA 1TJHL 3IDNB 3INUH 3RY6A 1CGUA 1BEYH 1T5XB 3WHE1 5FUOH 1LP9B 3H9ZA 4I3RH 1E6OL 3U7WH 4LHJB 4WWKC 5GS0C 4QF1B 1FBIH 4F33B 1C5DA 3O4OB 1NKOA 3ARDC 4HMCA 2ID5A 5DHVH 4QYOB 1OAYH 2W9DH 3RI5K 3CFCL 1MVFA 2H26B 4PP1D 4GUPA 1YEGH 3MJ8B 5EU7C 4QRUA 4TOYH 1PX4A 2OK0L 4WI5A 1CTNA 2EYTB 4XB7A 5FECB 2QHRH 2UWEF 1EFQA 1DQJB 2WM0A 1UQSB 5DR5H 1N6QL 3DHMA 4X6BA 4JGUA 2MOVA 3MNZA 3P9LB 4IIQA 3F5WA 4X9GA 2GTWB 4LLUA 4ONFH 4M6AA 4QXGH 1N4XL 1MJ8H 3LB6C 1NFDE 3B8YA 4Y5VB 1I9IH 4FA8A 3FO0H 4U05A 1P4IH 4OZIA 4L8SC 3GUTA 4U6XA 2IEPA 1CFNA 1J5OH 3MUZ1 4NOBA 1RZKH 1S9XA 3QUYD 2Q8BH 2W59A 1PKQA 1MFDL 3M1BB 5DD0H 1JWUB 1G7MB 5ICXB 2A74A 4P99A 3RIAF 3TO4D 5F7EH 4BZYA 3HUJE 4YHZL 5E6ID 4HUUB 4M5YH 5EU3B 2A0LC 3VXMA 2R69L 4LBEB 3MFFB 4D9LH 4JM2A 3V4PH 1YPZE 2AS5M 2Q3AA 2LTQB 3D39D 4GAGH 5KTEL 4HQQL 3ARDA 4ODSL 1A14H 3S34L 4RDQF 2BXZA 3BRGC 3MV7E 3EYVA 4K3HA 3S4SG 1G7JA 4M6NL 4MAYA 4BFEA 1QSFA 5ESQA 5F71A 2R1YA 5FV1L 3FKUS 2F74A 4MLIA 5F9JA 3L5XL 1WVZA 1SJVA 1K4CA 4U0RB 3W11C 3SJVB 1R3IL 3KWWB 1NUGA 1YEHL 5AG9A 3CU7A 4F7TA 1A64A 5IMLB 3MXVL 4R8WL 3IB4A 5FGBA 3UC0H 3QWRD 5TQ0L 2EDWA 2DYPD 5L0QC 3VXTA 1DLHB 5C86A 1KBGL 1CDCA 5EORH 5FAAA 1U58A 4Y19B 4RMQA 3NFPA 4QNPF 1XGYL 4M7ZC 3ZE2E 2D03L 5IOPB 1A3LH 4JKLA 5D7SH 3BGMB 1PJ9A 2AJUL 1CGSL 4DZ8A 4UUJB 3N1PC 4FQLH 1P5VA 2V5YA 4XWGH 1FORL 2NY2D 4LLVA 4OCWL 3C2SA 5GRVK 4OF0A 3DXAD 1NLDH 2H32A 4L4JA 4UT7H 1P4IL 4YBQD 1P1ZB 2AGJL 5EUOE 4P23D 2ESVE 3MLYH 4CRPA 1G7IA 4LSQL 1MWAB 4RGND 4DZ8B 4XPFH 3GRWL 1BF8A 1W0WA 3U7AA 3FQNB 1CICC 1KEML 4Q2ZB 5KJRL 3NACL 1RZGB 2FD6L 2UZIH 4OZFB 1PG7X 4UQ2B 1YYML 4R7DB 5E2WH 3VXRE 1UWXK 1B0GA 5CJXC 5K9QI 1JRHL 3T3ME 5IW1A 4HH9B 3OXSA 4FNLL 2ENSA 4X7CC 2EE3A 5EC2A 1AD9B 2FO4B 2I24N 1CFTA 3BWAB 2C1PA 3CSPA 3QQ3B 5DEZA 4MHHG 4EI5D 4NO5A 4M1CC 1MJUL 1OAYL 2W9DL 1L0YA 1EH9A 1SY6A 1UWGH 2BC4B 4U31A 5T1KB 4D8PB 3K2MC 4XAWL 1EEUA 3RWFA 3GMPB 3KPQA 4RA3A 3BN9D 3BKYL 3T0WA 4H88L 3BW9A 3D69B 4DGYH 3QDJB 2X4NB 3U30C 1LEIA 4JFYA 1S7XA 3FMGL 3SKJL 3OBAA 3IFOA 4PJEA 2NZIA 1YJDH 4DAGH 5MI0C 3SN6N 2R2CA 5DD6A 1I1YB 3OKEA 1YEKH 1Q94B 4LLDB 3JV6B 4M7JL 3N50A 3B2VH 3DUHA 4MXQD 2XA3A 3T65B 3GJFH 2K1MA 4LVNB 2I9LB 2JJSA 3SGJA 1G7JB 3HR6A 3O3AB 3RI5F 4X7TB 4MA8L 2HH0H 4P3DA 1RIVL 3W5NA 5F8QC 2IQ9H 2WIMA 3QUMB 5IVXF 1WCQA 4Y2DB 4LRIA 3KYAA 4FFVD 4KDWA 1IGFH 3EOAA 2DQDH 1LO4H 3PWPB 1E28B 4PJBA 5FK9B 1A9EB 1X5GA 1DN0B 4P46D 3JWOH 4QXUH 5H94B 3BSZH 2AJ3A 3E2HB 2VLRB 3KYNB 3GSNA 1P7KA 4R2GC 1IFHL 3ARWA 1A2YA 2ZJSH 1KJ2A 5BVJA 3V5KA 3UYPA 1ADQH 2UWEB 3HZKB 4JKMA 4QRSA 4U3CA 3UTQA 2V2TB 4WFED 2PCPA 2ENYA 1A7OL 1BAFH 4EI5C 5FFLA 1WZMA 2KZWA 5CSZA 3IXTA 1JNNH 1ZLSL 5JXAL 4JN1L 2AJZB 1EVTC 1Q0XL 3QUKA 4GAJL 1BQHG 3ARBD 5E2TL 3RWIB 1GGCL 4WIQA 3O8XA 4K9EC 4F2MB 4G9DB 1CLYH 2V5RA 3VXUA 1WBXA 3OKKB 4OCMC 4POUB 5TE7H 4MZ2A 5JHDD 1K3IA 5ERWB 3ULSB 4Z77A 5CJ8A 1U3JA 1VADA 3DMMB 3VCLB 3CK0H 3QPXH 3SQOL 4M62L 1C7TA 4X7SL 5FHAH 3PIQB 2AJXL 2YA1A 5E00A 5EN2B 1RZKC 1VESA 4E5XB 1WJ3A 4J1UB 5IBTL 1GJIA 2YMXH 4I4WB 1INEH 4GRWE 1JGVL 4Q9QH 2FDBP 1JBJA 1AKJD 3MBED 5JW4Q 5F9DC 1CD9B 3MLWH 2EO9A 4OZFH 4F80A 4UV4L 5I1EL 1LK3L 1MFNA 4RBPH 5BQ7B 4OD3H 4GBXC 1CE6A 1N0XL 4IOIB 1I85A 4OF8A 1FVCB 2CXGA 4A6YH 5DA4A 4PJAA 2D2OA 1V3KA 3CSBA 4RFNC 3QDMD 4AQOA 4JDTL 2DQFA 2D9QB 1JTTA 3FO2A 4G8GB 2VDMH 4HIEB 2X4PA 3VFNB 2VDML 1MPAL 5EDXA 4YDKH 2APTA 2VR9A 3H2WA 5F7MC 2OTUA 1ES0B 3IVKB 2BVYA 4OFYD 4EI5A 1VKXA 5CD3A 1YNTB 3LRSB 5D2NE 2DD8H 4XVTH 2JJSC 3LRGA 3TPUB 5FYJL 1NBYA 4Y4KA 3CLFL 1YZZA 4TSCH 3BKJH 5FM8A 5FHBL 1W72H 3BVNB 4J8RB 5ESAB 1R6VA 1TJGH 5IBTH 1OF2B 43CAA 4D2NA 3PV7A 3BPOB 1HQ4B 3MBXH 2H32B 1YEIH 4HWZB 1AKJA 3MBEA 4QTHB 1VFAA 3G6DH 2ZUVA 1BM3L 5DC0A 4GMTH 3CJJA 3S36L 2OMNA 4LLVB 1RZ7L 5HGAB 3BKMH 1ZHBA 1U93A 2CK0H 4R2GD 1U0QA 3MROA 1KNOA 3X11A 1RULL 1UJTA 1IEBA 4LHUG 2AKRA 3QNXB 1DBBL 3FQUA 5C0DB 1K8IB 1HEZB 3C2AL 3VE0A 1L0QA 4JEGB 1JYVA 5JHDA 3CVHH 3EW3B 1I8LC 2J6EL 4M43L 3HI6L 4R97C 3MOQA 3BHBA 1SQ2N 3VFPB 1RZFL 5HJ3B 3RUGE 1WFTA 2F9BT 1HQ4A 3DMMC 3PGDA 5HPMB 1UC6A 3QQ9C 2GSGA 5C8JA 4J8RA 3MO1B 5E8OA 4R97B 5GISH 3TYGH 1UCTA 3GB7B 3DRTA 3LKOA 3EOTH 4LSSL 4MAUH 4PD4J 1NBYB 3QIUC 4Y4KB 1HE7A 4H1LG 2WINB 4X6DF 4QLRA 3P0YH 4U6YB 1V3JA 5C6PB 3GM0A 4CMHC 1XF1A 5B39G 1HWGB 1F13A 5E1AA 2R0WH 1XIWA 3DX6B 4L8BB 3TESA 4L8SA 2FZ3B 4Z7WB 3C5ZA 1T1XB 4NJ9L 1I7ZB 4QHKJ 2C5DC 4PJHE 5I75C 4G8GA 2JB6A 1NCCH 3UJIH 3IJSA 1S7SB 1JFQL 2DKUA 1BIIA 2EC8A 4XWOC 4V1DD 1H0DA 5ENWB 5I8OH 1WT5A 5AUMB 2EH7H 4HH8A 1BF2A 2GKIA 3TH4T 2C3WA 1QPPA 3LD8C 3RVUC 2B1HH 4GKZB 3FCTB 3UDWA 3S97C 4Y16A 5FKPA 2GJZA 4PJDE 3O3BB 2R2BB 2XPGA 2HJKB 5FUCC 5E56A 5IR1A 4MJ6B 1QFPA 4HMDA 2YA2A 2DQGL 4NHUA 4QWWC 3D9AH 5KN5A 5D1QD 4U1GB 1TJIL 3KPRB 4J4PD 1UM6L 2WBJB 2NXYB 1ACYL 4YXKL 1AGDB 1ZT1A 3DO3A 1KTLA 5EZOH 4JQXC 1HHJB 2VQ1A 1A3RH 2DQHL 4LCCA 2DKMA 2AV1B 3B9DA 1HHIB 4LMQI 5AZ2H 4PR5A 1SEQH 3MUHL 4W81A 3RWIA 5D5MA 3TJEH 3D25B 4TUJB 2N56A 1KOAA 1QBMH 4TUOA 4GRLC 5DJDB 2F58L 3BZDA 4NM4H 2WW8A 3RRQA 3NFNB 4LCYA 3THMH 1IAIH 4WWID 3LKPA 2CDGB 5TF0A 3PP4L 1K4DB 4WDIA 2YUVA 4HBCH 2IH1B 2AK4D 5AYQA 5I74C 2XNAB 1D5ZB 1Q8MA 3BWUC 1FIEA 1UWXH 4UOW0 4OBRA 1FVEB 1BJ8A 2FECI 4P2RE 5DQDH 2ITDB 5IT2H 4OCLC 3FB7B 3BPCA 4JHWL 1KJVB 2Q76B 2CJUH 2D03H 1A6UH 1AGEA 2XQYK 3F7VB 5F96L 3U79A 1MFAL 4K2UL 3MV7A 4X5WA 3MV11 1GRWA 2MQCA 3CMOH 1EZVX 2F8OA 3D87B 1Y18B 1ZLVK 3E6HB 2XZAL 5C07E 4DZBB 2I9TA 5FYLD 1A6ZA 3OJ2C 2YPLA 4HT1H 1HOCA 4NZTL 3SGKC 5IB1A 1BJ1J 2HG5B 2QQKL 3LQAL 2VXSL 5DF0A 1F6AB 4ZFZA 5DK0A 3U46A 4PJBE 1S8DB 4EDXA 1YC8A 3NZHL 3ULUE 5DT1H 1YEHH 3VJ6A 2B1AL 2Z31A 4CADB 3O4LE 1V5JA 4OCRL 3KS0J 4QRRA 3O2VL 1PW3A 4G80A 3S4SB 5T1KA 3QJHA 4HGMA 5SWSD 1QBAA 1P6AB 2DTSA 2GJZB 3EO1A 5GGVH 2I07B 4BQ6A 1CDYA 3OXSB 5FM4A 1EBAA 3TO4B 5KTEH 4RAVA 5SWQB 5EOTB 4MWFB 3MV01 5EZIH 4Q0XL 5DJAA 5LGKA 1ADQA 5HI3D 1JZ2A 4Y5YB 3O6FC 3VMPA 1R5VA 4IOSD 3SKNB 4D9LL 5DC4B 5C08B 2VLJE 5CBAB 3O9WB 3TLRA 3QZWA 5LQBL 1PDKA 1FL5B 4YHZH 5CJOL 5D7JC 3UO1L 4LSTL 1BBJA 2A83B 1CLOL 5I15L 5DGQA 1EEZB 5KSVA 2WWMC 1AGFA 4WEBH 1XGQA 3FFCE 5DJ8A 3U0WH 3KPMB 4ZXBA 1VFBB 3I75B 5MHSE 1RIUH 3B9KC 5E94A 3ZE0F 5C0NC 1JWSB 3RKDC 4GKSA 3KPPA 2BVOB 4EXPX 1TZGL 4QY8A 3VWKB 3GHEL 3NMEA 1Q38A 5EA0H 2B39A 3WV0A 4KROC 3SDXE 2X4TB 1MFCH 3MRLB 4LLWB 2DQEH 1KCRH 5C8JB 5KOVC 1RZ8A 5E5RB 3RGVC 3LKNB 1KN2L 4WU5B 5J11C 4RFOL 2YD5A 1Z6JT 3DGGB 3JTTB 4X6DB 4YFDB 3L3GA 4Z7VE 4ZOEA 3ZYIA 3BP5B 1XR8A 5IHLB 2DJSA 3PP4H 4WRLA 1UGNA 1NBVH 3E3QE 3L5WA 4NQTA 1H5BB 1YNLH 1JK8A 5I1KL 4LOUD 3EKCA 1YEGL 1HN1A 3MRLA 3O2WH 1IEBB 1I8KA 2V5MA 4FOMA 5T5NF 3WFHA 5C3TA 4MA3B 4YFLF 4F37F 2XKUA 3LS4L 3ULVF 2C3XA 1E6OH 4H26B 3QG7L 4HFUH 3DVGA 2A77L 1VFAB 3H3PL 3FAWA 4P5MB 2BVQA 1CDJA 1A22B 2EEBA 4GRWH 4YXKH 3GBNH 1BVKA 5HHQB 3S9DB 2YPVH 4MD5A 4PLKC 4PRBB 1PY9A 25C8H 2X89D 4GXUM 4JM4H 5TGBB 3K8MA 3BVNA 1NFDB 4JHAL 4NC1C 4X4YA 4RGOL 2J4WH 1B88A 2EDHA 4TTDC 1FZMA 2Q86B 1HINH 4PJIB 3BZEB 4G43A 4XZUB 3VXRD 3RQ3A 5AWNH 1KTKE 4MWFA 3KXFD 1KLUA 1S3KL 1BWWA 4H8WL 4HLJA 1ZV5A 1OHQA 5JHLH 3EO9L 4NCDA 1OQXA 2YWZA 3WJLC 4QCIB 1LO2H 1P7QD 1U9KA 2XFXB 5GRWA 2D0FA 2AAVA 2O5ZL 1NJ9B 2MQ0A 3HMXA 4PYHA 3JV5A 4Z7QF 5KW9L 2JKXA 1JRHI 4P9MH 4U6HB 1XF2A 3DUSA 3MUGA 2HFFB 4JO2L 3FONB 5L2KA 4KZDH 4XNQA 1B6UA 1LVEA 4LSPL 3TWCL 4GW5B 2UUDH 3DUUA 3ULVH 1JCKA 3EOTL 5HYJA 1IAMA 5IVNA 1KV3A 4D3CH 4YWGH 5I1CL 1DDHB 1NMAL 3RVTD 5E9DB 1L6XA 4XVJH 1HOCB 4KROB 4QTIH 1OTSC 4GRMA 4G7VL 3MLPA 1XH3A 4I18A 1KEGL 4UU9A 3BYTA 3HI6H 5F72S 1SEBB 2VQUA 4K94H 2JK5A 4K23L 1F3DH 4I0PB 3TBWA 5DMGC 1RK1A 5TF1H 2QSCL 5MEQB 1WBXB 1YMMA 1NCNA 2N4IA 1UXSB 4OLYL 1GAFL 2BOCB 2ZSWB 3ROLB 2OL3B 3UBXA 5ILTL 4M8QB 4Y4FC 1J8KA 3VG9C 2P24B 2X44D 4O51A 1QLFB 4PV9B 1RZ7H 5IW6B 3I3BA 4NKDB 2R56H 3CX2A 1AFVL 3CDYA 4Z7NE 4JN2B 5ALCL 1YEIL 3RU8L 2EECA 1CTOA 1IAKB 3TO4C 3K80A 3V5KB 5AYUH 3RAJL 3CFJB 3SDCD 1NGPL 2Y6SC 5E2VH 3DPBA 4ODBD 2P5EB 3BKJL 4PBWD 5C1MB 1N0LA 3K81A 3S6CA 3U0PA 5F6HJ 1A9EA 4PJBB 5FK9A 4IRJA 3TA3B 5GIRA 3UXFA 1CZ8H 1D6EA 4U7KA 1TCRB 1JF1A 1ED3B 2R1WA 4PJGE 1F3JB 3QI9B 4YHOH 4MA7H 1CGYA 4JO4L 5ID1B 5FB8A 2P43B 2HKHL 1R5WB 4CN1A 2J88H 5T1MA 1QVOB 4HS8L 3ZL4H 1JYWA 1RUAL 2HJFA 2YXFA 4FFWC 3EOYG 3RA7L 2QKIB 2P8LB 4PJFE 3GMNB 3QUZC 4PG2C 4WTZA 1CBVL 2NY0D 3MLWL 3VFOB 3RVVD 4C56D 5LBSL 4NZDA 4UAOC 2EDJA 3P4MA 5FB8B 1B0RA 4KPHH 4LPCA 1JN6A 1BIIB 3SDDC 4PJGB 3R8QA 4NNXA 3SGEH 3I9GL 4W4OC 4HFWA 3VH8G 3QQ3A 4M62H 1FGNL 5LGHL 2EEAA 3BRFA 3TA3A 4PJ8C 2EE9A 3OWEA 1KELH 2YRZA 3HI5H 4KUZH 5JA8B 4X99A 1QG3A 4JGJA 2VR4A 1UT9A 3QPQD 4XI5C 2P45B 4Y5XA 4RFNB 4KHTL 5FYKH 3OB0K 1QSED 3DI3B 1QEWA 5KG9B 2A6IA 1K5NB 4KC3B 3I2CH 3GB7A 2LU7A 5JXAH 4K7FA 4ORGA 2DM2A 4LLQB 1MY5A 4ODHH 1OAQH 3DROB 5E4EC 4LSPH 3VH8B 4JRXE 3VMOA 3S37H 3V52L 1FLRH 2ZPKH 4XMPL 2JCCB 3NCYS 5DMGD 3HE6D 4NN7B 5J57B 1YA5A 2DQIL 3C5SB 4JPIA 3I6LD 5JHDE 2L7JA 1A7BA 1UH4A 4Y1AA 1LE5A 3LN4A 4LAQH 3HMWL 3LSOA 4HKZA 3KJ4B 4XMKL 4PJ7B 1J11A 4ZUUB 1S7QA 2VERN 5HDQH 3T3MF 3WS6A 2V6HA 1VCAA 1T7VA 2NY3B 4QEGA 2Z93A 3VRJB 3WJJC 2GYSA 3MRPA 4JCLA 4DGVH 1ZGLA 4JFHD 4JO1L 4YDJA 5DRXB 4KK6D 2GCYA 5MEPB 5IP4A 3RWGB 4HWZA 3PG2A 3SDDA 1CD0A 4DN3H 4O58H 4RISL 2R39A 3ZMRA 4LCIL 3ULUC 5J6GB 43CAB 1ZHNA 2VLRE 2EICA 4EBQH 4YUEH 6FABL 1QA9A 1C1EL 1TMCB 3GI8L 3VXSE 3R0MA 3VMNA 2IAMA 3MYJB 3QDGA 1J0YA 1TCRA 4U6HA 1XF2B 3H3PH 2DLEA 3ZSSA 4MJ2A 4HEME 4BQCA 3OR7B 4JB9L 3OAUL 1DEEA 3GMMA 4I77H 4KDVA 3B3IB 5BZDB 2BJML 1CICB 4PRNB 3RGHA 1ZKAA 3RGVA 2PYFB 1T66C 4QCIA 3EGSA 4HDIB 5DSCB 4CAGA 3QIUB 3JWDH 2CUMA 1S5HB 2W92A 4TQEL 5BO1L 4PJAB 4Z95L 1T1ZA 2FJFA 3HNSH 4WU7A 5C9JA 4P23A 1LO5B 3L5IA 4HPOH 5ABDE 4KQ3L 3MYJA 4HIXH 1D9KB 2VZUA 2X09A 5F7WC 1AJ7L 3EDFA 5IB5B 4AEEA 1H5BC 1OM3H 3VWJD 3ECBA 3UBXB 2IADA 4FP8L 2BY2A 4M48L 3P2TA 3CUPA 3HG1D 4J3UA 2EDLA 5KSAB 4J3XA 1Q0YL 1DEDA 1F11A 2YXMA 3JTSA 3L95A 3UTPE 2C3HA 1I8IA 4WWKB 3VXUD 5D2LA 5FO8A 2XWTB 5C0ND 4Z77B 2BVPA 2GITB 2VLJA 2YKLL 4U1MB 2BJMH 5IWLC 4HS6A 5A2JH 2PUQT 4PJ8A 1AHWB 4PRPA 1LE5B 4KMTL 4CDHA 1Q9OB 2AJZA 4MB4A 3P77A 3QHFH 4JPIB 3C5SA 5IBLC 3T77B 3BP4A 4J3SA 5EBWB 2NY5L 3DTXB 1C1EH 2XA8H 3HPJB 3RKDD 1G9ML 1UQSA 1RUMH 4BFGA 3DUSB 3MUGB 4WW2F 5CZKA 3V0WL 5CGTA 1KTLB 1BFVL 3MRRA 5TDPB 4LLQA 3FHQA 5EO0B 1AO7A 1Y6NR 3KPRA 4N8CL 1OT1A 4HIHA 5D4QA 1AXSA 5DUPL 5IR1B 2UZYB 1ZA3B 4YXLL 2DICA 5H94A 1NL0L 2OZ4L 3AAZB 3IFPB 4K9EL 4P4KC 3TEUA 1IARB 2P5WA 5DJ2A 1VA9A 4S2SB 5IVZB 1J05B 1YECH 3QFJA 4GW4B 4PV8B 1FO0L 1G9NC 1MAJA 1FFOB 1O7SA 4KV5E 3KHQA 3L5XH 4G6ML 3VFWA 3UTSD 2IAND 3ARUA 2KH2B 2PXYB 3VXMD 3IKCB 4MD5B 3UTSE 2I5YL 4ODUA 1CI5A 3O6ML 4N9GB 1SM3H 2AEIT 1MHEA 3B9KD 2VKWA 3WHXB 2YN3A 4OSUL 3CH8A 3NCJL 1NDMA 4ETQA 1JZ3A 1V7ML 1FN4B 1WTGT 4YPJA 3KLAA 4M5YL 4RCAA 3GMPA 2W9LA 5JW4M 2QADB 2E6JA 3TBSB 4KUZL 5DQDL 1KF9B 5LVEA 4YHLL 1J9CT 1FNGB 4OFPA 1NLBH 1A8JH 2FBJH 5HI3C 1OAKH 4IRJB 4KDTA 5DURB 1FV1B 3L3GB 4X6DA 3DGGA 3JTTA 4HBCL 1QKZH 2XTLA 1NCAL 2NLJB 2FR4A 1PG7W 1SBSH 4NM4L 1BD2D 2WLZA 5CEZD 1CBVH 3I84A 3AC0A 4P2OA 2Y7QB 2GTZA 4FQXA 3LVEA 1SEQL 3MROB 4Y19D 1MWAA 2XWTA 4APQD 4WTWA 2Y07L 2BMKA 4U49A 2VZ1A 4UTBH 5JOFA 3Q5TA 4ZNEA 3L95B 1X9QA 2E7LC 5D71H 3VGGA 5BMFH 2D3VA 2KQMA 4TOYL 2OL3A 1TJIH 5HHMD 3HG1A 1EEYB 4AH2B 4UNVA 1YMMB 4X8XA 1GPOH 3V6FB 2MJWA 5DEFA 3T2NL 1JPST 2L7UA 1S9VB 4NQEB 4P23B 3T1WA 1CXKA 1R5VB 3SO5A 2HP4A 4RGNB 5E2VL 5JW5A 2XWJB 2WP3T 1K8DB 4LLMA 1MHPL 2EH7L 1R3HB 4QGTA 3RU8H 1VACA 1EO8H 5I74B 4HDIA 3MFGB 1JPGA 4Z7UA 5DS8B 1N5YL 3ARQA 1NGYA 2D31B 2OR7A 3KR3L 1NAML 3QNYB 3MJ9L 4POYA 3MRMB 3D2UD 5HY9B 3WLWC 3QUYB 5C0FB 4ONGH 1OB1A 4HV8A 1RJCA 4M4PA 1G1CA 2FGWH 5C07B 1GAFH 4OLYH 5HDBF 1DBJL 4NUGL 4B50A 4DKAA 5I66B 5DJYA 4M1DH 1U8KA 1CLZL 4RX4A 1NJ9A 2PYEA 4QXWA 5CD5D 5KN5B 5GRJH 4PGZA 4PJXB 5ACZA 2R2BA 2XPGB 2HWZL 3QWOA 1A6AB 3QQNA 4U1JA 3GJFK 4EDWH 3ELAT 4KAQH 1C16A 3FCTA 3O11B 1C5BL 2O93L 3STLA 1OAXH 5I1CH 5JW5B 3VRJA 4RMSA 3KPSA 4U1IA 5D70L 2A1WH 1QQDA 4KK5C 3ULVL 1CD1B 1OP3H 1KPVB 1TZHB 1NAKH 5GSRA 3WS6C 3HRZB 3WXWH 5EBMB 4M1DL 5J6HB 3SJVD 1BQHB 5F1NB 4BELD 3ALXA 3LS5L 1C7SA 2JLLA 3A6CL 4DCQA 1ZAGA 1HQRB 2C3VB 2E27H 3T0XA 1MCKA 3F7RA 1IZJA 4GOSA 1T7ZA 3BDBA 4WW2B 1HHKB 1YMME 4YZFF 1FYTB 5KSUA 3MBXL 2WWKT 3BO8B 3O4LB 5D7IA 4U1GC 2FIKA 2OTWA 4LSDA 1MHPH 3L3KB 5GGRA 5BRZE 3PWUB 3OMZA 4N5ED 3BZ4B 1UWEL 4KDTC 1UADC 4X5LA 1MRFL 3UX9B 3T4AB 5H37G 3WFZA 3H8NA 4GG6A 1PG7L 3RVWC 5FYJH 2B20A 4MQTB 1GPOL 3ALPA 2BY3A 4YLQT 2HN7A 4LCCB 3VXOA 1I8MA 4MDJA 1KFAL 4HX1A 4MS8C 1YC7A 2XTJB 4LU5L 5DFVD 5E9DD 2HLAA 2I60H 4PJAE 3FQUB 3K4AA 3SE3A 3U9PH 3QUMA 4GJTB 5F7HA 2VLJD 5ISZA 4QY8B 2PTUA 1JI1A 2VL4A 3D39E 3QG7H 1EAJA 2E6PA 3O2DL 3REVB 3RWJA 2JB5H 2H1PH 5IESL 1G7QB 1G7PA 2J5LC 5DD6B 5LCVL 5GS0L 1AQKL 3RVVC 2AXJA 3HI1B 4UNUA 4WVRA 4MSWB 4OD3L 1I1FA 4Q6IA 5I1KH 4ODUB 4YBLB 3IDNA 4XCCH 1G6RL 1ZANH 1K2DB 3BT2H 3IYLW 2W0FB 4HUVB 3L6FA 5I8EA 1JGVH 3ZT7A 3HE7B 2CRIA 3PHOA 4YGVB 3LHPL 1AQKH 3O9WA 3TV3H 1WBZB 3ZDXF 2AJXH 2CR3A 2BNRD 2RQ8A 1J1OH 2ADFH 3VGAC 2CMRH 3CK0L 4Z7WA 1CE1L 1IM9B 3RPIA 4IDLA 4NN5C 5EA0L 5DJ2B 3RWEB 2KBGA 4QHKI 4ZMAT 2V9TA 3VRLF 4YQXH 4XHJC 1ES0A 4LIQH 3IVKA 3MLXH 5GQBA 2P5ED 1MAMH 5DZNA 4R7DA 2XZQL 3OJMB 4F8QA 1T20B 1Q1JH 2Q87A 4P4KA 4Q2ZA 4GAJH 3K8KA 5BS0D 1IAKA 2BY1A 2ZOKA 1INQB 1ZLSH 4WI6A 5I8EB 1LE9B 1KIPB 1NGQL 3FQTB 4ODXB 4EUPA 2F54D 5F44A 4DUVA 4G9FA 4PGDA 3UTTD 4BH7B 1X6NA 4MJIE 5HHOB 1I9JL 4ZYKB 5FOBB 1CK0L 2Q6WA 4V2BA 4O9HH 3SDDD 5D1ZB 2HG5A 2X70A 1HEZA 2NCMA 5JZ7C 1NUNB 1JI2A 3L5JA 3LB6D 3MUY1 1T21B 1S9YB 1EJOL 2ATKA 5K9JL 2VKXA 2OL3L 2YZ8A 5I6XB 1MWAL 3IAPA 1QRNA 3CU1A 4XNMB 3UBXI 1U3HA 3RY5A 4PB0H 3O6FB 3WE6A 2IQ9L 4NFBA 5E5MB 5I1JH 1LO0H 4RWYH 3MRNA 4J3OC 5DT1L 1RUML 3MGAA 1G0XA 4F7CA 3BZ4A 4L3ED 3SE9H 3ZSTA 3TGXA 4Z7UF 3U4BH 1A0QH 1MI5D 3MV8D 4C55A 2IALA 5GGUB 2YD9A 4WHYG 3N1FC 3BO8A 2X41A 4DAGL 2A6DA 3L7EB 3CDGB 2Z4QA 2BY0A 5K33A 5IJKA 5IMLA 2R23A 1K4DA 4WDIB 4JJHA 4RQQB 4H88H 4DGYL 1U3ZA 3BKYH 5B3JF 1QFWL 2B7DT 1A7NL 1HSBB 1EGJH 3KYNA 1C12B 3EGSB 5E8NB 5DJ6B 5C0AB 3RL2B 5J11B 1MFAH 4K2UH 1ACZA 4ZD3L 1WTLA 4C57C 3EDDA 1KIUA 1QQDB 4QHLA 1MJJA 1EFXA 5IT2L 2AV7A 5ADPH 3IDMA 1AGCB 3QISA 4TVPL 4K3GA 2FCBA 5KSBA 4HEPG 3O11A 4P3DB 1U8MB 3L3OB 4HIXL 4HPOL 4U1JB 3T65A 1FFRA 5EO9B 3OTTA 5CIPB 3EFFB 4H0IA 3MLZH 4Z95H 3MLYL 2OM5A 1C5CH 2EDOA 5E00B 2E9JA 4NNYB 5DRXA 3THML 1PKQB 2DS4A 1W0VA 2F53E 2NMSA 1OP5K 3HE6C 5SWZA 3UPAA 1ZEAL 1WZ1L 4XPGL 3PL6D 2YSSA 2HT4C 2WAHA 1J1PL 1F45A 4JB9H 1J1XL 4HZLA 4JDVB 1H3TA 2VIRB 3NAAL 5KVGH 1VPOL 4N0UE 4Z7VA 1A3QA 4XX1E 1UEYA 3BGFC 3OZ9L 4P57B 4YUEL 4HWEH 4WHDA 3CH1B 5FIEA 4L3EA 4LEOB 1CD8A 4AEIL 4HWBL 3IGAA 3ULUD 3DSFL 1YNKH 2GSGB 4F7CB 4KRPC 1W2KT 3S5LG 1D6VH 2IQAA 4JREC 2R29L 3QRGL 4F33A 4D9QE 5L9DH 2F5BH 3IFLH 3WO4B 1R5IA 5EU6D 3SGJC 4N1HB 2X4SA 2DQTL 3FT2B 4ZQKA 1F42A 4MVBD 1IL1A 1A6WL 4RFEB 3LPFA 4EOWH 3OKLA 4X7DC 5JR1H 2DQIH 4K3EL 4OLEA 3WN5A 2Y7QA 3BGMA 1MQ8A 2DLGA 1ZWIB 2ZPKL 5CMAA 1U93B 3S37L 3V52H 5ESVA 1HXMA 4P2RB 4EJ1C 1Q9WB 5B3JE 3E6FB 3TNMA 3IFOB 4PJEB 5GISL 4O2CA 2WUCH 3D48R 3OGCA 4PYGA 1T89A 2HJFB 4G6MH 1AD0B 3A6OA 1DQMH 4QRPD 5B4MD 1B6DA 3W0WD 2DQTH 5I30L 3P4OB 1UXWB 3DARA 2WSKA 5GJSL 1H8OA 2J6EH 5JUEL 1F3JA 1DSFH 4ISVB 5SWZE 4K9EH 1LO3H 4KJWC 4ONHB 4YXLH 1NEZA 3DURB 4NO0A 2HMIC 1T1WB 2R29H 5JLZB 3QIWD 3C2AH 5LG1A 4JFXB 1NAMB 5DUPH 4EDXB 1M4KA 2YRPA 5I1LB 3EUUA 4Q58C 5CD3B 3WHXA 4HH9A 4PB9L 5EO1B 2FH8A 4PRHD 1M6OA 1Q9WA 1DUZB 1OVZA 1SVZA 4V2CB 4WV1B 3OX8B 5AZEL 4PTUA 4UQ2A 4QXGL 1T6WA 1ZWIA 5SX4H 3KPRE 3WNOA 3LPGA 4LCWE 1RHHA 1FL6B 4JGMA 3FQNA 5E08H 4D0BA 3ZE1E 1WWBX 1RZIB 2BK8A 1IL1B 3E6HA 5IHUH 4Q6IC 2DBJA 2J88L 1A7RL 4OGXL 4H0HB 3BQUA 4YK4B 3GMOB 3WFEH 2E6QA 1JNHB 4MA7L 5D96B 1NC4B 3BJLA 4PTTB 4S1RH 5GRXG 4BUHA 4EUPG 1FQ9C 3CVIH 3FB7A 1I7UB 2W60B 3EJZD 3SKUD 4W4OA 3TP4A 5HYQB 1RZJC 2DQUH 1BZ9B 5IEHB 1M05B 2NY6B 2ZP0T 2VE6B 3PGCB 1EMTL 1TZIB 2VAAA 1FBIL 3UTZB 4OCYL 5C70A 1C5CL 3IU3B 3D0LA 4M48H 3DMMA 1BD2A 1MPAH 2ILLA 4YDKL 2Y4SA 3EAKA 4IRSA 5DVMA 1OM3L 4U0RC 2ZCLL 5FYLH 2MPAL 2VN7A 3CCHB 3GSRA 1FZJA 2AEPL 4G6AC 2JCCF 4KQ3H 5L88H 2HFGH 2VLKE 1FCCA 1LDPH 3DUUB 4LF3B 1LK3H 1LD9B 5E1HB 3MCLL 4Q9QL 4GKOA 1Y6KR 2BNQA 3DSNA 4NQCA 3RPKA 3DI2B 1IT9H 2W0PA 1WK0A 4F7PA 1I8IB 1MRDL 3WFBH 4PJGF 1K6QH 1T4KA 3UPRB 4LLYA 3NN8B 5T5FL 3K46A 4UDTB 5E6IB 3SJVA 2ARJQ 2VE6A 1E4WL 2NR6C 3EFFA 4YXHH 4K94L 1WT5C 2NR6D 3BIKA 1QSFB 5A2KH 4PLJD 3L3OA 1GC1C 3BKCH 3HRZA 2FGZA 4X98A 2IG2H 4KKLC 1D9KA 3FFDB 1GGCH 1WLHA 3P0GB 1AGCA 4HUNB 1VERA 1ONQA 3ILPB 2NTFA 4HGWA 5I17A 5HHVL 3ULUH 2MFNA 1MCSA 2FLRT 5I1JL 1UZ8A 2PTTB 3NTCH 1OPGL 5BXFB 2IC2A 1DLFL 1I3RA 1JV5A 1GSMA 5FDYA 5E8NA 5F6HI 1EZVY 3NFSH 1EJOH 1IC5L 3VA2C 3C5ZD 2X9XA 5FO7B 3RDTB 3GKZA 4NHCL 2MCPL 3D2UA 2P44B 1WIUA 1KCVL 3F8UB 5DQJB 1MCPH 2DKSA 4KI1A 4F9PC 4Y0GA 2F15A 4CJ1A 3MXWH 1ZSDA 3WSQL 3MV9E 3LZFL 1JP5A 3W81A 3HAEH 1FLRL 1JZ5A 4FQCL 3CZJA 4WCYL 1AC6A 4MXWH 4JY4B 1RJYA 5KZCB 3I2CL 4S0TD 5ECJE 4FABL 2DDQH 5J89A 9CGTA 2GUOB 2JJTA 4ELKB 3GBNL 3AXLA 4TTGA 1KLGB 1MAML 3QEUB 5FV2A 1U8JA 3IU3A 2JELH 3QG6B 3BH9A 3V4VH 5CKAA 3MREA 1E4WH 3PGCA 1CE1H 2DTMH 4R90H 1X5LA 4XPAL 4H1LH 4QHNB 3HKFA 1HYSD 3LS4H 3T04D 1IRAY 4OUUA 4I2XE 3WFBL 4XAWH 3I3EA 4LQFH 4ELMA 2QSTA 4Y5VC 4G42B 3RVUD 4OJFH 3O2WL 1T5XA 2YK1L 2BHUA 3AREB 3QUZD 1AGFB 4FTVD 5LBSH 3SO3B 4JRYD 4OV6F 3WDJA 3BOVA 4XWOD 4GBXD 5LGJB 4FMFA 1IILE 2VXUH 2N7BA 2ICCA 1DBML 3QXAA 4H5SA 5LCVH 1U6AL 2A6IB 5GS0H 3CH1A 1TPXC 1ND0A 3T0EC 2XIDA 1KCRL 5DHXB 5FUZH 3UYOD 3IXAB 1KEMH 5EO1A 3RGVD 3ARFD 3P9WB 2G9HA 3GSXA 4JO4H 4WTZG 4M7LT 1TZGH 3C6SB 4RSVA 4J6RH 5GHWL 2DI7A 1YEFL 3U9PL 4LSQH 1G9MC 2I60L 2OXHA 1BZQK 4GG6F 4L5FL 1CZ8L 4MMXC 1G1YA 2YRLA 4IMLB 5T33L 4HK3J 1MSPA 1QNZH 4TSAL 3VRIA 2OYPA 4JZOA 4NOFA 3SKMB 3CVIL 4HUWB 5DLMH 5TH2A 1EAPA 5I15H 1DE4A 4NFDA 1GGBL 1XGUB 3HC0B 1CGSH 2WWMD 1Z9LA 4NNYA 1QFWM 3EJYC 3S5LA 4BQ8A 5LQBH 3V7MA 2GY5A 4JFPA 4OB5L 4NN6B 2R2EB 3MLRH 3Q6FA 5MEOA 3F12A 3MACH 5T1DH 4Y2DC 4GAYA 3FFCD 4WW1B 3EJJX 4OQTL 2E7BA 2XQBH 5C0IA 1YY9D 3H0TB 1P4BH 1HWHB 4L9LA 4PJ5D 4O2EB 5IMMB 3SO3C 1EFXB 2NX5D 4EI6B 4NZUH 2K9UA 5F88B 5DUMH 1CDGA 1AGEB 2IPTH 1DQTA 3HE6A 4YX2H 2R1XB 2RR3A 2VDKL 1R3LB 4IS6B 4MJIB 3SDAC 1DTUA 3GIVA 1C5BH 3CFJA 1CL7I 5I30H 1HKLH 5AD0A 5SWSE 5IG7B 3KVQA 4CU8A 3L7FA 4XVJL 1HXYB 2E7LA 4F7PB 4U1SB 2Z4QB 3RWCB 1FYTA 4OZIB 3QXTA 4UB0H 3G6AB 4U1HB 3HPLB 4UILL 5FCUH 2GEEA 4ZO6A 2C3VA 1HQRA 4KZDL 5DJXB 2P4AB 3MRNB 4TUJA 4X83A 1YY8B 4I9WE 1L0XA 5KW9H 5ANMA 4JKKA 5E9DE 1HHIA 3Q5YA 1ZLUH 3N1GC 4PJBF 5A2FA 2XXMB 4N0YH 4OCXL 3Q6GH 5LAXA 5IB4A 4Y2DA 5F9AC 4P2QD 4MQ7A 3HR5B 5I1IL 3H0TA 3ZDYF 3QA3A 1TTFA 5TFSH 1OGAA 1MFDH 5DD0L 5D72L 5I1HL 1D6VL 1EA9C 4PJ5A 4I2XB 4NC2B 5MHSD 3TZVC 3ULVE 1HIMH 1A7QH 3DSFH 3JV6A 1ZOXA 5D5ME 1QLEH 3FFCA 4LVOC 2WWKO 3ZDZE 1MJ8L 4KK8C 3P0VL 5DJYB 3FB8A 2F58H 2VRAA 1UYWL 5IF0A 1QBML 2GJ6A 4OLWL 2YPVL 1OB1B 3RWFB 1J0IA 4JZOB 3N9GL 4F3FB 3MV8B 5KVGL 1A3RL 1WSST 2FJHB 5DJCA 1F6LL 4IMLA 4G5ZL 4HKXB 3OKOB 1T1XA 1BQUA 3PHQB 1I3GL 3K7UA 1QR1B 3O45A 5IB2A 1J7VR 4XNZB 4PJFB 4ZSOB 5GS1A 5T1LB 1W0YT 2BOBB 1QRNE 5FYJD 5JLZA 4PJHB 3REWB 1NBVL 4YHNA 1XGTA 1C08B 4UT6H 4NQDD 4LFHD 2C4FT 1ODAA 5F6IB 4M02A 1EEYA 5D7LE 1ZVSB 2VXVL 1N5AA 5HTSA 3UMTA 4FTVA 3VDBA 3QUXB 3PDOB 4I8DA 4R4FL 1WQVT 3EYOB 1QYGH 4PY8I 1AO7E 3PQYE 3SDAD 2NTSP 4I3SH 4LVOB 3WN5B 4O00A 5BV7H 2V5TA 1H3UA 5IFHL 4G8FA 4WEBL 2OS7A 3ZYZA 4ZQKB 1QFWH 4MDJB 2WLYA 1KCUL 4ZYKA 1N64H 1M7DB 4UB0L 3S35X 5SV3A 1M71B 3BUTA 4ODTH 2FX7L 1RJZA 4XVSL 4GS7B 3NGBB 2HVKB 1JPSL 4PGDB 1NFDF 3HZVA 4GO6B 2BCKB 3LN5B 3N85L 4XB8A 3CZFB 3FQTA 2J8OA 3HN3A 1ZVSA 5FYKU 3FO9A 4ORGB 1ZSDB 3DWTA 5EIIA 1AP2A 5BJTB 4N0FA 4JY5L 1XGTB 2VL5B 1M1SA 2IPUK 4S1QL 3C09C 4AM0B 1XAUA 1G7LB 4PJ9A 4Y4HD 4WW2A 2MTPA 5DYOA 5FO7A 3MYZA 2Q3ZA 4ZXBB 5K9JH 3NPSC 1GGIL 3W2DH 3BKML 5F1IB 2VWEC 4JDVA 3UZEA 2W0LA 4I18C 5CZXC 3MPCA 3NZHH 4G6KL 2RFXB 2PXYA 3HLAB 5BXFA 1H9VA 4KH2A 5DJZA 4LSVH 1CK0H 3TVMD 4QRRE 3PHOB 1FVCA 2HRPL 2DLFL 2HTLD 4OB5H 2Q7NA 3WS3A 3RZCD 1W72L 1JTOA 4HT1L 4X98B 2P8LA 3ZE1F 3BGAA 5I8CB 2YKLH 1NEZG 4LDEB 5CP3H 5HI4D 1J0HA 5KAQF 4MVBC 4NKMA 2V7NB 5IGXH 4U1NA 3BPOC 1EUTA 4OIIL 3KYKH 2DD8L 1JWUA 2ICEA 5L2KE 1JHLL 5KSBB 4FFZH 4TSBL 5LAXB 3K4DA 3QCTH 3RHWF 3WMSA 4QHLB 3RY6C 4DVBA 2APXA 3QUYA 3MOAL 5FOJA 3FZUC 3S96B 4G8GE 4OZIF 1TVBA 4O02H 1LD9A 3RNQA 2AI0H 1BLNB 4YAQA 4NQCD 3H9SB 3BUYB 4HS3A 4KTEL 3S35L 3T2PA 4XHQA 4PJ8B 4PRPB 4K8RC 2VC2H 2ESVB 1UZ6F 5MENE 4O5LH 4NO3A 2DMBA 1N26A 3IDJA 3UDWC 1WZKA 2CUHA 1BD2B 3AS0A 4N0RA 1FH5H 2CLVB 2A6DB 3ARPA 3IU4H 3UTQB 2JJWA 4CNIB 4D9QD 5L0QB 3FJTA 2Y1VA 2DQJH 2X9YA 4DCQB 3KPNA 1FJ1B 3O3DA 4GG8B 2EIDA 3WIIL 4XP6L 3V6OC 3UCRA 15C8H 5J6HA 5DD5H 1NC4D 1V7NL 3CFDB 1QRNB 3ZDYE 5B8CB 1KFAH 1I85C 3OV6A 2J8UB 5F88A 4NPYA 1G6RA 3WKMH 5HHPB 3T0EE 3CC5B 5C09B 4WI8A 4DN3L 3OR6A 2VISA 2MNUA 1FL6A 1RHHB 3JSSA 2GK2A 3NFNA 4LCYB 4CN6A 5HYJD 2I9LA 3PJSB 2Z35A 3OX8A 2UUDK 2HT2D 5TDNA 3C87A 2BVUA 3TN0A 1N3NA 1JFQH 2JTDA 2IBZY 1TQCB 1KCVH 2AV1A 1KC5L 3I3DA 2XRAH 3QHTC 1VEOA 3DVNB 1BVZA 2Z31D 3KDMA 5CFHA 1YN7B 1YYLL 5C0FA 5HY9A 3QIWA 1LDSA 1BQLH 2HRLA 1FG2B 1KB9J 1LO4L 4LKXB 2FWOA 4JO3H 5IEKA 2M26A 5F7KC 1ZHNB 1IBGH 1WBYA 3GIZL 2XY1A 2PW2A 1AD9A 5I0DA 1Q72L 2WBJC 4OLXL 3ZDXE 2NW2B 5JW4R 3RNKA 5D9SB 5C08D 4U0QB 4GKZA 1UACH 4B7LA 1E27B 3QAZC 1QPXA 2F53B 4G43B 4XCFL 4XZUA 3B6SA 3BAEH 3EO0B 3PL6C 4PJIA 4QOKD 4EDWL 4BSWB 1MCJA 3H42L 3SKOB 1KULA 3IETB 1U8HB 3HE7A 5CSGA 4NN6C 1R0AL 4M9PA 4C4KO 3VXRB 5CGYC 1Z3GH 3I9GH 5IVZA 1T6VN 1B4JL 2BDNH 4ERSH 3I02A 4HC1A 4P46B 3K0WA 4N9OB 3GSQB 1OD7A 1ZA3A 5E0QA 2D4FA 5L7XL 4Z0BL 2CIIA 4KTDH 3Q3GB 3KPLA 1VENA 4HIIA 5L88L 4JY6A 4JQIH 2BXYA 1Q9LA 4HXAL 1O0VA 4U6VH 5HSFA 1RUAH 2I27N 4ALAH 4PJEF 4PUBL 3E3QC 3F7QA 1YEDB 2HN7B 1FH5L 4FMKA 3MGTA 5FHBH 2HT3C 1CGWA 3QP3A 3IS1X 1D7FA 1S9WA 4IHOB 1Q9OA 1F4WL 4LK4A 3TCLA 5EUOB 2XKSA 4HFWB 3ARGB 3QJFA 4FG6C 3VFVA 1KCKA 2EDQA 3HC3L 1WICA 3Q3GA 3GSNL 5DQJA 1T89C 5IHBA 3K1DA 3HG1E 4APQC 3WFEL 1NGPH 3R1GH 4X4ZA 4UTBL 3KWWA 4JDTH 2XN9D 3NIGF 5FYKD 1HZHL 2OXGA 4NWUL 3H7LA 3JXAA 4RZCB 5CUSH 1U8NB 1G0YR 5KSVB 1S7VB 1XCQA 4FQJH 2WUBL 1OF2A 2XG4A 2K3TA 2AABL 3UYRL 4FQQB 5IGXL 3ZZ1A 3TVMA 2R0ZH 3QI9A 5AZEH 5TQ0H 2DMCA 1FFPB 4ZXBC 3VD7A 3TZVB 1CD1A 1YY9C 4JRYB 4PJIE 4GBXB 5FDWA 2YMXL 1ONQB 3ILPA 1WFUA 32C2A 1J05A 1KUMA 4HF5L 4ZSOA 1ORSB 4Z8FH 2Q20A 1LO3L 3NA4A 1WV7T 2V7HB 1JF5A 3QSKB 2GSIB 4YDIH 1IAOB 1IM9D 1HSBA 3CFEA 1IGCH 2R0LH 1A6VL 1Y0LA 2DWDA 3UPRA 1KXQE 1OSZA 2COQA 3P3YA 4KI5E 1NMAH 4G8EA 2UY6A 3VXNA 4NUJB 5D7LB 3O6MH 2IPKB 1QFUH 3DTXA 1QLFA 1GZPB 2A6KB 3AUVA 3W0WA 4IM8A 1MI5A 4JO2H 3ROLA 1FZJB 4MXVF 2FJGB 3O6FA 3OXRA 4PJCE 2B2XL 3GSOB 2IJ0C 3N85H 2UWEE 1EVUA 2SEBA 5T3ZL 3AM8A 2XKNA 5C09A 3PWPD 2FX7H 4XVSH 1F8TL 5B3NA 3D0LB 4UU9B 1FVDA 1X7QA 4PY7B 5F7EL 3TO2B 1MJ7H 2GIYA 5B8CA 1PFCA 3PWPE 1YMHB 1RZKL 2DQDL 2Q8BL 4L4TD 1KJVA 1YNKL 1T0NA 1BP3B 3OAYK 3LV3B 1DCLA 4JQXA 3P30H 4HBQA 5A2LH 4HWBH 2A6KA 5EU6A 3IXTB 1MCLA 1BFVH 4M93C 3NIFF 4ZUTB 1U8LB 4AG4H 4ONFL 4DUWA 4HWNA 2ADIB 2CLVA 3JV4A 3VH8A 2HTKC 4X4XB 5EWIH 1CXHA 2NXZB 3QRFM 1YEKL 2FH6A 1VPOH 4FQXB 4NO3B 4PPTA 2UVEA 1GOHA 2AEQL 5D7KD 3RIFK 1U92B 5HDOA 3QFDA 4TUOB 5DJDA 1A4KB 2VLRA 1JUFB 4UT6L 1R3LA 3HZYA 2FEEI 2RAMA 2EKSB 4ETYA 5FGCE 4LSUH 1SJEA 2YN5A 1BLNA 4WI7A 4L8DA 4Z7WE 4F15C 3T09A 4IOFC 2VQ1B 5DEGA 4XP1L 5FYLE 2GJ6D 1FZMB 1IEAB 4XPHH 3T4YB 4CMHB 1FFPA 2NY6C 4Y89A 1SBBA 4OCSH 3DX8A 3L9RB 2D7PA 3FOLB 5I71C 4N8VA 1HYSC 3L1OL 3OF6D 4OD1H 1DUYB 4V1DB 5J6GA 4HAFA 3N9GH 3NACH 3HUJA 5IMOA 4C83A 4S10A 4ZOBA 2GCYB 3CAFA 1OGAD 4ZAKC 5B39B 5IUSA 1BPVA 3MLVL 3H9YA 4P2QA 1ORQB 4MCZA 2DJUA 1U8IB 4WY7H 5EFIB 2W38A 2AQ2A 3P30L 2BNRB 4BA8A 1OL0A 1BECA 4UIKH 5DJZB 5ID0B 1A7QL 4XXDA 3EHBC 2E7HA 3O81A 1G7HB 5C09E 5C0JA 3BMVA 4P2YA 3O8XD 1T5WA 1VGKA 1BVLB 3A6BL 3OKMA 5CJXA 4R3SB 4M5ZL 4PJ9D 3ARSA 4OCXH 2VQTA 4GW1A 4EVNA 1PZ5A 3VFTB 3X17A 3U0PB 2P8PA 5IROC 4F9LC 2EKSA 1IKNC 1A0QL 4YPGB 1PGRB 3FB6A 4NYLB 1O7VA 3DROA 2KZ1B 4LLWA 3FN3A 2NY4C 4EN3B 2PR4L 3L3KA 4YHKH 2F54B 4PRDA 4P9HL 1IQDA 2BNUA 4O58L 1OW0A 4LEOA 1T22A 5D6DC 4ZFGH 4UILH 1N59A 4MB5A 2OLDA 1I8LA 1U8LA 5GGTA 3NA9L 5D2LF 3BHBB 5EUOF 4P46A 1DVFB 3T77A 3V5HB 4ELMB 3H7BB 3QQ4B 2P49B 4HJ0C 4TNVK 4UBDD 3O9WC 1AC0A 3JVGC 5LXGL 4DQOL 3WNNA 2CKBH 4R26L 2AKRB 3QNXA 5JIPA 4O9HL 3ARVA 1FPTL 3I6KA 2QV2A 3WHE0 3T2QA 1JN6B 2W0KA 3TBWB 4TNWF 3SGDH 3ULVC 1A1NB 4PGCB 3B6SB 2Q7YA 5CEXB 3GJEB 4I0CC 1KJMB 1C16B 4HUKB 2H32H 4Z7UE 4KWUA 2AJVL 2YEZB 2XQBL 1N5AB 2B0SL 1WUNT 4MMZC 2J5LB 3FOLA 3UBXG 1CR9L 3NZ8B 1CFSA 5JPMB 2CJUL 3MLRL 4OI7A 4U1LB 4WFHD 1QUNA 5L2JB 4LCWD 5F89A 4LASH 5I18L 1GGBH 3GMQB 1YPZF 2BSSB 4NZRL 4LHQB 1J1OL 4WO4B 3FZUD 1JGEB 4L4VA 4P0DA 2V9RA 3SPVA 4KKNA 1IAOA 1OQOA 4FRWA 1D5BB 1JPGB 4Z7UB 5DS8A 4EQ2A 1IJ9A 4HKXA 1F97A 1WISA 4YHPA 1JV5B 3QIWC 2FEDC 4JFED 4KPHL 3U36B 2VITA 5IB1B 2YPLB 4BUGA 4XCCL 4F3FA 3VXPB 2PTTA 5I9QC 4GBXA 5CLTA 4LGSB 4U1LA 5JIKA 3OG6B 4GKNB 2H1PL 4PJXF 1MCHA 1ZA6B 1UM4H 1BQSA 4OIAA 2YD6A 1VSCA 1U6AH 2DQHH 4ODVH 1JTPA 1U8NA 3O3DB 2QHRL 4GG8A 1FJ1A 1KB9K 3VI3F 5DD1H 4NN7C 4LDOB 4Z0BH 5L7XH 3MRCB 1A4JA 4ZFOL 3CFCH 1D5ZA 2BFVL 3GK8L 4ERSL 2FL5A 4KGLA 4XCYB 5DMJB 4M6OH 2CDGA 1IM3A 3B9AA 3LKPB 2AJYL 2FX8H 3DNKA 2DMKA 4PLNC 4LHUA 4YO0B 1FSKC 4WW2C 3X12A 2H2PD 2NPLX 3GSRB 3BAEL 1GZPA 1FV1A 3KJ6H 1TVBB 4ZSOE 3MBEC 4X6BB 1IAII 4XCEB 2A2QT 5GGSA 2P48B 2E27L 4BKLA 4HXBH 3BEVA 2ESVD 1OARL 3A0OA 1FRGL 3VA6A 5ILTH 4H25A 4HIIB 3SBWC 4GRWF 4GUPB 3GIVB 4XPTH 1QFWI 3LZFH 3V0VB 1E6JL 1MFBL 1NAKL 1KJ3L 4RRPG 4MJ5B 5FKPB 1DL7H 4JZNB 5D70H 1NBZA 2NX5A 5DRZB 2CKBL 4K7PY 4R26H 3VXQA 4E42B 3GMRB 4ZTPH 3QDHA 4W70A 5DWUL 4L3CA 4L1DA 5FDWB 2O5XH 3NCFB 2Z92B 3N1QC 3S36X 1L9NA 5HYSA 1A1MA 4JPWH 1B0RB 3CVHL 1U8IA 2NNAB 1BHGA 4X0KB 5B8CC 3VI4F 4JFDD 4MNGA 3VD4A 2ZNWA 2BVQB 3TO4A 4EZMA 3SY0B 1XIWB 1EUUA 2FGWL 2Z31C 4Y4KC 4RNRB 1OTUD 3IFPA 1EJ6A 5CJBA 1XGUA 3F65A 2IG2L 2V17H 4KRMB 1JWMB 5I1AB 2P5WD 4UDUB 4U6YA 3MJ9H 1I1CA 3U4EB 2JF1A 3IF1B 3QXUA 3WIHA 2APWA 3DX8B 5ISZB 5I76B 1UKTA 4JRXD 2BVEA 4NN5B 3QBTB 4M5ZH 5EO0A 1P7QB 4X6CF 3SDXB 4H8WH 4CMMA 1WIOA 3EYFB 2HVJA 4P49A 1CFTB 3BWAA 3HZVB 3PWLB 4Y5YC 5JIIA 7CGTA 4FXKB 1CDIA 4YIQA 4ZFFB 5DQ9B 4WEUD 1IGYB 5BZWA 2GFBA 2RJMA 4WU5A 5JMOC 2VC2L 4GSDL 1T7WA 3QHZH 1DJSA 4O2EA 1ZLUK 4JVWA 3ESUF 3HMXL 4FQIH 1A6ZB 4I9WD 3BGFB 4JRYE 2FIKB 3U9UB 3H3KA 3KYMB 3QUZA 4PG2A 3F7YA 4FXGB 3GI9L 5IV2B 4O02L 4NIKB 5ETUA 1ERNA 2X4OB 3AMLA 1PBYA 1ITCA 3SGKA 2EYRB 5DFTA 3QCTL 1LK2A 5DD3H 1UEMA 2GHWB 3CUPB 5HGDA 3TPKA 1PKOA 4DGIH 1T03H 3CSGA 5DHVB 1MCQA 1WC7B 3LV3A 4I5BB 4U4BA 1TVHB 2PN5A 1R3KB 4JFFB 4O4YH 3GJFA 1UXSA 4GRLA 1JYNA 2OBGA 3GSUA 5JNYB 2JIXA 1C08A 1CCZA 2IFFH 4ZOCA 2F53A 1NFKA 3IDJB 4KMLB 4Y19A 3RDTC 4GRMB 1BOYA 2CXKA 4MNQA 3VXPA 4PRHA 5DK2B 3GEWB 4OGXH 4YHLH 2Y06H 3E8UH 4HHAB 3LEYL 4NKIH 3QIUA 5EWIL 2P5EE 5D7JD 3BISA 3G6JF 4OKVB 2VIRA 4NRXB 3FTGB 4G6KH 4AG4L 4L4VB 12E8L 1IVLA 3SPVB 5TE7L 3SQBA 4OGZA 4O2FB 2IPKA 1U8KB 5I66A 1JZ7A 1N6VA 4PB9H 5A40E 4X4MA 5TE4L 5I16A 3WEXB 4OZGA 4PIRF 2DLIA 2Q1EA 4UQ3A 5LWYH 3F62A 2DWDB 4XPBL 5E5UB 5EUKA 1C8PA 2ORBH 5J13C 3EDEA 2IAMD 3C6LB 1XZ0B 4PJFF 4MAYC 3OG4B 1RZJL 1F6AA 2HJKA 2DL2A 1T0MA 1AGBA 5K9KA 1KXTB 4OFIA 1X44A 3G5VA 3B9KA 3HHRB 3N06B 3QXVA 4ENEC 4ZFOA 1RUKL 3D39A 3GSVA 4ZPVA 4XNXL 2HFEB 3QA3B 3M45A 1MJJB 2F19H 2YUXA 5F9OL 5FM5M 1S7QB 1N64L 1MCRA 5DFWH 2IANA 5F1OB 2D7QA 4PJ7A 1J86A 3JWOL 5MP6L 4R0LA 4BSVB 1PSKL 3KPTA 5LWYL 4M7ZB 5EU3A 3LN4B 2WZPD 5FA3A 3BIKB 2EIEA 4K3EH 2KL6A 3MCKB 4DKFH 4HC1H 4LARL 3RWHB 1DQLH 1P9MA 4HGKC 2OR9H 3MNVB 3G6AA 4U1HA 2AP2A 1SMAA 1QACA 3KAAA 2GK0A 4KVCL 1HXYA 3TBYB 3FMGH 3K3QA 5HD8C 4KMTH 3LKQB 4LP5A 5DMKB 5KZCD 5HPMA 2ZUYA 3OGOE 1X5KA 4DN4L 2VUOA 1U8PB 2R0ZL 4RAHA 1S7UB 2QTEA 5K9OB 1UWGL 4HWEL 5C6TH 4XNMA 5HHOD 2NY1D 5BVPL 1A7PL 2WUBH 3QXDB 3UJTL 3S96A 4FQJL 3PL6A 4S1DC 1Z5LA 1RQ5A 4NRZA 2ATKB 2IANE 1I3GH 4AT6A 5J12C 3OSKA 4PJGA 2ZG1A 1YEJL 3T0BA 3NAAH 5GZND 1RMFL 2E9WA 3LKRA 4QOKE 5JO5A 3KPLB 1KNOB 3X11B 4YH6A 1RURL 2B4CH 4Y4FA 2Z8WC 1AJ7H 3T1FA 4MJ6A 3TYFA 4LLDA 3PDOA 4OQ1A 5DVKA 5BOPA 2PKDA 3X14A 1DE4B 3P0VH 4PLOB 4MCYA 3BQUB 4G3YL 4KZEL 4G3YH 1FP5A 3MRBA 4LMQE 3KPQB 3SDCB 5GJTH 4LKCB 4B41A 2LU3A 5KVEH 5JQ6L 1MLCB 1NLDL 4D0BB 3PQYA 2YOCA 1CFVL 4BSWA 3QQ9D 4NDMA 2XYCA 4WUUD 4OFKA 4OGYH 4YHNB 1B3JA 5GGTL 4PUBH 4HMEA 4OCWH 3RY4A 5KS9F 3AMKA 3DYMA 4R4NC 2CRZA 4JQIL 5EZOL 4BQ9A 1RMFH 3RWEA 1GIGH 1F6FB 4PRIB 3S7GA 3SE3C 2AJSL 3HTLX 3ULUF 3BDYH 1FZKB 1EXUA 1A4KA 4D0DB 1I7TA 2X4PB 4KV5F 3U2SB 4XC1H 5GSVB 4TULL 3U0TB 2J1KA 4WJ5A 1S7RA 2GQHA 4K7PH 5BV7B 3MRRB 3QR2A 5HGHB 2ICES 1BFSA 5E8EB 8FABA 3JV4B 4KMQA 1FO0B 2EE2A 3SBWA 4CDGC 2LU4A 1NGXB 5F7NC 5L6YH 5IW6A 1WITA 1U3HD 4NQSB 2FATL 4K94C 4C56B 2YD2A 5EC1B 4AIOA 3G04B 5TDNB 1MI5E 1HH6A 1A6TA 4LP4A 5ITFB 2Q8AH 4AIZB 4MQXD 1HCVA 5F7DB 3EHBD 3REVA 3SCMC 4PJ5B 1AI1L 1UA6H 4MDIB 1YDPA 5HHNB 3BH9B 1RHFA 4NJ9H 1J12A 5H2BB 4MQ7B 5IB4B 2GUOA 4ELKA 2R0WL 2DQCH 4HULB 3V79C 4NZUL 3V5DA 3MRCA 1FRGH 2E3VA 3GSOA 2EDRA 1P2CA 4HXBL 4F2MA 2HKFH 3OAYH 4G9FD 4LVEA 3S98A 1BFOB 4LFHG 1NCWL 1H3VA 3HRPA 5IB5A 3CFKB 3O6KH 2DI8A 4TN9A 4ZS6D 1I7RA 4GS7C 4X6FA 2H8PA 1OP9A 3O6LH 5AD0B 5T1LA 2V9QA 4B5EA 5ANME 3HC4L 4DJMA 1NSNH 3PHQA 3MCKA 3BH8B 3D25A 5D5MB 3PHSA 4AJ0A 5JZ7D 2FJHA 4Y8AA 2D9CA 3QEGL 4Y7MA 2HTKD 1N4XH 3V0AC 12E8H 1TPXB 4K07A 3T0EB 2NW3B 1UCBH 5F1KC 4YK4C 2G60L 5C08E 5ALBL 1CDBA 3BP7A 4PRAA 4TYUA 5SWZB 4ODVL 4L3AA 5F3BB 2EIBA 1UM4L 4ZPVB 4HD9A 4HS8H 3AS3A 4YEFA 4DKDC 1NANH 4JANB 1CXLA 3JBG7 1HHHA 1VDGA 3E0GA 3PABA 2IFFL 4I2XA 3S5LB 4L4VE 1RV6X 5IW3A 3MJ7A 4NQVA 4OLUL 1P7HL 3NN8A 4LLYB 3RX7A 2AXGA 4XNUH 2X4NA 4XVTL 1G9NL 1T3FA 3S35H 5EPMB 3WJLA 1T03L 3BE1H 4GMSH 3IRZA 5ERWA 3ULSA 3T0EA 1CIUA 4A6YB 2Y9RT 1PLGL 2JB6B 2R0KL 4MXVE 3VFVB 2DB8A 2ED9A 3QO0A 2FBOJ 3Q1SL 5HYFA 4NRXA 5JOPE 3L5WB 1SYSA 3UAJC 2EYSB 5HVGB 3ARZA 2AERT 4A6YL 5GGSY 4WFFE 4RMVA 2G9HB 3GSXB 1DQDH 1SVCP 3HMXH 4FQIL 1GC1L 4JZJC 4LSRH 4AM0A 4ZUVB 1ND0B 3RWCA 3CDGA 5KSBF 4N0FB 4ZPTB 5DMIL 4NC0B 2W9EL 4QRSB 2FB4H 3V6ZA 4DUXA 5KVFH 1MREL 1TZIA 2VAAB 4EN3A 1MLBA 1G7IB 3WJJA 3WSQH 3NIFE 1FNFA 3LQAC 4UTAH 4FG6D 1SYVB 4L1HA 4XC3H 3MLUH 5TF1L 3PGDB 2EDEA 1P2CB 4X99B 4PS4L 3ULVD 4YHML 1KEGH 2YD4A 4L29B 4OT1H 3TCXA 1H3XA 2B5IB 1FZOA 3CDCA 1NGZB 4M9OA 2FX9L 3R8BB 3PE9A 4QTIL 5K59E 1I3UA 1FIGH 3UZQA 1P9MC 3A6CH 5H2BA 5INDB 3HB3C 1E0OB 1ZLWK 4BFIB 4E41B 2GAZA 4NQED 4UINH 3VFOA 3DXAB 3B43A 4MD4A 3U82B 5GXBB 2DRUA 5HHXH 3NTCL 4RRPA 1JGUL 1NGWB 5JW4N 3QUXA 4S1DD 1Z0NA 1RJYB 2X4QB 1K3ZA 4BK5A 3O0RL 3HUJB 3WO3B 4C83B 5I1LA 5IMOB 3DJ9A 3LD8B 5LKNA 2PW2B 1ZT4A 1LEIB 5TDOA 3BKCL 3C5ZC 3DX9B 2O5ZH 3F7PC 1T1WA 4OZHB 1NEZB 4ZTPL 4LKXA 1S7RB 3MRFA 5I76A 5KS9E 5M94B 1QR4A 3SGDI 5J7CC 5JHLL 4JZJB 4P4KB 2FHBA 2BNQE 2VUYA 3GFUA 5SWSA 4QXUL 3KDMB 1KJ3H 1LEGA 3KLAB 3CX5J 4OCNC 3RL1B 4JG1H 4XC3L 2R4RL 2G2RA 1JWMA 1K6QL 5T1KD 4UTAL 5I1AA 4FFVC 3LAFA 5IFHH 3BPNC 4XPTL 1KTDB 4PJFA 1IT9L 3GNMH 5ADOH 4KJYA 5KVFL 1RSFA 1HINL 1NGWA 1FNAA 3BIAX 1DP0A 1U3YA 4HIEA 3W39A 2GAZB 1N5YH 2AXFA 1J0ZA 4ZG1A 3PQYB 3QXAB 1EIBA 4KUCD 1MHHA 2JIXD 2AEPH 3OKLB 1N7ML 5IHZA 4NKQB 5J13B 5B38B 3MRBB 5FYLL 1NCDH 3KLHC 5IROA 4F9LA 1OTUC 3D6GA 2NY1C 4DVRH 4NO2B 5BQ7A 1I1FB 5HI5C 4WHCA 4JZNA 4O51B 2P24A 2X89A 4JG0L 3T2NH 1KPRA 1T83A 1L7TH 4UOW1 3V7AG 1G9NH 1MLBB 3LRHA 1JMXA 3NH7H 5MEQA 1T4KB 3QG6A 4NQUA 4CVWA 3VCLA 5FYJU 2VABA 3AY4A 3W9EB 1CIDA 1P5UA 4U6XB 1NKRA 5BS0E 4G5ZH 4NQCB 1S7TB 3MRDB 2AEQH 5D1XC 3OKKA 5E2WL 3HPJA 4Y1AE 1RD6A 5E99L 5K9OA 1A7RH 5EU5B 2QQLH 2AK1L 5FYJE 3BP6A 4P59L 4YNYB 4PLJC 1QOKA 5IFJA 4NRYB 2HTLC 2G75A 4PR5B 3VDCA 4PRIE 1JNLL 4YAQB 4YDLC 2J8HA 2EXYD 1IM3B 5C6WH 3DX7B 2J8UE 4AIXA 5FECA 4WWKA 4N0CD 4ONOA 1HIML 4CVZB 1AGDA 1IQWH 1D5IL 4JLRB 1FORH 4XWGL 1BJMA 2XFXA 3GSNB 2VLME 3KNBB 3FL7A 2VAJA 4IS6A 3IJYA 4MJIA 1MQKL 2FHFA 3DV6B 2XY2A 1I7UA 2W60A 5F8RC 1SJHA 3KPSD 4X8JA 2P1YA 3GRWA 3CXDH 2YBRA 4ENED 5EORL 4GXVL 1T83C 2NTFB 5I17B 4X7EC 3HE7D 2NY0B 2GW5A 2PF6A 2I5YH 5I19H 4JM2B 3I6GB 3G5VB 4JDZB 2VITB 3QUXC 1XCQB 2IMNA 4KJWD 1NANI 3PXHA 1A6AA 2DN7A 5IMKA 5EZLA 1BVKB 4EOWL 4HLZG 4G8GD 4L8SB 1GGTA 1RAMA 2PYEB 3DLQR 3MXVH 4R8WH 1FO0H 2D7TL 3B3IA 3EDJA 4Z5RA 5BZDA 2BSSA 4MQSB 5C07D 1AI1H 1PQZB 4JAMA 1NAMA 5EH1A 2VDPH 4RMTA 3BW9B 2H8PB 5ACLA 3QCUH 3IFLL 2D0GA 2BNQB 2FEEL 2ITCA 3CFBB 4X4ME 4Y4HA 4P48A 5IVXB 1ZGLP 1AP2B 4HF5H 3Q5OA 3LEVH 4QRRD 5HYEA 5IB3A 5D7JA 4ZUWB 4NZTH 1CS6A 1B9ZA 1KENL 3F5WB 2NY4D 2YEZA 1B4RA 4LHUD 5DRNA 2XZAH 1H3PH 4WFGE 4R6UA 1RJZB 3WIHL 2O61B 1KCLA 4YHKL 5CILH 4TULH 1X4XA 2Y5EA 5JHDB 5DZLA 2R69H 4KTYA 2G5RA 4HIJB 4MS8D 4BFIA 4J23A 5DEFB 3AB0C 2ZKHH 4MYWB 4HKZB 4A2LA 3D85B 1W72A 5D1ZA 5DLML 3BI9X 1C5DB 3AREA 1GZQA 2X4SB 1IQWL 3FQRB 4BSJA 1J5OL 4AEFA 4Q9BA 3HC3H 2W65A 1LP9A 1QHPA 1X5XA 4QRQB 5GJTL 5T33H 4YC2B 5D1XB 1NMBH 4XBEH 5TQ2H 1F4WH 5BRZA 5KSBE 2N7AA 1BBJB 1U8HA 1AXTH 1INQA 1FDLH 2VXQH 4LRNL 1IKFH 1MHHB 1P4LB 5CZXD 4P2OB 3QDMB 2L4OA 2R9HC 5CBAA 4Z7VF 4HIJA 5FUZL 1RUPH 1QRKA 2AK4A 2QQLL 4YDLB 2E7MA 4P5TA 3X13B 3CGTA 4Y5XB 3SE8H 4Y4KD 1M6OB 3HNSL 4OBSA 4EN3C 4UOJA 5HHOE 4U33A 3FHAA 1KG0A 5DI8A 2EDBA 4IOFD 3KGRA 2AVGA 4LGPB 1FNGA 4XP1H 3ESVF 1KN4L 5I1DA 4LLAA 4CMMB 1WCBB 1A7PH 4JFZH 4JZJA 1LILA 3U1SH 3VI4E 3IF1A 2W0FA 4DN4H 5JDSB 4KKAD 1NH6A 3U7WL 1KACB 2CKNA 4I3RL 3OAUH 1R0AH 5FUOL 3WNMA 1E4KC 1U2CA 2C3GA 2BZDA 3MZTA 4M1CD 5GRUL 4OIBA 3WFCL 1N7MH 1HHHB 3PABB 4RGNC 5CCKH 3C08L 5JIHA 2XXCB 1CU4L 4BZ1L 4CVUA 4QRPE 2CSPA 4X80L 1JE6A 3E1F1 3UTOA 1DANU 1MH5B 5FA4B 3GNML 4NRZB 1FHGA 3PL6B 5CD5C 4U2YA 1IC1A 4N90D 5TPWL 3NGBC 4MXQC 2AXHA 4QKXB 5DUBA 2R4RH 4NSKB 4LBEA 1S7UA 2PXYD 3VXMB 4RAUA 4MJ5A 3QH3A 1MJ7L 4JJ5A 4U6TA 2VR5A 3QULB 4I0PC 2L0DA 3C9NA 2Z8VC 3DRQA 1GVIA 2XRAL 3V0VA 4XNXH 3PWUA 1YEEH 1AO7B 1RUQL 2B2XH 1BX2A 2VDRH 3BEVB 5T3XD 2VYRE 5F70A 1RZFH 3NFSL 1HDMA 2XNAA 3UTPD 4KK6C 5D8JL 4TVSa 3U6RB 3DX7A 4ZTOL 4EUPH 2UWEA 4CJ0A 1CYGA 5HHXL 5D1ZC 3BP4B 5EBWA 1DFBL 2BSED 3K8LA 3MLTA 4ODHL 4LF3A 5IFJB 3BJ91 3BUYA 5HVWA 5F1NA 3ULUL 1F4YL 3QH3B 4JJ5B 1FYHB 2DYPB 3T3PE 3SDYL 1Z0MA 2NY3D 5EBMA 1AH1A 1IE5A 1XF4A 3MRQB 1F4XH 4R0LB 4U7SA 3WO4C 2YC1A 1IGCL 4XCYA 5DO2C 3WIIH 1X7QB 1OY3B 2CGRL 3FRUA 3H9HA 3E8UL 4BQBA 3WXVL 1NMCB 2ARWA 3MJ7B 4NQVB 3O3AA 5KSAA 1LNUB 3RJQB 3C60D 3M8OH 4HWUA 4JHBA 2NY2B 1MREH 2IADB 2BRRL 3F12B 1XZ0A 1A9BA 1HH9A 1TQBB 3B4NA 4GW5A 4MNHB 1ZANL 1G6RH 3VFRA 4PRPE 4UQ3B 3GMOA 4XAKE 3FONA 3IDMB 4N90E 2I25N 1LHZA 1QTYT 1WAAA 1QFOA 4NWUH 4PGBA 3T8XB 5KS9B 3FN0L 2E8ZA 1DANT 2MPAH 4Z78A 1MIML 1MCDA 4O2FA 1UG9A 3MOAH 3U36A 4Z7WF 5DJ6A 3VXME 3HUJF 5F1IA 4QXTB 4X5XB 1KG0B 5DI8B 2DM4A 4PJXE 4QRTB 3AU1A 3DX6A 4DK6A 1SHMA 1DEEB 3MX0A 1JHKL 3MR9B 4JFOA 1F3DJ 4JFXA 5GGRY 1F02I 2DQUL 2R23B 1DVFC 1RZGA 3MOBL 1AY1H 4ISVA 1X3DA 3QDMA 3LKOB 4P5TD 4RGNE 4LKCA 3GJFB 5FYKE 3QZWG 3RAJH 3TIDA 4Z76A 5M7QA 3RZCB 4PP2B 2DL9A 5IHUL 4ALAL 1ZHKB 3OGCB 1OGTA 3HA0A 4L4TA 2CDEA 4NNPL 3AVEA 2KKQA 1T04B 4OM1H 1GZQB 5CEXA 3RWJB 4OQTA 4Y5XC 3DXAA 3QEGH 3ZHKA 4XRCA 4G8FB 1JMZA 1NPUA 3MREB 1GHFH 3WFHB 1QBBA 5E2TH 5INDA 4XP9H 2IWGA 1YDPB 1X5HA 4UT9H 1NSNL 4FQHB 1QSEE 3QEUA 1KLGA 1AR1C 4WHTB 2ARJB 4Y2DD 1Z3GL 2VDLH 2BHYA 1NGZA 4HX1B 1FZOB 2APVA 5F7DA 1U58B 2AQ1A 5M95B 1IGYA 5BZWB 2WP3O 1XR8B 1E4JA 4C56E 1X5ZA 4J2XA 3EFDH 3PWLA 5L2KD 4YZFE 5DVOA 4EUPB 5E8EA 4WO4C 5DWUH 2IH3A 3O6KL 1JPSH 1YQVH 1QSEA 4MQXC 2OTWB 3MNWB 5FCSH 3V4UH 5ICZB 1FYTD 3ME0A 3S8WA 3CX5K 3GMLB 1T20A 5CHNA 2NZ9D 4N1EA 3D3VD 1IGML 5DHYB 2P8PB 2VLLA 3I02B 4EI5B 5JR1L 1U95A 2DBLH 5GZOC 4L4TE 5D93B 1QD0A 3RTQB 4KJPC 5CZVL 4NCC1 1JGLL 4JE4B 2EDTA 1OSPH 1BGXL 4NNXB 4ZOAA 2HA1A 5CCKL 1JZ8A 2N1KA 5GSRB 1QSFD 1TZHA 1EO8L 3TA3C 3VFWB 5KVMC 4NQEE 4J4PC 4PGBB 3T8XA 5KS9A 2C4FU 4DEPB 1UJ3A 4P9HC 4MCYB 4IMKC 4R4ND 4F8TA 4WFEE 3VG0L 2CRMA 3DGCR 5CGYD 2NW2A 3DIFA 1RVFL 3L3JA 4Z76B 3AAZA 4RGOH 3GSWB 2LABA 5HI5D 3VXSD 1KYOK 1WBYB 3GK8H 4JQVC 1QFHA 4PJCF 5E6IA 1FFNA 5GS3A 5F3HA 3BDYL 1S9XB 1JF1B 3RWDB 5J3HD 1XIWC 2Z31B 3T0DA 4HV8B 1VEMA 1J1XH 4KI5F 3M17A 1IC7H 2Y07H 5J8OA 2YUZA 2FD6H 5CLWA 4P5TC 5ANMB 1WZ1H 4XPGH 1NCBH 3T4AA 1VACB 3MRHA 4XPFL 3MLTB 4ELMF 1T2JA 3CCHA 43C9B 3CFIC 4AMKL 5TQ2L 3OKYA 2AGJH 1DQJA 1IGTA 4APQB 4Z7NF 4X4XA 4MD0B 1OAKL 2ZOLB 2V2TA 2H6PA 4FFYH 4LPVA 4QRUB 1ZS8B 4HG4K 4ZUTA 3DMMD 3F7VA 3VXUE 1KJ2B 2NY6D 1RI8A 4DW2L 4M8QA 4XP4L 1VGEL 2IAMC 5CP3A 3T0AA 1URLA 1YEJH 4ZD3H 4FZ8H 1OAZH 2BP3A 4NSKA 1AHWC 1Z9MA 2QHLA 1KPVA 5SX4I 1OWWA 2H6PB 3U83A 5CILL 2R15A 1SM3L 1EGJL 2FJFB 1RIHH 2AXFB 5BW7C 5ICYB 3HNTH 3BXNB 3MRHB 1IGJA 3UO1H 4PTUB 2IPUG 35C8L 3PV6A 5C2UB 4PBVC 1F90L 2R4SL 4R4BB 1HH6B 5AAWA 4GG6E 1Q94A 4JFPB 4KVCH 2IGFL 4J3TA 3QCUL 4WO4A 4J3WA 3VRLE 4HK0A 3DYOA 1NGXA 4PRHE 2EE6A 1BWMA 4OZGB 2HFFA 2D7TH 5F89B 2Y36L 1KIPA 3QEQD 3EYSL 3U7YH 1LE9A 1NL0H 2OZ4H 1P7QA 3SDXA 5CEZH 5D93C 3RTQC 4PB0L 1CFSB 5JPMA 2J2ZA 4EIGB 2D31A 4M6NH 2VLMD 3ZKSD 2RGSA 5D2NA 5EZJB 5CEZL 1LWRA 3FRPG 3L3JB 5F9OH 1A14L 3C6SA 1CGVA 3D0VB 3V8OA 2XN9B 2ZUQC 4GXVH 1ORSA 5FO9B 1I1RA 1G9MH 1B0GB 5J1AB 3V4PL 5ESVB 5GGVY 4NDMB 1HHGB 1FNEB 4I0PD 1A1MB 1E4KA 1FAIL 2VH5H 2D7MA 2A9NL 3I6KB 2VXSH 3IJSB 5IBUG 1DZBA 4Y8DC 4JFFA 4OLZL 3RVWD 3F6LA 4JFQA 5FF6B 1LQSR 4L29A 4XNYL 1D9KD 3CXHJ 5HGDB 5DRZA 7FABL 4TSAH 4WGVB 1GYAA 5T3XE 2JCCA 4MJID 3VI3E 1I9IL 1HCFX 1N8ZA 5GS2D 1A6UL 5F96H 5DTFB 3T0VA 3MLVH 3GO1L 2LAGB 2IBZX 1BBDL 4NP4H 1I8KB 3VGEA 3W5MA 1ZVYA 4ZPTA 1RU9L 4AT6B 1L4IA 3G08A 3JZ7A 5AG8A 4ZUVA 3TCLB 3OB8A 4OAWA 1OAUL 1S9WB 1N6QH 2XWBB 1XCTA 2QR0A 3LHPH 1LP9E 4R96A 2XTJC 4WI2A 4E0RB 4N0UA 3MGTB 1EX0A 2OK0H 3BT2L 5BO1H 1BVLA 1X5FA 3OKMB 3FQWB 5DDHA 1T5WB 1VGKB 2PXYC 4XBGA 2YK1H 1AHWA 5ID0A 1FYTE 2O26U 2IBGA 4A6YA 5F7FA 3B5TA 2EKJA 3RIAK 4JPKL 1Z9SA 4XMLH 2OJZH 2DTML 4R90L 4XPAH 3CXHK 1NDMB 4M7LL 1BEYL 1GGUA 3GMNA 4LVHB 4ETQB 1T04A 4Y16D 2PO6D 4G6JH 4G6FB 1MRCH 4KI5C 4KI5D 5T1MB 3RZCA 2V2WB 4FABH 5K59F 2WBKA 1JF6A 5I6XC 3QB7C 1LMKA 1UB6B 1ZA6A 4IDJL 4GLRI 4MGXA 1FL5A 4HLZH 1ZT7A 4WCYH 5GRVL 3ARDB 1LO5A 1R24B 3S37X 2NY2C 3IJHA 2YBRB 2WBJD 5CS7A 5DEGB 2B1HL 2NXZD 3STLB 3QFJB 3GSVB 4GW4A 4NC1E 1DBAL 4PV8A 5EU4B 4Q7DA 2BSRB 1SJEB 1YN6B 1UFUA 3D3VA 4QXTA 4FQXC 3UJIL 2YZ1A 2MCPH 4NHCH 2QADC 1FNLA 1G7MA 2VZTA 4KKAC 5ICXA 2QSQA 1JGLH 2F8VA 3UPCA 3QJHB 4RQQA 1HI6B 3O41A 2DBLL 4UIMA 1CFNB 3JUYA 3L7EA 4FQ1H 3GZKA 3S3SA 3WYRA 1CE6B 3FB8B 2VXTL 2LE9A 2UY7A 3HNVL 4Q9CA 4I48A 5L8JB 3TN0B 4ZDHB 3P77B 1BZ7B 1PYWB 4CW1A 1IMHC 4JFDE 3BP6B 3IS0X 3ZKNC 5ICYA 1D9KC 1KJMA 2CQVA 4KHTH 5FYKL 4LVHC 3MRPB 1ZGLB 1B90A 2Z93B 5D2LB 1VB9A 3HI5L 1SEBA 3FRUB 5I8KL 1PD6A 3WFDH 3RZCC 4XI5D 1T21A 3WD5H 3BFOA 5L8KB 1MFBH 1XF4B 3MRQA 3BMWA 5FGBC 4NM8L 3I6LE 4ZO8A 2ZCKH 5DUML 1DBBH 1MRDH 2VMFA 3O8XB 1TVHA 1AQDA 4L9DA 4XP9L 5J0BA 1M7XA 5HYQA 4B53A 1UB5A 2ITDA 4DTGL 4PJCB 5A3IC 4JHZA 2P42B 1BIHA 1LK2B 3I85A 1NFIB 1S5IH 4KHXL 1FVEA 4G9FB 3S36H 3N0PB 5DJ0A 1WEJH 1IGIL 2A0LD 3RA7H 4BFBD 5ETUB 4NNPH 5CUSL 3EJYD 1MCCA 2ZNXA 2IH1A 2EDKA 1ZTXH 3ZKXC 1SY6H 2A38A 2A9ML 3PUCA 4WJ5B 4EN3D 3QDGE 3U9UA 2KDGA 2PETA 2BSTA 1A2YB 5C0GB 1I7TB 5DSCA 4K71C 2D0HA 3ZT5A 2AJYH 2FX8L 2NQCA 3WBDA 3IDYB 4WV1A 1DUZA 2V7HA 4OGAD 4DEPC 4JFEE 1KTRL 3BE1L 4GMSL 2ATPB 5FGCB 4PRNA 3RIFF 5DUBB 4WFGD 5DRWA 1MVUB 2HVJB 5FA4A 5JQHC 5JXEC 1FL3A 4NT6B 3TZVA 1ZT7B 5K93A 2DWEB 5JW3L 5D71L 1UVQA 5EOCL 3T0ED 3B2UC 2O5YL 4K7PX 1YPZA 4WUUA 3O9WD 2A6JB 1KCSH 4WW1A 4UDUA 4PJDF 2Y6SD 1HNFA 3O3BA 2EDNA 1G9EA 3DIFB 5KSAD 2EEDA 3RWGA 3MCG1 3E6FA 3ZHLA 2XV6B 1N2RA 1G7PB 1G7QA 2DM3A 4UI2A 3TYFB 1OP5H 1R5WA 1UJ3B 2YHGA 2VZ3A 5JDSA 5CMAB 2VLKD 4WUUB 3LQZA 5C0CD 1U91A 3O3EB 2NY7H