3TC3A

Crystal structure of sacuvde
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
289
structure length
289
Chain Sequence
HMRVGYVSTNYSLGCKADKTIKLSSLSEERVLKVSSSNLLCLKNILEWNLKHEILFFRISSNTIPLASHPKFHVNWKDKLSHILGDIGDFIKENSIRISMHPGQYVVLNSVREEVVRSSIMELKYHADLLDSMGIEGKIQIHVGSSMNGKEESLNRFIENFRKLPSNISKRLVIENDDKVFSVKDCLWISERTGIPVIFDNLHHSILNNGESLNDALSLVRRTWKDRPMIDYSEQEPGEKPGVHATTINEENFRRFVNEVDEVDIMLEVKDKEISALKAVKVLKELNKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title UV damage endonuclease employs a novel dual-dinucleotide flipping mechanism to recognize different DNA lesions.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Hydrolase
molecule keywords UV damage endonuclease
total genus 123
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 3.-.-.-:
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03851 UvdE UV-endonuclease UvdE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3tc3A00
3P6LA 1S5NA 1TZ9A 3XIMA 5FA5A 4HNOA 4QE4A 1XLEA 4QDPA 1XIFA 3QXBA 4J4KA 1XYMA 1DIEA 9XIMA 3KCLA 3M0HA 4A8LA 2QUNA 4YTSA 2GLKA 4PGLA 1DE6A 4XIAA 3VNJA 3BZGA 2XIMA 3IUDA 4G56A 1XLHA 2X7VA 5XINA 4DUOA 7XIMA 3L23A 2GVEA 2NQ9A 3KBJA 5EMMA 3AYTA 1MUWA 1XIMA 1XLFA 3UXIA 3VNKA 2G0WA 5B80A 1XLGA 8XIMA 3CQIA 3ITTA 3IUIA 1XLCA 1I60A 1I6NA 3BANA 3ITYA 3KBVA 3C0QA 2I57A 1S5MA 4X60A 5TNVA 4LNCA 3KBSA 4GJJA 4EAYA 3AALA 4XIMA 1MNZA 1XP3A 2GYIA 3C0SA 3TVAA 4DVOA 5B7ZA 5XIMA 3VNMA 3M0LA 4ZB2A 9XIAA 2GUBA 3ITVA 1QTWA 3CQJA 5H1WA 1XIBA 1XIJA 3M0XA 6XIMA 1QUMA 1CLKA 4YTRA 4Q7IA 3ITXA 3ITLA 4KW2A 5B7YA 1DIDA 3IUHA 3U0HA 4ZBCA 3UU0A 1XYBA 1GW9A 4A8IA 2G4JA 3KCJA 3AAMA 4EACA 4ZB0A 3KBNA 1XLKA 3UA4A 3DX5A 1XINA 4K3ZA 3OBEA 1XLLA 1XIHA 1XYCA 4A8NA 2X7WA 4XISA 3QZAA 3U3HA 1XICA 4W4QA 4QE1A 2HCVA 4PFHA 2XISA 5AVNA 1XLMA 3ITOA 1YX1A 3CQHA 2QUMA 3CNYA 3DBNA 3AYVA 4YTTA 1XIGA 5AVHA 3GNXA 3BWWA 2QW5A 3N4AA 2I56A 3P14A 3KBWA 1BXCA 4OVXA 4QEEA 4E3VA 3NGFA 4QE5A 2Q02A 1XLJA 3VNIA 3C0LA 1BXBA 2NQJA 1A0CA 1XIDA 8XIAA 4GJIA 4HGXA 3KWSA 3UVAA 4A8RA 1XYAA 1XLAA 4XSMA 1D8WA 2HK0A 5J8LA 3QC0A 4XSLA 1XISA 1XLDA 5EMKA 3KTCA 3FVMA 3KBMA 3BDKA 3VYLA 4K1GA 2ZDSA 3M0VA 4X63A 3LMZA 3BZJA 1OADA 3WQOA 1A0EA 3CQKA 3M0YA 4QEHA 3M0MA 4HHLA 4HHMA 1O1HA 2HK1A 1K77A 3CWHA 3KCOA 1DXIA 1QT1A 5I7GA 4US6A 3XISA 2J6VA 4X61A 4GQBA 3JU2A 1XIIA 3UA3A 2ZVRA 4GLEA 5EMJA 5H6HA 4YTUA 4QDWA 5EMLA 5C9ZA 4ZB5A 2QULA 4YTQA 1DE5A 3VNLA 5XIAA 1XYLA 3QYSA 3XINA 1XLBA 2NQHA 1XLIA 2XINA 6XIAA 1A0DA 2OU4A 3TC3A 1XIEA 4XKMA
chains in the Genus database with same CATH superfamily
4BA0A 3TAOA 5HMDA 2A3EA 3V0SA 3WQVA 2QJGA 4KS0A 1LJYA 4ZE5A 2XU2A 2WBGA 2CESA 4XAYA 5FEWA 4Y9MA 4W9TA 3N2MA 5EBAA 5JIWA 2GJPA 5BU6A 8XIMA 4O10A 2AMGA 3WDQA 4GFIA 3U7BA 2JFEX 3IV8A 1OZQA 4ZB2A 3ITVA 4O1FA 5LIWX 4XAPA 1QU4A 2G4FA 1XH0A 1EEXA 4FZIA 3PJUA 4UBPC 4CNTA 6REQB 1LTDA 3EDDA 1KXVA 3CPUA 1M7JA 5I2UA 3NAVA 3ZLHA 3T78A 2WQDA 1Q13A 2FGBA 4U10A 1WBJA 1M3UA 3HZ3A 1NTHA 3LM3A 1GHRA 3D3FA 1TO3A 2J7BA 3N4AA 5HUPA 1FWSA 2KZHA 2UV8G 1RPXA 4DPQA 4R53A 4GJIA 1TSIA 1EGVA 2VCAA 2PRMA 3L0KA 1TA3B 1JZ4A 4L56A 2CBIA 4UIOA 4LWWA 3IJIA 3RCMA 3U5YA 1B1YA 4RE2A 4D6DA 2X42A 3MVIA 3BAYA 1SSGA 4MZ8A 5LA2A 1Y65A 3BJSA 3VDHA 2ZZ2A 4P7LA 3KCLA 1F2JA 4JIPA 3URQA 1F6YA 4FXSA 1A5OC 3MT1A 4L1GA 3PZVA 4NJGA 1FWJC 4ZEPA 1NEYA 4CD5A 4L65A 1XLCA 3ITYA 5AHLA 5FF2A 2XG9A 3EWDA 4IFKB 4HU3A 1VCFA 3G8EA 2EPMX 1TJ1A 2CZVA 1XIJA 2XVKA 3ITLA 1EGZA 3CZJA 3ARWA 1WX0A 2P5NA 1H7PA 3UPMA 1LG2A 3WF4A 1WV2A 1ITXA 4J3XA 2VO5A 1HJXA 4QE1A 5AVNA 5HJXA 3WQ6A 5K4XA 3ME3A 4OJYA 3ITOA 2WHKA 5A6JA 3RITA 1AJ2A 1Y5XA 4BKNA 3MCNA 4B3KA 4S3GA 1X97A 5A95A 1YADA 3N6HA 1NDYA 4WLCA 3SFWA 3RLGA 3H2AA 1ITCA 4S3AA 3KVJA 5KZDA 3F2BA 4ZODA 1VFMA 4ZO8A 3AU2A 3E74A 1UZ4A 1ODUA 4O50A 4D6HA 4TO8A 3TNOA 3BLEA 1NDZA 3LK6A 5H6HA 3LHYA 3HQNA 2QDHA 4H6QA 1J0JA 5F2GA 4IQDA 2WMIA 2PS2A 1CGYA 1UWIA 1S1PA 5IFTA 4PN2A 1B9ZA 2XH7A 1DQUA 4HD5A 4M1BA 4D9PA 5EB8A 3NZ1A 1ESWA 4PEKA 3PUDA 4CNNA 4W85A 2WKJA 1EF2A 5XINA 2C1GA 4FB7A 5KMYA 3KWXA 2W79A 1ZZMA 2G8ZA 3WF3A 3V4BA 1W9DM 1KFEA 5B80A 1L6WA 4IGHA 2VNCA 1VHNA 3KHJA 2H90A 1L0PA 3GE7A 4PB3A 4EPBC 2HE5A 4AVOA 1KCKA 3OB8A 4C91A 4C6CA 1DL3A 4XO7A 5DRCA 2J13A 3S4TA 3WQEA 4YTRA 4ZBCA 5DF0A 1I8JA 2QHAA 3TA9A 2HNEA 4WCJA 3H4WA 4GPNA 2X1TA 1ISWA 5I77A 5L9FA 3UWUA 1LBLA 2QQ6A 4PFHA 2PUZA 2XWDA 1H1NA 3CNYA 3L0NA 1Q85A 4R9XA 3F03K 4OVXA 4QLKA 1PCWA 3VUPA 4HSHA 4EXQA 7TAAA 3FA5A 3ZO9A 3VYLA 3WK2A 2DVXA 1OADA 1UH2A 4HHLA 4K8HA 2HK1A 3U4FA 3PTDA 3CUJA 2JIEA 1JYNA 4Q4SA 3W2NA 3FEMA 4Q4KA 5EMJA 1PVNA 2QGYA 4LCQA 3GTHA 5AOUA 1PKMA 1PX8A 2NSOA 3SCOA 4OBSA 2DSVA 3O1NA 4LUSA 3B8VA 2VQTA 2XFRA 3PZOA 3STPA 4N4PA 5FL0A 4TU1A 4DIAA 3WO8A 3KP1A 4S3FA 2I5IA 3AMDA 5DBUA 4LRTA 1IWAA 4PODA 1OCNA 2F8QA 4DO7A 4US5D 2PAJA 2INZA 4PTMA 4GNVA 4RV8A 2BHYA 2FFIA 5CLWA 1O12A 1A4MA 2YW4A 3APGA 4WOQA 1W2VA 1DWIM 1V6YA 2Q8LA 1K9EA 1QI5A 2DQXA 4KKXA 2J9YA 5D8WA 3KBNA 3AXIA 5KINA 3GR4A 3S6DA 4M51A 1MXGA 5GJNA 4NJJA 2GJLA 1ZS2A 2A21A 5DXXA 2RDXA 5HNRA 2XSXA 4POCA 1F5ZA 1W1PA 1R9XA 1W32A 2QV5A 2VVNA 2Z1BA 1W8SA 1U2YA 3ZT5A 2J74A 4V27A 4C6FA 2WWCA 3UZ5A 3MBDA 4BZYA 1JPKA 5F1UA 1EFZA 4N02A 5E9XA 5I7GA 1JPDX 1RP8A 2ACRA 3RCNA 4OE7A 3WEOA 2NXIA 2TYSA 3M0KA 5CPMA 3BAJA 1X39A 2VDGA 2VRJA 4DO4A 3AZTA 2Z29A 3PZUA 2XN1A 1TVPA 1TPEA 3ZS4A 4G8TA 6A3HA 2WCAA 3ID7A 4IFOA 1J5SA 2E6AA 4M24A 1RJPA 1CEOA 3AIEA 4G1KA 4G5DA 4GXPA 4UUIA 3W74A 1P6WA 4KCTA 1HL9A 3FAXA 2X05A 5HNTA 3K13A 4JTGA 3E2SA 1AA1B 4Z2LA 4MKSA 4DVOA 1E1FA 5XIMA 2BY0A 2DJLA 4NAFA 4LEFA 5CGMA 1HKKA 4LBSA 1V3IA 3T09A 3TWAA 4B9YA 3R10A 5EPDA 3KTSA 4IP5A 4FNTA 3GDRA 2WHMA 2E4TA 3W2JA 3WH8A 3MI3A 3AXHA 1HO1A 2EG6A 3AZRA 4UTTC 4X2RA 1OFDA 4O4VA 5LA1A 3FV9A 4KGJA 3R4IA 5CSRA 1RLCL 1SUXA 2ZUWA 1H4PA 3B4YA 3WQPA 1F3EA 2PD9A 4AD5A 1MWOA 2HEJA 1P0NA 4B5SA 1O5RA 4LB3A 3NURA 4CD8A 2D3NA 3IRSA 1RBOB 3NQBA 3SIMA 4WRHA 1P7TA 1V08A 3CAKA 3ISIX 3EX4A 2ATSA 1KB3A 7TIMA 3A64A 1HTIA 3WLHA 2FTYA 5CJMA 4CQDA 4J3VA 3VOHA 1A0DA 3TTEA 1KWGA 2JALA 2NV2A 3PF3A 2Z1WA 1XCXA 1IEQA 1DJHA 2BVWA 2R14A 4DRSA 2OYMA 1HVQA 3W7OA 1B5TA 1O60A 4FF5A 3U48A 3T81A 3ZWSA 2XVNA 3M0IA 3P8JA 3L5MA 3G1FA 1SW7A 2BDQA 1EHAA 1PWLA 3CQIA 3NXLA 3VZXA 4JD4A 2YGYA 4J9JA 3IV3A 3BTNA 1UD4A 3B06A 1VBHA 2PLMA 3ARSA 3OW1A 2L5HA 2ZADA 1H3GA 2WPGA 4MB3A 1JPIA 4NU7A 4ZQRA 1DXFA 1LRTA 1QPKA 1W3HA 2CXEA 3FAWA 3DFQA 4JTFA 1GT8A 3ZMRA 1BGAA 3SIZA 1K7XA 3MI2A 1A47A 5CZKA 4AWSA 1XRTA 2VM8A 2O9TA 2G4JA 3B04A 4H04A 3W86A 4FALA 1PEZA 1XD0A 4PCTA 4DBWA 4ZFCA 5C0QA 3TJXA 2EQDA 2VWTA 1Q3NA 2ATMA 3HO8A 3W6YA 1H09A 1GKRA 1KO0A 4C6DA 4MHBA 3LV5A 2FVKA 1AD1A 4UFHA 1TPWA 2REQB 3GIQA 3T8QA 4RZ6A 1YYAA 4WHBA 4NZJA 2Q8ZA 3AHYA 3A21A 1VF8A 3BGGA 4GQRA 3KVLA 1DXIA 3QR0A 2C3ZA 5E0CA 3B8IA 3CGTA 4FPSA 5CC6A 1XYLA 3OVGA 1FWFC 4IJRA 4NI3A 1JULA 1IZJA 2OKTA 1FWBC 3VOIA 2D0FA 4H2HA 2Z6IA 3CTLA 4LY4A 4FNSA 1PWMA 3LD5A 3L7RA 5CG7A 1OF8A 3T0AA 4IX2A 2NQ9A 1GEQA 5CC3A 4JKKA 4E8CA 1K9FA 4U31A 3ZR4A 3M16A 1XRSA 5CXPA 1LYXA 3L2MA 2G5WA 2CZFA 4ZGYA 1LT7A 4IMEA 3G6MA 3LM7A 3OJGA 1B2YA 2TRSA 4IJCA 2X0SA 1QNPA 4IPPA 3POHA 4Y6GA 4MY1A 5TBOA 4Z08A 5CZ0A 1FKXA 2X1UA 1NDWA 3G2GA 4M29A 3QR3A 4YPJA 1PYMA 4BI7A 1R5YA 3BLOA 3VE9A 4I8YA 1CGXA 3W85A 3QPEA 5FF3A 3TW7A 1NOUA 3PBUA 2DZBA 4HP5A 4QR6A 1V4YA 4L6HA 3LNPA 1V6TA 1TX0A 1UPPA 1XG3A 2WVTA 1MW3A 4Z17A 5AYBA 2E9BA 4UR7A 3SRKA 4A29A 1KCXA 3M44A 3UR8A 3OA5A 3L2LA 1W3KA 2QPUA 1Q6LA 4HYVA 4DX3A 3FDGA 3T44A 2OWWA 3R1ZA 3PBWA 2WVUA 3SZ8A 2DT1A 4N6FA 1A5AA 3RIKA 1JR1A 2NQHA 3R25A 2RKXA 1UJQA 1UROA 4MWAB 1JAKA 2ZA2A 2Y85A 3ARPA 1UD8A 2YL6A 2OELA 1XBYA 4PR4A 2W5FA 4O16A 7PTDA 1XC4A 3SQSA 2GGGA 2VEKA 3N18A 5E0FA 1XJBA 1HJVA 2J47A 2FH6A 1DXEA 1XI3A 2R9RA 3CUIA 5AZ1A 1TG7A 4AY7A 1ONWA 4JTLA 1K8YA 4UOJA 3AZSA 4DF1A 4NT0A 1HFBA 1GOIA 2J79A 1KQZA 3CEPA 5A6MA 4GMEA 4ZXLA 2CKSA 1W9VA 3N2BA 5AY7A 3EGJA 2G37A 1DHKA 3WMLA 3LOTA 3O7UA 2IQTA 4JIIX 2VZOA 4NASA 4AD2A 2V63A 4HYWA 4Z42C 1GVQA 3WJYA 4AW7A 1TPB1 3CH9A 4I9MA 1WDWA 1KFBA 5AHEA 4D6EA 2B0MA 4F2TA 2E8ZA 2WHJA 3SADA 3MP3A 3QKZA 4UNLA 5E6ZA 4WIWA 3GU9A 4GZJA 2Y70A 3AWOA 2BGSA 3W1LA 1EJTC 3PZQA 3UWVA 4QLLA 5HWMA 1RH9A 3J7HA 1ADOA 1HXJA 3SCTA 1BF2A 4HNLA 1H62A 1G4TA 5HMFA 3FXYA 4V2XA 4V1YA 3O63A 2OPJA 3I3BA 2GQAA 3FJLA 2NT1A 5ABFB 1XKYA 4E4UA 4XTIA 1QAPA 1I6NA 3TQPA 4JBRA 5DT5A 3OLDA 3G8RA 2C7FA 2PDCA 4DPPA 1JXJA 4IWWA 4L9ZA 3P60A 3NXFA 1GKQA 3QR1A 4OZOA 1AW1A 3H70A 5GNXA 1X1NA 1Q7MA 1NIUA 2G97A 4FP1A 2EG7A 3M5VA 4Q22A 2IPWA 2BB0A 2ZOXA 3UJFA 4WSHA 3HPAA 1QNVA 3FKKA 4GHRA 4JQ2A 1TELA 2PDUA 4IIBA 3N2OA 3RM4A 4LYPA 3LBMA 1KM0A 3DH7A 5AVHA 5I07A 5LIYX 2CEQA 3GWQA 3QQWA 2XM1A 3NVDA 1MFUA 3RJXA 2VUYA 1JYXA 3MUZ1 4YMZA 4K7VA 4UFIA 2ZDSA 2CIPA 2QJJA 3E0IA 1W1IE 1HKMA 4Q8VA 2BGQA 4K39A 4KIRA 4AISA 4KBXA 4MUZA 2WVVB 3DGBA 2Z7KA 2VX7A 5FSDC 3O3RA 1JZ3A 3HQPA 4EK7A 1EQPA 1YXYA 2O92A 1T8XA 3IANA 3DG6A 3DYOA 4GKLA 3W87A 3SW6A 4M6QA 3ARTA 7REQA 4J7RA 1RJRA 2PWDA 3M0HA 1N8WA 2O4MA 3EWCA 3QBUA 4AIBA 1W1B1 3GHTA 3QLLA 5M1TA 2A2IA 1A5CA 2DVUA 1WQ5A 2Y1HA 3EXSA 5K9CA 1TV2A 3FYYA 4Q7NA 1RLDA 3H7UA 1K8ZA 1QMLA 4PUMA 2B7PA 4WK9A 3QHOA 2Z1SA 1JZ2A 3S46A 1FOBA 4FX6M 1XXXA 3KRUA 2GUBA 4JIQA 4JPGA 3OLEA 2PTWA 4L6OA 2AQOA 2ZVIA 1YE6A 5KTLA 4ICNA 4CD4A 1YBQB 3WBYA 4RDWA 2ZUTA 3N4FA 2VFHA 2VOTA 3KOWA 1PE1A 3FGCB 1OIMA 1LCOA 4W7WA 4MPKA 1I2OA 1Q6FA 4JNZA 1HX0A 3AHXA 1BXBA 4DWSD 1PYFA 2VVSA 2CLKA 4GCXA 1A5UA 4R88A 2J7GA 3B0VC 1HG3A 4C5ZA 3HGJA 3QQ1A 3BVJA 4JTHA 3P62A 4ECLA 1K7FA 2R1PA 3WBXA 3LUTA 1G4EA 1QK0A 5C9ZA 3MSRA 3AXKA 5D9MA 1ALDA 1F3XA 1SJAA 1JPMA 2J78A 5FEPA 5FA5A 2V2DA 3LS9A 4I9TA 2E40A 1T7LA 2C8NA 4F0KA 2OSYA 2GLKA 4LCRA 1HKIA 5PTDA 4UFKA 1UD5A 1AZ2A 3CMJA 2WZEA 4GGHA 5JBFA 3MO7A 3OYXA 3PBYA 4MDPA 3NIYA 3OVRA 4J3WA 1F6KA 2V5LA 4GQGA 1H1ZA 1EJSC 3OA3A 3NL2A 5RUBA 1H7NA 1YPFA 1MNZA 4DYEA 1EX1A 1DP0A 1W54A 4H7CA 1EZWA 1J9YA 3E2VA 1J10A 1ZBVA 5C7VA 3CAVA 4LU0A 3SCUA 1GTEA 4ADUA 3GHRA 5H2ZA 1UR8A 3USZA 1JPHA 2G3MA 3AMGA 3G6LA 4GUHA 4AB4A 1UR4A 1TPFA 1CX9A 3WDJA 2PF8A 4CN6A 3BAWA 2PSNA 3WF0A 1OFQA 3W6LA 2VZUA 5A8MA 3A22A 3UR5A 3TIMA 1TJ0A 5C2GA 3AROA 3ES7A 4PRTA 1J2WA 3QFWA 3P14A 3SFKA 1PX3A 1R8LA 1FXPA 3WDHA 4C90A 1JDAA 1K70A 1V6UA 2PTDA 3CL8A 1G5AA 5IHSA 3ZIZA 1WAUA 3IGXA 4LYQA 4AHPA 4A3HA 4TVUA 4RV3A 4IOTA 3A4AA 3QEZA 5EFFA 1XBZA 4O28A 3TJLA 5DXYA 4YYFA 4XG1A 2GVYA 2J25A 4GVGA 2VDHA 2DH2A 3CH0A 3GUWA 4LC6A 3R79A 1W37A 5A94A 2QAFA 1YLVA 3LA4A 3RX4A 1YEYA 4F9DA 2WKLA 1Z69A 3R8GA 4B5XA 2INEA 1OGSA 4AVNA 3S6TA 4F66A 3TROA 5LYRA 4IQLA 3DFSA 3UPWA 4LW7A 4F0RA 3F4VA 4M3PA 3F4NA 1XX1A 3NO1A 3SUUA 5AHIA 3CL6A 1XYBA 4XZLX 4GJ1A 3EA1A 4NF7A 3AAMA 4P8VA 1DTNA 2YYUA 1XIHA 2PDWA 1SU5A 1PS9A 4FNQA 3B97A 3WLTA 5U4NA 2VC9A 4CQBA 3DECA 3JUGA 3I4KA 2I56A 4BHYA 2PU1A 2FHCA 2DP3A 1SR0A 2E5CA 3IGHX 3DC0A 3WNMA 2PDJA 3GNOA 1Q6OA 1E1CA 3F7JA 4PMDA 2WMFA 2NX9A 3GNDA 4MKVA 3RCYA 3GAYA 2F84A 1T41A 2ALRA 1XIIA 4U28A 2C6QA 4AZCB 3RR4A 1OFPA 3ONCA 2Z26A 4JIEA 4Y2WA 1MQQA 1KFCA 2WJEA 1E15A 3XIMA 1HVXA 1JGMA 1WUFA 4G7EB 1VYPX 4AZ6A 4WF7A 2ISFA 1R2RA 1ZGDA 3WUBA 2XIBA 2DT3A 2A7PA 3MP5A 4JY9A 2EF9A 4FLRA 1AVAA 4HK6A 5HINA 4HHPA 4D6GA 4IGNA 3KM8A 3S8HA 4HNUA 1RBAA 3AS3A 4GQ0A 2AKMA 1QUMA 4V1XA 3ECQA 3KOZA 2HWGA 1V3LA 3HFYA 3DEQA 2E5BA 2PC8A 3TAKA 4NXKA 1BAGA 3DFTA 1QW7A 2V2HA 1EP1A 1UJPA 5A8PA 3UCQA 3PPCA 5CSUA 3VZYA 3C3UA 1ZB5A 4JY8A 1YTDA 3TJIA 4LX4A 4UTIA 4X3ZA 3WLMA 1B3ZA 1E4LA 3BMXA 2E5DA 1L8NA 1Q2SA 1SZRA 4WOZA 2GK1A 3SRDA 1XUUA 1RA5A 3GNRA 3RRAA 2CERA 2Y63A 4AF0A 2YLLA 1FWIC 3FFSA 4ACYA 5I23A 5FF4A 3BV7A 4HA1A 1L8PA 4V28A 4XVEA 3EMZA 3BZJA 3PB2A 3WQOA 4BI5A 3FA3A 3Q58A 3CUHA 4ZCWA 3W2KA 1NVMA 2ZWZA 4TX8A 4J28A 1RXOB 5G1YA 1XSIA 3AIRA 4HK7A 4GZIA 4CGTA 3GB6A 4PUDA 3R0UA 3QN3A 2C16A 2RDWA 2ZC1A 3LHWA 2EJ1A 2NVAA 5D05A 4LBUA 3BCDA 3U5UA 4JFVA 1OM0A 1H63A 3BCJA 1A5NC 3GVQA 3WK1A 3IUIA 2NUYA 1V02E 4BQ4A 3TR9A 4AIEA 2PFHA 3OU8A 2PWGA 3RILA 2BY1A 1GVFA 5M2FX 2UY2A 2WCGA 1GOQA 1VAHA 3QY8A 4HT3A 2QLYA 4MOZA 4TX9A 1K9DA 3CHDA 3HOJA 3N2XA 1AMYA 2BX7A 1FDZA 1TTQA 1U5VA 2I17A 1VBJA 3FIGA 2QUUA 4DY1A 5DCBA 2O7QA 1BVNP 2W9MA 4GI8A 5G4HC 2E67A 1ADDA 3NQ8A 3S1VA 4R9OA 3VIGA 4GABA 4CQAA 3C8NA 4A8RA 4H83A 3ZFHA 1W1TA 3EDFA 3BSHA 3TCSA 1HGYA 3S1GA 3RF9A 1FCUA 1E4NA 2Q6ZA 3P82A 4MUPA 1KV8A 4KFOA 1EGMA 5D02A 4GVHA 4PTDA 1HT6A 2YXXA 3E1F1 3LXAA 4FR6A 1YTEA 4OOZA 3IAQA 5DMNA 1BD0A 2X1IA 5C55A 1IXQA 1XPYA 2JKAA 4Q33A 1OFOA 1Q63A 2VKZG 4K7YA 4B5UA 1QPOA 1SW3A 1KM5A 1G69A 3ZXWA 2A3CA 3NZRA 2HS6A 5HJLA 4ZL1A 3UZXA 2W92A 1S3HA 4MNKA 3VX0A 2FZ8A 3ALFA 4KWUA 3EA3A 1PXGA 2QVHA 1IYXA 4JTKA 3S2JA 2H8XA 2BP1A 3O6CA 3PZMA 3M47A 4JTRA 4PYSA 4DEFA 3LLFA 1QOPA 1OQFA 1NJJA 2Y7GA 3CWOX 3EWBX 3QGVA 1UQYA 3S9YA 3ARQA 1OWQA 3V1HA 1TWSA 3KE0A 4QSHA 3ITXA 3WJWA 3WFAA 3S42A 1H11A 4Q8NA 4JNMA 1W1ZA 6CGTA 4LYKA 4YWSA 1IIHA 3W7PA 4BCEA 4DHGA 3BGJA 2YL5A 2VQUA 2CFFA 3W7KA 1MDRA 2WZTA 3C2RA 3ZWTA 1I1WA 3V75A 2QGHA 5G2HA 3QMSA 4GIRA 1DWAM 1OYBA 2A1YA 1OJXA 3H2FA 1YDYA 1CECA 1DWJM 3VIHA 3FVMA 4OOUA 3FW6A 5DCDA 5JH2A 3VDCA 3H6OA 3GHSA 5CAKA 1OFRA 1CXEA 2CNCA 4IF2A 4EWJA 3MSDA 3A3WA 3KL3A 4X61A 3GVRA 2XVLA 4PUWA 1VP5A 2X0YA 1HP4A 2W3ZA 3QYSA 3W0KA 5A6BD 3GDKA 3K2GA 3VO0A 4N9CA 3EWUA 1H41A 2ZX6A 4CUCA 3TXVA 4TTUA 3EOUA 1KD0A 1FWNA 2J88A 4HNCA 1UQZA 2VEFA 1UG6A 5CPTA 1M03A 4XIAA 3O2LA 3KZPA 4Q4RA 4OV9A 3TA6A 4RPQA 4D2JA 2WC7A 4K1WA 3F4WA 2GJNA 1E9YB 4GINA 1O94A 1U1HA 4DJDA 3MWCA 1WBHA 1TB3A 3LCIA 4B3ZA 1I0DA 2FDSA 2WSKA 3OGVA 4DXKA 2C15A 1V6XA 2TAAA 3SN1A 1UD6A 2I16A 3ARUA 1UR1A 3ZJKA 3VX1A 5CLTA 4M80A 2VC6A 3WQDA 4GUGA 3G0SA 3P0WA 4K3ZA 1XLLA 3G1XA 4XZ9A 1FWEC 4DBDA 4YU1A 5EYWA 4C6OA 3GDMA 3LCHA 3KVMA 4X9YA 2VP8A 2QCMA 3STEA 1V93A 3NGFA 2WOQA 3ABZA 4MB1A 2YFNA 3DFNA 3HG4A 4JOMA 4LYRA 3O05A 3KS5A 2Q01A 2CPUA 1OFEA 2DSWA 1IEVA 2FZBA 3CIWA 4GXWA 1CW2A 1A5LC 4X9SA 3AXXA 1A3WA 3WX7A 1X6LA 3R13A 1QNQA 3WQ5A 1BSLA 2OGJA 3IPWA 5I3IA 3R0KA 1J0HA 2CXGA 1TIMA 3LRMA 2R1KA 3EX2A 1C93A 4LANA 2GFTA 4JICA 4UTHA 4LUTA 5H8UA 3STFA 2HXTA 4QJ4B 3PJTA 2A79A 3PUEA 2BMBA 3N6QA 4J27A 5DANA 4UFMA 1BRLB 2EPLX 3F2CA 4W88A 5CGTA 4CN4A 2HV5A 4LS1A 1PX4A 3Q67A 3KW3A 4TVDA 3DFPA 1JZ5A 3FJ6A 1F4AA 2JGYA 1IT8A 3W7NA 1E6NA 4GZ7A 2Z7GA 4I5UA 4LRSA 3IJ6A 4H8VA 1TJRA 2OZ0A 4ZB0A 5EFDA 1PTGA 5D2WA 1EYEA 1GKPA 1TRIA 1CGVA 3CHCA 4IUOA 5HJYA 2ZBTA 4MFEA 1UR0A 1X98A 1GVIA 3ARYA 4O17A 4QEEA 4DN1A 3CLWA 3H2CA 3P0XA 4F2BA 1WXJA 1Z3NA 2CBJA 4GIYA 4LUTB 2RGLA 2P8CA 1QDSA 1RSCA 3UXKA 4NJIA 2Y6ZA 4NI8A 5C6MA 3WD3A 1RHCA 4H00A 5AECA 5T8GA 4E4FA 2QJMA 1KFKA 4DJEC 3HPFA 5EMLA 2PDKA 1UPMB 1MVYA 2AQWA 3APYA 1PIIA 3O9NA 5GPRA 3TLLA 5AFDA 5AHMA 1S5NA 3L0GA 2VHLA 3G1SA 4WJ8A 4FX7A 1GZ1A 1XG4A 2YW3A 5FESA 5CEWA 5D04C 5I00A 3FVDA 1S1RA 1KQYA 1BTMA 4S3KA 3VGEA 3HJZA 3ATYA 3C0QA 3F5LA 2Q71A 3C8FA 3B8SA 1P6CA 3CEUA 1LQ2A 2IKJA 1PZ3A 4DBUA 2GUUA 1TV8A 1KFLA 3W1MA 3FXGA 2FKPA 4YVVA 3W01A 4N9BA 5F4XA 1FWDC 4D8AA 5AC8A 3H12A 3T2PA 4KRTA 2I5QA 3VOFA 1KFJA 3LLDA 4A35A 3OLIA 1TV3A 2QMKA 2Z2AA 3OODA 4K8GA 3VUSA 2GGJA 2Y8UA 1FDJA 3GS6A 4IIGA 1S3TC 2NZLA 3A4WA 1CWYA 3HPSA 2BZNA 3KWSA 1VJIA 5T91A 2VD9A 3UYCA 5BXTA 1KBKA 2INFA 2VRKA 2G41A 2YBVA 4IPNB 3N1AA 4BEUA 1NSJA 3QRHA 2DVTA 3VFCA 5LXXA 4LV4A 4LBRA 1BWKA 3UW6A 2KX9A 1VKFA 5HWNA 4QQUA 4AF0B 3W7DA 4DJFA 2V5BA 2DH3A 3DG7A 3NA8A 5G4EA 2OJPA 4XBKA 4P8XA 1MZHA 3CMFA 1DIEA 3LPFA 4FAMA 1G0CA 3K46A 2HISA 1UWQA 3MBFA 1YRRA 2QUNA 4QRNA 2JKPA 3VKDA 2GZXA 5T9CE 3CV7A 1DKWA 5REQB 1F05A 1K8CA 1HUVA 2CYGA 2MNRA 3P5ZA 4XZIA 4PMUA 5GJMA 3RYSA 1JIBA 5H1WA 4ERIA 1C91A 4IQEA 6XIMA 5C9RA 3ABSA 5A5WA 3T4CA 2POZA 1WXYA 3CAWA 5HPCA 3AJ7A 4WR3A 1OGBA 2V81A 4U2ZA 4NYYA 4CQCA 1E6SM 1BQGA 1QNRA 1XINA 4RUBA 3M5YA 5LXEA 2WBKA 3CASA 4LUIA 4V33A 3A3HA 2VFFA 3MYPA 2Y61A 4XZBA 2YDSA 3BJFA 4IH3A 4XSLA 1B4KA 1NU5A 4XBJA 4UQBA 2TPSA 3B8WA 4LFYA 3ZVHA 4ICMA 4HHMA 3UG8A 3CWHA 3GFYA 1MYRA 3HGRA 4Z2HA 5AN7A 4ZQCA 3DKLA 4DJFD 1WDDA 2XINA 3TC3A 2QUTA 4GE8A 7A3HA 4XD5A 4J1OA 4QAIA 3DOPA 4XTDA 1PSCA 3HV9A 4JQ1A 5JUVA 2Z2UA 2PP3A 4NNAA 4Q8PA 2HVMA 4DNMA 4X0NA 2GJXA 2E3ZA 4DUOA 4R27A 4M7SA 1OK6A 2R6OA 2VT0A 4AVFA 4GGBA 7ODCA 3ITTA 4J2PA 1O5XA 3SUWA 2R1LA 4EAYA 5IHRA 4XIMA 3MCMA 2PDIA 4BS0A 4GQQA 4B5WA 1ZAIA 2Y24A 3NPXA 1CLKA 1R3RA 4C6IA 4DBSA 5B7YA 3IAPA 1YDOA 1PAMA 4RW5A 3QY7A 3WMBA 2QEZA 1GUVA 1MEWA 1SJBA 2WCSA 4LS0A 2ZWYA 1QHZA 3FJ4A 1L6SA 3NQFA 4KIEA 4UZUA 5A8QA 3BH4A 2QCLA 1TYGA 2QT3A 3GDBA 3TN4A 1OIFA 3VK5A 4S3EA 5E70A 3DU0A 2ZDRA 4INFA 5HQEA 4WDWA 5CPQA 1SZNA 3KTXA 3ZR5A 1YDVA 1RVKA 2PP0A 3NFUA 4O11A 3TCEA 1NWRA 1EOMA 1JCTA 2BXYA 3LXCA 4I7WA 3MVTA 3H4XA 2F2HA 4DQWA 5I24A 2WM1A 4S1FA 2SFPA 2OEJA 2VFIA 3G22A 3THCA 4RZ4A 3EOSA 3R0DA 2PWVA 4A3RA 4RE0A 2QNEA 4JCMA 3QV8A 5BZAA 1YDNA 1JFHA 2I7GA 4TUFA 1MSSA 1UUQA 1MUMA 3E5PA 4H3DA 1C3FA 3QYQA 5AC6A 4MNLA 1QWGA 5LZLA 4FXJA 4L7ZA 3RX3A 4H9UA 4N42A 4U5KA 3VGDA 3VC5A 4DUXA 4PTNA 4J5NA 1MQRA 1SJCA 4RDVA 1F73A 1YTKA 3RO8A 1KTNA 3TDFA 3OVPA 1B54A 3TH6A 2NQ5A 3CWNA 3N2CA 4B2DD 3CZ8A 3QC0A 2VFGA 4DF0A 3KTCA 2WXDM 3URAA 1GOWA 1QW8A 5DX7A 3BAXA 5CSSA 4RDZA 2ZZ5A 3QSRA 4HYRA 3PZIA 1WZLA 1W31A 1TFVA 1P4CA 3H8AA 1NARA 3AS0A 3TSBA 1KTCA 1NFBA 4GIEA 4DJDC 3PNUA 3CHFA 4PBFA 3LEPA 5LHFA 3QV7A 3GKFA 3BAKA 1R2TA 3GXPA 1GVEA 4YL2A 1RQBA 3QOMA 1BLIA 2V3EA 4Z1YA 3B9EA 3HQ1A 1XGZA 3THAA 1BWLA 3AIWA 4IPLA 1UR9A 2O9OA 1A5SA 3W23A 3RN6A 3PPGA 2RHGA 3C2FA 5EBUA 1AW2A 3TV8A 2Z4GA 2FMNA 1J0YA 2PLKA 3P80A 3ANYA 3UGVA 5I6SA 4MYXA 4YN5A 1L6FA 2V9DA 1BRLA 1UCWA 8RUCA 2VCBA 3ANUA 1OT2A 3DGRA 1I75A 2CITA 3GH7A 2HVOA 2JEPA 2XHYA 3ARXA 5F2IA 1XC6A 2ZRYA 1VPYA 3DAQA 3TU9A 1FWGC 1OZMA 1M7PA 3B9NA 4DJDD 2XIJA 1LRNA 1J79A 3HG2A 1RD6A 3L21A 2VL4A 1I45A 2PE4A 1AFSA 4BR1A 3NL6A 3T07A 3GZ3A 4IMFA 1QVBA 3MV11 1LL6A 1A80A 3FN9A 3BOLA 2VEGA 2EAWA 4LAMA 3TYCA 1GGOA 4PBEA 3K8LA 2JQXA 2NWSA 5JVLA 3PN8A 1HZYA 3MB9A 5CPLA 3DCPA 2ZRUA 1JVNA 7CGTA 5CBJA 2OQHA 3BOXA 4HNOA 2VOMA 3AU6A 1P48A 2E9MA 4MLJA 1N8FA 4YTSA 4KT2A 3VNJA 2YB1A 1R87A 3BOFA 3I6RA 4OGZA 5GJPA 3TSDA 1MUWA 3LCXA 1LL4A 2WYSA 2V3GA 5BOOA 2Z1KA 4ATLA 1EIXA 1WOAA 1JNEA 4B5NA 1ICPA 3MI6A 3H2NA 4YXGA 3GR7A 4WVXA 5IRPA 1QTWA 3NVTA 2BGNE 2VZSA 3H22A 3PZTA 4GACA 2X0HA 2DY3A 5CC7A 3PUOA 3JS3A 5IM51 1T8QA 4BEQA 3LBCA 1REQB 1EJXC 4ZE4A 2OKOA 1JD7A 1G7UA 1XCFA 4MJZA 3RJYA 1LBFA 4C6PA 3QJAA 4GA8A 1PDYA 1NY1A 2Z1XA 3FOKA 2IKGA 5D30A 4GYPC 3IVSA 1NWUA 3E9AA 1JUEA 3ITGA 3ZT7A 1FCBA 4LUSB 3SRFA 3G1VA 5C2XA 4YHGA 2DZAA 3FYOA 1ZP3A 4HBKA 2JF7A 3MS8A 2Y0FA 2ZVRA 3VGHA 4CU6A 2PA6A 3CV2A 4OFCA 3WDRA 3HGSA 1KGXA 3M5XA 1Y7VA 1PKYA 3A4JA 3A3XA 1LWIA 4W87A 4KPLA 4KMQA 4A22A 4UTWA 1LLOA 3O8AA 1AQ0A 5AC5A 2QXWA 4QCFA 4IT1A 2ACUA 1BYDA 1QI3A 4ROPA 4XV0A 1US0A 3B8UA 1FWTA 2R94A 5FJIA 3VKBA 3UWZA 1V3JA 1I60A 3B8TA 2TODA 3AIQA 2X41A 1V3KA 1LORA 2BV9A 2HPIA 2ZFAA 4C6MA 4H7ZA 4JS3A 4AZ5A 1XIBA 4GYPA 4KGLA 4O13A 1QCWA 5AYZA 2DUXA 1PKLA 2HSAA 4ORIA 4FIRA 1YE4A 3OBEA 3OQEA 2ZUNA 2YCJA 3QHNA 2PLJA 3H53A 2PDFA 1UWUA 2Y4SA 4Y8EA 3IRDA 4CLMA 5D09A 3AYVA 1HKJA 3EPMA 2Y5SA 1R2SA 1OFBA 5J8LA 2BNJA 4JN6A 2Z6JA 4DJED 1CPUA 3GXMA 3U7VA 5D2XA 3M0VA 3EWZA 1YQ2A 3RM8A 8A3HA 5GNZA 3C5QA 1FCQA 1QJWA 2W27A 2ZX8A 2CHRA 4W84A 3IIXA 5J5DA 5CGQA 1F61A 1FHDA 4GCAA 4N6EA 1ONXA 5A69A 1W9XA 2ZYFA 1HJSA 2OU4A 3OQ8A 3GO2A 4XKMA 5LNUA 2YCLB 2WMKA 3WH7A 3ABXA 1H5VA 1XDMA 1M53A 3C52A 4Y96A 2XGZA 3EOLA 2DDXA 4E2OA 1F7BA 2PDQA 1KNWA 4GH1A 5LSMA 1J2BA 4K36A 5HMEA 1GOMA 1VBRA 2P1FA 2AGKA 2CLFA 3LRKA 2NVCA 3U57A 3BW2A 3MCOA 2RJHA 1W9PA 2E28A 3ICJA 2QCCA 2FPYA 4DLMA 3U4AA 1FH9A 1THFD 1XYCA 4MNJA 2FQIA 2UY4A 2PRLA 2RH9A 2FPTA 1YBQA 1IR1A 1JCNA 2ZUMA 4YLWA 4D6FA 1XIDA 5DT7A 4LT9A 2OTDA 1XLAA 5DELA 2VR5A 2B7OA 4F3HA 3GZAA 4WY0A 2D22A 4X63A 4O1DA 3UFYA 4ZQPA 2QDEA 1K77A 1KBJA 1QHPA 3PTKA 4RCXA 1FP8A 4OBRA 4FHAA 1E3XA 1IIGA 4B90A 3NUKA 2ZXAA 4JTEA 4WKHA 4O0ZA 4XWUA 5ECVA 3U2CA 3ABRA 2PLCA 4HA4A 3NSMA 1WDPA 2WMGA 4S3JA 2H8ZA 3UXDA 1YPXA 3VZZA 3TOPA 4KRZA 3EB3A 4ZQMA 3QPYA 1VPQA 3LZ5A 3E49A 1VHCA 5E6YA 3QH2A 4MNMA 4ZA0A 4GBDA 2CLLA 5HULA 3CZGA 1Y0EA 3MY9A 3M0LA 2CLEA 4H7VA 4RDYA 1EX5A 3TTYA 3W6MA 1YNQA 1HQTA 3BMVA 3MSYA 1TMLA 3IUHA 3UU0A 1B3XA 6TAAA 2GQ8A 3W29A 4UQ9A 4L5ZA 3VIPA 1TQJA 5ENLA 1EIBA 4ASTA 4RNIA 5I09A 3N25A 2GSEA 2E25A 5FACA 1KCLA 4LVFA 4DXXA 3M0ZA 4AAJA 1E0WA 5A8OA 1M41A 4WZHA 2NQJA 1ZP4A 4LS2A 1VYRA 1Q6RA 3W1NA 3LPPA 1FY6A 1G67A 2D0GA 4JTUA 2YR1A 3S3GA 5F1VA 2J9ZA 2PZ0A 4MG4A 3WIJA 2NLIA 4PTXA 1SW0A 3UZYA 2WSQA 4GQBA 3QGKC 4EX4A 4XB3A 1POKA 3KFTA 4IG2B 1MW2A 1BEUA 3GU1A 3RG6A 2VEMA 3QHMA 1XQKA 2G95A 3MPGA 1GVRA 2XFFA 2P53A 3ARVA 4Q3MA 1W1A1 3B03A 3M64A 4G1NA 1NF7A 1KLZA 4JR5A 2XVPA 3AIVA 3WNPA 1JJKA 4MYAA 3E0LA 1TE6A 1XW8A 2ZRVA 1D2KA 2QJHA 5I03A 3SGGA 1HO4A 4HNVA 3SSJA 2XIOA 3DFHA 1R86A 3KVKA 3GG1A 3RPDA 1WAWA 1VENA 1XP3A 4AIUA 3Q65A 4O57A 5D9PA 5LKYA 4LUYA 1RK5A 4CKQA 4UR8A 2QMJA 1R3TA 3PBGA 4BF5A 3EX3A 3WJSA 3UNTA 5C5YA 3MANA 3W82A 1I2PA 3RAOA 1HJUA 4WXYA 4X2PA 1LM1A 1YXDA 1R30A 4EKJA 1OINA 3OZMA 4JTTA 3CQHA 3W53A 2RGMA 4AU0A 2XTKA 3CAQA 4B5TA 4JTIA 2HJPA 1HIZA 4FS9A 4FI4A 1D8WA 3GX9A 3SCWA 4S2CA 4W93A 4J3TA 2XH0A 1RBLA 4UFJA 2BG5A 4C6JA 4EPEC 1D7FA 4NNBA 1PCKA 1LOSA 3C2VA 1AQHA 1GNXA 3GTXA 3RUBL 4A2SA 2E0PA 2XFWA 3PFRA 4PSPA 3AXMA 1DQXA 3QMTA 4QDPA 4MB4A 1TPVA 2WZIA 1JUBA 2HROA 2WSRA 1WKEA 4ZTXA 4G56A 2OT1A 5CZTA 4CVUA 3IS4A 1TWDA 4DO6A 3TMLA 5I3DA 2I57A 4TMCA 4LNCA 1ELSA 3WD1A 2WNNA 2CC0A 3I10A 4M5PA 3EB4A 3N9SA 4E2BA 3UQNA 4NIRA 3WMSA 1GTHA 4L4MA 1OX5A 2RAGA 3W76A 5HBFA 3G18A 1BYAA 3I7RA 2AKZA 4UTFA 3NQGA 3TUUA 1CGWA 2C18A 1GK8A 3IWPA 3PNZA 5E9AA 3CMGA 4LVDA 1EHNA 4RNHA 2QYGA 1UR3M 2V69A 4FO4A 3WUGA 3R12A 1V8EA 4QROA 4JNYA 4F9JA 1UWTA 2E68A 1Z41A 4IHCA 5DMMA 4J35A 1QT1A 1XRVA 1FVPA 1SZGA 4GLEA 4E0CA 2QZRA 5FD0A 3NYDA 4Y9NA 1J4EA 3GIYA 5K7JA 1NF0A 2MUCA 3POCA 4LQ1A 4S2BA 3W70A 1W5OA 3WD0A 1KRBC 4Y9AA 3KOFA 3VDAA 2EJAA 1Q66A 1Z32X 1FXQA 3NSXA 1VCVA 2WPBA 4NQ1A 4FNUA 2VD8A 2RDUA 5BOEA 4TV5A 3MDWA 1GJWA 3PULA 3AYTA 1ISYA 2C19A 1PIGA 4AEEA 4N7QA 3EWXA 4Z0SA 2VZTA 1ISVA 3DERA 3HFTA 5L6UA 3TVAA 3QF0A 1ISXA 1LDCA 2PU0A 4PA8A 2DIKA 1R3YA 4ADTA 3IJDA 3W7EA 2J4GA 4XD4A 4H6KA 3BL3A 4GK8A 3MWAA 1KC7A 4HCHA 2RFGA 5CZSA 1AJ0A 2BVTA 5HQLA 5BMWA 3TQKA 3KL5A 4W5ZA 3LLXA 3GM8A 1XIGA 1ENUA 3G1HA 4JTSA 1W3LA 2ALDA 2Q8XA 1BGGA 3IIZA 1XH1A 2XSAA 3PZNA 1J0IA 5TF0A 3NCOA 3AHZA 2E6DA 4RKAA 1GHSA 1QHOA 1RJQA 1AK5A 3B0XA 1NM9A 2AGTA 1RAKA 4LPCA 4IIHA 4IXHA 3NQ6A 3BLDA 3VIMA 4GVIA 2PRHA 4IICA 4WKFA 2ZA3A 1Q6CA 1BKSA 1O5QA 1GQJA 3WG6A 2C71A 4DJEA 2HNHA 3TX9A 2G0WA 2WJFA 3R43A 4X60A 5CZJA 3ARRA 5J5RA 3KHDA 4GFSA 1Z6KA 1KV5A 3CUFA 3GNPA 2GQ9A 1JCXA 4HA0A 5A6KA 3FCPA 1ZBWA 1KM3A 3VDGA 1VFFA 3FYPA 2UY5A 3RPTA 4PFMA 3VKJA 1V0MA 4GIAA 5FJUA 4KEVA 4JN7A 3HMJG 2A6NA 1ZAJA 3UJ2A 4MWAC 3WBEA 4DLFA 3CZKA 3MUCA 5LA0A 1TPH1 3DBPA 2BXVA 4H9TA 3DI0A 1DOSA 3ZSSA 4H6EA 3AICA 1XLJA 1YPIA 4O1BA 1GOKA 4ZOEA 3THUA 3BDKA 5JQ9A 1LLWA 2PWFA 3DUGA 5CBIA 2GJRA 1Q7QA 2XIIA 1SZEA 5M03A 2GVLA 2O56A 3DKJA 2WKGA 5K2ZA 3WLJA 1FX6A 3IJ8A 4O8RA 2DEPA 4Y90A 2CBUA 1XLIA 3UWQA 1ME9A 4PZVA 1XR2A 3BC9A 3SM0A 3UG5A 1EB3A 1VBUA 4ZFMA 3S5SA 1W3TA 4NKCA 4GISA 1ADSA 3FEQA 3RFAA 2DQWA 2ZX7A 3LG3A 4JIRA 4HCDA 3M43A 3AO0A 1KKRA 2A3BA 1B31A 1MNSA 3VKCA 3URNA 2ZTKA 3TLQA 3CQJA 2REQA 4LF1A 3WD4A 1E6PA 1TIWA 1M65A 2PWHA 3KUMA 3W4RA 3MUXA 2J77A 4ONVA 4YWIA 2TMDA 1Q65A 1LROA 1JFXA 3DN5A 4DBEA 3B0YA 1ZL1A 2WK2A 2PEVA 1GG1A 8XIAA 3HG3A 1E3ZA 2V30A 4FXFA 3O06A 2EGZA 4MKNA 5G4WA 1IF2A 1SQ7A 3F1QA 3AS1A 5EL1A 3AMCA 2PCEA 4KH2A 4OIFA 5FF0A 3QC3A 1AL7A 3NQDA 1EDTA 3PFMA 1W5NA 5TD4A 1UBPC 4ZXOA 3S1WA 4D6IA 4QM1A 2A3HA 4MZYA 4QDWA 4FX8A 5BRPA 1BKHA 3TYDA 2WAGA 3QVQA 3CB8A 3PVFA 1E9ZB 4QJ3B 3M1ZA 4I90A 3MZ2A 1EC9A 3I68A 4F2UA 4FIQA 1A3XA 2J66A 1NQKA 4EWND 4IP4A 4JFTA 3VILA 3EKZA 2PDMA 3E96A 4XKYB 1U1UA 3B9OA 4MFDA 2IXVA 3HV8A 3OHIA 4HJWA 3CUGA 3K8KA 1ZUAX 1EUNA 5F4WA 3CPGA 1A49A 1UZ1A 3I3DA 4CQ8A 1GW9A 2J7EA 3KCJA 1Z7AA 2F61A 4LB4A 3RPMA 1U33A 1F9CA 3U3HA 3CIVA 4CD7A 1EJWC 3NPUA 3N13A 5K3VA 4XVDA 2OO6A 1X38A 4Q4MA 1T40A 3T0CA 3TTSA 5GVJA 4U5IA 3SN4A 2G96A 3FK4A 3KBMA 3VGBA 4M8UA 1HL2A 2YSWA 3CQ0A 2P10A 4PCSA 1XPGA 4B4FA 3OGRA 1W2PA 2QCDB 3PSWA 4AMCA 4M56A 3SJNA 3ERPA 1UMYA 1S2CA 2ANUA 2H9AB 1CXLA 4WXZA 4QFUA 3W22A 3W1QA 1WDQA 4DI8A 2ZRZA 5G2WA 2VUNA 3MV01 4R85A 4QG9A 3UXIA 2PBOA 3EMCA 1SM9A 3WLIA 3U2EA 1S5MA 1Z8AA 2FZDA 1T5AA 3O6AA 2GYIA 2FPVA 3P74A 1EP2A 4DELA 1UKTA 3II1A 2NQLA 3TN5A 2GGIA 4OTKA 5A6LA 4WQ6A 4KFNA 3N4EA 4NZ5A 2BWGA 3M41A 5FEXA 1QPRA 5D38A 4XAFA 1JCLA 2R1MA 3SR7A 1JZ8A 2WHLA 3DX5A 4Z1CA 3RM9A 1W1YA 3W27A 4MVAA 4A8NA 1G6CA 1OX6A 4F0LA 3OYZA 1UD2A 3R8RA 1JDCA 4Z1AA 4FF7A 3VM5A 1BXNA 1GYNA 3A12A 4TMBA 3TQ0A 1R0MA 3WJZA 4K8EA 4AC7C 1NP0A 4LOCA 4IUGA 3W26A 5DBTA 4PMVA 2NSXA 4UQEA 3UYIA 4CVWA 2E09A 3WFZA 1UZHA 5GNYA 1A4LA 3KCOA 4NUWA 5ABFA 2DT2A 1VPXA 2OVLA 3VCCA 4IX0A 2FGLA 2QULA 2X16A 5HDRA 3M9YA 3WYZA 3TYZA 2PC4A 4JN8A 4HK5A 2ZZ7A 1N82A 1P0BA 3S5YA 3S5ZA 3NM3A 1VEMA 4IPJA 3GKAA 2CKRA 3KBJA 1QNOA 2BBFA 1LOLA 4NZ1A 3KLKA 3GXTA 3SCQA 4JX5A 2J62A 2G3FA 2FYMA 1AUSL 2GVJA 3VGFA 5B7ZA 5REQA 2FVMA 4NX5A 3GTIA 3B8DA 5A6BA 4I8DA 4NZ3A 3TK7A 2XWEA 3RHGA 1RQEA 1E9LA 4HVXA 5HMSA 3DG3A 1ZTVA 1V6WA 1UKQA 3M7WA 5T26A 3JRKA 5FKYA 3IEBA 4W4QA 4A2RA 3A5FA 3U8GA 2VX5A 5HOSA 1LL7A 3U2OA 2I14A 1IXPA 1R3VA 3OBKA 2E6YA 1H0GA 1CZ1A 4C1LA 1GVOA 1FDYA 3PC0A 3MZNA 3L66A 5JMUA 3LMZA 4QTGA 3P8IA 1YKWA 1E72M 1AL8A 1EJVC 2BTMA 2OB3A 3PSVA 4C60A 3DHDA 2FFCA 2Q3RA 3OIHA 1Q4WA 1FP9A 5G1MA 1P0KA 4AG0A 1FWRA 2DZTA 3LENA 4Z1DA 2ASHA 2EG8A 4S3BA 5G1TA 3LXBA 2PODA 4JTQA 2D73A 1M7OA 2ZZ3A 3WQFA 4O53A 1IQ8A 2DUZA 3BLPX 4TOQA 6PTDA 2ACSA 1YXCA 5DY3A 1MRAA 3MJMA 2X30A 3KZSA 4RW3A 4C7DA 3K4DA 1EDGA 4JFSA 1EA0A 2WJDA 2I1OA 3GYEA 2VX6A 2HZGA 3W1RA 1VBGA 3F4DA 4LUJA 4F48A 1BG9A 1J0ZA 4CCZA 3H7VA 1M9HA 3WDPP 2PB1A 1ECQA 3W7JA 4LAUA 3A23A 6ALDA 2A5HA 4TTGA 5D33A 4HQVA 3E2RA 2NVDA 1O6IA 1ZBKA 1D3CA 1E5NA 3FY1A 3FLUA 3JZUA 3GG8A 4XISA 4QS5A 2YCEA 4AIOA 3K5XA 4JYEA 4N9EA 1OB0A 1YX1A 3COTA 1VFOA 3WK3A 1DIKA 5E93A 2Y5JA 4P8WA 3SAZA 3ZLFA 3VKKA 1EWDA 3WLRA 4I9AA 3DHFA 1ICQA 3LV6A 1Z44A 1B3OA 3AUJA 3CT2A 4EANA 2ZA1A 4DXVA 3C61A 4NSBA 1WUEA 3WLOA 3CQKA 4TIMA 5BW6A 3SSZA 3PZ9A 4A3QA 2PDNA 3NG3A 4WSKA 3W38A 4NRRA 3W3OA 3BG9A 2JK2A 3E2QA 4LAOA 4FR1A 2YLAA 1FQ0A 2YJQA 4QG8A 2IPFA 3GW0A 4M7TA 5TAOA 1SFJA 4AWTA 4H19A 5KSWA 3MO4A 1FTXA 2PCQA 2BS9A 1Z9AA 3BPWA 2V68A 4U4MA 2O9PA 1OBAA 2Q09A 1F07A 1KKOA 2Z2BA 5LNVA 4FSAA 1CT5A 3G1YA 5BROA 1MO0A 2BVDA 4XD6A 5A6SA 4CNPA 3PUGA 4OV4A 3BLIA 1NAL1 1SYTA 3H55A 2Y7DA 4Z2IA 4XZWA 2QDGA 3E02A 2FJKA 1X1OA 1XFBA 4A8IA 3TC7A 2X2YA 1EBGA 3NM1A 4I5XA 4GD0A 3M5ZA 3BSMA 5JH1A 1QK2A 1E73M 4H9YA 3CIXA 4E4PA 3WQ4A 3G1RA 3RO6A 4UQAA 3GRIA 4J2MA 4HTBA 2B7QA 1F6PA 1VIWA 2H3DA 3TTQA 2YB4A 2ZQ0A 4UTUA 1XDLA 2HS8A 1YIXA 3KDNA 1P6BA 2X1RA 4US6A 3OBAA 5HAOA 4O0KA 2OWCA 3WY1A 2A7RA 3ABOA 3GH5A 2XH4A 1Q6EA 5FF7A 4PSRA 5HR7A 2WMHA 1L2QA 4YIWA 5AHFA 3WLNA 1ZJIA 2A85A 3OPSA 1C9WA 1FRBA 4R7WA 6XIAA 2BHZA 5C8BB 3UG3A 1TZ9A 3AC0A 2P0OA 1MW0A 4LCSA 3QXBA 4JL2A 3T6CA 1UWAA 2NXGA 2VRQA 3BZGA 4C6KA 3PTQA 3D3AA 1S2VA 4GY7A 3PB0A 3NOEA 4D71A 3M0JA 2EKCA 4NYUA 3LCWA 1RVGA 4NG3A 1FCVA 2ZRXA 2CETA 5BYWA 3ZYZA 4BFAA 1XKJA 2PGWA 1MUCA 4RXFA 1XDJA 5H91A 1I2QA 4MF4A 2F38A 3PY2A 4KW2A 4J3ZA 1SGJA 3WH6A 3FS2A 1GEHA 1E0UA 2XPKA 3DYPA 3MKKA 1BTCA 2ZXQA 2NW0A 4H2CA 1SJDA 1A3HA 2PZNA 3I6TA 3TE9A 2HE8A 4B5VA 1R3SA 4NAEA 3BG5A 2PGEA 1F3WA 5EGRA 3CYJA 3W1UA 1FFRA 4CQ9A 3VKAA 5CG0A 1WXZA 4QNEA 1Q7ZA 4UOQA 1SMDA 2VZVA 2W0UA 1DIOA 3UD6A 1S5WA 2OEKA 1TTIA 4G7EA 4IP7A 3E0VA 5D9OA 8CGTA 5M17A 1LBMA 2QPXA 2B31A 3DENA 3WQGA 2ZKMX 3THQA 2UBPC 2PDYA 3TW9A 1EUAA 3NPVA 3TFXA 2D69A 2PDHA 2XIMA 1OC7A 2PP1A 2V0TA 4QXIA 3B9DA 2QCDA 3GTFA 1FFQA 5CC5A 3VOGA 1X6UA 3BG3A 2J7DA 2VEPA 3AISA 3BAIA 1QOQA 2CW6A 3VD9A 3F4CA 1OF6A 1DJQA 1A5MC 2O4QA 2XIQA 4GH3A 4GJJA 4O1AA 1OEPA 3LGEA 3TEVA 2YXOA 2FJUB 3GXIA 3L5LA 3U9IA 1AW5A 2XJ7A 3QKEA 3WL0A 2GGEA 4QNWA 4PEEA 2ON3A 2NWRA 2D0HA 1BSIA 4E2DA 4JQAA 1TZZA 1SR9A 5C7HA 1IR2A 1T0OA 3NZPA 5CAHA 2DZSA 1KFWA 4QDMA 5EMUA 3EOOA 4PMOA 3WL1A 2QF7A 4AWEA 4UTTA 2VDIA 3CYVA 2PGRA 3I7SA 4LGXA 2VURA 3SI9A 3O6YX 1UKSA 3OZPA 4O14A 3CM4A 4ZENA 1N2VA 1JL8A 1MW1A 1B90A 2YKKA 1EKOA 4DWDA 2PBGA 4U2YA 3VC6A 5KZEA 5DCEA 5CSYA 3USBA 3VCNA 5IDZA 2YBTA 1MDLA 4S38A 2F7FA 4QX4A 3VCRA 1IGWA 2D23A 1U5HA 3TYBA 5AHNA 4IPIA 4XZNX 3P67A 3B4UA 5FIPA 3M7SA 5BWFA 4H9VA 4B92A 4CCEA 1OCJA 1V7YA 3VDBA 2E1DA 4UTKA 1G4PA 1V0LA 1Z89A 3ZM8A 1OABA 1T6MA 1OC6A 4PRRA 3SBFA 4BY3A 2HQAA 4QS6A 3DFYA 2IQ0A 1ZJHA 3ITCA 1A5KC 3EX6A 2CWNA 3G24A 3PWIA 2WVSA 2HMCA 1IEXA 4G7FA 4C1KA 4PE8A 4PUNA 1AMKA 3ZVHB 3A4XA 1H2JA 1KA9F 2W67A 1VJZA 4KWOA 1KXQA 2PD5A 4LV9A 1E0VA 2ONEA 3VIFA 1TMQA 2FGZA 1RQHA 3AYRA 2EHHA 3B9AA 4ZSUA 4MGGA 2OT0A 3O16A 4MAZA 3RRXA 2G3IA 3C2EA 2ZRWA 1ZJAA 2H6RA 3GC2A 1XGDA 3XISA 2ABAA 1HKWA 3G1AA 2OMAA 2EXOA 1JDDA 3S2CA 2V5CA 3AI0A 4J3UA 4ES4A 1KWKA 4Y9OA 4MDOA 4R7OA 2GSHA 2AAAA 1GVYA 4U3CA 1V79A 4KCUA 1NWTA 4L9YA 5KZ6A 3APTA 4UMAA 4AD3A 3H24A 4ENLA 1FWCC 1VFTA 4H4IA 3BJTA 4GUFA 1F3TA 3P84A 4EXAA 2NXHA 4W86A 5FJPA 4PL1A 1Q2RA 1DHPA 3EXRA 2PDXA 4XD3A 2ADAA 4O54A 3V5OA 2ISWA 2YPIA 1LT8A 2Y62A 3NR0A 1UC4A 1ZRQA 4GOAA 1H60A 1VFSA 1J93A 3G0UA 4MB5A 2PGFA 3BSGA 2YCIX 3I3EA 3H7RA 4HMDA 4QIUA 5FSEC 1P1XA 1G94A 4UQDA 3SUTA 4EACA 3JVAA 5JIPA 1US3A 2ZXBA 4CEXC 2BY3A 1W17A 2J8FA 4S3DA 1W5PA 4X22A 4L4OA 4QG6A 5U7SA 3DFOA 4UC5A 4NJHA 3OO2A 3MMDA 3VNIA 3M6DA 4XX6A 2YDRA 3PJXA 4DO5A 5E0KA 3AJXA 3DESA 4P61A 3REQB 4ZOBA 1X7FA 1O1HA 1QO5A 3UZZA 1QR7A 1B3WA 3C86A 3CO8A 3N12A 3H23A 3OZYA 4OWGA 2P0IA 4H8UA 4LH8A 4MPQA 5HWJA 3IJLA 1S5VA 4EF8A 1UKOA 3PJWA 1XIEA 3RR1A 4HKPA 4PULA 1ISZA 3WD2A 1QNSA 4XBSA 2I9UA 4DJFC 3HTWA 1D8CA 4AZIA 1Q8JA 3T9PA 3EBVA 3URBA 4GWEA 1I0BA 3SGZA 2E8YA 2ZZ6A 1JAEA 2D2HA 1E56A 1G4SA 2JF6A 2Z1VA 1DJNA 1CBGA 3OVQA 1VGAA 1HJWA 1PTDA 2CZEA 5FOOA 3N34A 1GQLA 3R58A 3VNDA 2ZUUA 3P7YA 1JDEA 1CXKA 2YZRA 2D2OA 1UZDA 3ONBA 5HATA 1DORA 1LF1A 1EEPA 4C6LA 3G3DA 3T1GA 4ACZA 2OSXA 1XRFA 3KL0A 4DYKA 4NZ4A 3NGJA 4ERAA 1ONRA 2Q02A 2A0NA 1R85A 3SCSA 3QMRA 1H49A 4JTDA 3RXZA 2AOSA 3QQ0A 1RV8A 2HRWA 3KLLA 1O1ZA 1QASA 4I5RA 1EBHA 2WANA 5BU9A 5H8MA 3UA3A 1OD8A 5C9WA 3S9ZA 4W8AA 1ZBCA 4Q4OA 1QBAA 4EIVA 5HANA 1B3VA 3HG5A 3STCA 1E1CB 1XLEA 4IG2A 1HNYA 1PZ1A 3NNTA 3OG3A 2Y7FA 4IIDA 1TPDA 4WDUA 5I3FA 5AKQA 3CS2A 3LGGA 4PMNA 3CO4A 4F0SA 3C0JA 2B81A 1GOOA 3BK0A 1XS2A 3AQUA 4MADA 1XYZA 3ORWA 3KBSA 4HA3A 1H61A 3T7VA 3MP4A 5CJ5A 4M0XA 2EO7A 2ICSA 4FA3A 2J6XA 2D24A 2C79A 3KX6A 3R6IA 5FAGA 4AC1X 5FEZA 1RA0A 2GUYA 4WGXA 4REQB 1WCGA 1Q45A 3UG4A 4KEUA 1SZFA 4KFPA 5BCAA 5LGZA 1X8CA 3WDIA 4OT7A 1S5TA 3TFCA 2Y2WA 3LPGA 4L1WA 3W7IA 4YTTA 2EPKX 2QW5A 4W5UA 4JDYA 3W1AA 3AOFA 2PTXA 1PUDA 4MWAA 1KXHA 3FSTA 4G6CA 1R3WA 3MDUA 5I79A 3IIVA 4RNJA 2FZMA 3LPOA 2P3ZA 4W7VA 3TOYA 5A1AA 4QQ3A 4NAEB 1CI1A 5EMYA 4NXSA 3RU8X 3T0BA 1VH7A 4Y9PA 3H54A 2QCEA 4BI6A 1OHLA 3S47A 4ORMA 1H7WA 1GONA 1TE1A 4UZSA 3LHVA 4E5TA 4XZMX 1XYFA 4KWSA 1RALA 5HNUA 2DT0A 1EWEA 2GWNA 1NFPA 3T55A 4E8DA 2GDQA 1SSDA 3P61A 2VFEA 4IFRA 3SY1A 4PUUA 5MKGB 1A5BA 2CLMA 4PH6A 3UBPC 3LHUA 2TSYA 1VLWA 1UW9A 4GX8A 3Q37A 4NNCA 1TWIA 4A6GA 3UJRA 1FA2A 3BXWA 2EPHA 3BGAA 1CENA 3GQYA 5KEZA 3QM3A 3NYZA 1BHGA 1TUFA 1WDSA 1VEOA 1W5MA 1NELA 2PWUA 4ATDA 4M6PA 4C6BA 4AX7A 1KGWA 1O5KA 4S3CA 4A21A 3WKZA 3QZAA 4UQCA 4HOWA 2JGQA 2QUMA 1FH8A 2FLIA 3P5YA 5LGXA 3BWWA 3CT7A 3GW3A 3L4UA 4F8XA 5BWAA 3VVGA 4Y8FA 3D47A 2JKEA 3W7MA 1UKPA 3F2DA 4QEHA 3R94A 3MJYA 4JTCA 1LRQA 1E4IA 3ZQ9A 2AQVA 1TV4A 1TMHA 3SCPA 4HU4A 3T0TA 4GVFA 2VGIA 2ZUVA 4L80A 2VGFA 1E51A 2D2GA 5ABTA 3IJQA 1NOWA 3OP2A 1V5XA 3QZEA 1B57A 1RP9A 1ZNNA 4D6JA 4D6CA 3RLHA 3RX2A 3W84A 1JUKA 4IQJA 4R34A 4O15A 3V5CA 1LQ0A 1O4UA 3CBWA 3L4ZA 1Q5MA 1ODZA 1TPC1 3DHPA 5A2AA 2V38A 3BCFA 1QOXA 4AY1A 3NQVA 1N7KA 2BY2A 1NP2A 2V5KA 4FOKA 4DWSA 4NHVA 3VAVA 2QF8A 3GG7A 1QI4A 1UR2A 1J6OA 3O6DA 4KF1A 3EDKA 4LNYA 2YDQA 2BVYA 4RL3A 1TCDA 3EB2A 4JQ3A 1UD3A 3K8MA 2C91A 1VD6A 4UTLA 1VFHA 3AS2A 1CTNA 1SFSA 5HPOA 1IGSA 4WEVX 3KRSA 3GD6A 4JKMA 1ONEA 1PPIA 1CIUA 3L4TA 4AXKA 4E3VA 4N9DA 3R89A 1F74A 3THDA 4QITA 2F9RA 5K4ZA 1EH9A 1I9CB 1M7XA 2XYLA 1GG0A 1IWPA 3T2OA 4Z2JA 3DI1A 4IL0A 1YNPA 2CHOA 3HURA 3OOQA 4QISA 2A7NA 2O55A 1L6YA 3WH9A 4AMAA 2I5GA 3XINA 4HNNA 2WSYA 3NPWA 4P7RA 2JIWA 1XWYA 2OG9A 3DXIA 3LYEA 1FWHC 1E71M 3MHFA 2F2KA 1OT1A 2X7VA 4ROQA 3WUEA 1MQPA 3BQ6A 3L5AA 3SCRA 4D72A 3QTGA 4FOUA 5HA7A 5TNVA 3AHVA 1SMAA 4WX2A 4DZAA 5A2CA 1E0TA 3CZEA 4Q6JA 3WLSA 2R1NA 4QP0A 2P50A 4QJ1A 2NV9A 1AH0A 1D3GA 4Q8OA 1HF6A 1VB9A 4JX6A 2WSPA 5LIKX 5ECUA 4Q8TA 1AODA 1C8YA 2POTA 3V0UA 5A6AA 3FA4A 3CHVA 1R38A 3S5NA 1XH2A 4WY0F 3E0WA 4ZZ9A 1UYQA 1VRXA 3KBWA 4BQ5A 3S9IA 3BMWA 1UOKA 2CWXA 3N9RA 1MEHA 1DYSA 3MUY1 2GVGA 3C4UA 4HZ7A 2YA1A 1FH7A 3T8LA 3M0MA 2ZIDA 3OZOA 4C6EA 4IMGA 4I7VA 4K6AA 3EMQA 4LVBA 2ZC8A 1EP3A 1QXLA 1GORA 1DJWA 3PBMA 4FLQA 2QUVA 4HIBA 4RX0A 3QY6A 1QFEA 2IUZA 3W1TA 3AWNA 4BK9A 3SQMA 4E2VA 4WY0B 2Y89A 3P6LA 4QE4A 1BFNA 2WWDA 4IFKA 1WDRA 4JAWA 3AUOA 5CBBA 4JHMA 1PHWA 2OXNA 1VLIA 4ZMGA 2CCRA 4US5A 2W91A 1DE6A 2DZPA 3BE7A 3MYOA 3VIJA 5FJRA 1CDGA 1NQ6A 4HSNA 4I3GA 5CPNA 3K1DA 3N29A 3WJXA 4A05A 2B7NA 1K3UA 3S1UA 2VGGA 4PCNA 4HZ6A 2A6LA 3UJEA 3UERA 3W28A 3S2NA 5CJNA 2OFJA 4RPPA 3IVUA 4PRWA 1XF0A 4H9XA 3VPLA 2QKFA 5I3KA 5DY2A 2O0TA 1X1ZA 2DZVA 3M46A 5D9NA 3FHQA 3NQMA 2OLHA 5IBXC 3HA1A 4HN8A 3GG0A 3VXGA 1CLXA 4DZ5A 1QATA 3PK7A 3E38A 3C0LA 2CLHA 3HQOA 1VC4A 5BRQA 5D8ZA 1OCQA 2EBNA 5C54A 2J7HA 1PB0A 4YJ5A 3SUVA 2HPMA 3WLPA 1JZ6A 4ZSTA 5AYIA 1R46A 2VC5A 3L4YA 3MU7A 1S2TA 2ISSA 4FEZA 3ZR6A 2GDVA 2UWFA 5IXEA 2OODA 1MXSA 1JQXA 4HCLA 1KGUA 2IKHA 4RR4A 3WLQA 4DUVA 3W88A 2IPJA 2YA0A 4PMRA 3VTRA 3KRBA 5C9UA 5I02A 3W25A 1MZRA 4FLOA 4CU8A 1T99A 1Y5VA 4HNTA 1I4NA 3F5KA 4ZOCA 1XQLA 2OSWA 5LNWA 2W62A 2HTMA 2XM2A 5CPSA 2Z27A 4Z0JA 3A9IA 1H7RA 1UH4A 1E5JA 3EKGA 4GC3A 4GKTA 4UR9A 3QLDA 3TONA 5CPOA 3RK8A 1XHGA 1BG4A 4GO9A 1VQTA 3IJ9A 1EDQA 2OOGA 2FMOA 3BQ5A 3GVGA 4Q7IA 2QV4A 5AC7A 1S2AA 3BO9A 3UETA 1VJSA 4Z1BA 4B15A 2W61A 1M01A 1I2RA 3RMEA 1TZ7A 2OX4A 1L6GA 4P5UA 4N2YA 5C2CA 1B0IA 3VMPA 3TYUA 1WZAA 3QSTA 1GJPA 2AAMA 3JZEA 3A24A 1W9UA 2C14A 1XLDA 1IT7A 4A3UA 4YS1A 1BVWA 3AIUA 1GCYA 1N8IA 4AEOA 1W91A 1E6QM 3HPXA 5DQPA 5FAJA 1IZKA 5HK4A 2WNQA 2FVLA 4RK8A 2D2JA 5AB3A 1R3QA 1S39A 1TJPA 1UA7A 1AG1O 1JQVA 4JTAA 1JI1A 4GG9A 5M3WA 3UWWA 4TR9A 4M82A 2OEMA 1UHVA 3E5BA 4TVCA 4H1ZA 4H41A 3SCNA 2D20A 5EY5A 3R2GA 4JYDA 5LNSA 4GYJA 4UCFA 1REQA 3W7QA 3VA8A 1TR1A 4QJ5B 4OHQA 4RXGA 3HIJA 3LMYA 2P8BA 3O07A 3GLCA 3L68A 4WJXA 1ZFJA 1JF5A 5E1QA 1WNOA 2EPNA 3M07A 4MY9A 2J7CA 3VD7A 5DLCA 3LSCA 3LZ3A 1AQMA 3UNDA 2ZE0A 1EO7A 3PPFA 1E9IA 1XV8A 3EWYA 2ESCA 3KOYA 1H5YA 4ZR8A 1ZPTA 5KETA 1X96A 3NOYA 1B4EA 3BURA 1XLMA 2QCGA 2WMJA 4MJMA 3AYSA 2NV1A 3VOJA 2RDTA 3DIPA 3PANA 1K6AA 1W6TA 6ENLA 4HGXA 1XM3A 3VE7A 1I1XA 2PF0A 2DW7A 3Q2DA 2DSZA 3F5JA 1G1YA 3VD3A 3E0FA 4DZIA 1PBGA 4Q8QA 2OLAA 1Z42A 2YFOA 4GXMA 2FHBA 3NL3A 1EXPA 3FNDA 1V0NA 1GW1A 4DB7A 1TTJA 2X8RA 3LRLA 3LGDA 4K2SA 4B3LA 1Q6GA 2IPGA 3A13A 3EEGA 5K9DA 1Z48A 4PMXA 5A2BA 3LCFA 4K37A 1NH6A 4JGDA 1J0KA 4Q4QA 4JDBA 1SO4A 5IFPA 1DTUA 1H0IA 2DFAA 2FTWA 1E6RA 3GUGA 4NILA 2WV8A 5TQLA 5I06A 1DJIA 2V6AA 1BQCA 1I2NA 1JEZA 3EPNA 3N9KA 1BYBA 4IXXA 3TR2A 3FHAA 2GJXB 1W56A 7REQB 2ZX9A 2XN2A 4EPDC 3SY8A 2GOKA 1XL9A 1OG0A 1YHTA 2AL1A 3LI1A 3TNBA 1PKNA 2C0HA 4LAKA 4CNUA 1X8FA 1ZSXA 3E12A 3SRHA 1L9WA 2YOCA 2KAUC 1AQFA 2VR4A 5LNRA 2O9RA 3EAUA 4LVAA 1XYAA 2X40A 4AH7A 1E6ZA 1J8VA 3EEZA 1WKDA 4IGSA 1PHQA 3UWYA 3M0YA 1Y5WA 4IJBA 4BF9A 4NY2A 2ZZ4A 4MJ2A 3CTTA 1POJA 2YCLA 1SFLA 4GNJA 4PB4A 4D8ZA 3PTMA 4YCOA 1VS1A 4JKLA 4HZ8A 3TP4A 1FKWA 2CHNA 1XIFA 1TUXA 1ME7A 3U6WA 4DYJA 3E6EA 4IZGA 4KETA 4PUEA 4H8NA 2DW6A 2ACQA 1PJ9A 2GVEA 2XGIA 4Q7BA 5AYXA 2A3AA 2IKIA 4FK9A 1P0EA 3UY8A 3WEZA 1DBTA 5D2VA 1OCBA 4E38A 3UF9A 1SO3A 3NQEA 2QPSA 1GZGA 4FOJA 3N11A 4LXFA 1KRMA 1TVLA 1D9EA 4U3AA 3NDZA 2OYLA 5DN1A 1OGGA 4GY1A 3STGA 1XICA 1QRQA 3N3TA 3W7HA 2YZ5A 1ZJBA 2GWGA 3IK4A 4E8GA 5AYYA 1TA3A 3UZJA 3VI2A 2OCZA 1B3YA 5C70A 1MEIA 3D46A 1KCZA 2WQPA 2QDDA 1YW1A 1OYAA 3K1GA 1QPNA 2PDPA 1HN1A 5I78A 2WNWA 4AD1A 3C3NA 2GGHA 1KXTA 1X7IA 4LALA 3NDYA 5A8NA 2YA2A 3GXFA 2JBMA 2V3DA 3YPIA 1UUOA 3PHAA 4P2VA 3UY7A 5MF5A 4TQTA 1V6VA 4E6MA 4HMEA 4AXNA 3TC6A 4H9MA 4GI4A 3W75A 4DZHA 4CNOA 4ZQNA 3VNKA 1J18A 4LY8A 2QCHA 1TR9A 2EEXA 1M5WA 1RK6A 3CK5A 1OSEA 2OX1A 4LEQA 3NO3A 3WQ8A 3CLMA 2ODOA 4NRSA 3G0XA 4NZFA 3D6NA 3TYEA 1WB0A 3N14A 1SFTA 4LSBA 3GH4A 1DIDA 2O7SA 3H2OA 1YNYA 2MANA 3W83A 2WB5A 3IJ7A 3S0CA 4JYFA 2VC7A 1LZOA 3BV4A 5DRIA 1PZ2A 1K03A 2VX4A 4O12A 3D0CA 3GFXA 4LC8A 2VJXA 3EYPA 4AD0A 2YIHA 4AWUA 4L9XA 1AH4A 4E3TA 1FWAC 2HDJA 2HVNA 4AFYA 4PUKA 3GU2A 3UESA 3WN6A 4HOXA 2YL8A 4NVTA 1EPVA 4JFUA 4HMCA 1RR2A 1CGTA 1R7OA 2YBUA 1ML1A 1TQXA 3UXAA 3MA8A 2PTYA 1LUCA 4O1CA 4GBUA 1Q6DA 3VIOA 1ZCOA 2QCFA 4HJFA 4ML9A 6TIMA 5A3HA 3B05A 4J4KA 3GFZA 2OGYA 2IS7A 2OZ3A 2VCCA 3DC8A 1UP3A 3TW6A 4AY8A 2AMXA 3SY5A 3WF2A 2NT0A 4N4QA 3GR8A 1TCMA 1V03A 3MSGA 5I3JA 4V15A 3LI0A 3N17A 1JYWA 1C7TA 1LLZA 1GYLA 2X1SA 3PAOA 3M0XA 4ALDA 4XK2A 1EC8A 3PG8A 4RZBA 4D1JA 4B91A 3CC1A 3U0HA 1O95A 1XD1A 4M6VA 3VINA 3TSMA 1WOBA 4UWMA 3BW3A 3A6OA 2VENA 2FTPA 4QGCA 4XKYA 4NJKA 3WLLA 1ICSA 1FHLA 1LUCB 1PV8A 3DZ1A 4GRSA 4YCPA 4Q8WA 1RUSA 5FCZA 2WC3A 1DPMA 9RUBA 4PMYA 3K30A 4I6VA 3N3MA 2DZUA 4OQVA 3IIPA 3SO7A 3GVVA 4K1GA 3Q45A 3KOXA 5EU9A 3V5FA 4OU1A 1RY8A 1EQCA 2HXUA 4URIA 3LU2A 2DZWA 3L4WA 4KQNA 1UMLA 1K4HA 3JU2A 1W9BM 1XUZA 3L9CA 3LTPA 3T0DA 2XUCA 5DMLA 4OKDA 3MKVA 1E55A 5I0DA 4MWAE 4Y7EA 2DORA 3UGRA 3CV1A 3GAKA 3HN3A 3RMJA 3SURA 1FBAA 3WF1A 1C29A 4UTWC 1NOFA 4RE4A 4AZHA 3EXTA 1KRAC 3GYCA 1S2UA 4JEJA 1RCQA 8TIMA 4KESA 3QFEA 1KRCC 4HPJA 2B4GA 2Z00A 2EPOA 3I7QA 3SN0A 3B3DA 2ZE3A 3C2OA 4HPXA 3W7RA 5LHEA 4DM1A 1KM4A 3KBVA 2QJIA 4EXBA 2Y8VA 2GSJA 3UP8A 3NQAA 2YXGA 4UXDA 2ISDA 3N19B 1CXIA 3LQGA 3O0FA 1UOZA 3B0PA 4O19A 3WELA 3KS6A 2BLEA 3HPZA 3R8HA 4ATWA 3LY0A 1DQWA 4LVGA 4F40A 4JX4A 4BF7A 3VNYA 4IMAA 1EJUC 1P0DA 1V7AA 4HN4A 3R7MA 3W1PA 1TTPA 4ZTYA 1H7OA 3L4VA 3C2YA 1BF6A 3ENLA 4GZEA 4I7UA 1BWVA 1R9YA 2VYOA 3GY1A 4GY0A 3N6JA 4CD6A 3GK0A 3GHUA 3ANVA 5G5IA 3PAJA 1CNVA 2OZ8A 1TV5A 4AZGA 2FIQA 2Z25A 1J01A 1V3HA 4MM1A 5BMXA 1HP5A 1AH3A 3GTNA 3WNLA 3H26A 3ES8A 4GYKA 4FXRA 4ZVJA 1J12A 3UCDA 3GIPA 3LCLA 2DJXA 1LQAA 3V16A 4KWWA 3PG9A 4BQ2A 2WVVA 3NQ7A 4J40A 4UFLA 1JI2A 1IEIA 2A4AA 4NAFB 3MC5A 3INPA 1C92A 2BFGA 3LTYA 2BSLA 3AHTA 1LOQA 1AZ1A 3PR2A 4IIFA 4KWVA 3A9BA 4WD0A 3H21A 4M6UA 1KBBA 2Z28A 3NSNA 1WP6A 3W00A 3WK0A 3LQLA 5I3GA 1GZJA 4GI9A 4DAIA 1CCWB 5D2YA 1TV7A 5JBDA 2WJZA 3HJEA 1QBBA 3WEMA 5BXPA 1JCYA 2HCVA 3S5OA 3VD5A 4ZQOA 4LAZA 4O4WA 1US2A 1BXCA 4O0QA 2NLYA 1E43A 4XQ6A 4GC4A 3QPZA 3UVAA 4C7GA 4R3UA 1GVSA 1P7TB 1IV8A 4XO6A 1UA3A 7ENLA 1HW6A 4AYSA 1EXBA 2XH2A 1W0MA 2J8GA 4PMQA 3W2UA 4HB7A 3KAOA 4YTQA 3L67A 1QWKA 5XIAA 1TREA 1EOKA 1OK4A 1H7XA 2WW5A 3G77A 1S2WA 4GYFA 3UPBA 1U1JA 1XBVA 1ZQ5A 3HF3A 1MI3A 4MLRA 1NFGA 2IXUA 3N15A 3BW4A 3EOEA 3H2MA 1PL9A 3WLKX 1OX4A 4UTMA 5BOFA 4BJHA 4CU7A 3BICA 2C13A 5D03A 4D1IA 3NTYA 4M81A 3NO5A 2BOEX 3SECA 3MHUA 2J8TA 4C5YA 4UNIA 3GXNA 4HPNA 2UZ9A 5JXQA 2F6UA 4I9JA 2PI6A 1N55A 3OGSA 3NEVA 2PPGA 4Q4PA 4H01A 3TN3A 3O0KA 3P2VA 3EDJA 5BNKA 3I6EA 3UT0A 1GYMA 1TKKA 3JR2A 3ZSTA 5HXMA 5D4YA 5D2TA 1TWWA 1P1MA 2RJGA 4NX0A 1ZALA 2VFDA 2OR2A 4I6KA 1GPWA 3C6CA 3K4WA 3KP0A 2WLYA 3BUVA 3ZT6A 4QE5A 3W9ZA 5K9XA 3OIXA 2GQ3A 1MFVA 1PO9A 1OX4B 4P7OA 1K6WA 4QBXA 1HKVA 1PIFA 5EMKA 4EP8C 4DM2A 1EO5A 1DV7A 3MUAA 4UMBA 4AZ7A 3VIIA 2G3JA 5FJTA 2OQYA 5HQMA 2PDGA 1CB2A 1G01A 1EYWA 4ZOAA 2Y88A 3VNLA 3SQLA 2R91A 3VABA 1VFLA 4YNGA 1ECEA 1VZWA 3TQVA 4P8UA 2G3NA 9XIMA 1ZENA 1KBLA 2XGBA 4PGLA 1UWSA 3CU2A 2WNZA 2WC4A 4M1RA 1J96A 5EMMA 3QW4B 3UVIA 2A3LA 4GI6A 4WDTA 3TJ4A 2PURA 1RCOB 3N73A 3VU2A 1R47A 1WO2A 1P5BA 3FJNA 3AALA 2BASA 2XN0A 4S23A 1OC5A 5DMYA 2ISVA 5CCZA 3M6YA 1JG9A 4WDXA 4XAGA 1M04A 3DHUA 1OFAA 3KRZA 4HTYA 4CCDA 4B16A 1E4MM 4K38A 1G7VA 2QCNA 3W7CA 1K1DA 3H2EA 1TVNA 3AMLA 3GNXA 3W37A 4MJ4A 4R7JA 4RJEA 2ZX5A 4AZBA 3AMKA 3WZ0E 3GSMA 1E70M 3P3BA 4OECA 2V67A 1LG1A 1J5TA 1DJXA 1ZY9A 4R33A 3W2LA 1IXNA 1Q6QA 3ZJ6A 4EOUA 2VXNA 1RD5A 3ELFA 3QTPA 5EKYA 1TJ2A 4Q6XA 3TYAA 2FB3A 4PTWA 1XLBA 3TTOA 4BWLC 1KLYA 3ABQA 3ARZA 3W1XA 2E77A 3E3HA 1KM1A 1UC5A 4UB9A 1JDFA 5AC4A 3T40A 2NUXA 3L2IA 1UIPA 3UCCA 2UY3A 4AZCA 7XIMA 3IK2A 2XFYA 4Q8MA 4RE3A 2GPTA 3TXZA 3CV6A 3BANA 3CUZA 4O52A 2PDBA 4BWLA 1QO2A 3NZQA 1DJZA 4H6RA 3TZFA 1VEPA 1H50A 1MMFA 1BVZA 2IQDA 2FB2A 2QIWA 3SB0A 2ZCGA 3W81A 2W66A 1LP6A 2WLZA 4JHOA 3DYMA 3V18A 1PZ0A 2E6FA 3GC4A 2NUWA 3WSUA 4BQ3A 4OUIA 4W7UA 4CCCA 3PP7A 3HGOA 1EC7A 2P76A 3DBNA 4C65A 2H9AA 3EPOA 1M68A 2J7FA 2OZTA 1UP0A 1V51A 4RLIA 3LB0A 4MY8A 4ILSA 1B9BA 3PZGA 2BOGX 4CNSA 1F8IA 4EF9A 3MW7A 1O66A 3TMQA 4MAVA 4L6DA 2J6VA 3NL5A 1TX2A 3PM6A 5F4SA 4DAFA 4NP7A 3VOCA 4QHRA 1DE5A 3BLLA 3WH5A 4XUGA 4EAMA 1FHUA 4L1XA 3CZLA 2JEQA 3LX9A 2WZMA 5C71A 2DIJA 3OLGA 3RGTA 1UH3A 4A8LA 4PMJA 1C7SA 5HUOA 5JU6A 2XZ9A 3KDOA 4XUYA 1R6WA 2G50A 3PPHA 3QW3A 4EE9A 1XLFA 1WKYA 3S2MA 2FZNA 3LCGA 5FL1A 9XIAA 1IEWA 4PC8A 1YMYA 4YVPA 4OUEA 3O15A 5F2LA 2EKGA 4O8AA 3IGUA 2X09A 3OEXA 3IACA