3TC3A

Crystal structure of sacuvde
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
289
structure length
289
Chain Sequence
HMRVGYVSTNYSLGCKADKTIKLSSLSEERVLKVSSSNLLCLKNILEWNLKHEILFFRISSNTIPLASHPKFHVNWKDKLSHILGDIGDFIKENSIRISMHPGQYVVLNSVREEVVRSSIMELKYHADLLDSMGIEGKIQIHVGSSMNGKEESLNRFIENFRKLPSNISKRLVIENDDKVFSVKDCLWISERTGIPVIFDNLHHSILNNGESLNDALSLVRRTWKDRPMIDYSEQEPGEKPGVHATTINEENFRRFVNEVDEVDIMLEVKDKEISALKAVKVLKELNKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UV damage endonuclease
publication title UV damage endonuclease employs a novel dual-dinucleotide flipping mechanism to recognize different DNA lesions.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Hydrolase
total genus 123
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 3.-.-.-:
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03851 UvdE UV-endonuclease UvdE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3tc3A00
2GUBA 3BANA 2QW5A 4K3ZA 5B7YA 3C0SA 4ZB5A 3VNMA 1DE6A 1XLEA 3KCLA 4GJIA 3NGFA 3CQIA 2G0WA 3VNKA 5EMLA 1OADA 3JU2A 3CQHA 3LMZA 1YX1A 4US6A 3UXIA 3ITVA 4K1GA 2HK1A 1XIMA 3QYSA 4ZB2A 4A8IA 4YTTA 2GLKA 4KW2A 5EMJA 3C0LA 2ZVRA 2QUNA 3CQJA 4HHMA 3BZJA 3VNLA 2G4JA 3CNYA 3UVAA 2OU4A 2XIMA 4HGXA 1CLKA 1DIEA 3CWHA 4G56A 4X63A 1A0EA 2HCVA 3GNXA 3DX5A 1QT1A 4GLEA 1XLKA 3KWSA 4XKMA 2I57A 3AYVA 3ITOA 1QUMA 1TZ9A 2NQHA 4XISA 6XIAA 3DBNA 1XIJA 3KCOA 3M0VA 1BXCA 4OVXA 5I7GA 5H1WA 3ITYA 1XLIA 1XINA 3WQOA 4LNCA 1XIGA 1XLHA 4QEEA 2J6VA 1XLFA 3VNIA 1GW9A 1D8WA 4DUOA 2GYIA 3QXBA 4XSLA 4J4KA 2QUMA 1XIBA 3KBNA 4X60A 3TVAA 1XYMA 4YTRA 1DXIA 3KBJA 1XLLA 3BDKA 5C9ZA 5EMMA 4XSMA 5XINA 1QTWA 1A0DA 4Q7IA 1O1HA 1I6NA 1XLMA 1I60A 1XIDA 3M0XA 4QEHA 1XYCA 4PFHA 2ZDSA 3UA4A 3QC0A 3UU0A 1XLCA 5EMKA 3XINA 3ITLA 8XIAA 4YTUA 4X61A 3KBVA 3KCJA 3M0YA 5B7ZA 4W4QA 1XYLA 2XINA 4PGLA 4XIMA 3P6LA 3AALA 3AYTA 3FVMA 4QE5A 3M0HA 5J8LA 3IUHA 1XLBA 3CQKA 4ZBCA 3VNJA 4QE1A 2X7VA 5FA5A 4A8RA 1BXBA 4ZB0A 3M0LA 3XIMA 5B80A 2QULA 2X7WA 3ITXA 3L23A 2NQJA 3OBEA 3KBMA 3UA3A 1XP3A 3M0MA 5XIMA 1DE5A 1XIHA 4QE4A 9XIAA 3TC3A 4A8LA 4A8NA 1DIDA 8XIMA 1S5MA 5TNVA 1XYAA 3IUDA 2XISA 4XIAA 3KBWA 3ITTA 9XIMA 4YTQA 2GVEA 3IUIA 1K77A 3BWWA 4GQBA 1XICA 1MUWA 3AAMA 1XLDA 2HK0A 4YTSA 2Q02A 3XISA 1XLJA 1XIFA 4QDPA 4HHLA 4QDWA 1XYBA 3N4AA 3C0QA 1XIIA 5XIAA 5H6HA 4EACA 3QZAA 7XIMA 3VYLA 4E3VA 4DVOA 4HNOA 5AVHA 2I56A 1A0CA 3U3HA 1MNZA 3P14A 3KTCA 4EAYA 1XLGA 3U0HA 4GJJA 5AVNA 1XISA 2NQ9A 6XIMA 3BZGA 1XLAA 1XIEA 3KBSA 1S5NA
chains in the Genus database with same CATH superfamily
2YXXA 2X05A 1XH0A 2VM8A 1Y0EA 4Q8QA 4CCEA 1VQTA 3I3EA 4HOZA 1TTPA 2C1HA 3B0VC 2G3MA 3W1RA 4RX0A 3FGCB 2PEVA 3VDBA 3UXAA 5IBXC 3GNXA 3DX5A 2QMKA 3HPAA 2G97A 1DOSA 1HKVA 1H7RA 4W7WA 1QPOA 3H2OA 4JAWA 1KRAC 5LNUA 4FNQA 1JPIA 4K68A 3WDQA 1V03A 5CG0A 1KM0A 1LWJA 2VDHA 4EF9A 3ZYZA 7ENLA 3MHGA 3SGGA 3UNTA 4AYSA 3P61A 4L64A 4D6FA 5EMKA 4AD3A 1BD0A 1L6FA 1JZ5A 5E0FA 3GNDA 2UBPC 3AMCA 1EEXA 3AYSA 2J7DA 3ITCA 2OT0A 2FZDA 5FEZA 4JTCA 3JR2A 5ABEA 2XZ9A 4NJIA 4DJDC 3W1NA 3MJMA 5BZAA 1PCKA 4LY4A 2R94A 4NHVA 3GU9A 2Z4GA 4G8TA 1AQ0A 1E6QM 1OYBA 3WH7A 3WUEA 1R3QA 1C29A 4LUYA 1NF0A 3OEXA 4JDBA 1RP8A 1J93A 3S6OA 1IT0A 2XIIA 3M0JA 1DWGM 2ZZ2A 1EJXC 1NOWA 1DWAM 6ENLA 2EO7A 1E1CB 3AIUA 1JCMP 3GVQA 1KXTA 2J66A 1C7TA 4JYEA 4PUEA 3SM0A 1SMAA 2PDMA 4KWVA 1B9ZA 2RFGA 4YJ5A 1VJIA 3LTSA 2HBVA 3B0PA 4CQAA 5D02A 4MZ1A 5KINA 2X0SA 3TYEA 2PDLA 1W1VA 3CWOX 3LI1A 1REQB 4TVDA 3V1PA 4PMDA 2J4GA 1ONRA 1OK6A 1GJWA 2BVTA 2XFWA 3DGBA 3M7SA 2NVCA 4V1YA 1V6TA 2YL8A 2OG9A 3RJXA 1EBHA 2EKGA 4PUKA 4KIEA 1TSIA 3P93A 1X39A 4GNJA 4DXKA 3QW4B 2BS9A 4FB7A 1DJNA 3VKJA 1OYCA 4DAFA 3GXDA 4IGHA 1N2VA 2ZE3A 3GH7A 4FSAA 4JGDA 3M0MA 1YE4A 1U5VA 1XQKA 2WV8A 2PE4A 4GA8A 4UUIA 4AWSA 4LC8A 1UD8A 2W63A 5A8MA 3CB8A 1LRQA 1ISYA 3IJQA 2NX3A 5CGMA 3REQA 1K9TA 1YTKA 2YA1A 3ARRA 3MKKA 1CGTA 1JD7A 1ECQA 2Q6ZA 3DECA 3SI9A 3VIGA 3OGVA 1PCWA 1HVXA 1GVOA 4K1GA 3FFSA 3RFAA 1BXNA 2C1IA 3KE0A 4E4UA 4K7VA 3SECA 3LM7A 1BTMA 4NZFA 2P10A 1JFHA 1SO3A 2ASHA 1RH9A 5AC4A 1WDQA 2O9OA 3R1ZA 3UZWA 1QNRA 1K6WA 6REQA 1L6WA 2MANA 3KWSA 3OLDA 1S5WA 2I7GA 1S38A 4MWAD 3UF9A 4NI3A 5DANA 3T78A 3WLIA 4MVAA 3R12A 3EA1A 3PZTA 2V5CA 5KZ6A 3O63A 3TJIA 2OSYA 3D3FA 1T41A 1E5NA 2V69A 3K2GA 1BWVA 3MP5A 4L4MA 1LP6A 2PA6A 2IPGA 3RITA 2D23A 4IQJA 3M0ZA 1M65A 4WOZA 5TAOA 3QLLA 3SQLA 2ACUA 4MSSA 5AYXA 3GRIA 1VBGA 2KAUC 4KKXA 3OVQA 3MCMA 5M17A 4GQ0A 3UZ5A 1PDYA 2JFEX 4FMVA 2VGBA 1IR2A 1H60A 4PMUA 1G9HA 4XKYA 4H6KA 3EOOA 3SW6A 1EP2A 1QW7A 1FTXA 4IGNA 1XLGA 4AMAA 4YWIA 3W7JA 3DZ1A 4PUJA 3K1GA 4W8LA 2QCFA 3VC6A 1P1XA 2Q01A 3KOZA 1UWUA 3VD7A 5IFPA 3TONA 1BVZA 4X2RA 3F5JA 2PDHA 1D8CA 1YYAA 2W27A 8RUCA 3M6DA 3WN6A 1XC6A 3P62A 3E5BA 2DT1A 4ACZA 1DORA 2HISA 8CGTA 3HQPA 4RE2A 1VC4A 1XINA 3FSTA 4TV5A 3VOFA 3ONCA 4UZUA 4REQB 3STFA 9RUBA 5CGQA 1FXPA 1XLMA 2ZDSA 3W4RA 4M1RA 2EPOA 5DO8A 2J79A 4HPXA 4LRTA 1GJUA 4US5A 1QFEA 1QPKA 1ENUA 2I9EA 3GXPA 3TOPA 1VBJA 4CUCA 3GE7A 4DEFA 4MPKA 1JVNA 3FA3A 1OC5A 3V3WA 3OW1A 3VE7A 2GOUA 1MFVA 5C55A 4A8RA 4CEUC 2Y7EA 3WEOA 1E56A 2E1WA 3GD6A 3N2CA 1NP2A 3L2IA 3WUFA 3A23A 5A94A 1ONXA 4WRHA 4HSNA 4OOUA 2FIQA 1SW3A 1SSDA 2PDCA 1OCJA 3BQ5A 3A5VA 3WNPA 5DCBA 1JZ4A 2EG8A 3ARPA 1V0NA 4GXWA 4ICNA 2X40A 1TWDA 3KP1A 4TO8A 4CQCA 2O56A 3WDJA 3AWNA 3T81A 3EKLA 5B7YA 1GZGA 5HNRA 3P81A 4U4MA 3GHTA 3KZSA 4NJHA 5C9WA 3D5HA 3LYEA 4BS0A 2DUXA 2WNQA 2ZX5A 3DFSA 2Z2AA 3AXIA 3B4YA 3RM8A 3M9YA 3PZOA 4HOWA 4NRSA 4OUEA 1PAMA 5CJ5A 5AC8A 1T8QA 3ABZA 5H1WA 4Q8PA 1O5XA 3E6EA 4QITA 1GCYA 2Z00A 4PSPA 4J4KA 4RK8A 1HJVA 4AU0A 1DWHM 2QKFA 3PR2A 3T7VA 1R3WA 1MO0A 1OT2A 2NQZA 2QJGA 3QV6A 1SVDA 1HKKA 3KBVA 2E8ZA 2UY2A 1Z41A 3BLDA 4ADUA 1MQPA 4B3KA 4DNHA 3IIVA 1H5VA 3IGSA 1KGXA 3UCCA 5I6SA 1CW2A 2ONEA 4QE1A 4UIOA 3UERA 3GR4A 3S1XA 3NSXA 3AIQA 3Q67A 1HJWA 3OOQA 2C8NA 4G5DA 4AY7A 1E43A 3E12A 2AQOA 4C6FA 2AMGA 1UA3A 4E8CA 3N12A 2FPVA 4XZWA 3ARQA 2IQTA 1V0MA 1K7EA 4G7FA 2EGZA 1ICPA 2NX9A 3T6CA 3MUY1 5DMNA 1QMLA 2CLPA 3KBSA 1X6NA 3TJXA 3VGDA 5BU6A 4ZB5A 3FXYA 5E1QA 2J7HA 4H01A 3B8UA 4D6DA 4TMCA 3AS1A 4N02A 1SFTA 5EBAA 4GI4A 2GGHA 1V3KA 1C93A 1M3UA 5I78A 4PFMA 1HZYA 4ACZB 2RGLA 1EJTC 4ONVA 1B4EA 1BXCA 3TTEA 1KFBA 1B3OA 5HPOA 1RQBA 1H1NA 4QHRA 1XUZA 3B4UA 1J0HA 3AZRA 2X09A 1KXVA 2CETA 3W24A 4GQGA 1TJPA 4FIQA 4NF7A 1Y65A 4GO8A 3W7RA 4B4FA 3ITLA 4E0CA 3UETA 2OFJA 4V33A 4BWLC 3S2NA 1JFXA 5I07A 5DT7A 4E6MA 2WQPA 3WF0A 4AD1A 4HT3A 3WZ0E 1MFUA 3CO4A 1W3JA 4JTAA 4QIUA 3F7JA 1WUEA 3RO6A 1E6SM 2OT1A 8XIMA 2CCRA 4W7VA 3KRZA 2DVXA 3S9ZA 2BFGA 1BKHA 4DM2A 4MFEA 4O0ZA 3T42A 4IIFA 3E74A 3ZJ6A 2VXNA 4JHOA 1F8IA 1LT7A 1M68A 1X96A 1F07A 3UW6A 3UJRA 5LIUX 4WD0A 3HURA 4FZIA 1O66A 1GVYA 3TTSA 1AD1A 1W8SA 3FJNA 1OZQA 3WLSA 2PTWA 3UZYA 4DF2A 2WMHA 1QDSA 4V27A 3EX4A 3O6AA 1WKFA 3CHDA 1YNQA 2OWWA 2V30A 6XIAA 2VEMA 4HNNA 4TUFA 4Y9NA 3WK1A 4HU4A 4P61A 3QMSA 3AYRA 2YOCA 1XIBA 3E0WA 3AS2A 4C7FA 4JFVA 3HG4A 3NZQA 2HS6A 4DYKA 4MLJA 4E2DA 3BLFA 4BF7A 4CEXC 3L9CA 4IMGA 3UJEA 2D0GA 1ME8A 1TPB1 4MDOA 4HCDA 2XIQA 4BCEA 4E2VA 3AS0A 1V0LA 2DSVA 3W84A 1R3RA 3QOMA 4ES4A 1OG0A 1QW8A 1JPHA 2JQXA 2PU0A 5FF4A 1IZKA 4R85A 1CXIA 2WMKA 4A8LA 4TTUA 3VU2A 1OFOA 3WK0A 1J6OA 4HTYA 3EGJA 3GYCA 1NM9A 3SCQA 3LPPA 3TN4A 3OYXA 3QZAA 3C2VA 3HMJG 1R7OA 1FHLA 1HUVA 3B0YA 2ISFA 5I3FA 3F2BA 2TYSA 5E6ZA 3URBA 2A4AA 4DBDA 3MJYA 2QGYA 4IGSA 2D20A 3JS3A 2DIJA 2CBIA 4IOTA 3BLPX 3MMDA 4B2DA 2I9UA 2C13A 3TFXA 3HN3A 3FW6A 3W7LA 1H2JA 3VIHA 3CPRA 2AQWA 4TVUA 4H9XA 1KGWA 2WVUA 3CWHA 1JULA 3DFTA 1V3HA 5F2LA 3NDYA 1J0YA 4HNUA 3K30A 1OGBA 1CNVA 4MYXA 5IRPA 3PNUA 4PUWA 2H8ZA 4XVEA 1B3ZA 4F0LA 4K6AA 4HA4A 4DO5A 4D72A 3W2JA 4EPBC 1KKRA 1H11A 5CC5A 2PGEA 5A5WA 1S39A 3ABOA 5EB8A 4JQAA 1RQEA 2VRQA 3QJAA 1X1OA 5I3KA 1I0DA 4CNTA 4BEQA 1KRBC 3I4KA 1V6UA 2F2KA 1TV4A 1FVPA 3DYOA 1AW5A 3PB0A 2V3EA 3E96A 4PSRA 4FNUA 1PIIA 2XSAA 3Q58A 4RPPA 1N55A 1UR9A 3OZYA 2D1ZA 1XIFA 2EBNA 2X8RA 1XH1A 1UC5A 3B0UX 4W5ZA 3U0HA 4LEQA 1I2RA 5CJNA 1I2OA 2FGLA 1XLAA 1ODZA 3RLVA 5AFDA 2FTYA 2RAGA 2A3HA 3BUVA 2PD5A 1G7VA 1FFQA 1FUYA 3D46A 3WNNA 4QG9A 3BTNA 3D47A 2QUNA 3QMRA 3W1QA 3RN6A 4RE0A 5I09A 4P8XA 1BYCA 1KCZA 4MHBA 2WKGA 1TR9A 2OODA 4MUPA 3R7MA 1K4GA 2WXDM 3RNDA 4D71A 3B8DA 3TEVA 4NP7A 4B5XA 1P0BA 5A6AA 4OGZA 4FO4A 1UIPA 3QGAC 2EEXA 1MUMA 1XIDA 2XGIA 1NF7A 1P7TA 1L6GA 4JYFA 3N15A 4GXMA 3TK7A 3PSVA 3P6LA 5GQBA 2W6RA 1YQ2A 3GXIA 3A4JA 3DC0A 4KPLA 5DBUA 4KFOA 1EO7A 1JDDA 3AJ7A 2XDFA 4Z2HA 2A3BA 3H2FA 3CIWA 1XPGA 1C92A 4OFCA 4U5IA 1VR6A 3B06A 3AAMA 3E02A 3KL3A 3BO9A 1HJUA 4C6PA 3RHGA 4YMZA 3LU2A 2HV5A 4EACA 4UFMA 2C6QA 4PTWA 3LLDA 5T9BG 4U33A 1EA9C 1EXBA 3TA9A 1LQ2A 3FN9A 4KEVA 3SCNA 1HF6A 1TPC1 3BICA 1SFSA 7CGTA 2Z1BA 2R14A 3BK0A 3NSNA 1UIOA 1KTNA 3GC2A 1YBQB 1JQXA 1VBUA 3NZGA 3CL8A 3CT2A 4KESA 4YHEA 1KFCA 4HYWA 1KQZA 4N4QA 3VNLA 4LH8A 3V5FA 4HJWA 2PRLA 4GZIA 4F0RA 3VDHA 2J7BA 4S39A 1VEMA 2VZVA 2EPHA 1XLIA 4UCFA 5D04C 2XG9A 4ZA0A 1XIGA 1AW2A 4AD0A 1JZ7A 2GYIA 3DERA 1ZZMA 3PWGA 1YDNA 1R3TA 4HHPA 3SY5A 3WQWA 2W66A 4JHZA 1JYNA 2BHYA 4QLLA 1ZPTA 1EYEA 2BP1A 4MG4A 3WMLA 1EL3A 3ARXA 3R11A 4MJ2A 2OX1A 5LNRA 3SADA 1F6PA 1XSKA 4A3QA 1FCBA 3SGZA 2R82A 4JFSA 5HNNA 3UG5A 2G41A 3EX3A 1Y7VA 3LXAA 4GBDA 1LLOA 4NT0A 5IOBA 1BG4A 4YLWA 1EA0A 4UCGA 3G1XA 1LZOA 2NUWA 1M7OA 2IS7A 1UQZA 1H7PA 4QAWA 3NEVA 4HVXA 4US5D 2OELA 2ZC1A 4AEEA 4AEOA 2VD8A 4GYJA 2BASA 2DZPA 4LAKA 4S3JA 4PTDA 4WDUA 5DRIA 1PKYA 4JTJA 1YLVA 1J5TA 2D24A 3CEPA 3U7VA 4Z08A 4XAYA 1C9WA 3UXIA 3TNOA 4L80A 2JEPA 3FK4A 3W23A 3GW0A 4IIGA 4UTWA 3DFQA 3IACA 3UESA 1H0GA 1KBKA 2FFCA 2A3AA 5T91A 2X42A 1HN1A 1WKDA 5C5YA 4ZCWA 5CBJA 4NI8A 5G4WA 4RDVA 3EWCA 5H8PA 4GYKA 2JF6A 5HJXA 1M03A 4LB3A 4YTRA 1Q85A 4PL2A 4UR7A 3UYIA 4PRRA 3BXWA 4L6DA 4DELA 3VKKA 4ENLA 2E6YA 3KCJA 1TE6A 2B7OA 1LL6A 4JBRA 1FHDA 1O5QA 3UXLA 2BY0A 2O7QA 4FX6M 2VC6A 1GT8A 3PG9A 1J8VA 2WJDA 1WBHA 3QQ1A 4GKTA 4JIHA 4GQBA 4XD3A 1QI5A 1PZ2A 2VGFA 3PNZA 4QDPA 5XIAA 2RDTA 2Q3OA 3WJSA 2NV9A 3VTRA 1DQUA 2ABBA 1OT1A 5DQPA 1TVNA 3L2LA 3WMBA 4NIRA 5A6SA 4OKDA 2HNHA 3R5EA 2F8QA 4HB7A 2GUBA 3ZWTA 3ME3A 4ZOAA 2D0HA 4RW5A 4OBRA 4PL1A 1VEOA 1A3XA 1BF6A 2WMIA 2HK1A 2DH2A 1J0KA 2ZYFA 3ZS4A 4A22A 2XN2A 1ZSXA 3NA8A 3PAJA 1EF2A 1EJVC 1CXEA 2A6NA 4EIVA 1F6YA 4B5SA 4EXAA 4GCAA 3B0XA 1GK8A 5BW6A 4S3KA 3S9IA 1UB3A 1UD5A 2ZZ1A 3GU2A 2RH9A 2WW5A 4ZOEA 1QNPA 4XTDA 3W74A 4WGHA 3N18A 3OU8A 4OJYA 1DWJM 1AQFA 3A3XA 4NZCA 3PBGA 1MW3A 3TTYA 3WQ5A 4PMXA 5A2CA 2Z1WA 5DBTA 3A4XA 3LBCA 1TVLA 4XIMA 4YYFA 3ARYA 4H2HA 4QX4A 4MTVA 5GNZA 4O1BA 1XM3A 2WSYA 3N6JA 3KWXA 2J78A 2FKPA 1B30A 1QXLA 2D73A 1ZQ5A 1AZ2A 3WF2A 4HK7A 2PWHA 4Z0SA 5TD4A 2WPGA 3M0KA 2ZUTA 3ABSA 2X1UA 1W31A 3BAYA 1JGMA 8TIMA 4M56A 3KZPA 1XG3A 3U3HA 1MNZA 4DHGA 4IXHA 1P43A 3W38A 3FCPA 4IFKA 1K9EA 2INFA 3KTXA 5IHRA 1KQYA 4XZIA 4FOJA 4UWMA 3IJ6A 1J79A 1F61A 3M16A 2YCLB 1AJZA 2O55A 4AVFA 3QLDA 1OFAA 4I9JA 5FOOA 2OZ0A 1DJHA 2J47A 2JF7A 5CZJA 2C16A 3LCIA 4IJRA 1K8CA 4JNZA 1ZGDA 4FXRA 2AQVA 1EPVA 2OKTA 4IPJA 4L4OA 5CEWA 3LHYA 5I3JA 2A7NA 4ZXOA 1GYMA 1RPKA 1NP0A 3QXBA 1EO5A 3QSTA 2Z0IA 1VH7A 1DVJA 4C91A 2W67A 4S38A 1TB3A 3QC0A 1H5YA 4AXKA 2BG5A 2CLOA 4GI9A 2GZXA 1XYLA 1WDWA 1J11A 3DKJA 3NXFA 2PCEA 1E6NA 3ABQA 4K8EA 1GVIA 3W87A 1IXQA 1UBSA 3FS2A 3PTKA 4KF1A 4J28A 4L1XA 2FTPA 3VIPA 4LX4A 3MY9A 3TJLA 1WZLA 4YVXA 1LLZA 2GVEA 3ZO9A 1CXLA 1SR0A 1VKFA 3GHSA 1G0CA 3W85A 4HN8A 1E51A 4UBPC 1OBAA 2F38A 1SMDA 3W9ZA 5JQ9A 4EPEC 4GY0A 3P67A 5I23A 4WXYA 3TYAA 2HTMA 3M4HA 2QDGA 3GDBA 3LK6A 3L4TA 1XR2A 4N9CA 3VGHA 5D30A 4G7EB 1W1PA 2EPMX 3CZJA 3FA5A 1NDVA 1IQ8A 3UR5A 2PFHA 4Q8MA 3N13A 4K39A 1KM3A 2D69A 1U33A 5FEXA 3O07A 1NWRA 4JKMA 3PJUA 4RL3A 1RBOB 4YCOA 3T0CA 1LF1A 1X38A 3EZ4A 2O0TA 4RZ4A 4RLIA 3G1YA 3GY1A 4TU1A 4ZEPA 3LBMA 4C1NA 1CXKA 3WBYA 1UWTA 4Q4OA 4Q8WA 1US3A 3TTQA 4S3DA 2FDSA 3F1QA 2REQA 2ZE0A 5D33A 3SRFA 3R79A 2XH2A 5IM51 2WLYA 3IVSA 1DE5A 2E68A 1KXHA 3GR7A 1S5MA 4O4WA 4PBGA 3H70A 2PLKA 3PZ9A 2QQ6A 3NG3A 5A6TC 3G0XA 4HCLA 1EJ7L 3IV8A 1W2VA 4KETA 4HNVA 2BODX 1UZDA 5CAKA 3TIMA 4QS6A 2F84A 1ADSA 1SU5A 2OLHA 4O50A 4AF0A 4EWND 2ZRYA 2WMGA 1A50A 1EDTA 1E9ZB 4K3ZA 1IF2A 3VIIA 1C91A 3ZR5A 4PMQA 2V9DA 4ML9A 3NGFA 4PMYA 1P0DA 1Q6EA 2PP3A 3BLLA 2OLAA 3WNKA 4PRWA 3WLJA 4MPQA 4ZSTA 2DW7A 3I4EA 1TA3B 3E1F1 4C6EA 5CCZA 3DCPA 3WD0A 1A5LC 5LHFA 3UD6A 4MADA 1BVWA 4AC1X 4BHYA 1JIBA 1GEQA 4TV6A 1OFQA 4LV9A 1MVYA 1DXIA 2FQIA 1JD9A 5D2TA 4ASTA 1TX2A 1GVRA 1R3SA 5FACA 3CO8A 5D9NA 2PMQA 2MUCA 3WBWA 1EWDA 4AISA 3MCNA 2IPFA 2AMXA 3B9AA 4M3PA 3A6OA 2ZXAA 7REQA 3VNJA 1PS9A 2HWGA 3TXVA 2C71A 1TJ1A 1J10A 4Q3MA 1CLXA 1S5TA 1XDJA 3LA4A 1E4IA 1XI3A 2V3DA 1LRTA 1XYAA 4AZCB 4EVZA 9XIMA 2VZTA 4GVFA 1GPWA 4LEFA 4AMCA 4KQNA 3NQMA 1GPFA 4U2YA 1IGSA 1U5JA 1QNVA 1E6PA 2PC8A 1G01A 2NQ9A 4X60A 3EX1A 4J3UA 1HQTA 4KCVA 4R88A 4MAVA 3OIHA 3UYCA 4MMWA 2ZUSA 4HZ8A 5IHSA 3O6DA 5EGRA 4UTIA 5DXXA 3NQBA 3F2DA 4LCQA 1H7NA 4XAGA 3P7YA 1RVKA 2XHYA 1EC8A 3GXNA 4QTGA 1TV7A 5AHEA 1WDPA 4O8RA 4QCFA 3GAKA 1UWQA 2ZDRA 2VEFA 1D3GA 1ISVA 3NL3A 1QK0A 4NQ1A 1XDLA 2ATMA 5AZ1A 1XS2A 3TN3A 4A29A 1MUCA 1RXOB 5BMXA 2P88A 4JTSA 3DG3A 4Z2JA 3URNA 2XZ7A 5J5DA 4AZIA 1GTEA 4QJ1A 1W9PA 3OZMA 4F0MA 4EAMA 1POKA 4CU6A 5I5RA 2ZXBA 1P4CA 1E6ZA 4ZB0A 3ZLGA 1F3XA 2PGWA 4NNAA 1EJUC 1GORA 2R1KA 1CGXA 2VUNA 1EHAA 4EXBA 4MJMA 2RHGA 1QU4A 2G96A 3TA6A 3VM7A 1G4TA 2Y85A 4LPCA 3NL5A 4O52A 3HU7A 4O54A 4RV8A 3W1LA 1SZRA 3ZOAA 3OPSA 2Y7DA 3MTWA 2OKOA 1TV8A 1GKQA 4GVHA 4WIWA 4RKAA 1PHWA 3V0UA 5HUOA 2XVGA 4JNMA 7PTDA 1RA5A 3MKVA 1OQFA 1R7AA 3FDKA 4P2VA 4X0NA 1OG6A 2GDQA 4L6HA 3VKBA 4DJFD 1AG1O 4C6JA 5D37A 4GUHA 3ARWA 3VNZA 3CQHA 5U4NA 1R5YA 1DV7A 3W7HA 3O15A 1FCUA 4UZSA 1VLIA 3LX9A 1SJCA 3UWEA 3MP4A 2PAJA 1CXFA 2PTDA 4ZO9A 2OU4A 2GWGA 1VIWA 1BTCA 3HZ3A 1JEZA 1RD6A 4R33A 3EWXA 3AMGA 1MQRA 4OHQA 3IGUA 1W5OA 2PTZA 2Y0FA 3ABRA 1YDYA 4L9XA 1DP0A 2NUXA 5HQMA 3D3AA 1OINA 1VF8A 2VEKA 3UNDA 2EF9A 1J01A 2R9RA 1IWBA 3L21A 1FWIC 2WCSA 3IAQA 2BXVA 1I6NA 1I60A 1XJBA 1A5AA 4LGXA 5ECUA 1UD3A 3UZJA 3BV4A 5U7SA 5DN1A 4QSFA 3HG3A 2BGNE 3AIWA 1DQWA 2JGYA 2J9YA 3CGTA 1QI2A 2GGJA 2DW6A 1MQQA 2V68A 2PDGA 3RRXA 5JUVA 2GPTA 2WHKA 1KWGA 2XUCA 4JEQA 3BURA 3DYPA 1U1UA 4KCWA 3SUWA 4DWSA 2CZ5A 3ERPA 1WUFA 1GVSA 5H8MA 2PDJA 3V18A 3OVRA 2OSWA 1HG3A 3MMWA 3UVIA 5FAJA 3I10A 4BQ3A 1WX0A 4WJ8A 4GJIA 5CLTA 3GWQA 2WJZA 2AAAA 1GYNA 2CNCA 3MO4A 4PBFA 2CLHA 3AROA 3PJTA 4GC3A 4MFDA 3WYZA 5CBIA 1OX5A 4IMCA 3SIMA 1LG2A 5FESA 3HV9A 2XIMA 1JAEA 5FF3A 4NZ3A 1NWSA 1Q66A 3WY1A 4CU8A 4XVDA 1KFWA 3M5XA 5C2CA 3QQWA 1IEVA 1RPXA 3BLIA 3TVAA 3NDOA 1YE6A 2XFFA 3SZ8A 4RDYA 1DHKA 1W9XA 4UFLA 1B3WA 2XH0A 4A6GA 1OFBA 1A47A 5HNUA 1H61A 2O7SA 1VLWA 4BK9A 3MANA 4IP5A 4PODA 4Q4MA 5LIKX 3WG6A 1A49A 3K4AA 1GUVA 3EX6A 1ZTVA 5E09A 3BPWA 3STEA 4YTQA 3VILA 4JTHA 3IUIA 2WJFA 2B31A 3RLUA 5BYWA 2VWSA 3GKFA 2VFDA 5AVHA 1W37A 3LD5A 5E9XA 4AWTA 1P0EA 3FXGA 4PMOA 4RZ6A 4L9YA 3TU9A 2XVNA 4FNPA 1NSJA 4ERIA 3TN6A 2WSRA 4JHMA 3A9IA 3BCJA 3T44A 2XYLA 4DUXA 3LQGA 3NZPA 2O9TA 3E0VA 1XYZA 2G4JA 4ACYA 2XSXA 3CAKA 1GQKA 1GGOA 3NOYA 1UW9A 4UTJA 4D9PA 4D6CA 5BRQA 1SJAA 1WAWA 3V16A 2PTXA 2VX6A 2G5WA 3CV7A 4MUZA 4UOQA 1XXXA 3R0KA 3BL3A 3NQ7A 3VO0A 1GYLA 3ARZA 3VUSA 4AX6A 5ECVA 2YL6A 3GNPA 3WQDA 4I5RA 2WZIA 4FNRA 8XIAA 2XJ7A 3SSZA 5FI8A 2A79A 1G6CA 3Q94A 4Y90A 1S2TA 4M6VA 2VT0A 4NJJA 4UTWC 1RUSA 3E0FA 1VEPA 2P0IA 1WQ5A 1D9EA 1A3HA 4JTLA 2AKMA 2ZQ0A 1UQYA 4MB1A 5TBOA 1BLIA 4DWSB 4FLRA 1RBLA 2ISSA 3OQEA 2HK0A 4MDPA 3S1GA 1XLJA 2PDPA 3EDKA 1FWWA 5C2GA 3IGXA 1VFLA 4OTKA 1E0TA 3CQ0A 2E7FA 1OHLA 4WY0F 5DXYA 3F4VA 5AZ0A 1IR1A 3GVRA 2OYKA 3SQMA 2W0UA 3GDTA 3OG2A 4I9TA 1AQMA 1HKIA 1LG1A 4CD8A 1M6JA 2Y70A 2YBUA 4X2PA 3PUGA 1YPIA 4WGXA 1HP5A 2DGAA 5ABTA 1KM6A 3TYUA 1UWSA 3VDGA 2VUYA 3UY8A 4JICA 5DY3A 3AYVA 2AL1A 3H4WA 3RCYA 1X98A 5D9PA 3BW4A 2ON3A 1DXFA 2PP1A 3IS4A 3LHWA 1TZZA 2AKZA 2E5CA 3WQPA 2IQDA 2BOGX 3KAOA 3M0YA 2QAFA 3W6YA 2ALRA 3ABXA 1BEUA 4C1KA 3QQ0A 4R5EA 2IXUA 4ZE5A 4N2YA 5D03A 3AI0A 2P50A 1YTEA 3WUBA 4D2JA 1Y5VA 3UFYA 4UC5A 3VD5A 4LC6A 2PDFA 3TX9A 3E2QA 4NNBA 3BW2A 1WKEA 2AOSA 1RA0A 4R7WA 2BX7A 4JQ2A 3PC0A 3F03K 1KD0A 3NZ1A 4LY8A 2QDHA 1UMYA 3ZJ8A 2J77A 2ZUUA 2XM1A 3DHUA 3AO0A 1S2VA 1OGSA 2QCEA 2OEKA 3PSWA 2C14A 2ZADA 3G8EA 3SCVA 3T05A 1QNSA 3C2RA 2I5IA 2PBGA 1CEOA 3TCEA 3CUGA 3H2AA 3CUIA 3C0LA 2GVJA 3VA8A 3GTXA 2CEQA 1VS1A 4V15A 2CKRA 2DJLA 1ZNNA 3AHYA 1HFBA 3TW6A 2QV4A 2GUYA 3G1SA 2YL9A 4P7LA 2YB4A 3AZSA 4JQ4A 3GTFA 4IFOA 3B03A 3SRHA 4WLCA 3R8GA 3H55A 1W9UA 1EGVA 3QC3A 1PZ0A 4ZL1A 3MUCA 3QPEA 1EC9A 5TQLA 4UTLA 4Y9AA 1ZL1A 4U31A 1LOLA 2YW4A 4IQEA 3RCNA 5F1VA 3GHRA 3EWBX 2GWNA 4PCFA 1RY8A 2RJHA 1X7IA 1QBAA 3EWZA 3S5NA 3HJZA 5MKGB 4PMJA 1NFGA 5ABGA 5HDRA 1XKYA 4MJZA 2D2OA 3LZ3A 5CPQA 1OY0A 1CENA 3C52A 3KP0A 3VZYA 3OIXA 2IKGA 4IIEA 1TRDA 2I56A 3NVTA 4YL2A 3B8WA 1PE1A 2VO5A 3W71A 1XGZA 4F8XA 3R58A 4LYKA 3C8FA 2BDQA 4M0XA 1FWCC 4H1ZA 5JMUA 2ZX8A 4QG8A 4ZO6A 1HNYA 2V2DA 4DI8A 4Z1AA 4BF5A 1XIMA 4MYAA 6ALDA 2VCBA 3SR7A 1NDWA 2Y5SA 1HW6A 5HA7A 4L65A 1FY6A 3U6WA 2QCGA 3BH4A 1MW0A 3CZKA 4A3YA 1NDYA 2G3JA 3ITOA 2PWDA 2JE8A 3NYDA 4Q7BA 5I7GA 1KCKA 3N3TA 4DQWA 1FWJC 2QJMA 5D9OA 1QO5A 1YNYA 3B8VA 5I03A 3R10A 4EE9A 3V75A 1PKLA 4GFSA 5LA1A 4TQTA 1ZAIA 4HOXA 3QW3A 1YNPA 3F5KA 1GOIA 4IL0A 5J8LA 2WK2A 4ERGA 1G7UA 3AU2A 3NQCA 1ZENA 4JZ5A 4NXSA 5DFAA 3S8HA 3GM8A 3DIPA 3FJ6A 4A2RA 1C3FA 3RLGA 1I2NA 1NEYA 4FXSA 3VK5A 1ZBVA 3IJLA 4C6LA 3HQNA 4Y9MA 1MUWA 1DYSA 3TC7A 1X6LA 1XRSA 3C0QA 3WD4A 2WKJA 4N6FA 3AMLA 4GGHA 4LAOA 3C56A 3HTWA 4KWWA 1QHOA 4PMZA 1I1XA 1GKRA 1TV3A 4L4LA 3CYJA 4QQUA 1MW2A 3R0DA 4UFHA 5MF5A 5CZTA 2VHLA 4JQ1A 1C9DA 1TMQA 3IJ9A 1EH9A 1Q6QA 1N82A 2XFYA 4UTMA 3PPHA 3HA1A 5DMLA 4H2CA 1EOKA 1MDRA 2AGKA 2Z29A 1VCGA 5DELA 2R6OA 2C91A 4NAEB 3CTTA 4Q4SA 4H9MA 5L9FA 2ZRWA 4CNPA 3DHPA 2GQ3A 2FDMA 3BG9A 4D1JA 2WBKA 4LAUA 3W3OA 4Q7NA 3QTPA 3MMTA 4IL2A 4PGLA 1W56A 2Y89A 3U57A 1KR0A 3RXZA 1GQNA 3WQGA 1RLDA 1JCXA 2TRSA 2J7GA 4DZAA 3LLFA 1V3MA 2NXIA 3F4NA 2DT0A 5EFFA 1QBBA 1TX0A 3JW7A 5A6JA 3L5AA 1L2UA 3ISIX 3T1GA 1EDGA 1ISZA 3LGDA 3FOKA 4BEUA 2VVSA 3O1NA 4O1DA 2YCEA 3B40A 1N8WA 3QZ6A 3S2JA 2BHUA 1CPUA 3MDUA 3M64A 5EY5A 4B16A 3SUUA 3ARVA 1JG9A 4DWDA 1L8NA 4DJEA 1XCFA 3SY8A 1UMLA 4NSBA 4DWSD 3G1FA 1WDDA 1A5KC 1JPKA 4CN1A 2FB2A 1KV8A 1JCTA 3MSDA 3QPYA 4EP8C 2WQDA 3C2OA 1X1NA 3CAQA 4JIEA 3W7EA 1K8YA 2GK1B 4IQLA 1AL8A 3KHDA 2CFFA 4PUUA 3FJ4A 2OPJA 3S2MA 3UCQA 2PDBA 4B15A 1QWGA 3R13A 2XVPA 2IMRA 3S1UA 2ZC8A 3RX4A 1HT6A 1AUSL 2WMJA 2Y4SA 1QPQA 4AHOA 2Y8UA 4H8UA 2VFIA 4C6BA 1Z89A 4R9XA 5ABFA 3QH2A 4NZ5A 2GOKA 4GC4A 3KVMA 3UR7A 1FBAA 3QKZA 1Z8AA 1ZHAA 4BI7A 3W2MA 1KNWA 4H83A 3LRMA 3DGRA 6TIMA 4FOKA 3LN3A 3XIMA 1SM9A 4GINA 1LBMA 1R6WA 3VZZA 2HNEA 4MB3A 3WLQA 1NJJA 4ECLA 4F9DA 5CSYA 3AUJA 1A3WA 4HKPA 1UPMB 3M5ZA 2WZHA 1PUDA 4KEUA 1ME7A 4GKLA 3RPDA 3H7VA 3P0WA 4G9PA 4GGBA 1CGVA 2XGZA 3CUJA 2FGZA 4Q4KA 4H04A 2WBGA 2CBVA 1ZJBA 1IIHA 4NZJA 3BG5A 1GZ1A 2O92A 1S5NA 3UG8A 1V0KA 4XD5A 1IWAA 1FCQA 4HPHA 4C6CA 1Q7MA 3N2XA 2PPGA 1NOUA 4S1FA 3CMJA 1YXCA 2ISWA 3L4XA 1IHIA 5HNTA 2YDAA 3GG8A 1Q13A 1U30A 5LIYX 1BVNP 2XWDA 4IPIA 3CXOA 2DIEA 2C15A 3AIEA 3LPGA 1XQLA 2E6AA 4OECA 4A2SA 3ZM8A 1NY1A 4XISA 3E0IA 1LOQA 4PCSA 3G22A 1XD1A 2DUZA 3KBNA 3SEPA 2Z28A 1UG6A 3DN5A 4UQ9A 2NZLA 1M7JA 3CV6A 3EDEA 3E5PA 4WQ6A 2HMCA 1R0MA 3W7NA 4BF9A 3S4TA 2WB5A 2OLSA 1KM4A 3MP3A 3QR1A 3ZMRA 4IG2A 5BMWA 4JN7A 4H7ZA 3OHIA 5FEWA 4J7RA 4W89A 5FEPA 5JH1A 2DT2A 2E67A 5HBFA 1E6RA 4GACA 4GG9A 3T0BA 1ECEA 3VI2A 3VOHA 1Z44A 4O8AA 4F3HA 4ROPA 3TP4A 1ZAHA 3BJFA 1RHCA 3PWIA 1PKNA 1CI1A 1XIIA 1BRLA 4JIRA 1ZJIA 4XQ6A 1US2A 1UROA 4F2UA 4GNVA 1NARA 4NU7A 3BAXA 4LOCA 1F3WA 1IIGA 1QCWA 1HL2A 3WD2A 1E4MM 3A4AA 5EU9A 3AJXA 3Q45A 4D8AA 1G1YA 2BWGA 3TMQA 4JS3A 3ZXWA 2H9AA 1VFUA 3VCCA 2FHFA 2POZA 4RNHA 4LFYA 3H53A 5DCEA 1Z3NA 4HYRA 3NNTA 3AMDA 1KM2A 4XZBA 2NV1A 3GH5A 1GKPA 4GX8A 3LGGA 3EWWA 3T9PA 1XLHA 4H8VA 1KO0A 1GW9A 4M24A 1W1ZA 1PTGA 1VYSX 2QYGA 3BC9A 4QNEA 5D05A 5C71A 4DJDD 2Y8VA 2HXUA 2VFHA 4Z17A 2VEPA 4AY1A 1RAKA 2PP0A 3U9IA 2BXYA 1DQXA 4M6QA 1DXEA 2QLYA 1W3KA 1G4SA 3WEMA 2QULA 2O9RA 4A3RA 3A5FA 3DDMA 5TNVA 2WC4A 2Y8KA 4FHAA 3LCFA 2OX4A 2Q09A 4KBXA 2YCJA 3HJEA 2QPUA 4RDWA 3WH9A 1CBGA 3EMQA 1OX4A 3TQVA 2D0FA 1X97A 2E9MA 5J5RA 3IARA 3GNNA 4LUTB 4LANA 4FNSA 3F4WA 5I3HA 4C60A 4N9BA 4PZVA 1UWAA 3KM8A 3GAYA 1I2QA 3PHAA 2PDXA 2ZXDA 3N4EA 3LRLA 5ENLA 1TZ7A 3AHVA 2Y5JA 2DJXA 3TYBA 3T8QA 1X6UA 3ZJKA 1XPYA 2ZA1A 3HPZA 4K8GA 1DBTA 2WHJA 3E2SA 5A1AA 4HIBA 4OWGA 4B3ZA 4QAIA 2Z7GA 3BOXA 3VD4A 3AU6A 3LERA 1DJZA 3OGSA 4HMCA 3WQOA 4BI6A 1H51A 3UBPC 3QSRA 4PA8A 3FYPA 4Y2WA 1UR3M 3P8IA 1FKXA 3MDWA 5CPSA 3UT0A 4KGLA 2OZ3A 5KZDA 1HL8A 2W91A 4IZGA 2CHNA 3OB8A 7TAAA 2KX9A 1XH2A 4J2PA 4Z42C 1PDZA 1XW8A 2W92A 4CQDA 1L8PA 1ZB5A 1UZ4A 3UWQA 4A8NA 4HU8A 2D2HA 1GQJA 2FZMA 3NL2A 3R0UA 2PWVA 3WD3A 1GOQA 2RKXA 1AFSA 3GG0A 1THFD 5A3HA 4X22A 4XZMX 1RP9A 4QQ3A 1KLZA 1TV2A 4RPQA 1NAL1 2HSAA 2VX5A 3M5YA 1F76A 2AL2B 4C6KA 4LUSA 2CC0A 3DAQA 1VP5A 1TMLA 3O2LA 5BOOA 2AGTA 5E70A 1EIXA 2C19A 5EMLA 4LS1A 3VKCA 1W5QA 5GNXA 4AZ6A 3ECQA 1XBXA 2YFOA 1SYTA 1CLKA 4C90A 4Q8VA 3H2NA 4AUBA 4ZQNA 1JCLA 1PB0A 4YU1A 4IUOA 3ITYA 2BTMA 4JY8A 1SJDA 4L4PA 4N9EA 3D6NA 4WHBA 2E9BA 1LUCA 4HHHA 3RIKA 2XVLA 4JYDA 2FHCA 3RDKA 4CN4A 4NZ1A 5JBEA 3GIPA 3RF9A 1WV2A 2VR4A 3DKLA 3VE9A 4S2CA 3LB0A 2HEJA 3S2LA 1CXHA 2OWCA 1W91A 3S47A 3ENLA 2ZRZA 3T8LA 3KX6A 4WY0B 5XIMA 1FWTA 2HXTA 3NPWA 4RCXA 4IXXA 4UNIA 1RBAA 4IFRA 1L6YA 5LNWA 1R30A 1TWZA 1G69A 1W32A 2PWUA 1VHCA 1OX4B 4K7YA 5G4EA 4CN6A 3THAA 3UR8A 4KRUA 1AL7A 1LORA 4C6MA 4HPJA 4ZQPA 4A21A 3W7PA 1IXPA 4UTUA 3QRHA 1PVNA 1GHSA 2E5DA 3SURA 2FVKA 4S3CA 3NYZA 1TWSA 1WOAA 3DHDA 4PUDA 3GR8A 1QNQA 4QSHA 1GONA 3W2KA 3IPWA 1F4HA 3S5OA 3R2GA 4JCMA 4GIRA 2P3ZA 2FH6A 4IM4A 1XIJA 4HBKA 3LPFA 3EBVA 1J12A 3ZVHB 3WO8A 1KCLA 3F2CA 1CB2A 3NQEA 3HPFA 3EOUA 3XINA 2GJXB 3OTRA 1Q4WA 3TC6A 3FY1A 4F2TA 2WNWA 2Y5EA 1LBFA 5G5IA 2DSKA 4O1FA 1EGMA 1IEIA 4QNWA 4MGGA 1NELA 5IDZA 1PJ9A 3UPMA 1UD6A 1C7SA 1PYFA 4MWAE 4UMCA 4R27A 1UC4A 2DU2A 3MSRA 1A0CA 3P14A 4Z2IA 5SWUA 2ZRXA 3HOJA 1UR8A 3AIBA 3C3UA 3G18A 4O15A 1J5SA 1XSIA 3OA5A 2CBUA 1IEXA 3JU2A 3LMZA 1VAHA 2EHHA 3CV1A 3SY1A 1DPMA 4PB4A 2WWDA 4CD4A 2D3NA 1XYFA 5LHEA 5LA2A 4FX8A 3QGVA 3NCOA 4HZ6A 3KDOA 4AD4A 2DZAA 1OC6A 3CPUA 4TOQA 4XKMA 3AHZA 3N2BA 3KCOA 3RUBL 1YPXA 4J5NA 2WSPA 3COTA 4YN5A 2QZRA 3GIQA 4MKSA 4DLMA 1W3NA 1WXJA 1BF2A 5I79A 5AECA 4I3GA 3GBEA 1DL3A 1UUOA 4QROA 4C5YA 5F2IA 4QE5A 4QGCA 3VABA 1XLBA 1TPWA 2R1MA 5C7VA 1ZJHA 3CZEA 4IISA 5LKYA 3KBMA 5JH2A 4ORIA 5EPDA 4S3AA 3S5YA 1UKSA 1H7OA 1ZP3A 3L4YA 2E1DA 2GVLA 1O5RA 3GBDA 1CT5A 3W7MA 1TPEA 5C54A 3GFYA 1JF5A 3SN1A 2Q02A 5FKYA 4R9OA 3SN4A 4DBWA 1OVDA 4AHQA 4DO7A 4QBXA 1CIUA 3PBUA 4UQCA 1ZAJA 5AVNA 3VD3A 5LIWX 1NH6A 1Q45A 3LMYA 5A2AA 4B5UA 4IF2A 2GQAA 2YB1A 3QM3A 3DFYA 5BXRA 4KH2A 1EJWC 5C9UA 1JI1A 4CLMA 2TSYA 2E5BA 4O0QA 1JDCA 2PS2A 4ICCX 3LDVA 1D7FA 1ITXA 5HANA 5K9DA 1XG4A 1E72M 2FJKA 2WC3A 2C0AA 3A9BA 2FTWA 4IWWA 1LROA 4LBSA 1RCXB 1XCXA 3GK0A 4YWSA 1EPXA 5AN7A 4GUGA 3OBKA 4LBUA 1AH0A 1KA9F 3BDKA 4CGTA 2CYGA 4AZHA 3FV9A 5BRPA 3C6CA 4K36A 3CM4A 3UCDA 4UFIA 1IZJA 3NIYA 3M0HA 3S0CA 2XN1A 3MB9A 2X7VA 5CAHA 1GOKA 1ZFJA 3HG2A 4JIPA 1VJZA 3REQB 4IMDA 1XP3A 4AQLA 4RR4A 4JTUA 2E40A 2VELA 3O3RA 3WBXA 2QDDA 1GQIA 3IK4A 4D1IA 4I9AA 3VGGA 2YXGA 1EQCA 2WKLA 4M6UA 4PMVA 3TLQA 1UCWA 3MUAA 1S1PA 3RR4A 3V0SA 3N11A 6REQB 4M29A 3PG8A 2YDRA 4W87A 4O13A 2R1PA 2V8ZA 1P6WA 2VCAA 4H9UA 3WL0A 1CGUA 3WELA 3I6EA 1J9YA 3GYEA 4ZO7A 3VNYA 5CZ0A 2Z6JA 1W9BM 2E0PA 1MXSA 4G56A 1HO1A 3FVDA 3CUZA 5F1UA 3PUEA 2CITA 4H41A 4KWUA 3UQNA 8A3HA 5JVLA 1KBIA 5A6KA 3M0VA 1CGWA 4M8UA 4XBJA 1E0XA 1F7BA 3UWVA 1V6YA 7ODCA 1EBGA 5EA9A 3QPZA 3MT1A 5C9ZA 4B4HA 5BXSA 2WC7A 1E1FA 1FP9A 4WDTA 3P84A 5A2BA 2GSJA 1XL9A 4WOQA 1KTCA 2O9PA 2ZWZA 4M7SA 4DJEC 1HTIA 1XD0A 4LUJA 4UR8A 2W4XA 4XKYB 3QV9A 1EB3A 3T2QA 4Z1YA 2W3ZA 3S83A 3WF3A 3TQPA 1WE5A 3Q2DA 4NG3A 4UOJA 2VQTA 1H7WA 2GSHA 3UGVA 3BLEA 1EZWA 3KUMA 2ODOA 3N34A 3DESA 3WQFA 4C6IA 5DMYA 1V3JA 1TCMA 2PUZA 3EMCA 5G2HA 4LS2A 4J1OA 4GABA 2BZNA 4P8WA 3T4CA 3N4AA 3NO5A 1FWFC 7XIMA 1JAKA 1PX3A 3K13A 3VIFA 4KS0A 3TW7A 1BQGA 3C4UA 1VBHA 1O95A 2WJEA 2ZZ3A 1MI3A 1TFVA 4DI9A 4Y8EA 4B9ZA 1I45A 4GUJA 2Y61A 4WKFA 3FX4A 4LV4A 1LOSA 4R34A 1JF6A 3DI1A 3F4DA 5CPTA 3WL1A 2G4FA 1MW1A 4PTXA 2X0YA 1ADDA 3I7RA 3VAVA 2GLKA 1AD4A 3BLKA 1LWHA 1T40A 1B0IA 4X63A 2HCVA 2H90A 1W6TA 4UNLA 3TAOA 1ZCCA 3RPTA 3O0FA 3WKZA 1S2UA 2F2HA 3LLXA 3W1PA 5E6YA 5HQLA 2HE8A 3NPXA 4EX4A 1DHPA 3ALFA 4Z0JA 1XLLA 2YSWA 4JPGA 3RK8A 4TMBA 3WQ4A 5A8PA 3U2EA 1OK4A 3WCZA 3U4AA 3GU1A 4I5XA 4A4AA 1JZ6A 1WCGA 4WDXA 1LM1A 3MI6A 2QDEA 2QVNA 2YCKX 3QVQA 3SCRA 4Q32A 1VFTA 2Z1SA 2WAGA 5CZKA 5FF2A 4LCRA 4Y7EA 5FA5A 1M04A 3L2MA 3BARA 3L0GA 3ITXA 6PTDA 2HDJA 1SFLA 4I7WA 2QCLA 5BNKA 3OODA 3LOTA 5A8QA 2WOQA 4RW3A 4L6OA 5K9CA 1FP8A 2OMAA 2WPBA 3USZA 3F4CA 3W86A 3TR9A 4NVTA 5G2IA 1GNXA 2XN0A 3THUA 2Z26A 1A53A 2ISDA 3RMEA 2YDSA 3W81A 3LUTA 4O53A 5EKYA 6XIMA 2PB1A 3UR2A 3FA4A 1ZBKA 2FHBA 4IP7A 4W88A 1C8XA 5CPMA 3BAKA 1GOWA 2CLFA 3W6MA 2J74A 2GQ9A 1NQ6A 4MWAA 2C1GA 2FZ8A 3CNYA 3VUPA 4LBRA 3K46A 1YPFA 4IHCA 2PI6A 4S23A 2E9LA 3WK3A 4H6QA 2DY3A 4I6VA 2VFFA 3GFZA 4MJ4A 4AFYA 1GG0A 2DQXA 5BRBA 3E3HA 4Z1CA 1XV8A 3FIGA 5B7ZA 1VRXA 2G8ZA 2L5HA 4M81A 3CHEA 3QYQA 3EEZA 3TV8A 4JNYA 3KOWA 1TKKA 4TX9A 4JTTA 4IPPA 1HJQA 1QOXA 3CYVA 2X7WA 1KWKA 2NQJA 4QCEA 3MU7A 2FZ9A 1A5UA 1TPH1 3RMJA 3SCOA 4LJ3A 1EYWA 1EHNA 3BGGA 2VGIA 2WVVA 1S3TC 4NAFA 3M43A 4WKHA 1W3TA 3BMWA 2PZNA 1EFZA 1K7XA 1ALDA 4TXEA 2A5HA 2VGGA 5EFDA 3WLNA 3SSJA 4GD0A 4ALDA 1XUUA 4QJ3B 4FOUA 2QT3A 2Y7GA 5CSSA 1N8FA 2QV5A 3WNOA 3SRKA 4L56A 1UOKA 4MKVA 4ZQCA 4IIDA 2WVTA 1Q6RA 1V02E 1DJXA 1FOBA 4Z2GA 1GEHA 2DUAA 1NOFA 1PX4A 4UQEA 3T0AA 2PDNA 1L6SA 4C6OA 3DC8A 3WDIA 2RDUA 2A3EA 1YIXA 1QI0A 1MXGA 1WOBA 2O4MA 3N73A 3PZUA 5I24A 3PK7A 4J9JA 4OBSA 4DO6A 2ZBTA 2ZIDA 4B90A 1XYMA 1TQXA 1CDGA 4XSMA 1FRBA 1PV8A 1MYRA 3O16A 5FL1A 1E1EA 4KIRA 1GW1A 1Q7QA 3RM4A 3NFUA 2R24A 5IXEA 3OQ8A 3W75A 1Z42A 2PWGA 4JIQA 3LHZA 2YDQA 2DV0A 2XH7A 3WK2A 2VR2A 3CAVA 3G0UA 3VIOA 4A35A 1GVFA 1KFEA 2V2HA 2J7CA 5BU9A 3BG3A 4JOMA 1H62A 4PYSA 2BGSA 3S3GA 2V2CA 3SB0A 2H8XA 1QNOA 2BMBA 4F79A 2Z2UA 3BZGA 4H7VA 1OD8A 3EDFA 4Q4RA 2ZX7A 1VFMA 3PP7A 2QCDA 1W3LA 1ZCOA 2XIBA 2VR5A 4KERA 1TR1A 2Y63A 4P7RA 4U3CA 4L1GA 4W86A 3AZTA 1DWIM 2W5FA 1KFJA 5JIWA 2ESCA 2Y6ZA 1FWAC 2I57A 3MUIA 2WANA 2ANUA 1UZ1A 1MZHA 2HBXA 3PBWA 2QUMA 1I1WA 3STGA 3M46A 1GOXA 2QCCA 2J27A 3FGCA 1TJRA 2P8CA 2INEA 4OV9A 1J4EA 3EPMA 3RGTA 5HWJA 4MB4A 1KFLA 3R4IA 1H1ZA 2QIWA 5CKSA 5DCDA 1RJPA 4NX0A 3QHOA 5MHBA 6CGTA 4TVCA 3M1ZA 4JTIA 1JUBA 1V79A 4HQVA 2QS8A 2BXZA 2HS8A 1K9DA 1SW0A 4AD2A 3FNDA 3IUDA 3LS9A 2WVVB 4WJEA 1B54A 5CSUA 4M80A 1IV8A 3CLWA 4IMAA 1DJGA 4O11A 3NPVA 3GUWA 3THCA 1U22A 4NL1A 3P5YA 3F5LA 5H91A 1UKOA 2NT1A 1P48A 2YA0A 4N9DA 4RZ5A 4AZBA 2VC5A 3N2OA 1YXYA 4E8GA 4C1LA 2YYTA 2ZTJA 4JTRA 1CX9A 3W7OA 2OEMA 3B9NA 4ZMGA 4P8UA 4N0RA 3W88A 1WZMA 3SJNA 1K3UA 4PC8A 3QFEA 4CD6A 1RALA 1E1CA 2C7FA 3LNMA 2X2YA 4K37A 4JIIX 5A6BA 2JALA 2DORA 4YPJA 3OBAA 4IJBA 4Z2LA 5JBFA 2PDWA 1WDSA 1QAPA 1H1YA 3TWBA 1JNEA 4O18A 1REQA 2H3BA 2OVLA 3N17A 2J9ZA 1KW1A 3U5UA 4MY9A 3GDMA 5FIPA 5DEZA 4EWJA 5H2ZA 1ZRQA 5JU6A 3VC5A 3OBEA 5D8ZA 1AW1A 3HIJA 4QE4A 3P8JA 4O28A 5HR6A 1M9HA 4PTNA 1RD5A 3BOFA 1UR0A 4UMAA 1KCXA 4E4PA 3ZLHA 4Q8TA 4GIYA 5FD0A 4AHPA 4DN1A 5H6HA 3AXHA 1UKPA 3NWRA 3CLMA 3VIJA 1BGAA 1RQHA 2NW0A 4GYPA 1IEWA 1K02A 4W8AA 1AJ2A 1AK5A 4EAYA 3QTGA 4IT1A 4XAZA 5JIPA 3IAPA 1R9YA 4H00A 4P7NA 2J8FA 5FJIA 2FPYA 3MVTA 4JFTA 4DPQA 2WZEA 1ZBWA 1Y5WA 4B92A 1OIMA 4DBSA 3NGJA 2F6XA 1OB0A 3ANVA 1FFRA 1HIZA 3VPLA 1DTNA 1W5NA 4ML4A 3WJYA 2X1SA 1YDOA 1P7TB 4HPNA 2G3NA 3WJXA 5BROA 5FCZA 3KHJA 1GHRA 2HQAA 4H9YA 4XUYA 3VKAA 2DP3A 3DOPA 2JKAA 1EXPA 1BQCA 1JI2A 3PWAA 5CLWA 1E0UA 4DUOA 1T0OA 2VZOA 2YZ5A 4Q7IA 1SQ7A 5KZMA 1X8CA 3JVAA 1TIWA 1XLCA 3M6YA 3SN0A 2YGYA 2YR1A 3WJWA 4LQ1A 1FH9A 5CH9A 1XBYA 1RVGA 3V4BA 1P1MA 3PPCA 5F4SA 3A13A 1UH2A 4PTMA 5D32A 3K8MA 3HV8A 1C8QA 3RG6A 4EOUA 1OEPA 1XLDA 5HINA 1OX6A 4M5PA 1FXQA 3UGRA 2OQHA 1RZMA 4FX7A 4ZODA 2NVAA 3VCNA 5F7UA 3GG1A 2V5LA 2PLJA 3B9EA 4HPGA 2ZVIA 3UWWA 2CESA 3PPFA 3W25A 1H7XA 4O19A 3I3BA 5FL0A 2GSEA 4JR5A 4O16A 4UFKA 1TWWA 1QI4A 2OO0A 1ICQA 1A80A 3W1UA 1DJYA 3AXKA 2B7NA 3W1MA 1IT8A 1OCQA 1GVEA 4GQQA 1JUEA 3N9KA 1V02A 1UHVA 4W85A 2W62A 4FP1A 3H8AA 3SAZA 5HUPA 3TN5A 5FAGA 4I8DA 3UWZA 3L5MA 2HPMA 3T2PA 2FPTA 2IXVA 2YL5A 2EPLX 1C8VA 3APGA 4AIUA 1VFOA 4X61A 2VQUA 1OJXA 2XINA 3NAVA 1QJWA 2HJPA 3TYCA 1M53A 3W29A 2QNEA 1FH8A 2O4QA 3G1AA 4R7JA 3BSMA 4REQA 4HMDA 3HO8A 3RU6A 1BKSA 1UP3A 1WXYA 4DYJA 1UUMA 3APYA 2DVUA 4DF0A 3SUTA 2Z24A 1JZ2A 2ZRUA 1OD0A 4HNCA 3K5XA 4XUGA 1BSIA 2EQDA 3THQA 4HSOA 1CZ1A 2W61A 5M1TA 4DPPA 3BMXA 3TFCA 1MSSA 3BE7A 1SO6A 3NQFA 2IQ0A 4KWOA 4JY9A 4U5KA 3W53A 4AVNA 2WYSA 4O14A 3H2CA 1K1DA 3WQCA 3T4WA 3B97A 2CZFA 4NUWA 5I02A 3NM1A 3WF4A 1WZAA 3H4XA 2A7RA 1JCNA 1DJQA 3GXMA 4ZFCA 3M0XA 5KSWA 2ZZ6A 4KCTA 3R94A 5I77A 3KVLA 3RRAA 4B5WA 2J24A 4XAFA 2JGQA 1Q6GA 2PDKA 1RY0A 1TJ0A 2CWNA 1UJQA 4Z2KA 3M0LA 4ZQOA 5B80A 3LSBA 2XPKA 3B8IA 4BQ5A 1V3LA 1W3IA 3PS7A 2EG7A 2PC4A 3NPUA 1DIKA 3DH7A 3ZT7A 4QXIA 2V3GA 4W84A 2YYUA 2PGRA 3H2EA 5D2WA 3MSGA 3S1VA 2WMIB 2RDWA 1DWFM 3SFKA 4BKNA 4YIWA 1E5JA 4FAMA 3ZSTA 3FAWA 3G1DA 3LCWA 3GVGA 1BSLA 4RE3A 3ARSA 2Y2WA 4PH6A 1QPNA 4UTHA 5GJPA 5LZLA 2BY2A 1OADA 2YLAA 4GOAA 4R3UA 4C6DA 3VMOA 2ZZ7A 2BVYA 1B31A 4YTTA 3ZLFA 4M6PA 3VOJA 4IMEA 3MBDA 4B2DD 3WBAA 1DIEA 3LRKA 4HP5A 3W7CA 2BOFX 3CEUA 5C9XA 3HG5A 2PF0A 3W2UA 4E3TA 4DIAA 1WO2A 2EXOA 3JUGA 2IKJA 4JQ3A 1RK6A 2CZVA 2QUVA 5A69A 1XYCA 2VYOA 3EPNA 5IFTA 5DY2A 4IIHA 3B9OA 3TYZA 3O7UA 3THDA 4ZBCA 1DJIA 4Y6GA 3PULA 4IFKB 2PGFA 4Q6JA 5E5CA 2Z27A 3M7WA 3C2FA 1AH4A 4RXGA 3SGUA 3ZQ9A 2GJLA 1UR2A 3RR1A 3NVDA 5CBBA 5REQA 2VNCA 1PIFA 4DM1A 3SO7A 2OQYA 1K4HA 4E38A 5PTDA 1QVBA 1VFFA 4HZ7A 3KLKA 4DUWA 4NASA 3AICA 1KBLA 1RSCA 4XTIA 4MKNA 2Q8XA 3OJGA 3HBLA 3PTMA 2J7FA 4K8HA 2NXGA 1ZJAA 2IUZA 2QXWA 2DDXA 4AY8A 2JEQA 3BCDA 5T9CE 4US6A 1VBRA 3GO2A 1XGDA 2ZTKA 4C6QA 1TTIA 2YBTA 4KW2A 1F3TA 1O60A 3NQVA 2X16A 1V5XA 4JTEA 1FWNA 4GYFA 2DZBA 3SQSA 1TQJA 4OE7A 5DRCA 2G95A 1XLKA 4L7ZA 3W02A 1TUFA 4D6IA 3FYOA 1PKMA 3SUVA 4ZENA 1TELA 3FEQA 4J3WA 2VZSA 2A3CA 2ALDA 4LVGA 3U7BA 2QF7A 3UA4A 2KZHA 3SCTA 3UU0A 1V08A 5BWFA 1PSCA 4CNSA 1YDVA 3G0SA 4D6EA 4MLRA 3AALA 5DF0A 4MWAC 2CLLA 1BFNA 1F73A 4WX2A 1E0VA 4EKJA 2A0NA 2C18A 3VVGA 2NSXA 5BOEA 3IJIA 2OSXA 4I7UA 3CBWA 3KBWA 4WKAA 2QCHA 3EB2A 5C70A 1JZ8A 4AEFA 1VYPX 4UFJA 1SJBA 3B8TA 3PB2A 3FYYA 3B9DA 3G24A 3SIZA 1Q2SA 1XKJA 3MW7A 3ONBA 1X1ZA 4XO7A 3EOEA 2QJHA 1AJ0A 2Q8LA 2HVOA 2VURA 3EPOA 4PEEA 4U3AA 4GFIA 2GDVA 1ELSA 1UPPA 2BSLA 3NL6A 2WNNA 2NX1A 2ZUNA 2HZGA 3NQ2A 4G6CA 4Q33A 3QHMA 4FK9A 4S3FA 4C1NB 2HRWA 1TPFA 4QS5A 1HJSA 3S46A 4M19A 1AZ1A 4AB4A 4GUFA 4ADTA 1NDZA 5F4WA 1A4MA 2MNRA 2WSQA 2REQB 4N4PA 4O4VA 3U4FA 5BCAA 4EK7A 3E9AA 4LVBA 4GZJA 1OFEA 1CB7B 1M5WA 1H49A 2ISVA 3WDRA 4WUIA 4LVFA 5A8GA 5AC7A 3GHUA 1JYVA 3BSGA 3IUHA 4CQ9A 3CQKA 1NVMA 2GUUA 4UQAA 4AF0B 4LF2A 1RR2A 1KB3A 1Q5MA 1DKWA 2YKKA 1KBJA 3KOYA 3ZR4A 3C5QA 1UWIA 4WSJA 2EAWA 3GC5A 2XISA 2X2GA 4NJGA 5REQB 3USBA 5A6BD 4QRNA 3H7RA 4JEJA 1XBZA 1SPQA 1SZGA 3BMVA 3C0JA 3R8RA 4GY7A 3GZ3A 5AYBA 1R2SA 3A12A 3UZZA 3CUHA 1YMYA 3PFMA 1GWJA 4OIFA 4GY1A 3BANA 1AH3A 3GS6A 1VZWA 3MV11 2DZSA 2J75A 3TXZA 3PJXA 1F9CA 4F4RA 1C90A 1LJYA 1QHZA 3E49A 3HGRA 3EA2A 2TAAA 4XBSA 2QJJA 3L12A 1W1B1 4GVIA 4IX2A 2NWRA 2Z1KA 2XWEA 1R86A 2OJPA 3CZGA 1VD6A 4MB5A 2YCIX 3TH6A 1SO5A 3WD1A 3NZRA 7REQB 1OCBA 1V4YA 4KWSA 1XLFA 4LVDA 5GPRA 4UB9A 3GH4A 3ANUA 3W83A 1KR1A 1OF8A 3MVIA 5FJOA 3GIYA 1OSEA 5LGZA 3O6YX 3UEQA 3NO1A 4L61A 3VX0A 1JNDA 1OWQA 2WNZA 4NNCA 1LYXA 2V5KA 1P0NA 4G1NA 3WLTA 2TMDA 4GE8A 3BCFA 1YW1A 5DLCA 5ABHA 2XTKA 3PBMA 4YVPA 4A3UA 1UKQA 4GIEA 4JTFA 2BLEA 2WWCA 2ZCGA 3AMKA 2VL4A 3LM3A 3MI3A 3WFAA 5M5DA 4AYGA 3H2MA 3CIVA 2OGJA 4FXJA 4MZYA 4C7GA 2J8TA 3PZNA 4W5UA 5AHIA 3EXTA 1VIZA 4IJCA 5TIMA 3B8SA 3U2ZA 1UP2A 3MPGA 1J18A 3KLLA 4PE8A 4O0KA 2CU0A 3OGRA 3IV3A 3P60A 4W93A 5D4YA 2YPIA 2E77A 3BAJA 3EEGA 4G1KA 1TTJA 1WP6A 3GNOA 3IWPA 3S9YA 3II1A 2DIKA 2WZMA 3UPWA 5CJMA 3N9RA 4R7OA 1NIUA 4JDYA 5HULA 1TZ9A 3M0IA 3W70A 4TX6A 4XZNX 1HXJA 1W5MA 1YBQA 4QJ4B 3LENA 4A3HA 3N04A 5LYRA 3W1TA 3OYZA 1JRCA 3MQTA 2YFNA 3VMPA 2G50A 1XGEA 2W9MA 1H50A 3ELFA 4UQBA 2ZICA 5A8NA 1YRRA 2P0OA 3FVMA 1Q8AA 3TCSA 1RCOB 2CZEA 1PZ3A 2FMNA 2Y88A 1EKOA 1Q6DA 4R53A 3QV8A 3CJPA 3WEZA 3ICJA 5G2WA 1DJWA 4KGJA 4HYVA 2PF8A 3VKDA 2PDUA 4FEZA 2Z2BA 2YW3A 3DU0A 4XIAA 4PULA 3RCMA 1G4PA 3VOIA 3LSCA 1EF3A 3UWUA 3DG6A 5GJMA 4PEKA 3VNDA 4INFA 1BWKA 1Y8BA 2CW6A 1W3HA 1O7AA 2DFAA 4XB3A 1XISA 1GOOA 3TQ0A 3INPA 3S5SA 3AXMA 1B57A 3WDPP 2DZXA 1XLEA 6A3HA 3V5CA 3MUXA 3CS2A 4LVAA 5LGXA 2VRKA 3QN3A 4JD4A 4GMEA 1LT8A 3CK5A 1FQ0A 1EIBA 3WH8A 4DX3A 3IRSA 2XU2A 4PR4A 1TWIA 1ZY9A 4H6RA 1V6WA 3LCGA 1TTQA 3V35A 1UR1A 4CD5A 1MDLA 5I3GA 4UXDA 5FJRA 4O1EA 1O68A 2Q3RA 3IJDA 4GYPC 1FWSA 2OCZA 3QY6A 1H4PA 1PIGA 1TPVA 4Y9PA 3ZVIA 3PANA 3O0KA 4DXVA 1QRQA 3PJWA 1V6VA 1F5ZA 4AZGA 5A6MA 1J2BA 1B3YA 1H3GA 2PZ0A 2JK2A 4I7VA 4W9TA 1NWTA 3CB3A 3DHFA 4GH1A 4AZ5A 4N7QA 4LYQA 1M41A 1LTDA 1FKWA 1GTHA 1VPXA 3B3DA 4F40A 3EB4A 2R1NA 4C7DA 1CYGA 4XAPA 3ZZ1A 3CT7A 5GNYA 1QR7A 3H24A 3K4WA 3IVUA 1L2QA 3G77A 2DZWA 3L68A 3XISA 3IVTA 4OV4A 3KS6A 3TE9A 3W72A 3BGJA 2VMFA 1A5MC 1F8MA 2QR6A 3KXQA 4Z1BA 2A6LA 4JXCA 2QPSA 2P5NA 3PUOA 1XBVA 3SJ3A 4PN2A 4O57A 3VNKA 3POCA 1U5HA 3GLCA 4A8IA 5EMJA 3LCXA 3PN8A 1O12A 4GUIA 3M07A 4X9SA 5I3DA 3AUOA 2GGIA 2X30A 4QR6A 2YIHA 4QM1A 4UNKA 1I0BA 2UZ9A 4YXGA 3EYPA 4V2XA 4LU0A 3WUGA 4GISA 4EF8A 4X0VA 3C2EA 1R2TA 1FWBC 3CWNA 1NFPA 2EPKX 1QWKA 2PRMA 2ZWYA 2PDIA 1TREA 1D2KA 1FWHC 4FR1A 5CQ1A 4YTUA 2DH3A 3TYDA 1Q63A 2DSWA 2PD9A 3W2NA 2CHOA 3OHMB 3LBOA 4J3ZA 4KCUA 3IJ8A 1XIHA 2D2JA 1PXGA 1BYBA 4TR9A 3O05A 4F2BA 1EJSC 4FS9A 3WLMA 2PWFA 2FH8A 2HROA 2BHZA 1JL8A 4AG0A 4KT2A 2E28A 4DJFA 3CU2A 1XCWA 3GZAA 3HB9A 4LS0A 1XRFA 4HD5A 4O12A 3V1HA 1ITCA 2JKEA 3PF3A 4CKQA 3C0SA 3W7KA 5D09A 3N6QA 1DE6A 4NX5A 3CL7A 1DIOA 3ITVA 4F0SA 1H09A 3I68A 3VMNA 2GVYA 5HAOA 5EYWA 3N1AA 3L4VA 3V7PA 2I17A 3VGEA 1E71M 3LHTA 3NSMA 4FLQA 4EANA 1YTDA 4ZXLA 1R87A 2YCLA 1TPUA 3HQ1A 2QUTA 2J6VA 2GQ8A 3G8RA 1HVQA 4XWUA 1MEWA 2FLIA 3ES8A 3V36A 1KRCC 3C3NA 2P53A 2Y1HA 3CZ8A 3UP8A 2E25A 3G2GA 1N8IA 3NQ6A 4Z1DA 4ZSUA 1E55A 4Q22A 5E0CA 2RJGA 4LAMA 3LHVA 2FVLA 3W7IA 1GG1A 1TIMA 2DSZA 2CZDA 4DAIA 1UH3A 1Z48A 4CCZA 4AVOA 4DLFA 5KITA 3VIKA 1E4LA 1U2YA 3MUZ1 2WHMA 3PY2A 5AYIA 4H4IA 3CH0A 4LT9A 4AD5A 3W76A 5K7JA 4YHGA 3WFZA 3ARUA 1AMYA 4GBUA 5CC7A 4XG1A 4Q8UA 3DFNA 4O10A 4XV0A 2E8YA 3G1RA 2ABAA 2B7QA 3HGOA 4JTGA 1T99A 1K8XA 1M7XA 3W73A 1H63A 4YYCA 4ICMA 4HA0A 5FJJA 2J6XA 1P0KA 3H12A 2RGMA 1WXZA 4JKLA 5KTLA 4UMBA 4I9MA 4J3VA 5FF0A 3NJ3A 2VFGA 1LDCA 4GLEA 1MEIA 1AQHA 1BPLB 4BR1A 3VFLA 3BAIA 1EP1A 1PHQA 5CPNA 3DFPA 4G7EA 3IJ7A 4GIAA 3KBJA 4CCDA 3W28A 1IEQA 4KRTA 3WQEA 2QEZA 2Q71A 4E2BA 5GVJA 4MZ8A 3TUUA 3N4FA 3FKRA 5AHLA 1JPMA 3H21A 3VGFA 3MHFA 3OZPA 4W4QA 1FWDC 1JQVA 4K38A 5DMMA 1WZKA 4BJHA 4AH7A 4IICA 5K4XA 4CD7A 4I6KA 3I7SA 1FDJA 4AIBA 1ITUA 4LALA 1EP3A 3L23A 1ONWA 2QCNA 4DZ5A 4LYPA 4GI6A 3S1WA 2FFIA 2ACQA 3UZXA 2JIEA 5AHNA 2GJPA 1VCVA 1K7FA 1OGGA 2J88A 3VINA 1RCQA 4DUVA 3BJTA 2WHLA 1HP4A 4HA3A 2WM0A 2WZTA 3OP2A 3MCOA 1EC7A 4AIEA 4H3DA 4Q4QA 1G94A 2V6AA 5CPOA 3QYSA 4ZB2A 3PAOA 5RUBA 1KKOA 4D6JA 2VX4A 1RK5A 4DXXA 1JRBA 1VCFA 2VEGA 2CPUA 4AIOA 1BGGA 2YA2A 4XK2A 3W01A 1QUMA 3GTHA 1O5KA 1VENA 1OC7A 4JTDA 4QEEA 3BJSA 2GL5A 4RJEA 2BY3A 1D8WA 1GQLA 3AHTA 1AODA 2X1IA 4C6NA 2Z6IA 4H9VA 1SUXA 4C65A 4QLJA 5XINA 1BAGA 4ZGYA 1TA3A 3UWYA 5D9MA 2OOGA 4FNTA 1QPRA 5LA0A 3O9NA 2VKZG 1J2WA 3GDKA 1TG7A 5AKQA 3PZGA 4L5ZA 1Z9AA 3HMCA 5LXXA 5AYYA 1ODUA 3LGEA 3W27A 3I3DA 3S42A 1VPQA 1Q8JA 4DB7A 1KTBA 1H0IA 1ZP4A 3KVJA 3UJ2A 1A5OC 2TPSA 3UJFA 2J13A 1XICA 1XHGA 4E5TA 3EDJA 2HVMA 3WBEA 4IP4A 2OR2A 3H26A 4HMEA 4GQRA 3J7HA 3VYLA 4DVOA 3LCLA 4LUIA 4XX6A 3ZIZA 4IIBA 1JXJA 1R9ZA 4QG6A 5AB3A 2R1LA 1BYAA 5KZEA 3VNMA 3TSMA 1YXDA 4AZCA 2D3LA 3TDFA 1LCOA 3Q65A 3U48A 3QY7A 4RNFA 1LL7A 1A5SA 4RXFA 5CC3A 4XBKA 2IW0A 2I5GA 4WEVX 3BGAA 3UVAA 1E9YB 3BAWA 3PBVA 4JFUA 2VDIA 3LQLA 4HSHA 2V67A 3TJ4A 1T96A 4B5TA 1B2YA 1ISXA 4H7CA 1PO9A 2FMOA 3W1AA 2DVTA 2QIIA 1E70M 4EXQA 1U83A 3TKFA 1PEZA 7TIMA 3ARTA 4JN6A 3B05A 1B3XA 2SFPA 4F0HA 3MA8A 5F2MA 4GNKB 2A85A 1QO2A 2F6UA 4CNOA 4X3ZA 1BXBA 2GJNA 3TROA 4U28A 1H41A 1FH7A 1UASA 1ADOA 1NQKA 5K4ZA 2GJRA 2VEIA 3IIXA 1VRDA 1Q6LA 2FZBA 2CLIA 1E9IA 5FJPA 4V28A 4HNOA 5CGTA 1CTNA 3IIOA 4BY3A 2WVSA 1UBPC 1IGWA 4JTKA 3SCPA 1U1JA 4B91A 3SDOA 3EKZA 3OZOA 4GX9A 4UTTA 2G0WA 3E38A 3GTNA 3W82A 2JIWA 4P7QA 2HVNA 5D2YA 5K9XA 5CG7A 3R8HA 3LTPA 1E0WA 3WLKX 5I00A 3TNBA 1XRVA 5TF0A 2X41A 2DZVA 4HCHA 3KL0A 3WQ6A 3BQ6A 1TPDA 3W7GA 1OYAA 2Z25A 3FAXA 4AW7A 4B9YA 2DQWA 4KEMA 3STPA 2D22A 4ZO8A 4KFNA 1CLVA 2VRJA 2VJXA 3OLEA 1Q6OA 2CLKA 3IEBA 5I3IA 1EX1A 4DRSA 4FIRA 3SFWA 5T8GA 3P3BA 2XGBA 3A3HA 1GJPA 4LXFA 3CPGA 1LQAA 1NFBA 3N25A 3E0LA 4IMFA 5F2GA 3NO3A 5HOSA 2XIOA 2ZUWA 3DFOA 1OF6A 1Q6CA 4IPLA 3A22A 3R89A 4UQDA 5A95A 3CZLA 1JYXA 2NQLA 1R46A 1K70A 2H6RA 3GVVA 3IIPA 1UD4A 4FLSA 4G2DA 1OCNA 1JZ3A 3W37A 1JCYA 3W7QA 1QK2A 3GC4A 1CCWB 2X1RA 3AXXA 1R2RA 3LV6A 1F05A 2OZTA 1O6IA 5K2ZA 4QISA 3N19B 3QY8A 2J62A 2NWSA 3GG7A 4OBTA 3LG3A 2BBFA 1ITQA 2A3LA 2VVNA 4CQ8A 3QV7A 1UH4A 1LWIA 5G1YA 4IX0A 2QJNA 3N2MA 1Q7ZA 5ABFB 2H3DA 4HNTA 4F0KA 3N14A 5LNVA 2NQHA 3H4GA 1IYXA 2G3IA 4LNCA 4J2MA 3NQAA 1W8GA 2B7PA 3G3MA 2A2IA 3L67A 2E3ZA 1O1HA 4NXKA 4PFHA 4KEZA 1NTHA 1ISWA 1ZUAX 5CPLA 3O8AA 2V81A 4HMNA 2P8BA 4LSBA 3HPSA 2V5JA 5LNSA 2PURA 2QVHA 4UTKA 5EMYA 2W79A 2PLMA 2EPNA 3AIVA 4URIA 3LV5A 3OO2A 4ZR8A 2FB3A 3T55A 3OVGA 1GZJA 3N3MA 2A21A 2Z1VA 3WX7A 4GZEA 4OQVA 1E4NA 4S3EA 4QDWA 3GSMA 5BXTA 4NYYA 1R47A 2R91A 3BW3A 4XD6A 2DZTA 2F6KA 2VX7A 2ATSA 4PUNA 1OIFA 4ZE4A 4WDWA 3GVWA 2QW5A 3KOFA 3TQKA 3UPBA 1FA2A 1IXOA 3G1HA 1S2CA 4E2OA 4JTQA 3M41A 4PRTA 3EDDA 3BOLA 3FSUA 2OEJA 2PDYA 2QCMA 3QOKA 1ME9A 3VOCA 3FHAA 5HJYA 1AVAA 3TAKA 2ZFAA 1WYIA 1K6AA 3M47A 4P5UA 4IG2B 2UY3A 1PTDA 3G6LA 3TZNA 4GVGA 4FA3A 4H8NA 2YLLA 1WAUA 1O94A 2CKSA 5GJNA 4A05A 3QHNA 4FF5A 1MNSA 3SBFA 1T6MA 2V3FA 4PCTA 3QFWA 3DXIA 2PTYA 1UZHA 1E40A 4U2ZA 3L66A 1Y5XA 1YADA 2INZA 2TODA 1I4NA 4S3GA 1BRLB 3RX2A 2J7EA 1FWRA 2IKIA 2Z7KA 3MWAA 3P80A 3KTSA 3I6TA 4ZQMA 5BWAA 4JFWA 2YZRA 4YNGA 3AQUA 3WLRA 5BXPA 1QHPA 3LXBA 2OB3A 1A5BA 1VYRA 3NDZA 4OOZA 1Z69A 2E6DA 1ZLPA 2OYMA 3LEPA 3E2RA 5HPCA 2ZKMX 3HFTA 4OT7A 4LF1A 4HHLA 1X7FA 3W2LA 2H9AB 3W07A 4E3VA 4QJ5B 3ZT5A 2GGGA 3IIZA 3IK2A 3TW9A 2ZRVA 3WLHA 1DEDA 1YHTA 5HMSA 4K2SA 2PU1A 1PPIA 4CVWA 3ES7A 1S46A 4GRSA 1VPYA 3BSHA 5T26A 1T8XA 3WQVA 1EDQA 1C8YA 1ZS2A 4O1CA 2WSKA 3QF0A 4Q4PA 3CTLA 5CSRA 1P6BA 5HR7A 1HJXA 2A7PA 1XWYA 4FXFA 1QT1A 5AOUA 2B0MA 3E2VA 2ZX9A 4PMRA 3ATYA 4DZHA 3WNMA 1R8LA 1P5BA 1B5TA 4YCPA 3CV2A 5E0KA 1RJRA 1BWLA 1A0DA 1HGYA 4NJKA 2V5BA 4CNUA 4WZHA 1E73M 4AWUA 4P8VA 2P3EA 4J3SA 2P1FA 1IWPA 4N6EA 3EWDA 3WH6A 1LQ0A 4D6HA 1WDRA 3H6OA 2QJIA 3TOYA 1JR1A 3ITGA 1F4AA 1AA1B 5FJTA 1EEPA 1OM0A 3G6MA 1TE1A 1ZU8A 3T0DA 4DO4A 1SW7A 2Z1XA 3K8KA 1E15A 1A4LA 5M3WA 4H19A 3WLLA 2NT0A 3BWWA 2ZA3A 4IUGA 2I5QA 1QW9A 3PTQA 1W2PA 2DEPA 1KLYA 2CLEA 3VDCA 1S1RA 3L5LA 1J6PA 1RJQA 2XFRA 2J8GA 4PTVA 4WJXA 1CECA 3FEMA 4GJJA 4Q8OA 3CMFA 4PCNA 1JGIA 1D3CA 2F61A 2VD9A 1WA3A 4GZ7A 3QZEA 3ANYA 2WCGA 3WMCA 2UWFA 1UD2A 3HQOA 1L0PA 3BZJA 3EOSA 4HK6A 4JL2A 3V0TA 4BFAA 3S6DA 1XX1A 1V8EA 4I90A 2E09A 2WO5A 3MS8A 1JXKA 4OU1A 3KDNA 4ZTYA 3U5YA 4HJFA 4OVXA 1Q3NA 3KEHA 3EOLA 4DJFC 3KS5A 3GDRA 4H9ZA 3WF1A 4PMNA 1JCJA 2V5DA 1J96A 3A4WA 3MYPA 1XRTA 3M5VA 4D6GA 3ZR6A 5JXQA 3P0XA 4J40A 3VM5A 5H8UA 1I9CB 3CUFA 4QDMA 2VOMA 1W54A 2NLYA 3NR0A 3VFCA 2DT3A 4JCLA 4C5ZA 1VB9A 3LY0A 3K8LA 2OZ8A 3T07A 1V93A 2AAMA 1G5AA 3TSBA 2X0HA 5K3VA 3NUKA 3CC1A 5C2XA 4WSHA 4ZQRA 3RYSA 2C3ZA 1DTUA 2QMJA 2YJQA 1S3HA 2OQLA 4LUSB 3SCUA 1IXNA 5LSMA 3W22A 5FSDC 4FI4A 4MNJA 5IBXA 2F9RA 1T5AA 3NQGA 4Q6XA 5DT5A 3AS3A 1W9DM 1FDZA 1XYBA 2ICSA 3N9SA 1KC7A 3DUGA 3RPMA 4ZVJA 2WLZA 3UG3A 4OZOA 2OGYA 5IDIA 4JN8A 3WIJA 4MAZA 1RV8A 3CHFA 2I14A 3C2YA 4RNJA 2PWEA 3BV7A 3QMTA 2GDUA 3EXRA 5G4HC 5MKGA 1SSGA 5G1MA 5I06A 1YX1A 3EMZA 4AWEA 1LUCB 1Q65A 1B1YA 2RUSA 2ZUMA 2QUUA 2PODA 1KGUA 1YEYA 1J0ZA 1TYGA 1K8ZA 4WCJA 4DJED 4BQ2A 4DZIA 1MMFA 1MRQA 3CMGA 4E4FA 3QR0A 3URQA 1EQPA 4DJDA 5AYZA 5I0DA 2CERA 4ERAA 3RU8X 5D2VA 5E93A 2C79A 2ADAA 1F3EA 3LCHA 4ATDA 3U8GA 3WLPA 1TRIA 4JX6A 1M7PA 4V1XA 2PCQA 4DNMA 4RNIA 3IRDA 3PZVA 4GWEA 1XFBA 3IGHX 3PM6A 1M01A 3QEZA 3TSDA 1I8JA 3A64A 3UA3A 5EMUA 3L4ZA 5CZSA 5JBDA 2V0TA 5HWNA 3TC3A 1EX5A 3KRUA 4IPNB 1QOPA 2DPEA 3H54A 4TX8A 4MNMA 1O1ZA 2C0HA 2RDXA 2HPIA 2DSUA 2QPXA 3LTYA 1FWEC 3VXGA 1SZNA 1LL4A 1W0MA 4IH3A 4N42A 4UTFA 4L1WA 2CXEA 2VFEA 1JYWA 1F6KA 3ITTA 1Z6KA 1E3XA 2PRHA 1WBJA 4CNNA 3TR2A 1MZRA 2VCCA 4YVVA 2VC9A 2VP8A 1K9FA 4M82A 4BA0A 1W5PA 3WENA 3L7RA 2DZUA 5CC6A 2CLMA 4HHMA 2NUYA 3SUSA 3O6CA 1A0EA 2EJAA 1SFJA 1UUQA 3WLOA 1S2WA 5AY7A 5AHMA 3EA3A 2CIPA 3FDGA 3T40A 4PB5A 4LAZA 3DI0A 5C7HA 1UKTA 3R25A 3A3WA 4M1BA 3DYMA 3LNPA