3TC3A

Crystal structure of sacuvde
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
289
structure length
289
Chain Sequence
b'HMRVGYVSTNYSLGCKADKTIKLSSLSEERVLKVSSSNLLCLKNILEWNLKHEILFFRISSNTIPLASHPKFHVNWKDKLSHILGDIGDFIKENSIRISMHPGQYVVLNSVREEVVRSSIMELKYHADLLDSMGIEGKIQIHVGSSMNGKEESLNRFIENFRKLPSNISKRLVIENDDKVFSVKDCLWISERTGIPVIFDNLHHSILNNGESLNDALSLVRRTWKDRPMIDYSEQEPGEKPGVHATTINEENFRRFVNEVDEVDIMLEVKDKEISALKAVKVLKELNKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UV damage endonuclease
publication title UV damage endonuclease employs a novel dual-dinucleotide flipping mechanism to recognize different DNA lesions.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Hydrolase
total genus 123
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature ec 3.-.-.-:
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03851 UvdE UV-endonuclease UvdE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3tc3A00
3M0XA 1TZ9A 3KBNA 5EMJA 1D8WA 1XYBA 3U0HA 3IUDA 2GVEA 2HCVA 3M0HA 4X61A 4YTTA 3UA4A 3CQKA 3CNYA 3P14A 4ZB5A 1XIDA 3KWSA 2XISA 7XIMA 3ITVA 4QE1A 2HK1A 3JU2A 3VNLA 3ITTA 4EAYA 3P6LA 3AALA 1I6NA 1XLFA 2QUNA 5FA5A 1A0CA 4GJJA 2ZDSA 1DIDA 3C0QA 4QDWA 4XIAA 3VNMA 3XISA 3NGFA 9XIAA 4XISA 4XSLA 1MUWA 4J4KA 1A0EA 4DVOA 4XIMA 3XINA 1QUMA 1XP3A 5AVNA 4PFHA 1O1HA 4QEEA 4A8LA 6XIAA 1XLLA 1XYAA 2XINA 3QC0A 1GW9A 4G56A 1XYLA 1XIBA 4HHLA 4QEHA 2I57A 4OVXA 1DXIA 3KBWA 5I7GA 1XIMA 5B7ZA 4K1GA 2J6VA 4GJIA 3TC3A 3ITLA 3KBSA 3M0LA 1S5NA 1XLKA 4YTUA 4LNCA 2QW5A 4Q7IA 4XKMA 4HNOA 1YX1A 1QT1A 2GYIA 4K3ZA 1DE5A 3UU0A 3VYLA 1XLEA 3UXIA 2NQHA 3VNJA 4W4QA 6XIMA 3FVMA 1CLKA 3XIMA 4A8RA 1DIEA 1OADA 1XIIA 1DE6A 3C0SA 3ITYA 1XICA 3M0YA 2G0WA 1XLJA 1QTWA 3BWWA 3CQIA 3KBJA 4X60A 4EACA 4DUOA 1XLHA 2OU4A 1BXCA 3BDKA 3UA3A 4GLEA 4XSMA 1XLAA 3IUHA 4ZB0A 2GUBA 3DX5A 2NQJA 1XLMA 3C0LA 4QDPA 3DBNA 1XIJA 3CQJA 3KTCA 1S5MA 3ITXA 1XISA 2G4JA 3M0MA 1XYCA 3AAMA 5EMKA 8XIAA 1XLCA 3IUIA 4YTSA 3KCOA 5EMLA 8XIMA 4A8NA 4HGXA 2GLKA 5XINA 3UVAA 1XYMA 3QXBA 5B7YA 5TNVA 3BZJA 5H1WA 1XLIA 2Q02A 3BANA 3U3HA 3VNKA 5AVHA 2X7VA 3M0VA 4KW2A 1XIFA 4HHMA 2ZVRA 4ZB2A 4A8IA 3AYTA 5EMMA 5C9ZA 4GQBA 4ZBCA 1XIHA 3AYVA 2XIMA 1XIGA 3BZGA 3QYSA 3KBVA 4QE4A 5XIAA 3LMZA 1MNZA 3CWHA 4PGLA 5H6HA 3N4AA 3TVAA 3KBMA 1K77A 3QZAA 1I60A 1BXBA 3KCLA 5J8LA 4US6A 2NQ9A 1XLDA 9XIMA 4E3VA 3OBEA 3CQHA 3WQOA 1A0DA 1XINA 2HK0A 4YTQA 2QULA 3VNIA 2I56A 1XLGA 3KCJA 4X63A 4YTRA 5B80A 3L23A 1XIEA 2QUMA 1XLBA 2X7WA 4QE5A 5XIMA 3ITOA 3GNXA
chains in the Genus database with same CATH superfamily
4I7WA 4QIUA 1Z32X 4S39A 3T44A 4L56A 2HCVA 4JTGA 4GXPA 2EHHA 4QNWA 3VX0A 1EHAA 4GXMA 4NAFA 4OTKA 1BWLA 3L68A 3R10A 1QNRA 1OG6A 5LA1A 2UBPC 4DLFA 1XYAA 1V8EA 4ZOCA 3MVIA 2WJZA 4XD5A 4W87A 4GJ1A 3MYOA 2XHYA 3NO3A 1NU5A 4Y90A 3IV8A 1W1IE 4Y7EA 1MUMA 4JNZA 3GVWA 2X1UA 1C9DA 3K30A 1E1CB 2GJPA 5IM51 1LUCB 3B9DA 1GVFA 1OC6A 3RIKA 4NZCA 1GG1A 2CC0A 1TREA 3W6LA 4XZHA 4US5A 1X6LA 4PRRA 4MY8A 3UWUA 3GKAA 3N2MA 5FJOA 5E0FA 4A22A 1AH3A 1JRCA 1Q8AA 4ZB2A 5FJTA 4GYFA 1B4KA 3HN3A 1KTBA 1MDRA 2GQ3A 2QYGA 4UTTA 1Z6KA 3I6TA 4HP5A 2FPTA 3RYSA 3N15A 2O7QA 1Y65A 3F2DA 4H8NA 1BQGA 1U1HA 2GSEA 3B9OA 4A05A 3VC5A 3KVLA 4KH2A 1NOUA 3UERA 3TC7A 4FLQA 3KHJA 2Y1HA 4ZE4A 2JKPA 4UWMA 1N2VA 4I9TA 1R5YA 5FSDC 3HQPA 2A5HA 2ZKMX 4NIRA 5EKYA 4IPNB 4JFVA 2CIPA 3CHEA 4TO8A 3NQ8A 3QV9A 5E70A 1IQ8A 1FCQA 3E6EA 1KBLA 1NWTA 3WQ4A 6XIAA 4LAOA 2QUVA 2EAWA 2E8ZA 1DKWA 4F48A 1W3KA 1XIMA 1ITCA 2PTDA 4KGJA 3WIJA 2J75A 1ISYA 5A6BA 2YB1A 3KZPA 2X1TA 1JYWA 3Q58A 4ZENA 1JRBA 4M82A 1JGIA 1OADA 3PULA 4LV9A 1RPKA 1XLAA 4ZTYA 2IKJA 3F5KA 4XTIA 3OBAA 4JL2A 3VX1A 4JIRA 2G4JA 2PDBA 2E9BA 4EAMA 1GOWA 2AMXA 2BHUA 4QQ3A 4MPQA 1JZ4A 5D2WA 3NYZA 2QJGA 1NDZA 3R8GA 1PL9A 4OJYA 3PZGA 4M8UA 2PDYA 1S2WA 4TR9A 1XLDA 3SM0A 4CCZA 3R94A 4MADA 1A5MC 4QCFA 3GWQA 2RGLA 4B91A 4B3LA 2O92A 3W7JA 3GXIA 1HL2A 3ARWA 4AVNA 2XU2A 1LQ2A 2EF9A 4DYJA 4IIBA 3R43A 1JPMA 3UZWA 4EAYA 3ZYZA 2JF6A 3B97A 1NY1A 2WSPA 4XZWA 3W3OA 4D8ZA 3T2QA 2A1YA 1CGTA 1B1YA 2TSYA 2NX9A 2DQWA 1Q7QA 2KZHA 4FMVA 5HA7A 3QY7A 1KM1A 5K7JA 1UR1A 1S5NA 1VFHA 4Q8QA 5CPSA 3GNDA 1EB3A 3H4WA 1QK2A 1QDSA 4TXEA 2VWTA 1EBHA 1X38A 4IJCA 4O11A 5GJMA 2BNJA 4OWGA 3SSZA 4R53A 3PG9A 1LLZA 3IS4A 3IUHA 1ZB5A 2X05A 5TQLA 4W7UA 1KXVA 1EEPA 3WNKA 2DW6A 3C2OA 4TIMA 3W2KA 1A5SA 1UKOA 4C6BA 3UG5A 4WDXA 2DSKA 1TA3A 3MUY1 3SN0A 2QQ6A 2FKPA 1VHNA 3PTKA 3AYVA 8A3HA 1M6JA 5A2BA 4W84A 2XM1A 3SAZA 4MM1A 2VR4A 3EPOA 1IWPA 2A2IA 3WLMA 1ZZMA 2O55A 1WDPA 3N9SA 2QLYA 4H8VA 2FZBA 4DEFA 4G2DA 3M07A 3RU8X 1ZAJA 2ZYFA 3D0CA 5FF0A 1F3XA 3PUGA 1RP9A 3GC2A 1T6MA 1EKOA 5DX7A 3VKBA 4PUNA 1VBUA 2Y7GA 1UR3M 1VYRA 2VX5A 4BWLA 2DSUA 1VF8A 3HQNA 4JICA 2C0AA 2PWGA 4M80A 5D2XA 4ICNA 3MSGA 4XIMA 3BSGA 5G2HA 5IDIA 1XP3A 3GYCA 3T6CA 1BWKA 2GGHA 3SECA 4QEHA 1R47A 4P7RA 1G4SA 4HOXA 4UNLA 3VXGA 5I24A 2Z2AA 4KRZA 2WO5A 3PPGA 3G22A 3E9AA 1TPB1 1J4EA 4WDUA 4Y9AA 1JVNA 7CGTA 3NZRA 3ZMRA 4FZIA 2OLHA 3V16A 3OA5A 2G3IA 1C93A 1RLCL 3THUA 3TV8A 1DOSA 3VINA 4XTDA 3TYUA 4LY8A 4GYPA 3TTEA 4LEQA 2WZMA 5AZ1A 1W1YA 3ZM8A 2BP1A 4AEFA 3CHVA 2WMHA 3MJMA 4ZCWA 1F73A 1NF7A 1RA5A 3NZPA 3WBYA 4FP1A 3G1AA 5FEPA 1J0ZA 3EMZA 3S2MA 3TW9A 4UTWA 5F2GA 5GJNA 1KM0A 1GZJA 5LXEA 2B7QA 3GXPA 4GNJA 2P8BA 3OYZA 3RPDA 4O18A 2H8XA 3GC4A 4Z2GA 2ZRZA 2PSNA 3VDBA 4KCVA 3L12A 4DUXA 2BY0A 1UD8A 2J25A 3RDKA 2OLSA 2QJIA 3PWIA 4KWWA 4PZVA 1GQLA 1TQJA 5D9MA 3OW1A 1A4MA 1PPIA 3G1YA 3U57A 4GVFA 2ACQA 1VFLA 3W6MA 2Y85A 3AUOA 4DBSA 1Z9AA 1I6NA 4O1CA 1A50A 1Z89A 1LL4A 2D3LA 3W2MA 4DVOA 1P5BA 1V3HA 3E0WA 2YBTA 1IEIA 2G41A 5CPMA 3SQLA 4LFYA 3CH0A 3N11A 1UH3A 1NELA 2OEJA 3T2OA 3EDJA 3OZMA 1F61A 3NA8A 4M29A 1RLDA 1JFHA 2DH3A 4LNCA 3V0SA 3W1NA 4RPPA 4KCTA 4KIRA 3STFA 2QHAA 5AC6A 3OBKA 3PZIA 3B4UA 4IPLA 3MT1A 3NL5A 3URBA 1LL6A 1B54A 4JFSA 2F61A 3SCOA 1PTGA 5F4WA 4ZVJA 3T0DA 2OZTA 4AX6A 4AMCA 2HWGA 3UJRA 1ONRA 2VVSA 1XIFA 3TOYA 4O13A 1YQ2A 1FBAA 1SPQA 1EX1A 1MNZA 1OINA 1ZPTA 5CPQA 3LM7A 3WL0A 1GKQA 4MZ1A 1P6CA 3THDA 1Y0EA 4LY4A 2C16A 7REQA 4CD6A 1AW5A 1CIUA 2ZRWA 1A0DA 2PTWA 1KKRA 3ITGA 1JF6A 4BY3A 3QSTA 3T0AA 4GCXA 3GNXA 3HFTA 1UW9A 1W54A 3SDOA 2FDSA 3IUDA 1ZJHA 3B03A 4J3UA 4HNLA 4QISA 3DYOA 3O15A 3ATYA 3S1GA 2DIKA 3Q45A 4LQ1A 2A4AA 4TVDA 3P8IA 2P1FA 1SW3A 1C90A 1EOKA 4KWUA 3I7SA 3HFYA 1P0DA 3AICA 2RDWA 1QI5A 3OEXA 3TUUA 1OD0A 1W3HA 3TN5A 3KW3A 3KLKA 4FXSA 1JCMP 3LZ5A 3V5FA 1V0LA 3EWDA 3VUSA 3DUGA 3RCNA 1OY0A 4JN8A 3LBMA 2O0TA 4CGTA 4HU3A 1XQLA 3AS2A 3GR7A 1EJSC 5DQPA 1NAL1 1A5BA 1NP2A 2FHBA 1QWGA 1XX1A 1WXZA 4GABA 4C60A 4WGHA 2IXVA 3LMZA 3LRMA 4LRSA 3FFSA 3DFSA 4ZSTA 1RQEA 4LS0A 1EIBA 2G3MA 1VR6A 3NSXA 3W24A 4ZQMA 4RNFA 2DUZA 3GHSA 3CUHA 3PZMA 2PD5A 3IJQA 1KRAC 1OFPA 4A4AA 5FA5A 1YTEA 5EU9A 3P0WA 1BRLB 2DZBA 2DIEA 4IQEA 3WLPA 1US3A 5LNUA 1BHGA 1UOZA 3NQGA 2GUUA 3WQCA 3RM8A 1I45A 3HMCA 1PTAA 3VDCA 1F3WA 4Q7BA 1P6WA 2VFIA 1KGWA 4UFMA 2PI6A 4EIVA 3A5VA 4B2DD 4QJ1A 3VGEA 1J93A 2HVNA 4OECA 3OZOA 3PB2A 1JFXA 3IGUA 3FVMA 1VPQA 3HF3A 2PU1A 5F2IA 2Z24A 4YS1A 1W9PA 3MMWA 3G1SA 3AIWA 4P7OA 3QM3A 1O5KA 2I1OA 2ADAA 3W73A 3LCHA 1GOMA 3N12A 4UQBA 1CW2A 1IR1A 1XR2A 2QCHA 3BW2A 4IIGA 2BHZA 4H9UA 5A6TC 4KPLA 2A0NA 3B0XA 3NPUA 2FB2A 3CJPA 3TQ0A 3E1F1 2TAAA 3TJXA 1OZQA 3MMUA 3H54A 4Z42C 4Q8WA 4GIAA 1YBQB 4OZOA 3P2VA 1HUVA 2Z29A 1A53A 4CD7A 1S2TA 4ASTA 3RM4A 5KZMA 3R58A 5GVJA 4UZUA 1FWAC 3C6CA 4H4IA 4HN4A 1TUXA 4C6EA 1SJBA 2Y63A 3T4WA 1MW1A 3NSNA 4S3FA 3RITA 2WHKA 1NARA 3I65A 3KOYA 2VTFA 2OEKA 5A8QA 1TELA 3E0IA 3MC5A 1X6UA 4BEQA 5HNNA 4AF0B 2PRHA 2X0HA 4B9YA 5HNTA 4JHZA 3R79A 4BFAA 1JGMA 1LWIA 2ZC1A 4WKHA 4C1NB 4AWSA 2BVDA 3HG5A 2F84A 4O1AA 1PKMA 2TMDA 3DG7A 3IIXA 3EX2A 2GDVA 1PWMA 3USBA 3SCPA 2B31A 4WXYA 4MLRA 2OELA 4Y9PA 1KM6A 3OB8A 4ZQOA 1L6SA 1SU5A 4HHHA 2Z6IA 1KBIA 1BSIA 4XAZA 1UP2A 3LY0A 4W93A 3WBWA 1XISA 3MO4A 1C8QA 1MW0A 1JZ2A 3AIRA 2OT0A 4D6FA 9CGTA 3BOFA 4XZBA 5E6YA 3U9IA 5FIPA 2XVPA 4MNLA 2VOTA 5DRIA 4IIFA 4Q7NA 3SUVA 1IEWA 1MDLA 3TVAA 2YDRA 1CXEA 4DPQA 1DBTA 1OFBA 4MWAA 1NDVA 1XINA 3BGAA 3JRKA 1AQMA 1UWUA 4RV3A 1QOPA 3MBDA 3N4EA 3KEHA 3WFLA 4DJDA 3L4TA 1M41A 2O9OA 1PIFA 3SCSA 3LPPA 1DL3A 1DJWA 1LT7A 2FZMA 2JK2A 2FFIA 4HJFA 2YZRA 3VD4A 3S47A 1TWDA 2XISA 2WM1A 3VKCA 4ATLA 3H2OA 4HOZA 4NYUA 3WD0A 3P93A 3ABZA 4EF8A 3JZEA 4LGXA 3TZNA 4ONVA 1R9YA 2R91A 2HTMA 3MI2A 3F03K 4AIOA 1JPIA 1AZ1A 5HBFA 4HCHA 4PN2A 1MEWA 2GDUA 2RDTA 2PWEA 4L1WA 3HPXA 1CXFA 3HM7A 2A3AA 4FIRA 1RAKA 2V30A 3VE9A 5AKQA 3TYEA 4Q8OA 4UIOA 4X2PA 1OC7A 4FHAA 2NUYA 3BXWA 2DFAA 2CITA 4C1LA 2VHLA 5HK4A 4KETA 3UY7A 3FKRA 4X9YA 2IPGA 1N7KA 5TAOA 3WUFA 4N02A 3QXBA 4CQAA 2YXGA 4LVAA 2OGJA 4NZFA 3M6DA 3BJSA 2WYSA 1XIGA 1W5OA 3H4XA 3QZEA 1YW1A 1E0WA 4NNBA 3MZ2A 3P8JA 4JCLA 1WOBA 1E9IA 2Z26A 3BW3A 9XIMA 1TJ0A 2XVLA 4IMCA 2GJXB 2UZ9A 5HNRA 1F6KA 3M43A 3LHVA 5CJ5A 2F6XA 1XRVA 4GFIA 3DG3A 4FF5A 1XYBA 1IWBA 1LL7A 2PDKA 4P7NA 3GZAA 3WUGA 4LWWA 3FJ4A 2V3FA 4B5UA 3P6LA 2ASHA 2E25A 5JVLA 3O6YX 4XZLX 2J8TA 3C0QA 3LSBA 4K68A 4XSLA 3BLEA 3ZLHA 1WBHA 3QQWA 4AWEA 1MUCA 1KFBA 2TPSA 3CUGA 4I7VA 2F7FA 5BRPA 3L5AA 1YNPA 6ENLA 3NEHA 1PB0A 3NXFA 3CT2A 3RAOA 3VIKA 1NOWA 4MUPA 1HKMA 3FK4A 3NQVA 4MZYA 3TK7A 4BCEA 2VC5A 3FXYA 4FIQA 4BS0A 4JTJA 4N42A 1ZENA 1UZDA 4GH3A 2BXVA 4WR3A 1D9EA 5JIWA 4H6QA 3U6WA 1FWIC 2ZUWA 4PRTA 3CMJA 3FSUA 4O53A 3D6NA 3LLXA 2QDHA 4EXAA 4TMCA 1H0IA 1V0NA 1GVYA 4HSOA 3O63A 4J27A 5DMNA 1G69A 1LF1A 4IQJA 1U22A 4POCA 3L4XA 1XIEA 4I8YA 2REQB 3BUVA 6PTDA 1G6CA 3U2ZA 1OC5A 3ZR5A 6REQB 1JXKA 2IQTA 3DHDA 3MYPA 4G8TA 5H8PA 2AQOA 2FPYA 2DP3A 1V93A 1M7JA 4E0CA 2FFCA 2UY4A 3UZYA 3W53A 4WZHA 3CL6A 3PHAA 1PZ3A 3VAVA 3CMGA 1H7PA 3PJXA 1QUMA 3WUEA 4EPBC 3PZNA 2WNQA 4HN8A 3SW6A 2A21A 3VUPA 3S5ZA 3GH4A 1LG2A 3G8EA 2HE8A 3R11A 4FNQA 6XIMA 4NRSA 1TVNA 1AL8A 4AAJA 1R85A 4GLEA 1TPC1 3JVAA 3RO8A 4MKVA 1XIJA 3OLEA 4U28A 2VQTA 4AHQA 1SZNA 4PTXA 2VWSA 4W5UA 3EOSA 1DWGM 4E2VA 4UQCA 4JN6A 2Y5EA 3RO6A 4IMEA 1BVWA 5E09A 3VIIA 3P82A 4IPPA 1FH8A 2DZTA 3LLFA 1QO5A 1EJWC 3MY9A 2WQDA 3CV7A 3S8HA 2OGYA 1MZHA 2DH2A 2FJUB 3L4UA 3NL6A 4FX6M 2ISWA 5FJJA 3E0LA 2OX1A 4PTVA 3UYIA 4WGXA 3HJEA 1QPOA 3PAJA 3E5BA 4JNYA 4WX2A 4M5PA 5CZSA 1YNYA 5A1AA 3ID7A 4G9PA 1KBJA 4NZJA 3WLQA 5C9XA 3ITTA 1PYFA 5AC4A 1E5NA 3BV7A 3MP3A 3W7LA 3T40A 3OVRA 2VX7A 5H2ZA 3STPA 3PP7A 3MCNA 5SWUA 4KFOA 1UJQA 3TLQA 2IQDA 2FMOA 4R7OA 1AH0A 3PZVA 3BOLA 3SFWA 1H63A 2QJHA 3IGXA 4WD0A 1HJWA 1PWLA 1UA3A 3AC0A 3CUIA 3GDMA 4DI9A 1DE5A 3W72A 3SJNA 1VLIA 3QVQA 4HK7A 4GZJA 1H1YA 2NV9A 2WJFA 1KO0A 3KTSA 1RK6A 4QFUA 4GBUA 4JEQA 4NU7A 4KKXA 1XS2A 3ITXA 1MNSA 5J04A 5C7VA 3UETA 3GO2A 3DC0A 4AISA 4IM4A 3W74A 5I77A 4AZHA 1XFBA 2V9DA 3WF1A 3VIOA 3QQ0A 2QR6A 4NJKA 4IICA 2ZRVA 3WJZA 3SADA 4S3CA 3FYOA 4WDWA 2A3BA 4AXKA 1Z7AA 2HV5A 5G1MA 5H6HA 1C7SA 4DXKA 2CZEA 3BAXA 4IPIA 5LHEA 2NQ9A 4AZBA 5DT5A 3N29A 4ZTXA 4JFWA 4C6JA 2CZDA 3ITOA 2YPIA 1JI1A 4G5DA 1E6ZA 2HE5A 1WKEA 1UD4A 2OPJA 4LVDA 2F2KA 2OWCA 3MZNA 5EPDA 3T07A 3U7BA 1YXCA 3HGSA 3G1VA 5I3IA 1HP4A 3EB4A 2QF7A 1NTHA 4XZMX 3O6CA 3KBWA 2VZTA 4AZGA 3W7HA 1EH9A 1W3IA 1JXJA 2C18A 4DNHA 1H4PA 1ME7A 1FWDC 4L4OA 4O8RA 4LX4A 3VYLA 4HPNA 3MUAA 3WNMA 3HOJA 3K4AA 1B9ZA 2PLJA 3SGUA 4ATDA 3KBJA 3MB9A 1R46A 3Q2DA 4GWEA 3UA3A 1OK6A 1L9WA 2VCAA 1PX4A 2XTKA 4M81A 1DIOA 1EO5A 1NJJA 4UTHA 3AAMA 4ACZB 4JDBA 1U83A 5ECUA 4O15A 2QV5A 4AEOA 3E74A 3RU6A 2O9PA 4LRTA 3GG8A 1KM2A 3IRSA 1SZFA 1PV8A 2VEGA 3TH6A 1Q6OA 4AYGA 4PA8A 4OV9A 2HPIA 4J3XA 1V6YA 3EWZA 3LU2A 2GVLA 4W8BA 2QV4A 4GI4A 1M7XA 4DUVA 5D32A 1HL8A 4I6VA 1JDFA 3D5HA 4RE2A 5LYRA 3RX3A 4YTRA 3T0BA 4PODA 4H83A 3AXIA 2JFEX 1W5MA 2ZA3A 3TA6A 5I0DA 2ZOXA 3LHTA 4S3EA 3H7VA 4EP8C 3EX1A 5TD4A 1JZ7A 3WELA 3STEA 4K37A 4ZA0A 2Y7FA 2WB5A 1XLFA 4DF2A 1ZJAA 3BC9A 5AHIA 2ISSA 1F07A 4J3VA 2NQZA 2IUZA 1WXYA 2A7RA 4WJXA 5BXSA 1X1ZA 4JTAA 4KCUA 3CC1A 3VNYA 3GSMA 3O0FA 3VIMA 3I3DA 1IYXA 3P84A 4LUSB 3UYCA 1JUKA 1BLIA 3EWCA 2P76A 3YPIA 4N0RA 2BB0A 5BXTA 1ZGDA 5REQB 1J0JA 1QJWA 1XLJA 3HG3A 3UQNA 2XPKA 5HXMA 4P5UA 4XSMA 2XFWA 1TKKA 3OLGA 2W9MA 1UIOA 4YN5A 3CLWA 3QHOA 1L0PA 3LBCA 2QS8A 3PUDA 4KEVA 4DAFA 3TOPA 1GEHA 2XDFA 3R13A 1D2KA 3NM3A 5EMMA 4DWSD 4BF9A 1Q2RA 4EOUA 1HP5A 4A6GA 1YYAA 3W7GA 4MB5A 5IBXA 1GYMA 1BRLA 2CZ5A 3RUBL 4ZO6A 3TMQA 2QMJA 4Z2JA 2PD9A 1QPRA 1UWSA 3E2RA 3NOYA 4H9TA 4JN7A 5MKGA 4HA3A 3RMJA 3O6DA 1VEPA 3VD7A 5LNSA 1GCYA 1HN1A 3VDAA 1TRIA 2DIJA 4LVBA 4ADSA 3TEVA 2AOSA 1CLXA 3C2RA 1PXGA 1HJUA 2O9RA 4X2RA 4XV0A 4OU1A 4FS9A 1R3WA 4O0KA 4N6FA 3A21A 1H7XA 4QEEA 1XGDA 2Q8ZA 1WZLA 2Z1KA 3B0PA 3S6DA 3WNNA 4EK7A 4FLRA 5GNYA 5FSEC 2VUNA 5BU6A 4XKYA 3AU2A 3MKVA 3LERA 3CZKA 2XN0A 5I00A 1AH4A 4A3HA 2AKZA 1VPYA 1XD1A 4QBXA 4YNGA 4E3TA 1M01A 4ES4A 1JCNA 2CKRA 3UWZA 2Z00A 2ZWZA 1A3HA 3N2BA 4D1IA 1T96A 1TR1A 2W5FA 3IIVA 3RHGA 1UH4A 2I14A 3U3HA 3LPFA 1UKQA 1W2VA 1Z41A 5CSYA 1GT8A 3PBGA 5I6SA 1UP3A 2ZUNA 4Z1BA 2FZ9A 3SCVA 4P7QA 3ZLFA 4EWND 1QI0A 4C6FA 3PC0A 4B5SA 4D72A 1DPMA 1SJDA 4UCFA 2V5CA 4BQ4A 1GOXA 4DQWA 4LVFA 1KXTA 1TCDA 3EA2A 3FHAA 4O54A 5K9DA 3A24A 4B4HA 4DB7A 1V02E 4Q22A 2FJKA 3GNOA 1SSDA 2RHGA 1PUDA 4CD4A 1XV8A 3UWVA 1UUOA 1WBJA 2XSAA 4EKJA 1TX2A 4QRNA 4U33A 3C4UA 4PFHA 2P50A 3ZQ9A 3KTXA 3S83A 1J5TA 4IG2B 1EF2A 3K8KA 4IHCA 1D7FA 3LTYA 4HNNA 1FWRA 1GORA 1ZL1A 4HU0A 1MMFA 5FESA 1JYVA 3TIMA 3C3UA 5GQBA 4NXSA 2CCRA 3DESA 4NRRA 5BXPA 3S2LA 2ZFAA 1AUSL 2PDLA 3FW6A 3W71A 2OMAA 5DCBA 2J62A 5A69A 3GH7A 1ICSA 2YL8A 4ZOBA 1T8QA 2EQDA 4PUWA 5TNVA 2ISFA 1Y5WA 2JIEA 4B5VA 4A29A 4GKLA 1ICPA 1UD3A 3NQBA 4ADUA 3ANYA 1M9HA 3CQ0A 4B5TA 5HUOA 3BLKA 3KBMA 4IXXA 1XD0A 3RX2A 4QAIA 5LHFA 1WO2A 2J7FA 3LRKA 2XN2A 4DJED 2WZEA 5GJPA 1VFMA 3G1RA 1HTIA 1BPLB 3QFWA 3GXDA 3EYPA 2JQXA 4DUWA 1BWVA 4H6KA 1R8LA 1UR4A 1CECA 3GKFA 4ILSA 2B0MA 5AFDA 4MGGA 4PUEA 2J7EA 3GFXA 2W67A 5G2WA 3W28A 3C2VA 4MY9A 2FHCA 4K2SA 1AK5A 3OG2A 3RJXA 2VENA 2JEPA 2WJEA 3WK0A 1SZGA 1H62A 4JYFA 4C65A 1S2CA 1PCWA 3T4CA 4GO9A 1L6GA 3PZQA 1UASA 4MNKA 4NI8A 3ZT7A 4C6MA 4LCRA 2KAUC 3WFZA 1S1PA 4DJFD 1YEYA 1ALDA 3AIBA 4Q4SA 2X1SA 4JTCA 4V33A 4RXFA 1ADOA 2GJXA 4MJMA 3CTLA 4QLJA 5BXRA 2PC8A 1KCKA 2VZUA 4A2SA 1NFPA 4NSBA 3A23A 4QJ3B 5E5CA 3LTSA 4KT2A 3NCOA 1ZTVA 2CU0A 3GDRA 3G2GA 4RZ6A 3N17A 3QPYA 2UWFA 2XFYA 3RLVA 3M0HA 1PBGA 5AHEA 1MEIA 1LROA 4B4FA 3SCQA 3B05A 4JYEA 2OX4A 5E0KA 3M5XA 3BGJA 2C1IA 1UIPA 4HPXA 4UQAA 4K7YA 1OIFA 1DWIM 4X0NA 2XVNA 3TJLA 3HQOA 4NL1A 3NURA 3AZRA 3W4RA 5CZTA 3M1ZA 4QITA 2XFRA 5EBUA 3W1AA 5HOSA 4GPNA 1XBVA 1OFOA 3QGAC 3S4TA 3TSBA 3KVMA 4PCNA 2XIOA 1F3EA 1X98A 4JTSA 3W2JA 5BNKA 4HIBA 3NNTA 1HF6A 5DY3A 2XZ9A 4JOMA 5MHBA 3O05A 3PK7A 1VPXA 3CWOX 1VEOA 4CQ8A 3S2CA 4J2MA 4JTTA 2ZUVA 4IFKB 2VCCA 3OO2A 3V0TA 4RKAA 3GG1A 2WMKA 1TCMA 1SMAA 4GYJA 1B3VA 4NZ5A 5FJIA 1EL3A 5CZJA 1VS1A 2ZE3A 1XPYA 4MKSA 4OGZA 3GIPA 1EDTA 2ABBA 1TPWA 1OF6A 1GYLA 3GR8A 1FWEC 2I7GA 1NWSA 1ZSXA 2WSQA 2A3CA 1XRSA 2ZA1A 1RHCA 1SM9A 3R8RA 1EP3A 1A5NC 2EEXA 2HNEA 2EJ1A 3LD5A 1XSJA 2E68A 5DXXA 4IJRA 3M5ZA 1OIMA 1QI2A 3L5MA 1TV4A 1SSGA 4LUIA 3TTOA 4L6OA 4F2BA 3NEVA 1IEXA 1EPXA 3OOQA 5B7ZA 3FDGA 4UTTC 2VFFA 5DO8A 2IQ0A 2I9UA 2QW5A 2CLFA 3QC3A 3ARRA 3BMXA 3AROA 3GIYA 2W27A 2XIJA 4ZOAA 5F2MA 1P0BA 4F0KA 4LUTB 5B80A 3CQIA 1DYSA 2PP3A 1Z3NA 4K8HA 1P6BA 3W25A 1C92A 4DX3A 1H5VA 1CPUA 1RJRA 2BTMA 4JGDA 1UKPA 4QHRA 2YCLA 2UY5A 1EEXA 3QKEA 3WLSA 3KXQA 3KX6A 4XD4A 5AC7A 3UBPC 4J28A 4JBRA 4L65A 2P0OA 4A8IA 5A6JA 1GVQA 2ACRA 1REQB 2VEIA 4O4WA 1B4EA 1UWAA 4URIA 1ZNNA 3EKZA 5T9CE 3CB8A 2ZA2A 1S38A 5KSWA 1I60A 3WLOA 1RJPA 3PB0A 4L7ZA 1EA9C 3OZYA 2J7HA 3QF0A 5M3WA 3CV1A 3LV6A 2XVGA 4GFSA 4PB4A 1VFFA 1W32A 2EGZA 3EDKA 1XLBA 3B04A 2V2DA 3PBMA 5I02A 3GUGA 3ARPA 2WVTA 1S46A 4AZIA 4H6EA 4HMDA 1TVLA 3WH7A 3EB3A 1JULA 4XQ6A 3W7PA 5K4XA 3SY1A 2XWEA 1IEVA 4E8CA 3UWYA 1HJVA 3A4XA 5G1TA 4L5ZA 2L5HA 5K2ZA 4UTMA 1QO2A 2X0SA 1YDVA 4K36A 4ALDA 4JTHA 5HMDA 4FEZA 4ML9A 5A2AA 5C55A 4Z1DA 2ZUMA 1KBBA 1S5MA 1JDCA 3H22A 4FSAA 2ZZ2A 5HWNA 4NG3A 4QROA 4BJHA 1F8MA 4Q6XA 2CEQA 2PUZA 2FH6A 1V77A 3VD3A 4AMAA 2RJGA 1XC6A 1W3LA 3VKAA 1W9XA 2HMCA 1GOKA 2GWNA 3F4CA 5G2IA 4PMOA 3VDHA 4XO7A 2X8RA 2D69A 2CZFA 3KRSA 4WEVX 1U1UA 1F9CA 1FXPA 4LYPA 1GVRA 3GDBA 4R7WA 2BASA 3WQ6A 2FTYA 1PO9A 2D0HA 1W91A 3VFCA 3N34A 4L9YA 1GPWA 4KMQA 4H9YA 1XBXA 2X7WA 1ONEA 3TLLA 1JD9A 2OQLA 1VCGA 4M1RA 4L1XA 4X61A 3WUBA 1L2UA 3EB2A 3ORWA 3CAWA 4P8VA 4Z2LA 1WOAA 3V75A 4Z1AA 1DHPA 3G3MA 4GINA 3DKLA 5DMMA 4AHOA 3MJYA 4GUFA 1KQYA 2OYKA 4KCWA 2BVWA 3R25A 4LF2A 2ZUTA 2C91A 2C71A 3VKKA 4YWSA 2BY2A 4PMYA 1G0CA 1VJZA 3U2CA 5CKSA 3ES7A 2CHOA 3R0KA 4H7VA 5FAJA 3RN6A 1ISZA 2FTPA 1Y7VA 1DE6A 2CLEA 2VGBA 2QNEA 3CMFA 4I3GA 4O1EA 4ZGYA 2CNCA 4JIPA 1H0GA 4G6CA 4GD0A 3E0VA 2DZAA 4Q33A 1IV8A 2X1RA 1CBGA 4GQQA 4JX5A 3BCDA 4IZGA 2X40A 2TRSA 3APTA 5A3HA 5B7YA 3DHFA 4S3BA 5HMFA 1A3WA 3R0UA 4BWLC 1OVDA 3WH8A 1E6QM 3GAYA 1KC7A 3LDVA 4HZ6A 1ZRQA 4QG8A 1TIWA 4W89A 3VGHA 3WQGA 4LJ3A 3TONA 4HKPA 4CD5A 4HQVA 1Q7MA 5C2GA 1C3FA 2ZX7A 3MWCA 3PWAA 1A5AA 1R30A 3L65A 4CNSA 5T26A 2PGRA 5FF2A 2WPGA 2TODA 3LGGA 4ERIA 3IJDA 5A8NA 2HBVA 5MF5A 3C0JA 4NILA 3F4WA 4GYPC 1JPHA 1RQBA 1U33A 1PKNA 5KZ6A 2H8ZA 4GGBA 3UG3A 1XWYA 1BXNA 1JJKA 5EFDA 1QASA 4C6DA 4UTWC 3TTYA 1IXNA 1E9LA 2E0PA 3VOGA 4AEEA 1Q63A 1IZJA 4XG1A 2HS6A 4YTUA 1UH2A 1LOLA 5AYXA 2GGIA 4HCDA 3GFYA 1UJPA 4KWSA 3E12A 4J3ZA 1SR0A 1M68A 3B4YA 4AQLA 4GVIA 2VDIA 1O1ZA 1TA3B 2DDXA 3DX5A 2OZ8A 4WY0A 2JGYA 5CSUA 1GOOA 3IAQA 3M0MA 2IXUA 4F40A 1OX4B 3EX4A 1ZJBA 5BRBA 3KM8A 3BANA 1O60A 1S5VA 4XAFA 5LSMA 4JTFA 4GQ0A 1QW9A 3N14A 2RDXA 2J47A 1U5JA 2F6UA 4IL2A 3P7YA 1EX5A 3IGSA 6ALDA 1V7AA 3ZVIA 4PMXA 1SO6A 4BZYA 4ZXOA 1LT8A 1WZKA 1IGWA 2IKIA 5CAHA 1GWJA 2C1HA 4JL1A 1I4NA 3B8IA 4FOUA 1KTCA 4P7LA 2WNNA 3WBXA 1OF8A 2E1WA 1LORA 1Q6LA 3CZGA 4GI6A 1S5TA 2OEMA 2G3JA 1DTNA 3N3TA 3VNLA 2ALRA 4JIIX 3FYYA 3OJGA 4B3ZA 1C9WA 4RV8A 1KFLA 3GVRA 5CZKA 1E15A 4EPEC 1X96A 2CPUA 2YXOA 4LU0A 3MHFA 5M5DA 4GZ7A 4JPGA 3C8NA 2ZDRA 3C3NA 3U5UA 5I3DA 1YX1A 3W1UA 3RILA 3N9KA 4RX0A 1AD1A 3CO8A 2GPTA 3M0YA 4S3JA 4EACA 4MB1A 3WLKX 3FGCA 3VM7A 1FWNA 3ARVA 1VGAA 3GE7A 4U5IA 3F5LA 3TKFA 2PAJA 3B3DA 4ZO7A 1U5VA 2BG5A 3KOXA 3WJYA 1XC4A 4DF1A 1GEQA 2OCZA 1C8XA 3WENA 1H1NA 4AU0A 3AQUA 2DZXA 2GQ8A 2HNHA 3R12A 1YMYA 2XN1A 2QIIA 2Z25A 1XSKA 1PS9A 4NASA 3WBEA 3W75A 1V3MA 1MW2A 3R1ZA 2PBOA 1TMHA 4UFJA 2P3EA 4G7EA 2BGNE 4LYQA 3PAOA 1EBGA 4U3AA 3L67A 4UXDA 4PYSA 1SJAA 4U4MA 2XIIA 3VMNA 1WKFA 3NXLA 1P43A 3N04A 1FOBA 3EDFA 5I3KA 4ZZ9A 4NP7A 3ZT6A 3NQCA 4FAMA 3I4KA 2E5BA 4IF2A 2PDCA 1RVKA 4RDZA 2NUWA 4UNIA 3GC5A 1VIZA 2WHMA 4B3KA 3IVUA 3O9NA 1PSCA 1N8IA 3DERA 5CGQA 1J2WA 5EY5A 1AG1O 3HURA 4N6EA 3HGOA 1EYWA 3LOTA 3TYCA 4AXNA 3DI0A 4MJZA 1QRQA 1CLVA 1ZCOA 2JKAA 4DXVA 1QPKA 2GZXA 4IP5A 3FY1A 2OO0A 1XICA 3W29A 5F7UA 1BYBA 1BTCA 4R3UA 2QF8A 1XLMA 4YJ5A 2EG6A 2PTZA 1AFSA 2A6LA 3EOEA 5G5IA 1TPDA 3QSRA 2W0UA 2ZZ7A 2V82A 3KHDA 5C0QA 4U5KA 1VBRA 4C90A 5AVHA 3LXBA 5FL1A 4ATWA 4F2TA 3S9IA 1IGSA 1MSSA 7REQB 2NZLA 4HB7A 2VZSA 1UC4A 4U2ZA 1KFJA 2XH7A 2WLYA 4B15A 4DZ5A 3D47A 5EMYA 1WXJA 1ZS2A 4UOJA 3PFRA 1HKJA 3BE7A 3EMQA 4UFKA 2Q3OA 2QCFA 4C6NA 2VJXA 2J7GA 5DLCA 5BCAA 5LIKX 3IACA 4J2PA 2DU2A 1ME8A 1CCWB 3M5YA 3AMLA 1TPUA 3WH5A 1L6YA 3M6YA 3XISA 3AMGA 3H55A 3OU8A 2Y61A 2EJAA 3AWNA 4JTRA 1CGVA 2V8ZA 3MI3A 1PDYA 3IANA 1G4EA 1Q45A 3BSHA 4D6HA 3E3HA 3EA3A 3UFYA 3L9CA 3MKCA 3GG0A 3WJXA 3W7OA 3PJTA 3UWQA 4O17A 2GYIA 4C6KA 3W88A 3GUWA 4NNAA 2FTWA 3BWWA 1X7IA 1UG6A 3AIUA 3T55A 2O56A 4FXRA 4PMQA 1FRBA 1UQYA 3QR3A 4GHRA 2RFGA 4OE7A 1D3GA 3SZ8A 1EXBA 1Q6CA 3A3HA 1DEDA 3OHMB 4R5EA 4CCEA 4YPJA 4LEFA 4R9OA 4PSRA 1TFVA 4DAIA 1FY6A 1XUUA 1QOQA 4QJ5B 1AMYA 3F5JA 2CLKA 2J24A 3A22A 1L6FA 4L6DA 3UZ5A 5LGZA 3CQHA 4IUOA 2X42A 4XD6A 5C6MA 5C9WA 2OKOA 1R3SA 1EDQA 4F9JA 4HOWA 1OCNA 2E6YA 1TE1A 2BXYA 1S39A 2Z2UA 4NHVA 3ABXA 1HNYA 3CNYA 1J01A 1V0MA 3GVQA 5FF7A 4QE1A 1YHTA 1BVZA 1GOQA 1UB3A 2E3ZA 4GUHA 4FK9A 3MA8A 3IJ9A 3G8RA 3GHUA 1B90A 3BAJA 4GUGA 4TV5A 1AJZA 3B06A 4O0ZA 1LBFA 3RRAA 4NZ3A 1RZMA 1TPVA 4D8LA 1OB0A 3QFEA 3KP1A 3ARQA 3CV6A 4HA1A 3H2CA 2YBUA 1E0VA 3AISA 1ZFJA 3RR4A 1BF6A 4CU7A 4MWAC 3DN5A 4EE9A 4IFKA 5TF0A 1OQFA 2E09A 1OX6A 1CX9A 3TROA 3DEQA 4CUCA 3W2LA 4DJDC 4NVTA 1K9DA 3I6EA 1IHIA 3R6IA 1A5KC 1OCQA 4C6OA 4JKKA 4C91A 4HA0A 1V3KA 3CAKA 1EUNA 3JZUA 3OG3A 1QPNA 3W7KA 3BSMA 5I78A 4Q4KA 1D3CA 4UC5A 2O7SA 2GGEA 4LAZA 2J88A 2C8NA 4O57A 1KRBC 3H7RA 3CUXA 1Q8JA 3NQAA 4RK8A 1OX5A 1BKHA 3LLDA 3GU1A 5KINA 1RSCA 1ELSA 1XLGA 3MDUA 3MSDA 1KRCC 4XZ9A 3SRFA 5LIWX 2HSAA 3II1A 1T0OA 4GY7A 5I2UA 1UR2A 1EJ7L 5CPOA 4YTTA 3LHYA 1XIDA 3KWSA 3O3RA 3ALFA 1FHVA 4KBXA 2GQAA 2NUXA 3LS9A 1SR9A 1OT2A 1ZP3A 1VCFA 2HVMA 3B0YA 4MJ2A 1DWHM 4JQ3A 1BVNP 1XYLA 4LUTA 4AC1X 2J8GA 3P60A 1KV8A 3NQEA 1UYQA 3N13A 2A85A 4AIBA 4LH8A 4GOAA 4L64A 3H2MA 4F0RA 3W1RA 3MBFA 1THFD 2WMFA 4CEXC 1OZMA 4D6EA 1F76A 2ZX8A 4XB3A 4PBFA 1W5QA 2P3ZA 5AYZA 4K39A 1EC8A 4PMJA 3I68A 3M47A 1BYCA 3L21A 2ANUA 3RCMA 4IQLA 5CJNA 3T2PA 1DJXA 4JQ1A 4MJ4A 1RCXB 3S1UA 1DV7A 3SSJA 3W23A 3TR2A 1VBGA 5DELA 4BF7A 3UXDA 1F5ZA 1VLWA 4M7SA 3BCJA 2DZSA 4MWAB 4DHGA 2Y8UA 1UPMB 3VIJA 1EJVC 3ZZ1A 3IJLA 4JIEA 4F4RA 1JNDA 3VABA 3VZZA 2Y88A 2XSXA 2FVMA 1PZ0A 4MFDA 3S0CA 1H61A 1KM4A 3OIXA 3VVGA 1OGBA 5HR7A 4R9XA 3WD2A 1D8WA 1B3WA 1IT0A 3CQKA 1BSLA 4QNEA 2YLLA 4UTFA 3EDEA 1TJRA 5HAOA 2QUNA 3GAKA 3ZIZA 4Q8UA 2BSLA 3G1DA 4HYRA 3QV8A 3N3MA 3MUXA 4HHLA 3Q94A 4IJBA 3HMJG 3MS8A 2OB3A 3BL3A 3F7JA 1WAWA 4KS0A 1P0KA 3ZOAA 1XH2A 3LSCA 3M7WA 1CLKA 3FKKA 1KM5A 1OFQA 2OTDA 3DFOA 1ADDA 3UR8A 1SZRA 3PZUA 4WOZA 3WEOA 1E70M 2BOEX 5A8OA 4HT3A 4MUZA 2EPKX 3UXKA 2DORA 3VOJA 2EPOA 5H1WA 2ACSA 1JCXA 3GRIA 4DELA 1JPKA 3VMOA 3A6OA 3UT0A 2H3BA 1OABA 5L9FA 1XYFA 5I3FA 1YTKA 3D46A 4GIYA 4S3KA 3RPTA 3QV7A 3WF3A 5C5YA 2GJLA 4C6CA 1TG7A 2CBIA 1I1XA 7PTDA 5D04C 1Z69A 4WF7A 2EBNA 3T8QA 4GISA 4M51A 1UR8A 1XH1A 1SFSA 1DJGA 4CU6A 1R38A 3AXHA 4QSHA 4RPQA 5HWMA 5AB3A 4EXBA 4AD0A 4INFA 1IEQA 1MEHA 3LTPA 4KFPA 3EKLA 3S46A 3BH4A 1SYTA 2IPFA 2V3GA 1M53A 1UWTA 1ZBVA 1ZALA 1JCYA 1OFAA 3WO8A 3TU9A 3ECQA 1YTDA 5G4EA 4FPSA 3BMVA 3RCYA 3VPLA 4BHYA 3GTNA 2P8CA 3V0UA 3OP2A 4J40A 4NX5A 1YE6A 1A5OC 2WC4A 4GMEA 5A8GA 1AODA 1SFJA 4NZ4A 2TYSA 1R2RA 3FS2A 2ZC8A 3IUIA 4S3AA 4C6PA 3HJZA 1Q4NX 4JTEA 3WLIA 1CENA 4S1FA 4C7DA 3KAOA 4TV6A 3AJ7A 3OLIA 1K1DA 1GOIA 4PR4A 3WQ5A 1Q6FA 1CYGA 4H9XA 3VIHA 4RLIA 1PEZA 4U31A 3DCPA 1DWJM 4NF7A 4JKLA 2YFOA 3QLLA 1E3XA 2IS7A 4AY7A 3E38A 2DV0A 3WY1A 3TC6A 2WJDA 4YLWA 3A9BA 4PUMA 3WLTA 1JQVA 2OSXA 1BG9A 2P0IA 3M0XA 1P4CA 3DECA 3CZ8A 2QGHA 5JBDA 4C6LA 4DY1A 4F0HA 4H04A 3WDQA 3BLOA 2B4GA 2PDPA 4AH7A 1VCVA 1RA0A 4Z1CA 3NGFA 3S1XA 1TQXA 1GK8A 1OFEA 2D2GA 1MQRA 3VC6A 3W87A 3VGDA 3CUJA 4RR4A 1WUFA 1DJIA 1S2UA 4AD4A 1HVQA 1XIBA 4GQRA 5FL0A 4K1GA 2J6VA 2Q71A 3K8LA 3AJXA 5D8ZA 4WJ8A 3F4DA 3NQ7A 1JUEA 2D2JA 1FP9A 4Y2WA 2NWRA 2WKJA 4PC8A 5AECA 3ITYA 3AXKA 5AC8A 1KBKA 1OX4A 2A3EA 4TQTA 2AQVA 3DI1A 4YVXA 4ACYA 1XHGA 3FOKA 1G1YA 1KTNA 2VL4A 2F2HA 3T78A 1H3GA 1KXHA 4QS5A 2YDQA 1VQTA 4P2VA 2VR5A 3FX4A 4W8LA 1V4YA 1X1OA 3G0UA 1K02A 3PZ9A 4HYWA 1CXKA 4LC6A 4W7WA 1MXDA 1CZ1A 1GQKA 4LBUA 2B7OA 1ZLPA 1JZ5A 2PWHA 2BY1A 4JR5A 1TWSA 1IT8A 1M5WA 3UCDA 4L61A 1KR1A 2VR2A 1JDAA 3IRDA 2A3LA 3GDTA 4AZ7A 4PUJA 4E2BA 3MHGA 1EOMA 3GH5A 3MSRA 1J6OA 4JKMA 4AUBA 2XSBA 1X6NA 1SZEA 1YDYA 2HK1A 3PPHA 1ISWA 4F0LA 4H7ZA 1FA2A 1V6UA 1N55A 3V5OA 5JH2A 1BTMA 3AI0A 3OODA 3I10A 5HJLA 5BOEA 3N6QA 4NQ1A 4L6HA 5BRQA 2PDXA 1U30A 4JFUA 4WHBA 4AZ6A 1VENA 4AG0A 4I5UA 4Q4QA 1FWHC 2VM8A 3ITCA 4D1JA 3FNDA 2ALDA 2I9EA 4XVEA 2RGMA 2ZWYA 3L2IA 3TWBA 2ZTJA 4V1XA 4RW5A 3MHUA 3BLLA 1JI2A 3AZSA 4R33A 2PRMA 1W1A1 4RE4A 3WEZA 5I3GA 3G1FA 4QTGA 4KW2A 1ADSA 3S9ZA 2NT0A 4LS2A 1TTQA 4ZQRA 3LCGA 3PBVA 4MMWA 1RUSA 3WJSA 4QR6A 1JZ6A 5BWFA 3W7DA 1NOFA 1PHQA 1Q65A 3W38A 1M03A 4V15A 2Z1VA 3VIPA 2IW0A 1YNQA 5CZ0A 1GTHA 3ERPA 4ZOEA 2CHRA 2ZZ5A 3QR0A 3GW3A 1F6YA 2D0FA 2G8ZA 1DXFA 3C2YA 3WD1A 4JNMA 1O95A 3S5OA 3GZ3A 4YMZA 2WCGA 4CQCA 1QXLA 4M56A 2AMGA 3AIEA 4PTMA 1DQUA 1WX0A 2VT0A 1Z48A 4GX9A 2Y2WA 3EX3A 1EQPA 1KB3A 3N9RA 1D7KA 4ZR8A 1Q85A 5IFTA 3W7MA 3XINA 3OPSA 4Z08A 1KWKA 3L7RA 3N73A 3AWOA 2BGQA 3W07A 1V79A 2I57A 2I5IA 4JHMA 1E0UA 1RD6A 3H8AA 3NZ1A 1QHZA 5CCZA 3WN6A 1TJ1A 2DUXA 2DJXA 2YLAA 5IBXC 5AN7A 4J5NA 3PZTA 3M5VA 4DZIA 2HPMA 3SQSA 2A3HA 3OGSA 2DZPA 2J7CA 3M44A 1UWRA 3CV2A 1TX0A 1JR1A 4IFOA 1OYAA 1Q13A 4KEUA 1LCOA 4AHPA 3GU9A 3LG3A 5GNZA 1XGZA 4S2CA 3W00A 3OLDA 4NJHA 2QXWA 4CNOA 4FNPA 1V6WA 4UQEA 3WG6A 5F4SA 4ZODA 1KNWA 4HBKA 4HNTA 1EJRC 2CHNA 3WH6A 2BODX 4AFYA 1XUZA 1K77A 3WNOA 3TZFA 2YIHA 5U7SA 4YTQA 1KCLA 3IJ6A 2X16A 1ZJIA 2EO7A 1E51A 4MAVA 3QHNA 1VD6A 3UP8A 2ZX9A 1V6TA 1K9TA 2X2YA 1RQHA 1TRDA 1KXQA 2QPUA 1FHUA 5ABFA 4AZCB 1EDGA 4GBDA 2A7NA 4YYCA 1XF0A 3KOFA 5H91A 4XIAA 2R1NA 4PMNA 3JW7A 1A0EA 4M19A 2V69A 4PMZA 4BI6A 1Q66A 2JIWA 3A64A 3RXZA 2J9ZA 3CIWA 3ABRA 4IX0A 1C29A 4M6UA 1HW6A 2HROA 1W37A 4IWWA 1C7TA 4Q32A 1SFTA 1YKWA 4O52A 1LQAA 2QUUA 4DO6A 2BFGA 4QDPA 2QJJA 4MB4A 4O1DA 2VDHA 2PDJA 4NKCA 5C9UA 3ZSSA 2VFEA 4O14A 4B2DA 1E72M 2WKLA 4DM1A 2Q09A 1ECEA 2E1DA 2QPSA 3IK2A 1JIBA 5XIAA 2XWDA 2J13A 3CWHA 3QMRA 3UZJA 2QCEA 1R3QA 3W2NA 4S3GA 3S42A 2GK1A 4LOCA 2OVLA 3AYSA 7TIMA 4D6IA 4RW3A 5MKGB 1GTEA 5BOOA 3BMWA 1TMLA 3BPWA 5CBJA 3EA1A 4Z2HA 4WUIA 4ICCX 1VAHA 4RJEA 3C2FA 3GIQA 1JF5A 1B31A 4DNMA 4MVAA 4WOQA 1F3TA 3Q37A 5KZEA 1JDEA 4ZXLA 1D8CA 1LWHA 2ZDSA 2EPMX 3NPVA 1MFVA 3W9ZA 3COTA 3SUWA 4V1YA 5AY7A 4NZ1A 1XLLA 1BEUA 4XKYB 1SMDA 1TIMA 3OGRA 3KRBA 2YDAA 2WPBA 1XLKA 5M2FX 2W61A 3MUIA 4DPPA 2PDWA 4GIEA 3WCZA 3B9EA 2AAAA 4V2XA 5CEWA 2FVKA 1K03A 4E2OA 1C8VA 3TQKA 5CC3A 2OQHA 2ZRYA 2C6QA 1BG4A 1EGMA 1ENUA 2QZRA 2GVYA 3QTPA 1A3XA 3N25A 5CSSA 3UJSA 1PKYA 2AGKA 1XG3A 1QI4A 4LVGA 4JFTA 4E4PA 1KCZA 5DEZA 1JCTA 1WUEA 4WSKA 4CNNA 3KCLA 2B7NA 1F74A 3LQLA 3W26A 3KRUA 4UMBA 4IGMA 4CD8A 3MWAA 2Y62A 2VCBA 3NO1A 4MB3A 1FWFC 3P81A 3GX9A 4O16A 1TZ9A 2PODA 3TYDA 3BW4A 3QMSA 4RUBA 4FNUA 1CB7B 3IAPA 2OT1A 3LNPA 1V6XA 1K8XA 1NFGA 3W7EA 5A6LA 1E56A 1HGWA 1GZGA 1I9CB 3AO0A 2NX1A 3BQ6A 3GXNA 3Q65A 1POJA 3SGGA 1UP0A 1CGXA 3E96A 2OZ0A 4HSNA 2GOUA 5FJPA 1R0MA 2OG9A 3PS7A 3QR1A 3UZXA 3NQFA 2RKXA 1TV7A 4YHGA 2WBKA 2VUYA 1WKYA 4WCJA 4IGNA 4K38A 4V27A 2PFHA 5I07A 2ZICA 5LIUX 2OU4A 2DQXA 3LZ3A 1JZ8A 2BV9A 4ZB0A 1LRTA 4HU8A 1XBYA 1VC4A 2WHLA 3KP0A 3NL2A 2PWFA 3TYZA 3GTHA 1E6NA 3L4WA 4H00A 1L2QA 2QAFA 4ZFMA 3M0KA 2E9MA 1NDYA 4NNCA 1R87A 3L4ZA 2Z4GA 4HD5A 1Q6GA 1QOXA 1MXGA 2NX3A 3LCFA 3NZQA 3CS2A 3GQYA 2YL6A 3K4DA 4FXFA 3GTXA 3VOCA 4O12A 1FQ0A 2GJNA 1M7OA 2CLIA 3ONCA 4H8HA 5LGXA 3LNMA 5DCDA 3PTMA 1OJXA 4XAGA 4BQ2A 1AVAA 3EEZA 3A5FA 2EXOA 4J4KA 2C7FA 2XGIA 5FJUA 3EWUA 3W7RA 3P0XA 4DWDA 3PY2A 3QPZA 1J9YA 4JIHA 4UTIA 2YYUA 2E40A 4BR1A 5E93A 4RNJA 1JYNA 5H8UA 4JY9A 2YW4A 1HQTA 2HJPA 4PB5A 2Q3RA 3CWNA 4WJEA 2FB3A 1HG3A 2P53A 4LC8A 3LMYA 4WSJA 3FA3A 5EMKA 2J74A 1ZAIA 4F2UA 2J79A 1NEYA 3W1PA 1SVDA 5XINA 3NQ2A 1UZHA 4IUGA 2FHFA 1J96A 3EKGA 3LQGA 4ZE5A 1OGSA 5KTLA 4XZNX 2VVNA 1B3OA 2QDEA 1JEZA 2X1IA 1GPFA 3LB0A 4PUUA 4X22A 4AD5A 2HISA 3B0VC 3QZAA 2OQYA 3DYPA 3HA1A 1GUVA 1F4HA 2NT1A 4MWAE 1OG0A 3N6JA 2Y5JA 4M7TA 4QAWA 3S6OA 4KERA 1K4GA 3OQ8A 3FHQA 4LALA 1PTDA 4IT1A 1G01A 1EP2A 2RH9A 5GPRA 3GNRA 3S5YA 1RCQA 3SUSA 7ENLA 1K8CA 3U5YA 4BI5A 5G1YA 4QDMA 2E6DA 5RUBA 1Q2SA 3UGRA 3NM1A 3SUUA 1E6PA 1NP0A 2WSYA 2C15A 3UF9A 3XIMA 3P74A 2R82A 3CHCA 3WMCA 4JY8A 1EJUC 1LRQA 5AYBA 2VRJA 5D33A 1I2QA 2E5DA 3KCOA 4DO5A 4AWTA 5CBBA 1HX0A 4I7UA 3UR7A 3VCNA 3WX7A 4QX4A 3BLDA 4MAZA 4PUKA 4ZSUA 2WVUA 1L6WA 3UZZA 5K9CA 1GKPA 2BZNA 3NVDA 3MUZ1 4YVVA 5F2LA 3DENA 3VNZA 5D9PA 3AS3A 5CXPA 1SUXA 2HK0A 2DGAA 4ZO8A 1GHRA 4B5XA 1GJWA 3TWAA 4LW7A 1B2YA 4YWIA 1NWRA 3SRHA 3O7UA 1VRXA 2VI0A 5DRCA 2VEMA 4NY2A 7ODCA 1UOKA 2QDDA 1YRRA 1HJSA 3MKKA 4C6IA 3VOFA 2R1LA 4OBSA 3A3XA 1MQPA 3QC0A 1AL7A 3OVQA 2Y6ZA 3WMSA 4ECLA 3PNZA 5HPCA 4YVPA 1BGGA 4FOJA 4GY1A 1VFTA 3I7RA 1N82A 3MO7A 3WDJA 4AZ5A 1UHVA 1FHLA 1XLEA 1GONA 3MI6A 3QQ1A 1SO3A 2E7FA 2YCLB 3LI1A 3VCRA 3B40A 2PGEA 3F4NA 1U1JA 1ML1A 3B8UA 1OCBA 3MCMA 2PTXA 4PBEA 4GZEA 4YTSA 1ZHAA 1QI3A 1B3ZA 1UWIA 2JE8A 3K4WA 1ITQA 3AUJA 1O5QA 3RF9A 2QT3A 1HO1A 3QBUA 4CCCA 3LCXA 3TXVA 1DQXA 1UZ4A 4GO8A 2CW6A 4A3YA 2ZX5A 3MSYA 1V3IA 1P7TA 1ZUAX 3MP4A 5BYWA 4A3UA 4YU1A 2PGFA 3DFTA 3NDYA 3AFBA 3K5XA 4LUYA 4J3WA 4RNHA 3GDKA 2FZ8A 4UFLA 1QNSA 3KZSA 3ENLA 3WLJA 1EPVA 4CN4A 1JAEA 2QGYA 4ZB5A 5LNWA 1IXPA 2D20A 4JQAA 1TWWA 4ZQCA 2WMJA 3DFNA 1XSIA 3WNLA 2V6AA 2R14A 5A6SA 4Q6JA 2OSWA 2VGFA 4XWUA 3SRDA 4MNJA 5ABEA 2YCKX 3W7QA 2V68A 2W91A 4A3QA 2NQLA 3WDRA 3ME3A 5AVNA 3C8FA 4US5D 2VGIA 3APGA 4NUWA 2XINA 4H3DA 3AHYA 2WBGA 3DFQA 1K8YA 1CXLA 2Y70A 4W4QA 3EOOA 4A8RA 1K9EA 1Q6DA 4UTJA 2I16A 4AVOA 2PDGA 3R0DA 2XM2A 2PDHA 1FCUA 2DEPA 2W4XA 3LENA 1K7FA 1XCFA 3A4AA 1XG4A 3C56A 1FP8A 3LPOA 5KETA 2ZXQA 3DYMA 5C8BB 1FWBC 1E4IA 1WV2A 4D6GA 3FEMA 4OT7A 2ISVA 4RDVA 2OZ3A 2VEPA 4DBWA 2WVVA 3CZJA 4FNTA 4E5TA 4BK9A 4HA4A 2PURA 2GUYA 4PEEA 3RNDA 4PFMA 3VDGA 4DRSA 4IOTA 2ISDA 4NYYA 5T9BG 1V51A 1FWWA 1QCWA 2PGWA 3W86A 5A6BD 3WZ0E 1QR7A 4H2CA 2QJMA 1UD6A 2ZXDA 3JU2A 5DXYA 3SUTA 2W62A 5HDRA 3MVTA 4K8EA 3URQA 2EPNA 3GY1A 2X09A 4JS3A 2OSYA 4Z2KA 2EPHA 2WMIA 4HU4A 1XBZA 2E67A 4MY1A 1FWGC 3ZVHA 2XG9A 1WP6A 5CGMA 1TPEA 2C0HA 3W82A 3WQPA 3HPZA 3W01A 3GD6A 1E0TA 4F3HA 3NZGA 3E5PA 1UWQA 1BF2A 3BLFA 4PH6A 4X60A 8CGTA 3NQMA 2IMRA 4EF9A 4HYVA 5J5RA 3ANVA 1PE1A 3GFZA 4KIEA 4QGCA 5AC5A 1Q5MA 3B8DA 4LYRA 3SCNA 2GLKA 3QZ6A 3GS6A 4DIAA 2OYMA 3HO8A 1BQCA 1Q6EA 5CC5A 3PZOA 2EPLX 1FXQA 1XI3A 3KS6A 3QGVA 2FLIA 3QOMA 4HMNA 4PGLA 3N4FA 3SRKA 2AL2A 4UNKA 1K7XA 3SCUA 4GG9A 2QAPA 4J9JA 1X8FA 1O5RA 3TW6A 3ZJ8A 4IFRA 4MDPA 1BD0A 2VEFA 2UY3A 3DDMA 1WDWA 2FZNA 4AZCA 1I8JA 1MZRA 4UR9A 5C2CA 2CXGA 2FVLA 4DWSA 2PDNA 3HB9A 2Y89A 7XIMA 1Q3NA 2ZRXA 2C1GA 2FPVA 4GJJA 4JTKA 4ENLA 2CLHA 2PWUA 4P61A 4IL0A 3LCWA 1KGXA 3UW6A 2ZIDA 1E4LA 4H9VA 3GB6A 3J7HA 5A8MA 3FA4A 2UY2A 1RBAA 5DCEA 4XKMA 3TW7A 3IARA 1FH9A 4XBKA 4E4UA 4WY0B 2WHJA 3S1VA 3R5EA 1O66A 1LZOA 4Q8PA 4F66A 3WF4A 1X7FA 3IJ8A 1W8SA 3EZ4A 1UROA 4QP0A 3ZT5A 3TN4A 1KGUA 2NXHA 3STCA 1UMLA 5HQMA 4DYEA 2NW0A 3C61A 1G4TA 2XIMA 1H7RA 3ZR4A 2R8WA 2VMFA 3ZXWA 1W56A 1OHLA 3TNOA 2XUCA 3FAWA 2RDUA 3HIJA 3PUOA 3SCRA 3CTTA 2IPJA 3L23A 5ABGA 3T0TA 1XCWA 4FF7A 3PJWA 2DZUA 3V35A 4M1BA 4GC3A 3DGBA 4GUJA 1N8FA 4E4FA 1M3UA 3M4HA 3VI2A 4GX8A 5FEWA 2VD8A 1KD0A 1WZAA 3B8SA 4GGHA 3L2MA 4A35A 3C86A 4YHEA 2I5QA 5AHMA 1TO3A 1VP5A 1WA3A 1PJ9A 2WSKA 3FGCB 1UZ1A 3QEZA 3BICA 2FH8A 2RJHA 3O0KA 3UU0A 3QN3A 4CNTA 1QNQA 1HFBA 1WE5A 4GC4A 3C0SA 1JD7A 2C14A 1TV5A 4B5NA 4LV4A 1H41A 1R9ZA 2YDSA 3DBNA 1RD5A 5JUVA 3DXIA 1J10A 3G5EA 4J3TA 2Y7EA 4A8NA 3W7IA 2D2HA 2CLPA 4ADTA 1TMQA 2QCDA 1XQKA 1IWAA 5HWJA 4GQBA 4TX6A 2HS8A 2WCSA 4N9BA 3KUMA 4L4LA 4G7EB 1SJCA 2VX4A 4TU1A 3BO9A 2WC7A 3WQDA 3TSMA 4QLKA 3TQPA 2PDUA 5DFAA 2JKEA 2X30A 3ARXA 4GVHA 1TR9A 3BOXA 3ARSA 4K7VA 3CH9A 2PA6A 1QFEA 3HBLA 1J0IA 1XGEA 5CG7A 5JQ9A 5AYYA 1XL9A 2ZX6A 1E55A 3REQA 1ME9A 2QIWA 5ABHA 1MW3A 3UNTA 1LLOA 2ZZ6A 2WW5A 4DJEA 4WVXA 4FX7A 5D38A 4QJ4B 2R1MA 4XAPA 5AYIA 3FIGA 4O19A 4UMAA 3BJFA 4DUOA 1BXCA 5CPLA 3U7VA 1YDOA 4H8UA 1J0KA 4O8AA 3FEQA 3GLCA 3H2NA 2Q8XA 1DTUA 2OO6A 4DO7A 2Q01A 1I1WA 2GOKA 1OYCA 1RCOB 2WSRA 2ZRUA 3P5YA 3MQTA 1V0KA 4M6QA 1XRTA 1FKXA 3WDIA 3GXTA 4JIQA 4O28A 2PCQA 4GE8A 4JTDA 3SY5A 3CYJA 4WXZA 4XK2A 1WNOA 4DZHA 4TVUA 5IDZA 1J8VA 1XCXA 3STGA 4QS6A 5XIMA 2JEQA 4TUFA 4DJFA 2XYLA 1I2NA 1NH6A 2CBUA 3AYRA 4I9MA 3FXGA 4ZFCA 2JALA 3LEPA 1VFUA 4ORIA 1EC9A 5CLWA 3TJIA 2H3DA 2Z1WA 3EWBX 4D6JA 1F6PA 4UOQA 3ELFA 1AJ0A 1GW1A 1QAPA 1VEMA 5JMUA 3CPRA 1MQQA 4IXHA 1DWAM 3TC3A 4PSPA 2FGLA 2PZ0A 4JZ5A 1PVNA 3F2BA 2VRQA 4C7GA 1TTPA 2V5JA 2I17A 1HIZA 2G0WA 2FQIA 3PG8A 4N7QA 3DHPA 3S5NA 1PIGA 4TTGA 3V3WA 4C7FA 4FLSA 1CI1A 6TAAA 2NV2A 3BURA 4UTLA 3LGDA 4NAEB 4AY1A 4PRWA 2HXTA 3W76A 3W85A 1BKSA 1XLIA 3RLGA 2YL9A 1K7EA 3HQ1A 3TN6A 2MNRA 4L9ZA 2PMQA 3VO0A 2VFGA 3P67A 3PR2A 2CKSA 4CQBA 4PUDA 2VQUA 1WCGA 3AHZA 3G77A 2VC7A 2V5LA 3Q4DA 4E6MA 9RUBA 3GW0A 2G5WA 2H90A 4KWOA 4PMRA 3VMPA 5TIMA 2I56A 2JGQA 1S3TC 2ZUSA 3CHFA 4XBSA 3UD6A 2V5KA 3K8MA 5D03A 3ZFHA 4Z0JA 1BAGA 1GVEA 1W9UA 3PUEA 3EEGA 2VKZG 1GQJA 1CXHA 3R2GA 5LNVA 2INZA 1O5XA 4RZ4A 1TV2A 1OYBA 4FO4A 2IPWA 2O4MA 3AS1A 1WKDA 5I09A 5BOFA 2XIBA 4FNSA 1CGUA 3PSVA 3WDHA 2W79A 1ZBWA 2DVTA 4UR8A 3EXSA 3DC8A 1J5SA 3ISIX 3G6MA 1MWOA 4GJIA 3HG2A 3WD4A 5D2TA 4R27A 1RY8A 3GU2A 4PBGA 1Y5VA 2ON3A 3UXIA 3TSDA 4Y9MA 4EX4A 5IHSA 3ALGA 3N2OA 3BDKA 4KEMA 5HINA 3BGGA 5H8MA 3OVPA 5M1TA 3U4AA 2DSWA 1PAMA 4CVUA 3TN3A 2NVCA 4LB3A 3RG6A 1PIIA 3H21A 2V3EA 1R9XA 1VIWA 2EG8A 3OYXA 4ZL1A 3VE7A 3LYEA 4O1FA 1W9VA 3T81A 4KF1A 2GWGA 2PDIA 4KQNA 3T7VA 2JF7A 4L4MA 3EGJA 3VD9A 3T1GA 2BLEA 3ARUA 3OZPA 3ANUA 5FACA 3ARYA 3NIYA 2HRWA 1XM3A 2ZXAA 1WYIA 3D3FA 1XRFA 1I0BA 1W9BM 4W5ZA 2NXGA 3CASA 3P14A 1GGOA 1V3JA 2YA0A 5L6UA 1I2PA 5U4NA 3WK3A 3QLDA 3C2EA 3OIHA 3ATZA 1OM0A 1P48A 2WAGA 4UMCA 3WMLA 5J5DA 4LUJA 3POCA 1J79A 3OHIA 3T8LA 2NXIA 1W9DM 1IR2A 4UB9A 5KITA 4EPKA 1SQ7A 3VD5A 2ZZ3A 3DHUA 2OLAA 3T0CA 2Z6JA 3AIQA 1W1B1 1TE6A 3W1XA 3O1NA 5K4ZA 2XFFA 3URAA 1HKKA 4RE3A 2DSZA 1UKTA 3NSMA 4MWAD 5ECVA 4IGSA 1C91A 1SO4A 1XLCA 1E1CA 3S5SA 1LUCA 3C5QA 4DJDD 3H2FA 4M24A 3S2JA 4BQ3A 1VZWA 1YPIA 3KFTA 4CNUA 2CFFA 1TTIA 1W2PA 4RNIA 3L4VA 1V7YA 4MG4A 2WQPA 1UBSA 3RPMA 4ZBCA 1Z42A 3WBAA 3QYSA 4E8GA 3UWEA 1M1BA 4K1WA 5FKYA 1QBBA 1Y5XA 2Z27A 4JQ4A 4GNKB 3MANA 5AHLA 1YADA 1TB3A 3MW7A 3CUZA 4DF0A 2PB1A 3KBSA 1VRDA 4UZSA 1H1ZA 3DAQA 5DMLA 2ATSA 1PDZA 5AHNA 3O2LA 1S2AA 4MF4A 3CBWA 2ZZ1A 3IIPA 2P10A 3OTRA 2NVDA 2NLYA 2ONEA 4IP4A 3MP5A 4DLMA 4EXQA 4LF1A 2VXNA 4M6VA 5A2CA 3QTGA 2B81A 3ZR6A 2Z28A 4IMFA 4QLLA 4OIFA 2G3FA 3FYPA 3CUFA 3QHMA 1EWDA 4JTQA 1E6SM 2PPGA 5KEZA 4Y6GA 4JDYA 3GYEA 4Q7IA 2VC6A 2C19A 1FDJA 1RVGA 4IIEA 1GQNA 3R4IA 3PFMA 1PYMA 1IF2A 7A3HA 3PBYA 2VP8A 3N6HA 3PN8A 3MDWA 4REQB 3TP4A 4O4VA 3A4WA 4L9XA 1NVMA 1UUQA 1GQIA 3TXZA 1V03A 4C6QA 1P1MA 1EYEA 3TJ4A 3H23A 1F2JA 2GGGA 5FI8A 2WMGA 4HTBA 1NDWA 1S2VA 5LA2A 2BOGX 4X9SA 5F1UA 3WJWA 3SIZA 1GJPA 2G96A 3W84A 1R3RA 2WNZA 4IH3A 1J0YA 4Q4MA 2QCCA 1VB9A 1FKWA 3IK4A 4O1BA 2ABAA 1Q6RA 1BXBA 4OUIA 3BLPX 3EAUA 2FIQA 5HJXA 4HPGA 2OOGA 2QVNA 3MU7A 3DOPA 3FAXA 4FXJA 1Q4WA 1FWJC 2C79A 3GHTA 3BVJA 4AW7A 3BG5A 3INPA 2WOQA 4IPJA 2GVEA 4HK5A 3FJLA 3DG6A 5FJRA 5CAKA 2J9XA 1U5HA 1DJNA 4CN6A 1XPGA 1LTDA 3MTWA 3MCOA 1QK0A 5JBFA 1EWEA 3KS5A 4A3RA 1RH9A 3NYDA 1UC5A 5LKYA 1E6XM 1K70A 3M9YA 3KLLA 3E02A 1E40A 4UR7A 2VRKA 3A3WA 1CNVA 3B9NA 3TMLA 1L8PA 3K13A 4J1OA 5C9RA 2NQHA 3VCCA 4OKDA 4UBPC 1QTWA 2BVYA 1AW2A 2BX7A 4FI4A 4MZ8A 1QBAA 3U8GA 1R3VA 4AYSA 2CWXA 3DFYA 1FH7A 4MOZA 2V2CA 5HPOA 4W7VA 2X7VA 3M0VA 1BYAA 2H6RA 3M0IA 2R6OA 1T40A 4B92A 1XXXA 2BHYA 1HKVA 4U2YA 2YA2A 1X8CA 1KLZA 1PZ1A 3G24A 3G1HA 1XFCA 3M41A 1WDSA 5A6AA 5DBUA 1EF3A 1WDRA 5A94A 3CK5A 5HQEA 1UKSA 2DY3A 1HGYA 1UQZA 1LP6A 1EC7A 4LSBA 4XVDA 2VNCA 1VH7A 3ITVA 5EYWA 1NIUA 3TYBA 1J12A 2WKGA 2HVOA 4PTDA 1DIDA 4GCAA 3VNMA 3L2LA 2INEA 3CPGA 3IJIA 1NF0A 3UESA 4EANA 4P8UA 4OVXA 3TQVA 5I7GA 4OBTA 3M0LA 3RGTA 4LYKA 5IOBA 1E9ZB 2VFDA 4JQ2A 2E77A 2GSJA 3BAYA 3SN1A 1I0DA 1E5JA 1ZAHA 1QNPA 2J27A 2GDQA 2V67A 4CQ9A 5C70A 5CJMA 3PSWA 1QPQA 3C0LA 2J8FA 1GVOA 1SGJA 3AMDA 3AZTA 3CL7A 1A80A 3UG8A 5A95A 1FCBA 2CESA 2NV1A 3PWGA 4H9MA 3S6TA 2DT1A 3L5LA 3BCFA 2WZIA 5D9OA 2CBJA 1E1FA 2DW7A 5C9ZA 2YKKA 4KFNA 3R7MA 2PC4A 3TCEA 3AMCA 1JNEA 3QY8A 3RLHA 3U2OA 4PL2A 3A47A 4S3DA 4PCTA 3G0SA 3QRHA 3E2SA 1EJXC 2DSVA 4RXGA 3GVGA 3TX9A 4HVXA 1XDJA 2D22A 4HJWA 1GKRA 1M04A 1EA0A 1UBPC 4I90A 3IVTA 5HMEA 3V1PA 3VK5A 1OCJA 1EIXA 3AHTA 3K1DA 1VHCA 3DU0A 3NQ6A 2VOMA 1DJYA 2EKGA 4F79A 3UVIA 1EFZA 5FCZA 3E2QA 4GY0A 3EOLA 1B9BA 3UR5A 3SB0A 3WK2A 4H2HA 4DBUA 3HGRA 3E49A 4O0QA 4R7JA 1KQZA 1TJPA 3NAVA 4PMDA 3NL3A 2XH2A 5HNUA 3PNUA 1EO7A 2WANA 3W37A 1HO4A 2VZOA 4PEKA 5PTDA 2C3ZA 3Q67A 5T8GA 1T41A 2E6FA 4N4PA 4GQGA 4Q8VA 3MUCA 1CTNA 3A4JA 2DVUA 3EBVA 1GHSA 2CXEA 5ABTA 1J18A 2E9LA 1E4MM 2SFPA 1H49A 1A4LA 3M16A 2CWNA 4DYKA 4XUGA 5DANA 4MYXA 4GI9A 4P8WA 3CYVA 4KRTA 1O6IA 3N4AA 4AIEA 4FR6A 4QM1A 3A9IA 4US6A 2BVTA 3FLUA 3V4BA 2IKHA 4E2DA 5IXEA 2AKMA 4YL2A 4TOQA 2YSWA 1G7UA 4M0XA 2A7PA 5EMJA 3CGTA 4BI7A 3U0HA 3EX6A 4N2YA 3HG4A 5M17A 2MANA 4K6AA 5IRPA 2YCEA 1KFCA 2E28A 5DT7A 5CQ1A 4OBRA 3GNNA 1AZ2A 3LK6A 4Q8TA 1AQ0A 4LAKA 2YYTA 3N2TA 3RM9A 3W2UA 3W1TA 4WLCA 3LHUA 1X1NA 4Z0SA 3PANA 5LXXA 3U2EA 3WQVA 3M0JA 1FDZA 2XGBA 3B8WA 1LOQA 5HULA 1QT1A 2W3ZA 4GKTA 4K3ZA 4YCOA 3H2AA 1I75A 2PDQA 1TV3A 3LXAA 5HUPA 2YZ5A 2R94A 5D2YA 4Q3MA 2WC3A 2CLLA 4MIMA 2DT2A 2FDMA 2ZVIA 8TIMA 1YPXA 5BMWA 2OR2A 3BG3A 3DH7A 1H51A 3M46A 1MI3A 3UR2A 1QHPA 4G1NA 4ZQNA 5C71A 1CWYA 1HKIA 4DBEA 1N8WA 3CB3A 3AXMA 4AD2A 4NXKA 4UTUA 3QPEA 5JIPA 3S1WA 3SCWA 2FGBA 4PMVA 3WLRA 2Y8VA 4ICMA 2EKCA 2V5DA 4MKNA 1R6WA 3QMTA 2G50A 3NJ3A 1JPDX 1LBLA 2INFA 2QUMA 1E1EA 4HHPA 4OOUA 5EB8A 3IGHX 3NQDA 5ABFB 3N19B 2OODA 1V02A 3DKJA 3L66A 1XDMA 1Z44A 1OD8A 3O8AA 4ZQPA 3SJ3A 2G37A 2FZDA 1T7LA 1MUWA 2FMNA 1T8XA 1G7VA 3CEPA 3N1AA 5DMYA 1P0EA 2BXZA 3FJ6A 2RAGA 2YR1A 1H7WA 3K1GA 4HNCA 4XX6A 1G94A 1US0A 3BTNA 4M6PA 2YCJA 3G6LA 1PX8A 3LXCA 1TUFA 4LPCA 1I2RA 3NDOA 5IFPA 3LUTA 1GJUA 1NSJA 5D9NA 3T42A 1KFWA 3LBOA 4NAEA 3WH9A 2R24A 4PL1A 3IVSA 3W6YA 3T9PA 2NSXA 4XAYA 4D71A 2GUBA 2VDGA 2WLZA 3CQJA 3W7NA 4W85A 2J77A 4MLJA 2WWDA 3H53A 5A6KA 1LJYA 2CZVA 4Y96A 3NR0A 3FA5A 1O94A 4LANA 2OXNA 4D9PA 1XIHA 2GK1B 4ROQA 4GRSA 4Q8NA 4WRHA 5I5RA 1WDDA 2WVSA 4AD3A 2VC9A 5JU6A 1RR2A 4XZIA 1FWTA 5J8LA 4LCSA 3LHZA 1CXIA 2W63A 4LB4A 4G7FA 1FHDA 3TTQA 1YBQA 1MRAA 4UCGA 2ODOA 5EFFA 1O68A 4CEUC 2CERA 4TTUA 2WWCA 3UPWA 4CLMA 1CT5A 3ZWSA 4IX2A 1POKA 3H7UA 2Q6ZA 1IIGA 1W1TA 5HQLA 3W27A 3BAWA 1CB2A 1YPFA 4D6CA 3P62A 1W17A 5GNXA 5LIXX 3LI0A 3A13A 4MPKA 4AF0A 1PCKA 2YW3A 4HTYA 3WYZA 3T09A 3UCQA 1LDCA 4NX0A 5FEZA 3N2XA 1JCJA 1R7AA 2J7BA 1UA7A 1H11A 2VX6A 2PRLA 1DWFM 3CEUA 3M64A 2J9YA 4C1NA 3LPGA 1SO5A 2X2GA 5DN1A 1AJ2A 4ORMA 3CPUA 1B57A 3VNDA 4P8XA 4J7RA 1DORA 4JHOA 5F4XA 3L4YA 2G95A 4J35A 3ZS4A 2V38A 5A6MA 1F05A 5EMLA 3KL3A 1EZWA 4H6RA 3WD3A 3AS0A 1R86A 2ZVRA 4NI3A 3AYTA 3BAKA 3BZGA 3B9AA 2PLCA 4Y8FA 3G0XA 4RZBA 2XH0A 1F8IA 1B0IA 6A3HA 2PU0A 3HU7A 1K9FA 1J0HA 4EVZA 1R2TA 3SIMA 2GVJA 1O7AA 1E6RA 2F8QA 5AZ0A 3CO4A 4CQDA 1EHNA 1YLVA 4YIWA 3HPFA 3UA4A 3KDOA 3ZSTA 3RK8A 3GBEA 3BV4A 1DVJA 5K3VA 1WPCA 1W3JA 3PJUA 3ABSA 1IZCA 3VM5A 1IXQA 1NQKA 4H01A 2RUSA 4J3SA 2ZBTA 3F2CA 3WKZA 4LS1A 3RMEA 3IJ7A 4QXIA 3RR1A 1DIKA 4YCPA 2DZWA 3FV9A 3CU2A 3UEQA 2VYOA 1RBOB 3UJFA 3NG3A 3VGBA 1QHOA 1X97A 3S2NA 1CGYA 3VNJA 3G3DA 1XIIA 5HR6A 3FSTA 4MHBA 3JUGA 2GSHA 2VGGA 1S3HA 4FX8A 2GFTA 4LCQA 5C7HA 3CM4A 3BAIA 1R3TA 2J78A 2GL5A 4PTWA 2AL1A 1QWKA 7TAAA 2G97A 3O07A 3KOZA 4IMAA 1H7NA 1F4AA 4C1KA 2DVXA 4LBRA 2ZADA 1W5PA 3O6AA 3WDPP 3KBVA 3RFAA 5E9AA 1KR0A 5EBAA 1BFNA 1LWJA 3C52A 1ONWA 1E43A 4Z2IA 4IIDA 2PF8A 3PF3A 3FJNA 2UV8G 3AOFA 4W9TA 1GG0A 2QEZA 1YXDA 3EDDA 1JAKA 3H6OA 4LAUA 5I23A 1UPPA 3WK1A 2V3DA 2DT0A 3F4VA 5G4HC 3EPNA 3AIVA 4F9DA 2B7PA 2Z0IA 4N4QA 3I3BA 3AHVA 1H5YA 1W3TA 3S9YA 2OWXA 4JD4A 3L0GA 1RJQA 4PULA 4GNVA 4YYFA 4HNVA 5M03A 2DUAA 2AGTA 3MMTA 1FWCC 1TPFA 1TWZA 2E6AA 3P61A 3W81A 2G4FA 3R89A 1ZBKA 1GVSA 4I9AA 3SCTA 1R2SA 4QG9A 3TE9A 4HPHA 1QW7A 1YE4A 4CNPA 4I5RA 2MUCA 1J11A 1OFDA 2VELA 4UQ9A 4REQA 5BWAA 1K8ZA 3NFUA 3ZJ7A 4AB4A 1S1RA 2VEKA 4WKFA 4CN1A 4XBJA 2Z1BA 1XLHA 3ES8A 3DBPA 1RXOB 3VOHA 3WQWA 1XDLA 3LGEA 3UJ2A 3WNPA 5LIYX 1RP8A 5EGRA 2PDMA 2NSOA 1XH0A 4CCDA 1SFLA 4H9ZA 3DGRA 3BZJA 1UR0A 3THAA 6CGTA 4JXCA 3VNKA 4PB3A 1KWGA 1DHKA 3HGJA 4PMUA 4BKNA 5D4YA 3DFHA 3BLIA 2ESCA 1TVPA 5JBEA 1ONXA 4Q4PA 2GGJA 5D05A 4FR1A 3V7PA 3IPWA 2QDGA 1LLWA 2PLMA 3A12A 4R34A 3EPMA 5AHFA 1B3XA 1K4HA 2BBFA 2WZHA 3PPCA 3W02A 3V5CA 5E6ZA 3W1MA 2YCIX 3G18A 1Z8AA 4AIUA 1HL9A 4DO4A 2REQA 2F6KA 1CEOA 3UXAA 1VYSX 4KGLA 6REQA 1A0CA 4NT0A 3KE0A 3OQEA 1UD2A 3EWYA 3U48A 2H9AB 1VFSA 3CZLA 4RE0A 3QGKC 1EUAA 1NFBA 4DZAA 3GK0A 2CLOA 1OFRA 4WY0F 4MTVA 3V1HA 1ZU8A 4DN1A 1ESWA 1OSEA 3VKJA 1FCVA 2HEJA 4H41A 2WV8A 1V6VA 2NLIA 3FVDA 1XKJA 3WL1A 1A5LC 1UMYA 5CC6A 2VZVA 4OV4A 2OWWA 4AVFA 4UTKA 4MDOA 3AMKA 1XYCA 2YFNA 1D3HA 3I7QA 3UJEA 1UCWA 3QKZA 3ZO9A 2J4GA 4JX4A 3EXTA 1QVBA 4E38A 4HHMA 1TTJA 3IIOA 3I3EA 2E5CA 1QU4A 4RL3A 4WIWA 2V2HA 4HSHA 3PTQA 4C5ZA 2YOCA 3F1QA 2F9RA 3H12A 4AY8A 3GHRA 4FLOA 3UGVA 4TMBA 3W7CA 2E4TA 1R3YA 4LTSA 3UG4A 3PM6A 3NPXA 2POTA 1RBLA 2PCEA 2QMKA 1PHWA 5CLTA 3W0KA 2GVGA 1AD4A 3NGJA 3EMCA 1DQWA 4W8AA 4LNYA 3VIFA 1M65A 3AHXA 4MNMA 3RRXA 3AU6A 5CPNA 3V18A 1HT6A 2KX9A 4RCXA 4H19A 3HPSA 4JAWA 1IXOA 4NAFB 4A8LA 5LA0A 4G56A 1PKLA 1ODZA 2R1PA 1VJSA 3OA3A 1CGWA 5FOOA 3NO5A 3SO7A 4B90A 2P88A 4W86A 1MO0A 4IQDA 4GH1A 4PCFA 1LBMA 1FDYA 2PTYA 1KKOA 2V5BA 2OYLA 4TVCA 3B0UX 1LQ0A 5FEXA 1KLYA 3H2EA 2PZNA 4HCLA 2WK2A 4UQDA 4A21A 3H4GA 1VBJA 1BGAA 3AXXA 3JS3A 1EXPA 5T91A 3USZA 2X0YA 2GJRA 1IE7C 1P7TB 6TIMA 4CU8A 5IHRA 3KRZA 4QSFA 2AAMA 1PZ2A 3MMDA 3WLHA 3R8HA 3I4EA 3S3GA 1AQFA 4WDTA 2Z2BA 1Y8BA 4K8GA 3LCIA 2QULA 4UFHA 2NQ5A 4X63A 4QE5A 1H09A 3KBNA 4D8AA 1JQXA 3APYA 3POHA 5HATA 1OEPA 5I3JA 1KFEA 3CHDA 1O4UA 2YXXA 3EXRA 1XW8A 1W1ZA 3N18A 3URNA 4XISA 4PCPA 4BF5A 1H7OA 5D09A 3B8VA 2XH4A 3VTRA 4PTNA 3M0ZA 4N9DA 4OHQA 4WK9A 1HXJA 3HV9A 3PPFA 5BROA 3KDNA 4L1GA 3THQA 4B16A 1RY0A