3TCOA

Crystallographic and spectroscopic characterization of sulfolobus solfataricus trxa1 provide insights into the determinants of thioredoxin fold stability
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
EDVTLVLTEENFDEVIRNNKLVLVDCWAEWCAPCHLYEPIYKKVAEKYKGKAVFGRLNVDENQKIADKYSVLNIPTTLIFVNGQLVDSLVGAVDEDTLESTVNKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin (TrxA-1)
publication title Crystallographic and spectroscopic characterizations of Sulfolobus solfataricus TrxA1 provide insights into the determinants of thioredoxin fold stability.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
total genus 30
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3tcoA00
2DIYA 2IMEA 2R4VA 3FR9A 2MMNA 4N0ZA 5H5RA 4HOJA 1TRSA 2VD0A 4PURA 5DAKB 3IDVA 2R5GA 4DSRA 1GNWA 5IMCA 4I2TA 4DSSB 5A4VA 5CRHA 5IO0A 3VWWA 2DMMA 5CO3A 2OACA 5EL8A 3G7JA 1SK2A 1YY7A 1X9MB 1H75A 1KTEA 2B6MA 1FB0A 3F8UA 2B5EA 1W4VA 4GQFA 1GLPA 3UBLA 3GIXA 3F0IA 4DSSA 3CYNA 1Z7RA 3AY8A 3O3TA 1XOAA 2M72A 3EU3A 2OE1A 3GTUA 1ZL9A 1TRVA 5G30A 4GSNA 2DJKA 2VOCA 1J0FA 2OJLA 3OR5A 3F6DA 4HQZA 3MDKA 4TXOA 5ECMB 4TR4A 3D4MA 3PR8A 2GT6A 3DIEA 2TRCP 1E2YA 4PGTA 5L71A 3KM6A 4JZQA 5J41A 2WGRA 5F05A 2GQKA 1SYRA 3CMIA 3C1RA 22GSA 1F37A 5KN3A 2VL3A 3KH9A 3BBYA 4N10A 2YWIA 4AJ8A 2PVQA 2AB6A 2C3TA 4V2NA 1AQVA 2IFQA 3EMPA 3IRAA 2O8VB 2HSYA 1EGRA 2GQLA 2ALBA 1GUHA 4FIWA 5IMDA 1TW9A 3TUEA 3F9UA 3IXRA 4BA7A 2VO4A 1RK4A 2BMXA 2O89A 5ECLB 2K9FA 1DE2A 2AYTA 1O6JA 1GSYA 2JL4A 3CSIA 3O76A 2GZPA 1Z6MA 3IR4A 4MPFA 2FNOA 4G9HA 2WRTA 3LXZA 1SJ6A 4NV2A 3KGKA 2P5RA 3ZMLA 3FZ4A 4CHSA 2K6VA 1K0NA 5ECPB 2FCHA 3I6AA 2WJUA 4Q5RA 2WDUA 1XOBA 3E9JB 3TB2A 3VFIA 1KNGA 4PUFC 3A2WA 2DLXA 4QQ7A 4ISDA 1B4QA 3CSJA 2H66A 4ZL8A 4L0UA 4H86A 4EUYA 1SYXA 1GWCA 2C8UA 1CQGA 1EOGA 2MMZA 3ERFA 2YJHA 3ZL5A 4EVMA 1YQ1A 1B4PA 2YNXA 1BJXA 1SK1A 4HJ2A 2IJYA 2X8GA 4K8MA 3LYPA 2LNTA 2X8HA 4OWYA 3CXGA 5ECNB 2V32A 1EP7A 1EGOA 2QGVA 2O87A 2GSTA 3PGTA 2B3SA 1K3YA 1PKWA 1VF1A 18GSA 3ZVJA 3Q19A 1PL1A 2H8LA 4K6XA 1X5DA 1T1VA 2VAFA 1A2LA 3LORA 6GSUA 4K1FA 4E8EA 1SL1B 4NPBA 3UIWA 2H6XA 4V1Ap 2YJ7A 4MMMA 3CBUA 1XWBA 4KDXA 1WP0A 5D73A 4YQMA 2H1BA 2EIOA 2CA8A 3TKRA 5EY6A 1TK0B 2WCIA 2LSTA 4RQXA 1YKCA 5IMZA 6GSYA 5DCGA 3QOUA 4MF6A 4NV5A 5GSSA 1LBKA 4IJ3A 1X0RA 4PNFA 4XS4B 5A5KA 3KEBA 1TOFA 1TDIA 5J3RA 2CAIA 1A0RP 2TRXA 3GURA 5AIXA 3HZ4A 3IBHA 2LS5A 3ZITA 2IPAA 3FY7A 4MDCA 3HXSA 1GSSA 1ZOFA 3P8WA 2A2RA 1M2BA 5IIZA 3HY2A 5J9BA 1X5CA 3L78A 1URMA 2X99A 4ZBDA 3BJ5A 2VL2C 4IS0A 3ZIJA 1SKSB 2HNLA 3IHQA 1GUKA 2YZHA 1EP8A 5KEJA 1BG5A 4KSOA 1K0DA 2P31A 3F4TA 2NDOA 3IC4A 3UL3A 3MSZA 4KCAA 2HLSA 4OMVA 2PBJA 1XPVA 3ZRDA 2M80A 4EL1A 1GNEA 4LL4B 2WZ9A 3TGZA 2R2JA 3RAZA 3KH7A 3P7XA 3A2VA 4OO5A 4F0CA 3LG6A 4P3YB 1GTUA 4MK3A 3C71A 1FVKA 1GP1A 2H74A 1MDIA 2G2QA 2CVDA 5ECHB 3VI7A 4TVEA 4PQHA 4L5OA 1T4ZA 5G5EA 2CV4A 2GZZA 2RM5A 3DWVA 3F6FA 2EIRA 3FEUA 1JLVA 1WPIA 3NIVA 4POMA 3UBKA 4RUVA 4XRDA 5JCUA 4PX1A 3WGXA 5H5QA 5IO2A 1MEKA 4ACSA 5B6NA 3TDGA 1PN9A 3L0HA 2YP6A 3L9SA 4AF2A 1HYUA 2RIIA 13GSA 3US3A 2V6OA 2R3XA 4FYCA 3HDCA 3DGQA 1ERWA 1OVNA 4ZBAA 2CX3A 1XCCA 2VCQA 2LEGA 2GQMA 4FO5A 3F63A 2I1UA 2FA4A 2FUG2 3VWVA 3W6GA 4AGSA 1V98A 2VUPA 4OFMA 2GVPA 3L9UA 5IMVA 3KMOA 3F4SA 5F07A 4GTUA 2IMIA 2VL9A 4MABA 1PX6A 1TI1A 3QFBC 3RHBA 3APOA 1DE1A 2KLXA 4K9ZA 4HI7A 4NXIA 4GCIA 5ELAA 4ZL9A 1CQHA 1O7UA 6GSVA 3LFLA 4Q5FA 4IBPA 3GKKA 4LA1A 1G6YA 4DEJA 5AN1A 2B5YA 1AAZA 2R37A 1SKWB 3UAPA 1GLQA 2GS3A 4QL7A 3M0FA 1ML6A 2V6KA 1YKAA 1TTZA 3HJPA 6GSWA 3GYKA 1YF1A 3N5OA 2HRNA 3TJBA 1QFNA 1O81A 2ES7A 2IL3A 2D2ZA 3LQ7A 3IPZA 4EDZA 1K0OA 2LJRA 5EVOA 1UN2A 1Y6EA 3VWUA 6GSXA 1F3BA 3KIJA 4YQUA 3TKPA 1ON4A 2HZEA 5D9TA 2KP1A 4K2DA 2JADA 5DBQA 1R4WA 1N8JA 5CREA 4KNDA 2GDRA 5G5FA 4L0WA 1GTIA 3L9VA 1J9BA 3DXBA 2B7KA 3GTUB 1O85A 2H76A 1WWJA 4AJ6A 5DQSA 2OE3A 4ECJA 3EE2A 2I81A 4TXOB 3E0UA 4I8BA 3EINA 4ZL7A 2PN8A 2REMA 1JZRA 3KTBA 1T00A 1QQ2A 3JCML 3DD3A 2GSQA 3VURA 2J23A 2DC5A 2V41A 3S9FA 5HFIA 1V2AA 2F8AA 1TXXA 1MDJA 2F9SA 1OKTA 2L59A 4X0XA 3FYGA 5CRGA 3LSZA 3RPNA 2AJQB 1H4OA 1A2JA 2IFQB 4D73A 2H73A 3FZ9A 2OKAA 2YWMA 4J2FA 1SKRB 4OFTA 1JFUA 4ZB8A 3ZIVA 2LRCA 3RBTA 1K0BA 1XWCA 1U3AA 1LJRA 3QDNA 4MJBA 2YCDA 3ZMKA 5D93A 2YN1A 2XPDA 2YWNA 4XRAA 3LEFA 1O8XA 1QK8A 1I9DA 1SD8A 1AIUA 5FT3A 5IMAA 4KE3A 1DBYA 2FD3A 3P2AA 4ZB6A 1JZDA 3UVHA 2WFCA 5AIVA 2FHEA 5E4WA 5JWRB 2AAWA 5KN2A 3IAS2 4IJIA 2ZNMA 3TKQA 1SK0A 2N5BA 2NPBA 4WF5A 2XC2A 3ZTLA 5INYA 2X8CA 4E8HA 4KGIA 4N0VA 4KH7A 3BOAA 1KBNA 4PUAA 1X9WB 5ENUA 4XHMA 2VCZA 3GMFA 3KD0A 2FWEA 3D0ZA 3FHKA 5DJLA 2L5LA 4BWQA 1VF4A 4TOPA 5LD0A 3WD6A 1VF2A 2KP2A 2MZCA 3ZYWA 1PSQA 4POLA 3VPQA 4JR4A 2QC7A 1B48A 2DBCA 5J5NA 3WT2A 3ME7A 3ZFBA 3M9KA 3TRQA 2YWOA 1RQMA 2GGTA 2X64A 1USBA 4I6XA 1R5PA 4Q5NA 1V57A 1ZYQB 2YOIA 4V2LA 2B1LA 4MH2A 2I9HA 2FY6A 2CT6A 3KP9A 3QCPA 1EOHA 19GSA 5GAND 3VLNA 2GZYA 3FW2A 3H8QA 2H1AA 2O7KA 2IN3A 2JU5A 2GTUA 1W89A 11GSA 2N5AA 1SJZA 2ZUPA 4K7IA 5JWOB 4WR5A 1TP9A 1O73A 5F0GA 1OYJA 4V1Ag 5ECKB 1T4YA 5DCHA 4XS1A 3APQA 4RI6A 1QXHA 1WJKA 1U6TA 3RDWA 1FAAA 4JU5A 2VM2A 1WIKA 3CTGA 2LV3A 2B7JA 2P5QA 1UVZA 4TR1A 4ZBBA 4FYUA 3DVXA 4WKWA 1TK8B 1M0UA 2E2MA 4I2UA 4MZWA 2DJ1A 2HZFA 4YAVA 1B9YC 4IHUA 1XWAA 3D21A 4KAEA 4IQ1A 5AISA 4OCEA 1OC9A 5FHIA 4YAPA 3IAM2 1R7HA 2VLVA 3QAWA 12GSA 2C0DA 3HA9A 1F9MA 3ERGA 2I4AA 4DVCA 4IP6A 5IPGA 2PWJA 3QR6A 1DUGA 4EC0A 5G31A 4ZXGA 1NHYA 1ZYEA 4V2MA 3U6VA 2R6KA 1IYIA 4YH2A 3DVWA 3DEXA 4BWSA 1GRXA 4K0GA 3CSHA 4POBA 1GUMA 1FB6A 2DSAA 3U5RE 1SD9A 3GH9A 3V1WA 1GL8A 3D5JA 1MTCA 1TU8A 1GSUA 4MH3A 1OC3A 2PPTA 4GQCA 3TJFA 4BVYA 5JWQB 1TRWA 3O6TA 3UOMA 4BPYA 3GX8A 3FZAA 4ZB9A 1K3LA 2YV7A 4QL9A 3C73A 1T3BA 2VD1A 4KDUA 5CNWA 2JACA 2GSRA 4LMWA 1PA3A 5EPFA 3HD5A 3ZREA 1EV4A 4LL1B 2JZTA 4IKHA 2GSSA 1FW1A 1GSQA 2A4VA 3FR6A 2JZRA 3NZNA 4ECCA 1F2EA 4L5LA 5G1KA 2FLSA 3M8NA 4EXJA 1GSEA 2C3QA 2LKUA 3J7Yb 1RW1A 3GKXA 1YEXA 3I43A 5LCZA 2C3NA 3M3MA 1E6BA 1M7TA 4OD7A 2H1DA 2AHEA 1XBSA 1BYEA 2P0GA 5HFKA 2CZ3A 2N5FA 3APSA 2EIQA 4POKA 3ED3A 2L5OA 5JCGA 4HJMA 2LQOA 4WEYA 3EYTA 3A3TA 4ILFA 3IK7A 2ON7A 5D9WA 2RLIA 4KW6A 4MJEA 5D9VA 2JSYA 4J56E 3W8JA 1OKDA 4TN8A 1XW5A 2K18A 1O8WA 2TIRA 5COHA 5J4UA 2JZSA 1R5AA 5IOWA 2K8VA 1XXUA 10GSA 1KEBA 1SENA 4KUNA 1FVJA 2BJXA 1F3AA 2C0EA 4NHWA 1HNCA 4ULXA 1A8YA 4F2IA 2WS2A 4NWYA 2C0FA 2VLUA 1EEJA 1A8LA 3ERWA 1NW2A 4OO4A 5GZZB 1ZMAA 4O5RA 3DRNA 5ECRB 3TJKA 3E3EA 5ECQB 4ECIA 2IMFA 4JE1A 2IMKA 2C0GA 3TKSE 2FGXA 1OAZA 1TRUA 1GULA 3QFAC 3D4TA 4IQAA 1TK5B 1FG4A 3WGDA 2HYXA 1VGLA 3M1GA 2H70A 3MNGA 3IV4A 4XS6A 5DVBA 3C1SA 3QAGA 1K0AA 1GH2A 2L4QA 4HUAA 2VCWA 3GN3A 4JR6A 4NMUA 2HE3A 1BQ7A 1G0TA 1AC1A 4L8EA 3TCOA 2HZEB 1AUCA 1YDKA 2LRTA 5GAPD 6GSSA 1THOA 5IM9A 5CP1A 3HVSA 4Q5QA 1ZGNA 1M9AA 3FRCA 1XFLA 5ECIB 3UJ1A 1LU4A 4N11A 4DSQA 3A2XA 4O7HA 2C80A 1F6MC 4KDYA 1K0MA 2YPMA 1SL2B 1ERVA 1TI3A 4ZIJA 2H1GA 5ABRA 2E2GA 1MD4A 2L6CA 4OFNA 3GKMA 2H6YA 3HHVA 17GSA 4X43A 3TJJA 3HJMA 6GSTA 5CAXA 3HJOA 5CYYA 5G1LA 3Q6OA 5IMFA 2IWTA 4TKYA 4ZILA 4RI7A 3FR3A 4X1UA 2CX4A 4XCSA 4K0NA 2PU9C 4HQSA 2LRNA 3Q74A 4D73B 2DJJA 3L4NA 3EMXA 3WT1A 4TXVA 1X5EA 3BD2A 5B8AA 2VLTA 3GFKA 1Y25A 2C1YA 2I3YA 4Z7XA 4K7NA 3GL3A 3GRXA 5HR3A 3IA1A 4ECBA 5DAKA 4HS1A 1XVWA 3SWLA 1YEPA 2DJ3A 3HCZA 2VCTA 5H5SA 5LNKe 7GSSA 3I69A 3VI5A 2KOKA 3LJRA 5D96A 3FZ5A 4MLYA 9GSSA 2HFDA 1XW6A 3BCKA 5D9XA 1TJDA 4JRRA 3UMAA 5DALB 1X9SB 4O92A 1XWKA 2PMTA 3K8NA 4F0BA 5DQYA 2FWHA 3HVVA 3J7Yk 2CVKA 3CRTA 3LGCA 1R26A 1V40A 1U3IA 2QSIA 3NOFA 3CTFA 1PRXA 4K7OA 5DALA 1T7PB 1PX7A 2G0FA 2O85A 4G19A 5C04A 1ACVA 3LWAA 3TOUA 2PGTA 16GSA 3MWHA 14GSA 2PVOC 3ISOA 3TRXA 4WETA 3H93A 5ID2B 2NBSA 5C00A 1Z9HA 1A2MA 1OE8A 4N30A 1I5GA 3R2QA 5KN0A 1U88A 2V1MA 3I9V2 1QGVA 3VK9A 2OA7A 5AGYA 2XHFA 1PQNA 1M2DA 3M9JA 5ID2A 8GSSA 1HD2A 1V58A 4HEA2 4IGJA 2NVLA 4HU7A 3EU4A 1C72A 1JZOA 2IIYA 5D8IA 2PERA 3SBCA 4WBJA 2H72A 4EKZA 3KMNA 1OE7A 2B1KA 4FH8A 1ILOA 2H0IA 2CZ2A 4PQIA 1M2AA 4BVXA 4TR3A 1MDKA 4BL7A 1YZXA 4LMVA 3GUSA 4TR1B 1A23A 4GRFA 3KXOA 4MP4A 4XIHA 4J57E 2MBTA 1FO5A 4CDOA 3GSSA 1NSWA 4OCFA 3UEMA 4EE0A 1PD21 1OC9B 3GX0A 3FK8A 3RPPA 4GF0A 1JZWA 2KUCA 2LJKA 2H6ZA 2WB9A 3D22A 3VPTA 1TKDB 1Q98A 2VCVA 2YANA 4TR0A 5HR2A 3TKSC 1U87A 1SL0B 1PMTA 1VF3A 2MYGA 4WR4A 5HFGA 1A0FA 2H19A 2MMAA 3F4RA 4HZ2A 2MMOA 4KCEA 3H4KA 1WRYA 2V2GA 5B8BA 2LNSA 2E0QA 5IPHA 5IOXA 4TRXA 3W8SA 1XWGA 4KA0A 3ZVJD 1YF0A 2L57A 1YJ6A 2LJAA 1ABAA 1SU9A 1MD3A 1G7OA 1GTAA 3HKRA 2ON5A 1V9WA 1NHOA 1HNBA 1THXA 2CQ9A 1TU7A 2RUEA 2YV9A 1GSDA 2AUVA 4G2EA 4MA9A 1AQXA 2EC4A 1BX9A 4MPGA 1Z6NA 4IW9A 2F8FA 3G7YA 3GHAA 2QKEA 1XW9A 4KSMA 2XBQA 3UVTA 2HT9A 2A2SA 2J9HA 3EC3A 3D6IA 3GKNA 2H0HA 3H79A 4I5QA 3G7IA 3PH9A 1GSFA 5DDLA 1ZZYA 3QPMA 3LXTA 3RHCA 4IVFA 1ERTA 3F3QA 4XS4A 5ECOB 1PKZA 5A4WA 5E59A 4NAXA 4EO3A 4I97A 4LLRA 5HQPA 4GLTA 5CRWA 3IOSA 2RM6A 3EURA 1AXDA 5FWGA 2AV4A 4F03A 2OBIA 4CW9A 2DMLA 2F3MA 1EWXA 3Q18A 5DJMA 1S3CA 4KX4A 1AQWA 3VWXA 1K3OA 4IP1A 3WGEA 4F9ZA 1G7EA 4TW5A 4MF7A 2GT5A 3GV1A 2IMDA 1J08A 2LTKA 2HRFA 3FKFA 1HNAA 4PQ1A 2HSHA 2E7PA 5F06A 1AW9A 4GSSA 4JBBA 4MCUA 4FYBA 3H1NA 4WXTA 1XVQA 3EVIA 4ML6A 3CRUA 2XBIA 2HI7A 3TKSA 3ZLPA 4G10A 4GSTA 1UA5A 1G6WA 3QD9A 4PXOA 2NTOA 5JCWA 4MZBA 3QMXA 1M99A 2YZUA 3UARA 3DKSA 2DJ0A 1HQOA 1ERUA 2L4CA 5IQYA 2JSZA 3GNJA 3HZ8A 4HU9A 4HDEA 2H71A 4YQVA 3GL5A 3IK9A 5B6MA 2GLRA 3HVXA 1WOUA 2FWFA 5A4UA 1Z5YE 1FOVA 4IN0A 4AJ7A 4ID0A 2L6DA 5HR1A 1PL2A 5J9CA 4MJCA 2VIMA 1UC7A 2BTOT 3GA4A 3C8EA 4IELA 20GSA 4WBRD 4F82A 1Z7PA 3TJGA 2F51A 3ZFLA 2K8SA 5KN1A 2M46A 1M9BA 2H30A 5B7CA 3KTLA 4EF0A 3N9JA 2VM1A 1N2AA 2FA8A 2LQQA 1OC8A 2OADA 1PGTA 1JHBA 2H75A 1WMJA 3F3RA 2ZCTA 1IYHA 1SJIA 1JLWA 2KHPA 2FWGA 2XPEA 4EDYA 4NHZA 1BAYA 1Z3EA 5HR0A 2B5XA 4XTSA 2PUKC 2OBKA 2Z9SA 2MBSA 3EWLA 1B8XA 1GTBA 4MZCA 3HYPA 1VRSD 3GSTA 4ML1A 1S3DA 2VL2A 5G2ZA 3C7MA 1T8EB 1EEMA 2LUSA 3KP8A 3KZQA 3MAKA 3QAVA 4WF4A 5ECSA 3ZZXA 3BCIA 1ST9A 5F8BA 1K0CA 2C4JA 1QMVA 3ME8A 4GWRA 4KB3A 3A5WA 1Q4JA 1EZKA 1XIYA 2HXKA 2H0GA 4MF5A 3DYRA 3PINA 3P90A 5CRDA 1B9XC 1XZOA 1WE0A 3IE3A 4MJAA 1DSBA 2RUFA 3GH6A 3G9BA 1S3AA 2WULA 1NM3A 4HZ4A 5ELGA 1QUWA 2OE0A 3DMLA 4O32A 1ZCPA 2CAQA 4RQRA 2VCXA 1FHEA 3KJYA 3TOTA 4JEDA 2DIZA 3WYWA 4PNGA 3TRPA 3KCMA 2CVBA 5GSTA 2DJ2A 1EV9A 2H01A 1BEDA 4GXZA 1A24A 3LYKA
chains in the Genus database with same CATH superfamily
2DIYA 2IMEA 2R4VA 3FR9A 2MMNA 4N0ZA 5H5RA 4HOJA 1TRSA 2VD0A 4PURA 5DAKB 3IDVA 2R5GA 4DSRA 1GNWA 5IMCA 4I2TA 4DSSB 5A4VA 5CRHA 5IO0A 3VWWA 2DMMA 5CO3A 2OACA 5EL8A 3G7JA 1SK2A 1YY7A 4Z2UA 1X9MB 1H75A 1KTEA 2B6MA 1FB0A 3F8UA 2B5EA 1W4VA 4GQFA 1GLPA 3UBLA 3GIXA 3F0IA 4DSSA 3CYNA 1Z7RA 1XG8A 3AY8A 3O3TA 1XOAA 2M72A 3EU3A 2OE1A 3GTUA 1ZL9A 1TRVA 5G30A 4GSNA 2DJKA 4KF9A 2VOCA 1J0FA 2OJLA 3OR5A 3F6DA 4HQZA 3MDKA 4TXOA 5ECMB 4TR4A 3D4MA 3PR8A 2GT6A 3DIEA 2TRCP 1E2YA 4PGTA 5L71A 3KM6A 4JZQA 5J41A 2WGRA 5KOWA 5F05A 2GQKA 1SYRA 3CMIA 3C1RA 22GSA 1F37A 5KN3A 2VL3A 2HRKA 3KH9A 3BBYA 4N10A 2YWIA 4AJ8A 2PVQA 2AB6A 2C3TA 4V2NA 1AQVA 2IFQA 3EMPA 3IRAA 2O8VB 2HSYA 1EGRA 2GQLA 2ALBA 1GUHA 4FIWA 5BMUA 5IMDA 1TW9A 3TUEA 3F9UA 3IXRA 4BA7A 2VO4A 1RK4A 2BMXA 2O89A 5ECLB 2K9FA 1DE2A 2AYTA 1O6JA 1GSYA 2JL4A 2UZ8A 3CSIA 2A4HA 3O76A 4Z2TA 2GZPA 1Z6MA 3IR4A 4MPFA 2FNOA 4G9HA 2WRTA 3LXZA 1SJ6A 4NV2A 3KGKA 4BVXB 2P5RA 3ZMLA 4BL7B 3FZ4A 4CHSA 2K6VA 1K0NA 5ECPB 2FCHA 3I6AA 2WJUA 4Q5RA 2WDUA 1XOBA 3E9JB 3A5IA 3TB2A 3VFIA 1KNGA 4PUFC 3A2WA 2DLXA 4QQ7A 4ISDA 1B4QA 3CSJA 2H66A 4ZL8A 4L0UA 4H86A 4EUYA 1SYXA 1GWCA 2C8UA 1CQGA 1EOGA 2MMZA 3ERFA 2YJHA 3ZL5A 4EVMA 1YQ1A 1B4PA 2YNXA 1BJXA 1SK1A 4HJ2A 2IJYA 2X8GA 4K8MA 3LYPA 2LNTA 2X8HA 5KOXA 4OWYA 3CXGA 5ECNB 2V32A 1EP7A 1EGOA 2QGVA 2O87A 2GSTA 3PGTA 2B3SA 2DKIA 1K3YA 1PKWA 1VF1A 18GSA 3ZVJA 3Q19A 1PL1A 2H8LA 4K6XA 1X5DA 1T1VA 2VAFA 1A2LA 3LORA 6GSUA 4K1FA 4E8EA 1SL1B 4NPBA 3UIWA 2H6XA 1M3IA 4V1Ap 2YJ7A 4MMMA 3CBUA 1XWBA 4KDXA 1WP0A 5D73A 4YQMA 2H1BA 2EIOA 2CA8A 3TKRA 5EY6A 1TK0B 2WCIA 2LSTA 4RQXA 1YKCA 5IMZA 6GSYA 5DCGA 3QOUA 4MF6A 4NV5A 5GSSA 1LBKA 4O5UA 4IJ3A 1X0RA 4PNFA 4XS4B 5A5KA 3KEBA 1TOFA 1TDIA 5J3RA 2CAIA 1A0RP 2TRXA 3GURA 5AIXA 3HZ4A 3IBHA 2LS5A 3ZITA 2IPAA 3FY7A 4MDCA 3HXSA 1GSSA 1ZOFA 3P8WA 2A2RA 1M2BA 5IIZA 3HY2A 5J9BA 1X5CA 3L78A 1URMA 2X99A 4ZBDA 3BJ5A 2VL2C 4IS0A 3ZIJA 1SKSB 2HNLA 2QA1A 3IHQA 1GUKA 2YZHA 1EP8A 5KEJA 1BG5A 4KSOA 1K0DA 2P31A 3F4TA 2NDOA 3IC4A 3UL3A 3MSZA 4KCAA 2HLSA 4OMVA 2PBJA 1XPVA 3IC8A 3ZRDA 2M80A 4EL1A 1GNEA 4LL4B 2WZ9A 3TGZA 2R2JA 3RAZA 3KH7A 3P7XA 3A2VA 4OO5A 4F0CA 3LG6A 4P3YB 1GTUA 4MK3A 3C71A 1FVKA 1GP1A 2H74A 1MDIA 2G2QA 2CVDA 5ECHB 3VI7A 4TVEA 4PQHA 4L5OA 1T4ZA 5G5EA 2CV4A 2GZZA 2RM5A 3DWVA 3F6FA 2EIRA 3FEUA 1JLVA 1WPIA 3NIVA 4POMA 3UBKA 4RUVA 4XRDA 5JCUA 4PX1A 3WGXA 5H5QA 5IO2A 1MEKA 4ACSA 5B6NA 1ZYNA 3TDGA 1PN9A 3L0HA 2YP6A 4CY8A 3L9SA 4AF2A 1HYUA 2RIIA 13GSA 3US3A 2V6OA 2R3XA 4FYCA 3HDCA 3DGQA 1ERWA 1OVNA 4ZBAA 2CX3A 1XCCA 2VCQA 2LEGA 2GQMA 4FO5A 3F63A 2I1UA 2FA4A 2FUG2 3VWVA 3W6GA 4AGSA 1V98A 2VUPA 4OFMA 2GVPA 3L9UA 5IMVA 3KMOA 3F4SA 5F07A 4GTUA 2IMIA 2VL9A 4MABA 1PX6A 1TI1A 3QFBC 3RHBA 3APOA 1DE1A 2KLXA 4K9ZA 4HI7A 4NXIA 4GCIA 5ELAA 4ZL9A 1CQHA 1O7UA 6GSVA 3LFLA 2X4AA 4Q5FA 4IBPA 3GKKA 4LA1A 1G6YA 4DEJA 5AN1A 2B5YA 1AAZA 2R37A 1SKWB 3UAPA 1GLQA 2GS3A 4QL7A 3M0FA 1ML6A 2V6KA 1YKAA 1TTZA 3HJPA 6GSWA 3GYKA 1YF1A 3N5OA 2HRNA 3TJBA 1QFNA 1O81A 2ES7A 2IL3A 2D2ZA 1S3RA 3LQ7A 3IPZA 4EDZA 1K0OA 2LJRA 5EVOA 1UN2A 1Y6EA 3VWUA 6GSXA 1F3BA 3KIJA 4YQUA 3TKPA 1ON4A 2HZEA 5D9TA 2KP1A 4K2DA 2JADA 5DBQA 1R4WA 1N8JA 5CREA 4KNDA 2GDRA 4K5RA 5G5FA 4L0WA 1GTIA 3L9VA 1J9BA 3DXBA 2B7KA 3GTUB 1O85A 2H76A 4G0KA 1WWJA 4AJ6A 5DQSA 2OE3A 4ECJA 3EE2A 2I81A 4TXOB 3E0UA 4I8BA 3EINA 4ZL7A 2PN8A 2REMA 1JZRA 3KTBA 1T00A 1QQ2A 3JCML 3DD3A 2GSQA 3VURA 2J23A 2DC5A 2V41A 3S9FA 5HFIA 1V2AA 2F8AA 1TXXA 1MDJA 2F9SA 1OKTA 2L59A 4X0XA 3FYGA 5CRGA 3LSZA 3RPNA 2AJQB 3IHGA 1H4OA 1A2JA 2IFQB 4D73A 2H73A 3FZ9A 2OKAA 2YWMA 4J2FA 1SKRB 4OFTA 1JFUA 4ZB8A 3ZIVA 2LRCA 3RBTA 1K0BA 1XWCA 2DKHA 1U3AA 1LJRA 3QDNA 4MJBA 2YCDA 3ZMKA 5D93A 2YN1A 2XPDA 2YWNA 4XRAA 3EPTA 3LEFA 1O8XA 1QK8A 1I9DA 1SD8A 1AIUA 5FT3A 5IMAA 4X4JA 4KE3A 1DBYA 2FD3A 3P2AA 4ZB6A 1JZDA 3UVHA 2WFCA 5AIVA 2FHEA 5E4WA 5JWRB 2AAWA 5KN2A 3IAS2 4IJIA 2ZNMA 3TKQA 1SK0A 2N5BA 2NPBA 4WF5A 2XC2A 3ZTLA 5INYA 2X8CA 4E8HA 4KGIA 4N0VA 4KH7A 3BOAA 1KBNA 4PUAA 1X9WB 5ENUA 4XHMA 2VCZA 3GMFA 4K2XA 3KD0A 2FWEA 3D0ZA 3FHKA 5DJLA 2L5LA 4BWQA 1VF4A 4TOPA 5LD0A 3LW9A 3WD6A 1VF2A 2KP2A 2MZCA 3ZYWA 1PSQA 4POLA 3VPQA 4JR4A 2QC7A 1B48A 2DBCA 5J5NA 3WT2A 3ME7A 3ZFBA 3M9KA 3TRQA 2YWOA 1RQMA 2GGTA 2X64A 1USBA 4I6XA 3PPUA 1R5PA 3HVNA 4Q5NA 1V57A 1ZYQB 2YOIA 4V2LA 2B1LA 4MH2A 2I9HA 2FY6A 2CT6A 3KP9A 3QCPA 1EOHA 19GSA 5GAND 3VLNA 2GZYA 4USSA 3FW2A 3H8QA 2H1AA 2O7KA 2IN3A 2JU5A 2GTUA 1W89A 11GSA 2N5AA 1SJZA 2ZUPA 4K7IA 5JWOB 4WR5A 1TP9A 1O73A 5F0GA 1OYJA 4V1Ag 5ECKB 1T4YA 5DCHA 4XS1A 3APQA 4RI6A 1QXHA 1WJKA 1U6TA 3RDWA 1FAAA 4JU5A 2VM2A 1WIKA 3CTGA 2LV3A 2B7JA 2P5QA 1UVZA 4TR1A 4ZBBA 4FYUA 3DVXA 4WKWA 1TK8B 1M0UA 2E2MA 4I2UA 4MZWA 2DJ1A 2HZFA 3R3EA 1B9YC 4YAVA 4IHUA 4YKFA 4EIPA 1XWAA 3D21A 4KAEA 4IQ1A 5AISA 4OCEA 1OC9A 5FHIA 4YAPA 3IAM2 1R7HA 2VLVA 3QAWA 12GSA 2C0DA 3HA9A 1F9MA 3ERGA 2I4AA 4DVCA 4IP6A 5IPGA 2PWJA 3QR6A 1DUGA 4EC0A 5G31A 4ZXGA 1NHYA 1ZYEA 4V2MA 3U6VA 2R6KA 1IYIA 4YH2A 3DVWA 3DEXA 4BWSA 1GRXA 4K0GA 3CSHA 4POBA 1GUMA 1FB6A 2DSAA 3U5RE 1SD9A 3GH9A 3V1WA 1GL8A 3D5JA 1MTCA 1TU8A 1GSUA 4MH3A 1OC3A 2PPTA 4GQCA 3TJFA 4BVYA 5JWQB 1TRWA 3O6TA 3UOMA 4BPYA 3GX8A 3FZAA 4ZB9A 1K3LA 2YV7A 4QL9A 3C73A 1T3BA 2VD1A 4KDUA 5CNWA 2JACA 2GSRA 4LMWA 1PA3A 3MIXA 5EPFA 3HD5A 3ZREA 1EV4A 4LL1B 2JZTA 4IKHA 2GSSA 1FW1A 1GSQA 2A4VA 3FR6A 2JZRA 3NZNA 4ECCA 1F2EA 4L5LA 5G1KA 2FLSA 3M8NA 4EXJA 1GSEA 4CY6A 2C3QA 2LKUA 3J7Yb 1RW1A 3GKXA 1YEXA 3I43A 5LCZA 2C3NA 3M3MA 1E6BA 1M7TA 4OD7A 2H1DA 2AHEA 1XBSA 1BYEA 2P0GA 5HFKA 2CZ3A 2N5FA 3APSA 2EIQA 4POKA 3ED3A 2L5OA 5JCGA 4HJMA 2LQOA 4WEYA 3EYTA 1M3JA 3A3TA 4BIKA 4ILFA 3IK7A 2ON7A 5D9WA 2RLIA 4KW6A 4MJEA 5D9VA 2JSYA 4J56E 3W8JA 1OKDA 4TN8A 1XW5A 2K18A 1O8WA 2TIRA 5COHA 5J4UA 2JZSA 1R5AA 5IOWA 2K8VA 4PTSA 1XXUA 10GSA 1KEBA 1SENA 4KUNA 1FVJA 2BJXA 1F3AA 2C0EA 4NHWA 1HNCA 4ULXA 1A8YA 4F2IA 2WS2A 4NWYA 5BRTA 2C0FA 2VLUA 1EEJA 1A8LA 3ERWA 1NW2A 4OO4A 5GZZB 1ZMAA 4O5RA 3DRNA 5ECRB 3TJKA 3E3EA 5ECQB 4ECIA 2IMFA 4JE1A 2IMKA 2C0GA 3TKSE 2FGXA 1OAZA 1TRUA 1GULA 3QFAC 3D4TA 4IQAA 1TK5B 1FG4A 3WGDA 2HYXA 1VGLA 3M1GA 2H70A 3MNGA 3IV4A 4XS6A 5DVBA 3C1SA 3QAGA 1K0AA 1GH2A 2L4QA 4HUAA 2VCWA 3GN3A 4JR6A 4NMUA 2HE3A 1BQ7A 1G0TA 1AC1A 4L8EA 3TCOA 2HZEB 1AUCA 1YDKA 2LRTA 5GAPD 6GSSA 1THOA 5IM9A 5CP1A 4ICYA 3HVSA 4Q5QA 1ZGNA 1M9AA 3FRCA 1XFLA 5ECIB 3UJ1A 1LU4A 4N11A 4DSQA 3A2XA 4O7HA 2C80A 1F6MC 4KDYA 1K0MA 2YPMA 1SL2B 1ERVA 1TI3A 4ZIJA 2H1GA 5ABRA 2E2GA 1MD4A 2L6CA 4OFNA 3GKMA 2H6YA 4EIQA 3HHVA 17GSA 4X43A 3TJJA 3HJMA 6GSTA 5CAXA 3HJOA 5CYYA 5G1LA 3Q6OA 5IMFA 2IWTA 4TKYA 4ZILA 4RI7A 3FR3A 4X1UA 2CX4A 4XCSA 4K0NA 2PU9C 4HQSA 2LRNA 3Q74A 4D73B 2DJJA 3MYDA 3L4NA 3EMXA 3WT1A 4TXVA 1X5EA 3BD2A 5B8AA 2VLTA 3GFKA 1Y25A 2C1YA 2I3YA 4Z7XA 4K7NA 3GL3A 3GRXA 5HR3A 3IA1A 4A5PA 4ECBA 5DAKA 4HS1A 1XVWA 3SWLA 1YEPA 2DJ3A 3HCZA 2VCTA 5H5SA 5LNKe 7GSSA 3I69A 2HRAA 3VI5A 2KOKA 3LJRA 3FZ5A 4MLYA 5D96A 9GSSA 2HFDA 1XW6A 3BCKA 5D9XA 1TJDA 4JRRA 3UMAA 5DALB 1X9SB 4G0LA 4O92A 1XWKA 2PMTA 3K8NA 4F0BA 5DQYA 2FWHA 3HVVA 4HSCX 3J7Yk 2CVKA 3CRTA 3LGCA 1R26A 1V40A 1U3IA 2QSIA 3NOFA 3CTFA 1PRXA 4K7OA 4YKGA 5DALA 1T7PB 1PX7A 2G0FA 2O85A 4G19A 5C04A 1ACVA 3LWAA 2R0GA 3TOUA 2PGTA 16GSA 3MWHA 14GSA 2PVOC 3ISOA 3TRXA 4WETA 3H93A 5ID2B 2NBSA 5C00A 1Z9HA 1A2MA 1OE8A 4N30A 1I5GA 3R2QA 5KN0A 4Z2RA 1U88A 2V1MA 3I9V2 1QGVA 3VK9A 2OA7A 5AGYA 2XHFA 1PQNA 1M2DA 3M9JA 5ID2A 8GSSA 1HD2A 1V58A 4HEA2 4IGJA 2NVLA 4HU7A 3EU4A 1C72A 1JZOA 2IIYA 5D8IA 3FMWA 2PERA 3SBCA 4WBJA 2H72A 4EKZA 3KMNA 1OE7A 2B1KA 4FH8A 1ILOA 2H0IA 2CZ2A 4PQIA 1M2AA 4BVXA 4TR3A 1MDKA 4BL7A 1YZXA 4LMVA 3GUSA 4TR1B 1A23A 4GRFA 3KXOA 4MP4A 4XIHA 4J57E 2MBTA 1FO5A 4CDOA 3GSSA 1NSWA 4OCFA 3UEMA 4EE0A 1PD21 1OC9B 3GX0A 3FK8A 3RPPA 4GF0A 1JZWA 2KUCA 2LJKA 2H6ZA 2WB9A 3D22A 3VPTA 1TKDB 1Q98A 2VCVA 2YANA 4TR0A 5HR2A 3TKSC 1U87A 1SL0B 1PMTA 1VF3A 2MYGA 4WR4A 5HFGA 1A0FA 2H19A 2MMAA 3F4RA 4HZ2A 2MMOA 4KCEA 3H4KA 1WRYA 2V2GA 5B8BA 2LNSA 2E0QA 5IPHA 5IOXA 4TRXA 3W8SA 1XWGA 4KA0A 3ZVJD 1YF0A 2L57A 1YJ6A 2LJAA 1ABAA 1SU9A 1MD3A 1G7OA 1GTAA 3HKRA 2ON5A 4BVYB 1V9WA 1NHOA 1HNBA 1THXA 2CQ9A 1TU7A 2RUEA 2YV9A 1GSDA 2AUVA 4G2EA 4MA9A 1AQXA 2EC4A 1BX9A 4MPGA 1Z6NA 4IW9A 2F8FA 3G7YA 3GHAA 2QKEA 1XW9A 4KSMA 2XBQA 3UVTA 2HT9A 2A2SA 4O5QA 2J9HA 3EC3A 3D6IA 1FOHA 3GKNA 2H0HA 3H79A 4I5QA 3G7IA 3PH9A 1GSFA 5DDLA 1ZZYA 3QPMA 3LXTA 3RHCA 4IVFA 1ERTA 3F3QA 4XS4A 5ECOB 1PKZA 5A4WA 5E59A 4NAXA 4EO3A 4I97A 4LLRA 5HQPA 4GLTA 5CRWA 3IOSA 2RM6A 3EURA 1AXDA 5FWGA 2AV4A 4F03A 2OBIA 4CW9A 2DMLA 2F3MA 1EWXA 3Q18A 5DJMA 1S3CA 4KX4A 1AQWA 3VWXA 2X49A 1K3OA 4IP1A 3WGEA 4F9ZA 1G7EA 4TW5A 4MF7A 2GT5A 3GV1A 2IMDA 1J08A 2LTKA 2HRFA 3FKFA 1HNAA 4PQ1A 2HSHA 2E7PA 5F06A 1AW9A 4GSSA 4JBBA 4MCUA 4FYBA 3H1NA 4WXTA 1XVQA 3EVIA 4ML6A 3CRUA 2XBIA 4K5SA 2HI7A 3TKSA 3ZLPA 4G10A 4GSTA 1UA5A 1G6WA 3QD9A 4PXOA 2NTOA 5JCWA 4MZBA 3QMXA 1M99A 2YZUA 3UARA 2A2PA 3DKSA 1ZYPA 2DJ0A 3CQFA 1HQOA 1ERUA 2L4CA 5IQYA 2JSZA 3GNJA 3HZ8A 4HU9A 4HDEA 2H71A 2HSMA 4YQVA 3GL5A 3IK9A 5B6MA 2GLRA 3HVXA 1WOUA 2FWFA 5A4UA 2R0PA 1Z5YE 1FOVA 4IN0A 4MNNA 4AJ7A 4ID0A 2L6DA 5HR1A 1PL2A 5J9CA 4MJCA 1PN0A 1UC7A 2BTOT 2VIMA 3GA4A 3C8EA 4IELA 20GSA 4WBRD 4F82A 1Z7PA 1PFOA 3TJGA 2F51A 3ZFLA 2K8SA 5KN1A 2M46A 1M9BA 2H30A 5B7CA 3KTLA 4EF0A 3N9JA 2VM1A 1N2AA 2FA8A 2LQQA 1OC8A 2OADA 1PGTA 1JHBA 2H75A 1WMJA 3F3RA 2ZCTA 1IYHA 1SJIA 1JLWA 2KHPA 2FWGA 2XPEA 4G0IA 4EDYA 4NHZA 1BAYA 1Z3EA 5HR0A 2B5XA 4XTSA 2PUKC 2OBKA 2Z9SA 2MBSA 3EWLA 1B8XA 1GTBA 4MZCA 3HYPA 1VRSD 3GSTA 4ML1A 1S3DA 2VL2A 2QA2A 5G2ZA 3C7MA 1T8EB 1EEMA 2LUSA 3KP8A 3KZQA 3MAKA 3QAVA 4WF4A 5ECSA 3ZZXA 3BCIA 1ST9A 5F8BA 1K0CA 2C4JA 1QMVA 3ME8A 4GWRA 4KB3A 3A5WA 1Q4JA 1EZKA 1XIYA 2HXKA 2H0GA 4MF5A 3DYRA 3PINA 3P90A 5CRDA 1B9XC 1XZOA 1WE0A 3IE3A 4MJAA 1DSBA 2R0CA 2RUFA 3GH6A 3G9BA 1S3AA 2WULA 1NM3A 4HZ4A 5ELGA 1QUWA 2OE0A 3DMLA 4O32A 1ZCPA 2CAQA 4RQRA 2VCXA 1FHEA 3KJYA 3TOTA 4JEDA 2DIZA 3WYWA 4PNGA 3TRPA 3KCMA 2CVBA 5GSTA 2DJ2A 1EV9A 2H01A 1BEDA 4GXZA 1A24A 4FQUA 3LYKA
chains in the Genus database with same CATH topology
2DIYA 2IMEA 2R4VA 3FR9A 2MMNA 4N0ZA 5H5RA 4HOJA 1TRSA 2VD0A 4PURA 5DAKB 3IDVA 2R5GA 4DSRA 1GNWA 5IMCA 4I2TA 4DSSB 5A4VA 5CRHA 5IO0A 3VWWA 2DMMA 5CO3A 2OACA 5EL8A 3G7JA 1SK2A 1YY7A 4Z2UA 1X9MB 1H75A 1KTEA 2B6MA 1FB0A 3F8UA 2B5EA 1W4VA 4GQFA 1GLPA 3UBLA 3GIXA 3F0IA 4DSSA 3CYNA 1Z7RA 3AY8A 3O3TA 1XOAA 2M72A 3EU3A 2OE1A 3GTUA 1ZL9A 1TRVA 5G30A 4GSNA 2DJKA 4KF9A 2VOCA 1J0FA 2OJLA 3OR5A 3F6DA 4HQZA 3MDKA 4TXOA 5ECMB 4TR4A 3D4MA 3PR8A 2GT6A 3DIEA 2TRCP 1E2YA 4PGTA 5L71A 3KM6A 4JZQA 5J41A 2WGRA 5KOWA 5F05A 2GQKA 1SYRA 3CMIA 3C1RA 22GSA 1F37A 5KN3A 2VL3A 2HRKA 3KH9A 3BBYA 4N10A 2YWIA 4AJ8A 2PVQA 2AB6A 2C3TA 4V2NA 1AQVA 2IFQA 3EMPA 3IRAA 2O8VB 2HSYA 1EGRA 2GQLA 2ALBA 1GUHA 4FIWA 5BMUA 5IMDA 1TW9A 3TUEA 3F9UA 3IXRA 4BA7A 2VO4A 1RK4A 2BMXA 2O89A 5ECLB 2K9FA 1DE2A 2AYTA 1O6JA 1GSYA 2JL4A 2UZ8A 3CSIA 2A4HA 3O76A 4Z2TA 2GZPA 1Z6MA 3IR4A 4MPFA 2FNOA 4G9HA 2WRTA 3LXZA 1SJ6A 4NV2A 3KGKA 4BVXB 2P5RA 3ZMLA 4BL7B 3FZ4A 4CHSA 2K6VA 1K0NA 5ECPB 2FCHA 3I6AA 2WJUA 4Q5RA 2WDUA 1XOBA 3E9JB 3A5IA 3TB2A 3VFIA 1KNGA 4PUFC 3A2WA 2DLXA 4QQ7A 4ISDA 1B4QA 3CSJA 2H66A 4ZL8A 4L0UA 4H86A 4EUYA 1SYXA 1GWCA 2C8UA 1CQGA 1EOGA 2MMZA 3ERFA 2YJHA 3ZL5A 4EVMA 1YQ1A 1B4PA 2YNXA 1BJXA 1SK1A 4HJ2A 2IJYA 2X8GA 4K8MA 3LYPA 2LNTA 2X8HA 5KOXA 4OWYA 3CXGA 5ECNB 2V32A 1EP7A 1EGOA 2QGVA 2O87A 2GSTA 3PGTA 2B3SA 2DKIA 1K3YA 1PKWA 1VF1A 18GSA 3ZVJA 3Q19A 1PL1A 2H8LA 4K6XA 1X5DA 1T1VA 2VAFA 1A2LA 3LORA 6GSUA 4K1FA 4E8EA 1SL1B 4NPBA 3UIWA 2H6XA 4V1Ap 2YJ7A 4MMMA 3CBUA 1XWBA 4KDXA 1WP0A 5D73A 4YQMA 2H1BA 2EIOA 2CA8A 3TKRA 5EY6A 1TK0B 2WCIA 2LSTA 4RQXA 1YKCA 5IMZA 6GSYA 5DCGA 3QOUA 4MF6A 4NV5A 5GSSA 1LBKA 4O5UA 4IJ3A 1X0RA 4PNFA 4XS4B 5A5KA 3KEBA 1TOFA 1TDIA 5J3RA 2CAIA 1A0RP 2TRXA 3GURA 5AIXA 3HZ4A 3IBHA 2LS5A 3ZITA 2IPAA 3FY7A 4MDCA 3HXSA 1GSSA 1ZOFA 3P8WA 2A2RA 1M2BA 5IIZA 3HY2A 5J9BA 1X5CA 3L78A 1URMA 2X99A 4ZBDA 3BJ5A 2VL2C 4IS0A 3ZIJA 1SKSB 2HNLA 2QA1A 3IHQA 1GUKA 2YZHA 1EP8A 5KEJA 1BG5A 4KSOA 1K0DA 2P31A 3F4TA 2NDOA 3IC4A 3UL3A 3MSZA 4KCAA 2HLSA 4OMVA 2PBJA 1XPVA 3IC8A 3ZRDA 2M80A 4EL1A 1GNEA 4LL4B 2WZ9A 3TGZA 2R2JA 3RAZA 3KH7A 3P7XA 3A2VA 4OO5A 4F0CA 3LG6A 4P3YB 1GTUA 4MK3A 3C71A 1FVKA 1GP1A 2H74A 1MDIA 2G2QA 2CVDA 5ECHB 3VI7A 4TVEA 4PQHA 4L5OA 1T4ZA 5G5EA 2CV4A 2GZZA 2RM5A 3DWVA 3F6FA 2EIRA 3FEUA 1JLVA 1WPIA 3NIVA 4POMA 3UBKA 4RUVA 4XRDA 5JCUA 4PX1A 3WGXA 5H5QA 5IO2A 1MEKA 4ACSA 5B6NA 1ZYNA 3TDGA 1PN9A 3L0HA 2YP6A 4CY8A 3L9SA 4AF2A 1HYUA 2RIIA 13GSA 3US3A 2V6OA 2R3XA 4FYCA 3HDCA 3DGQA 1ERWA 1OVNA 4ZBAA 2CX3A 1XCCA 2VCQA 2LEGA 2GQMA 4FO5A 3F63A 2I1UA 2FA4A 2FUG2 3VWVA 3W6GA 4AGSA 1V98A 2VUPA 4OFMA 2GVPA 3L9UA 5IMVA 3KMOA 3F4SA 5F07A 4GTUA 2IMIA 2VL9A 4MABA 1PX6A 1TI1A 3QFBC 3RHBA 3APOA 1DE1A 2KLXA 4K9ZA 4HI7A 4NXIA 4GCIA 5ELAA 4ZL9A 1CQHA 1O7UA 6GSVA 3LFLA 2X4AA 4Q5FA 4IBPA 3GKKA 4LA1A 1G6YA 4DEJA 5AN1A 2B5YA 1AAZA 2R37A 1SKWB 3UAPA 1GLQA 2GS3A 4QL7A 3M0FA 1ML6A 2V6KA 1YKAA 1TTZA 3HJPA 6GSWA 3GYKA 1YF1A 3N5OA 2HRNA 3TJBA 1QFNA 1O81A 2ES7A 2IL3A 2D2ZA 3LQ7A 3IPZA 4EDZA 1K0OA 2LJRA 5EVOA 1UN2A 1Y6EA 3VWUA 6GSXA 1F3BA 3KIJA 4YQUA 3TKPA 1ON4A 2HZEA 5D9TA 2KP1A 4K2DA 2JADA 5DBQA 1R4WA 1N8JA 5CREA 4KNDA 2GDRA 4K5RA 5G5FA 4L0WA 1GTIA 3L9VA 1J9BA 3DXBA 2B7KA 3GTUB 1O85A 2H76A 4G0KA 1WWJA 4AJ6A 5DQSA 2OE3A 4ECJA 3EE2A 2I81A 4TXOB 3E0UA 4I8BA 3EINA 4ZL7A 2PN8A 2REMA 1JZRA 3KTBA 1T00A 1QQ2A 3JCML 3DD3A 2GSQA 3VURA 2J23A 2DC5A 2V41A 3S9FA 5HFIA 1V2AA 2F8AA 1TXXA 1MDJA 2F9SA 1OKTA 2L59A 4X0XA 3FYGA 5CRGA 3LSZA 3RPNA 2AJQB 3IHGA 1H4OA 1A2JA 2IFQB 4D73A 2H73A 3FZ9A 2OKAA 2YWMA 4J2FA 1SKRB 4OFTA 1JFUA 4ZB8A 3ZIVA 2LRCA 3RBTA 1K0BA 1XWCA 2DKHA 1U3AA 1LJRA 3QDNA 4MJBA 2YCDA 3ZMKA 5D93A 2YN1A 2XPDA 2YWNA 4XRAA 3EPTA 3LEFA 1O8XA 1QK8A 1I9DA 1SD8A 1AIUA 5FT3A 5IMAA 4X4JA 4KE3A 1DBYA 2FD3A 3P2AA 4ZB6A 1JZDA 3UVHA 2WFCA 5AIVA 2FHEA 5E4WA 5JWRB 2AAWA 5KN2A 3IAS2 4IJIA 2ZNMA 3TKQA 1SK0A 2N5BA 2NPBA 4WF5A 2XC2A 3ZTLA 5INYA 2X8CA 4E8HA 4KGIA 4N0VA 4KH7A 3BOAA 1KBNA 4PUAA 1X9WB 5ENUA 4XHMA 2VCZA 3GMFA 4K2XA 3KD0A 2FWEA 3D0ZA 3FHKA 5DJLA 2L5LA 4BWQA 1VF4A 4TOPA 5LD0A 3LW9A 3WD6A 1VF2A 2KP2A 2MZCA 3ZYWA 1PSQA 4POLA 3VPQA 4JR4A 2QC7A 1B48A 2DBCA 5J5NA 3WT2A 3ME7A 3ZFBA 3M9KA 3TRQA 2YWOA 1RQMA 2GGTA 2X64A 1USBA 4I6XA 3PPUA 1R5PA 4Q5NA 1V57A 1ZYQB 2YOIA 4V2LA 2B1LA 4MH2A 2I9HA 2FY6A 2CT6A 3KP9A 3QCPA 1EOHA 19GSA 5GAND 3VLNA 2GZYA 4USSA 3FW2A 3H8QA 2H1AA 2O7KA 2IN3A 2JU5A 2GTUA 1W89A 11GSA 2N5AA 1SJZA 2ZUPA 4K7IA 5JWOB 4WR5A 1TP9A 1O73A 5F0GA 1OYJA 4V1Ag 5ECKB 1T4YA 5DCHA 4XS1A 3APQA 4RI6A 1QXHA 1WJKA 1U6TA 3RDWA 1FAAA 4JU5A 2VM2A 1WIKA 3CTGA 2LV3A 2B7JA 2P5QA 1UVZA 4TR1A 4ZBBA 4FYUA 3DVXA 4WKWA 1TK8B 1M0UA 2E2MA 4I2UA 4MZWA 2DJ1A 2HZFA 4YAVA 1B9YC 3R3EA 4IHUA 4YKFA 4EIPA 1XWAA 3D21A 4KAEA 4IQ1A 5AISA 4OCEA 1OC9A 5FHIA 4YAPA 3IAM2 1R7HA 2VLVA 3QAWA 12GSA 2C0DA 3HA9A 1F9MA 3ERGA 2I4AA 4DVCA 4IP6A 5IPGA 2PWJA 3QR6A 1DUGA 4EC0A 5G31A 4ZXGA 1NHYA 1ZYEA 4V2MA 3U6VA 2R6KA 1IYIA 4YH2A 3DVWA 3DEXA 4BWSA 1GRXA 4K0GA 3CSHA 4POBA 1GUMA 1FB6A 2DSAA 3U5RE 1SD9A 3GH9A 3V1WA 1GL8A 3D5JA 1MTCA 1TU8A 1GSUA 4MH3A 1OC3A 2PPTA 4GQCA 3TJFA 4BVYA 5JWQB 1TRWA 3O6TA 3UOMA 4BPYA 3GX8A 3FZAA 4ZB9A 1K3LA 2YV7A 4QL9A 3C73A 1T3BA 2VD1A 4KDUA 5CNWA 2JACA 2GSRA 4LMWA 1PA3A 3MIXA 5EPFA 3HD5A 3ZREA 1EV4A 4LL1B 2JZTA 4IKHA 2GSSA 1FW1A 1GSQA 2A4VA 3FR6A 2JZRA 3NZNA 4ECCA 1F2EA 4L5LA 5G1KA 2FLSA 3M8NA 4EXJA 1GSEA 4CY6A 2C3QA 2LKUA 3J7Yb 1RW1A 3GKXA 1YEXA 3I43A 5LCZA 2C3NA 3M3MA 1E6BA 1M7TA 4OD7A 2H1DA 2AHEA 1XBSA 1BYEA 2P0GA 5HFKA 2CZ3A 2N5FA 3APSA 2EIQA 4POKA 3ED3A 2L5OA 5JCGA 4HJMA 2LQOA 4WEYA 3EYTA 3A3TA 4ILFA 3IK7A 2ON7A 5D9WA 2RLIA 4KW6A 4MJEA 5D9VA 2JSYA 4J56E 3W8JA 1OKDA 4TN8A 1XW5A 2K18A 1O8WA 2TIRA 5COHA 5J4UA 2JZSA 1R5AA 5IOWA 2K8VA 4PTSA 1XXUA 10GSA 1KEBA 1SENA 4KUNA 1FVJA 2BJXA 1F3AA 2C0EA 4NHWA 1HNCA 4ULXA 1A8YA 4F2IA 2WS2A 4NWYA 5BRTA 2C0FA 2VLUA 1EEJA 1A8LA 3ERWA 1NW2A 4OO4A 5GZZB 1ZMAA 4O5RA 3DRNA 5ECRB 3TJKA 3E3EA 5ECQB 4ECIA 2IMFA 4JE1A 2IMKA 2C0GA 3TKSE 2FGXA 1OAZA 1TRUA 1GULA 3QFAC 3D4TA 4IQAA 1TK5B 1FG4A 3WGDA 2HYXA 1VGLA 3M1GA 2H70A 3MNGA 3IV4A 4XS6A 5DVBA 3C1SA 3QAGA 1K0AA 1GH2A 2L4QA 4HUAA 2VCWA 3GN3A 4JR6A 4NMUA 2HE3A 1BQ7A 1G0TA 1AC1A 4L8EA 3TCOA 2HZEB 1AUCA 1YDKA 2LRTA 5GAPD 6GSSA 1THOA 5IM9A 5CP1A 4ICYA 3HVSA 4Q5QA 1ZGNA 1M9AA 3FRCA 1XFLA 5ECIB 3UJ1A 1LU4A 4N11A 4DSQA 3A2XA 4O7HA 2C80A 1F6MC 4KDYA 1K0MA 2YPMA 1SL2B 1ERVA 1TI3A 4ZIJA 2H1GA 5ABRA 2E2GA 1MD4A 2L6CA 4OFNA 3GKMA 2H6YA 4EIQA 3HHVA 17GSA 4X43A 3TJJA 3HJMA 6GSTA 5CAXA 3HJOA 5CYYA 5G1LA 3Q6OA 5IMFA 2IWTA 4TKYA 4ZILA 4RI7A 3FR3A 4X1UA 2CX4A 4XCSA 4K0NA 2PU9C 4HQSA 2LRNA 3Q74A 4D73B 2DJJA 3MYDA 3L4NA 3EMXA 3WT1A 4TXVA 1X5EA 3BD2A 5B8AA 2VLTA 3GFKA 1Y25A 2C1YA 2I3YA 4Z7XA 4K7NA 3GL3A 3GRXA 5HR3A 3IA1A 4A5PA 4ECBA 5DAKA 4HS1A 1XVWA 3SWLA 1YEPA 2DJ3A 3HCZA 2VCTA 5H5SA 5LNKe 7GSSA 3I69A 2HRAA 3VI5A 2KOKA 3LJRA 5D96A 3FZ5A 4MLYA 9GSSA 2HFDA 1XW6A 3BCKA 5D9XA 1TJDA 4JRRA 3UMAA 5DALB 1X9SB 4G0LA 4O92A 1XWKA 2PMTA 3K8NA 4F0BA 5DQYA 2FWHA 3HVVA 3J7Yk 2CVKA 3CRTA 3LGCA 1R26A 1V40A 1U3IA 2QSIA 3NOFA 3CTFA 1PRXA 4K7OA 4YKGA 5DALA 1T7PB 1PX7A 2G0FA 2O85A 4G19A 5C04A 1ACVA 3LWAA 2R0GA 3TOUA 2PGTA 16GSA 3MWHA 14GSA 2PVOC 3ISOA 3TRXA 4WETA 3H93A 5ID2B 2NBSA 5C00A 1Z9HA 1A2MA 1OE8A 4N30A 1I5GA 3R2QA 5KN0A 4Z2RA 1U88A 2V1MA 3I9V2 1QGVA 3VK9A 2OA7A 5AGYA 2XHFA 1PQNA 1M2DA 3M9JA 5ID2A 8GSSA 1HD2A 1V58A 4HEA2 4IGJA 2NVLA 4HU7A 3EU4A 1C72A 1JZOA 2IIYA 5D8IA 3FMWA 2PERA 3SBCA 4WBJA 2H72A 4EKZA 3KMNA 1OE7A 2B1KA 4FH8A 1ILOA 2H0IA 2CZ2A 4PQIA 1M2AA 4BVXA 4TR3A 1MDKA 4BL7A 1YZXA 4LMVA 3GUSA 4TR1B 1A23A 4GRFA 3KXOA 4MP4A 4XIHA 4J57E 2MBTA 1FO5A 4CDOA 3GSSA 1NSWA 4OCFA 3UEMA 4EE0A 1PD21 1OC9B 3GX0A 3FK8A 3RPPA 4GF0A 1JZWA 2KUCA 2LJKA 2H6ZA 2WB9A 3D22A 3VPTA 1TKDB 1Q98A 2VCVA 2YANA 4TR0A 5HR2A 3TKSC 1U87A 1SL0B 1PMTA 1VF3A 2MYGA 4WR4A 5HFGA 1A0FA 2H19A 2MMAA 3F4RA 4HZ2A 2MMOA 4KCEA 3H4KA 1WRYA 2V2GA 5B8BA 2LNSA 2E0QA 5IPHA 5IOXA 4TRXA 3W8SA 1XWGA 4KA0A 3ZVJD 1YF0A 2L57A 1YJ6A 2LJAA 1ABAA 1SU9A 1MD3A 1G7OA 1GTAA 3HKRA 2ON5A 4BVYB 1V9WA 1NHOA 1HNBA 1THXA 2CQ9A 1TU7A 2RUEA 2YV9A 1GSDA 2AUVA 4G2EA 4MA9A 1AQXA 2EC4A 1BX9A 4MPGA 1Z6NA 4IW9A 2F8FA 3G7YA 3GHAA 2QKEA 1XW9A 4KSMA 2XBQA 3UVTA 2HT9A 2A2SA 4O5QA 2J9HA 3EC3A 3D6IA 1FOHA 3GKNA 2H0HA 3H79A 4I5QA 3G7IA 3PH9A 1GSFA 5DDLA 1ZZYA 3QPMA 3LXTA 3RHCA 4IVFA 1ERTA 3F3QA 4XS4A 5ECOB 1PKZA 5A4WA 5E59A 4NAXA 4EO3A 4I97A 4LLRA 5HQPA 4GLTA 5CRWA 3IOSA 2RM6A 3EURA 1AXDA 5FWGA 2AV4A 4F03A 2OBIA 4CW9A 2DMLA 2F3MA 1EWXA 3Q18A 5DJMA 1S3CA 4KX4A 1AQWA 3VWXA 2X49A 1K3OA 4IP1A 3WGEA 4F9ZA 1G7EA 4TW5A 4MF7A 2GT5A 3GV1A 2IMDA 1J08A 2LTKA 2HRFA 3FKFA 1HNAA 4PQ1A 2HSHA 2E7PA 5F06A 1AW9A 4GSSA 4JBBA 4MCUA 4FYBA 3H1NA 4WXTA 1XVQA 3EVIA 4ML6A 3CRUA 2XBIA 4K5SA 2HI7A 3TKSA 3ZLPA 4G10A 4GSTA 1UA5A 1G6WA 3QD9A 4PXOA 2NTOA 5JCWA 4MZBA 3QMXA 1M99A 2YZUA 3UARA 2A2PA 3DKSA 1ZYPA 2DJ0A 1HQOA 1ERUA 2L4CA 5IQYA 2JSZA 3GNJA 3HZ8A 4HU9A 4HDEA 2H71A 2HSMA 4YQVA 3GL5A 3IK9A 5B6MA 2GLRA 3HVXA 1WOUA 2FWFA 5A4UA 2R0PA 1Z5YE 1FOVA 4IN0A 4MNNA 4AJ7A 4ID0A 2L6DA 5HR1A 1PL2A 5J9CA 4MJCA 1PN0A 1UC7A 2BTOT 2VIMA 3GA4A 3C8EA 4IELA 20GSA 4WBRD 4F82A 1Z7PA 3TJGA 2F51A 3ZFLA 2K8SA 5KN1A 2M46A 1M9BA 2H30A 5B7CA 3KTLA 4EF0A 3N9JA 2VM1A 1N2AA 2FA8A 2LQQA 1OC8A 2OADA 1PGTA 1JHBA 2H75A 1WMJA 3F3RA 2ZCTA 1IYHA 1SJIA 1JLWA 2KHPA 2FWGA 2XPEA 4G0IA 4EDYA 4NHZA 1BAYA 1Z3EA 5HR0A 2B5XA 4XTSA 2PUKC 2OBKA 2Z9SA 2MBSA 3EWLA 1B8XA 1GTBA 4MZCA 3HYPA 1VRSD 3GSTA 4ML1A 1S3DA 2VL2A 2QA2A 5G2ZA 3C7MA 1T8EB 1EEMA 2LUSA 3KP8A 3KZQA 3MAKA 3QAVA 4WF4A 5ECSA 3ZZXA 3BCIA 1ST9A 5F8BA 1K0CA 2C4JA 1QMVA 3ME8A 4GWRA 4KB3A 3A5WA 1Q4JA 1EZKA 1XIYA 2HXKA 2H0GA 4MF5A 3DYRA 3PINA 3P90A 5CRDA 1B9XC 1XZOA 1WE0A 3IE3A 4MJAA 1DSBA 2R0CA 2RUFA 3GH6A 3G9BA 1S3AA 2WULA 1NM3A 4HZ4A 5ELGA 1QUWA 2OE0A 3DMLA 4O32A 1ZCPA 2CAQA 4RQRA 2VCXA 1FHEA 3KJYA 3TOTA 4JEDA 2DIZA 3WYWA 4PNGA 3TRPA 3KCMA 2CVBA 5GSTA 2DJ2A 1EV9A 2H01A 1BEDA 4GXZA 1A24A 4FQUA 3LYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DIY A;  2IME A;  2R4V A;  3FR9 A;  2MMN A;  4N0Z A;  5H5R A;  4HOJ A;  1TRS A;  2VD0 A;  4PUR A;  5DAK B;  3IDV A;  2R5G A;  4DSR A;  1GNW A;  5IMC A;  4I2T A;  4DSS B;  5A4V A;  5CRH A;  5IO0 A;  3VWW A;  2DMM A;  5CO3 A;  2OAC A;  5EL8 A;  3G7J A;  1SK2 A;  1YY7 A;  1X9M B;  1H75 A;  1KTE A;  2B6M A;  1FB0 A;  3F8U A;  2B5E A;  1W4V A;  4GQF A;  1GLP A;  3UBL A;  3GIX A;  3F0I A;  4DSS A;  3CYN A;  1Z7R A;  3AY8 A;  3O3T A;  1XOA A;  2M72 A;  3EU3 A;  2OE1 A;  3GTU A;  1ZL9 A;  1TRV A;  5G30 A;  4GSN A;  2DJK A;  2VOC A;  1J0F A;  2OJL A;  3OR5 A;  3F6D A;  4HQZ A;  3MDK A;  4TXO A;  5ECM B;  4TR4 A;  3D4M A;  3PR8 A;  2GT6 A;  3DIE A;  2TRC P;  1E2Y A;  4PGT A;  5L71 A;  3KM6 A;  4JZQ A;  5J41 A;  2WGR A;  5F05 A;  2GQK A;  1SYR A;  3CMI A;  3C1R A;  22GS A;  1F37 A;  5KN3 A;  2VL3 A;  3KH9 A;  3BBY A;  4N10 A;  2YWI A;  4AJ8 A;  2PVQ A;  2AB6 A;  2C3T A;  4V2N A;  1AQV A;  2IFQ A;  3EMP A;  3IRA A;  2O8V B;  2HSY A;  1EGR A;  2GQL A;  2ALB A;  1GUH A;  4FIW A;  5IMD A;  1TW9 A;  3TUE A;  3F9U A;  3IXR A;  4BA7 A;  2VO4 A;  1RK4 A;  2BMX A;  2O89 A;  5ECL B;  2K9F A;  1DE2 A;  2AYT A;  1O6J A;  1GSY A;  2JL4 A;  3CSI A;  3O76 A;  2GZP A;  1Z6M A;  3IR4 A;  4MPF A;  2FNO A;  4G9H A;  2WRT A;  3LXZ A;  1SJ6 A;  4NV2 A;  3KGK A;  2P5R A;  3ZML A;  3FZ4 A;  4CHS A;  2K6V A;  1K0N A;  5ECP B;  2FCH A;  3I6A A;  2WJU A;  4Q5R A;  2WDU A;  1XOB A;  3E9J B;  3TB2 A;  3VFI A;  1KNG A;  4PUF C;  3A2W A;  2DLX A;  4QQ7 A;  4ISD A;  1B4Q A;  3CSJ A;  2H66 A;  4ZL8 A;  4L0U A;  4H86 A;  4EUY A;  1SYX A;  1GWC A;  2C8U A;  1CQG A;  1EOG A;  2MMZ A;  3ERF A;  2YJH A;  3ZL5 A;  4EVM A;  1YQ1 A;  1B4P A;  2YNX A;  1BJX A;  1SK1 A;  4HJ2 A;  2IJY A;  2X8G A;  4K8M A;  3LYP A;  2LNT A;  2X8H A;  4OWY A;  3CXG A;  5ECN B;  2V32 A;  1EP7 A;  1EGO A;  2QGV A;  2O87 A;  2GST A;  3PGT A;  2B3S A;  1K3Y A;  1PKW A;  1VF1 A;  18GS A;  3ZVJ A;  3Q19 A;  1PL1 A;  2H8L A;  4K6X A;  1X5D A;  1T1V A;  2VAF A;  1A2L A;  3LOR A;  6GSU A;  4K1F A;  4E8E A;  1SL1 B;  4NPB A;  3UIW A;  2H6X A;  4V1A p;  2YJ7 A;  4MMM A;  3CBU A;  1XWB A;  4KDX A;  1WP0 A;  5D73 A;  4YQM A;  2H1B A;  2EIO A;  2CA8 A;  3TKR A;  5EY6 A;  1TK0 B;  2WCI A;  2LST A;  4RQX A;  1YKC A;  5IMZ A;  6GSY A;  5DCG A;  3QOU A;  4MF6 A;  4NV5 A;  5GSS A;  1LBK A;  4IJ3 A;  1X0R A;  4PNF A;  4XS4 B;  5A5K A;  3KEB A;  1TOF A;  1TDI A;  5J3R A;  2CAI A;  1A0R P;  2TRX A;  3GUR A;  5AIX A;  3HZ4 A;  3IBH A;  2LS5 A;  3ZIT A;  2IPA A;  3FY7 A;  4MDC A;  3HXS A;  1GSS A;  1ZOF A;  3P8W A;  2A2R A;  1M2B A;  5IIZ A;  3HY2 A;  5J9B A;  1X5C A;  3L78 A;  1URM A;  2X99 A;  4ZBD A;  3BJ5 A;  2VL2 C;  4IS0 A;  3ZIJ A;  1SKS B;  2HNL A;  3IHQ A;  1GUK A;  2YZH A;  1EP8 A;  5KEJ A;  1BG5 A;  4KSO A;  1K0D A;  2P31 A;  3F4T A;  2NDO A;  3IC4 A;  3UL3 A;  3MSZ A;  4KCA A;  2HLS A;  4OMV A;  2PBJ A;  1XPV A;  3ZRD A;  2M80 A;  4EL1 A;  1GNE A;  4LL4 B;  2WZ9 A;  3TGZ A;  2R2J A;  3RAZ A;  3KH7 A;  3P7X A;  3A2V A;  4OO5 A;  4F0C A;  3LG6 A;  4P3Y B;  1GTU A;  4MK3 A;  3C71 A;  1FVK A;  1GP1 A;  2H74 A;  1MDI A;  2G2Q A;  2CVD A;  5ECH B;  3VI7 A;  4TVE A;  4PQH A;  4L5O A;  1T4Z A;  5G5E A;  2CV4 A;  2GZZ A;  2RM5 A;  3DWV A;  3F6F A;  2EIR A;  3FEU A;  1JLV A;  1WPI A;  3NIV A;  4POM A;  3UBK A;  4RUV A;  4XRD A;  5JCU A;  4PX1 A;  3WGX A;  5H5Q A;  5IO2 A;  1MEK A;  4ACS A;  5B6N A;  3TDG A;  1PN9 A;  3L0H A;  2YP6 A;  3L9S A;  4AF2 A;  1HYU A;  2RII A;  13GS A;  3US3 A;  2V6O A;  2R3X A;  4FYC A;  3HDC A;  3DGQ A;  1ERW A;  1OVN A;  4ZBA A;  2CX3 A;  1XCC A;  2VCQ A;  2LEG A;  2GQM A;  4FO5 A;  3F63 A;  2I1U A;  2FA4 A;  2FUG 2;  3VWV A;  3W6G A;  4AGS A;  1V98 A;  2VUP A;  4OFM A;  2GVP A;  3L9U A;  5IMV A;  3KMO A;  3F4S A;  5F07 A;  4GTU A;  2IMI A;  2VL9 A;  4MAB A;  1PX6 A;  1TI1 A;  3QFB C;  3RHB A;  3APO A;  1DE1 A;  2KLX A;  4K9Z A;  4HI7 A;  4NXI A;  4GCI A;  5ELA A;  4ZL9 A;  1CQH A;  1O7U A;  6GSV A;  3LFL A;  4Q5F A;  4IBP A;  3GKK A;  4LA1 A;  1G6Y A;  4DEJ A;  5AN1 A;  2B5Y A;  1AAZ A;  2R37 A;  1SKW B;  3UAP A;  1GLQ A;  2GS3 A;  4QL7 A;  3M0F A;  1ML6 A;  2V6K A;  1YKA A;  1TTZ A;  3HJP A;  6GSW A;  3GYK A;  1YF1 A;  3N5O A;  2HRN A;  3TJB A;  1QFN A;  1O81 A;  2ES7 A;  2IL3 A;  2D2Z A;  3LQ7 A;  3IPZ A;  4EDZ A;  1K0O A;  2LJR A;  5EVO A;  1UN2 A;  1Y6E A;  3VWU A;  6GSX A;  1F3B A;  3KIJ A;  4YQU A;  3TKP A;  1ON4 A;  2HZE A;  5D9T A;  2KP1 A;  4K2D A;  2JAD A;  5DBQ A;  1R4W A;  1N8J A;  5CRE A;  4KND A;  2GDR A;  5G5F A;  4L0W A;  1GTI A;  3L9V A;  1J9B A;  3DXB A;  2B7K A;  3GTU B;  1O85 A;  2H76 A;  1WWJ A;  4AJ6 A;  5DQS A;  2OE3 A;  4ECJ A;  3EE2 A;  2I81 A;  4TXO B;  3E0U A;  4I8B A;  3EIN A;  4ZL7 A;  2PN8 A;  2REM A;  1JZR A;  3KTB A;  1T00 A;  1QQ2 A;  3JCM L;  3DD3 A;  2GSQ A;  3VUR A;  2J23 A;  2DC5 A;  2V41 A;  3S9F A;  5HFI A;  1V2A A;  2F8A A;  1TXX A;  1MDJ A;  2F9S A;  1OKT A;  2L59 A;  4X0X A;  3FYG A;  5CRG A;  3LSZ A;  3RPN A;  2AJQ B;  1H4O A;  1A2J A;  2IFQ B;  4D73 A;  2H73 A;  3FZ9 A;  2OKA A;  2YWM A;  4J2F A;  1SKR B;  4OFT A;  1JFU A;  4ZB8 A;  3ZIV A;  2LRC A;  3RBT A;  1K0B A;  1XWC A;  1U3A A;  1LJR A;  3QDN A;  4MJB A;  2YCD A;  3ZMK A;  5D93 A;  2YN1 A;  2XPD A;  2YWN A;  4XRA A;  3LEF A;  1O8X A;  1QK8 A;  1I9D A;  1SD8 A;  1AIU A;  5FT3 A;  5IMA A;  4KE3 A;  1DBY A;  2FD3 A;  3P2A A;  4ZB6 A;  1JZD A;  3UVH A;  2WFC A;  5AIV A;  2FHE A;  5E4W A;  5JWR B;  2AAW A;  5KN2 A;  3IAS 2;  4IJI A;  2ZNM A;  3TKQ A;  1SK0 A;  2N5B A;  2NPB A;  4WF5 A;  2XC2 A;  3ZTL A;  5INY A;  2X8C A;  4E8H A;  4KGI A;  4N0V A;  4KH7 A;  3BOA A;  1KBN A;  4PUA A;  1X9W B;  5ENU A;  4XHM A;  2VCZ A;  3GMF A;  3KD0 A;  2FWE A;  3D0Z A;  3FHK A;  5DJL A;  2L5L A;  4BWQ A;  1VF4 A;  4TOP A;  5LD0 A;  3WD6 A;  1VF2 A;  2KP2 A;  2MZC A;  3ZYW A;  1PSQ A;  4POL A;  3VPQ A;  4JR4 A;  2QC7 A;  1B48 A;  2DBC A;  5J5N A;  3WT2 A;  3ME7 A;  3ZFB A;  3M9K A;  3TRQ A;  2YWO A;  1RQM A;  2GGT A;  2X64 A;  1USB A;  4I6X A;  1R5P A;  4Q5N A;  1V57 A;  1ZYQ B;  2YOI A;  4V2L A;  2B1L A;  4MH2 A;  2I9H A;  2FY6 A;  2CT6 A;  3KP9 A;  3QCP A;  1EOH A;  19GS A;  5GAN D;  3VLN A;  2GZY A;  3FW2 A;  3H8Q A;  2H1A A;  2O7K A;  2IN3 A;  2JU5 A;  2GTU A;  1W89 A;  11GS A;  2N5A A;  1SJZ A;  2ZUP A;  4K7I A;  5JWO B;  4WR5 A;  1TP9 A;  1O73 A;  5F0G A;  1OYJ A;  4V1A g;  5ECK B;  1T4Y A;  5DCH A;  4XS1 A;  3APQ A;  4RI6 A;  1QXH A;  1WJK A;  1U6T A;  3RDW A;  1FAA A;  4JU5 A;  2VM2 A;  1WIK A;  3CTG A;  2LV3 A;  2B7J A;  2P5Q A;  1UVZ A;  4TR1 A;  4ZBB A;  4FYU A;  3DVX A;  4WKW A;  1TK8 B;  1M0U A;  2E2M A;  4I2U A;  4MZW A;  2DJ1 A;  2HZF A;  4YAV A;  1B9Y C;  4IHU A;  1XWA A;  3D21 A;  4KAE A;  4IQ1 A;  5AIS A;  4OCE A;  1OC9 A;  5FHI A;  4YAP A;  3IAM 2;  1R7H A;  2VLV A;  3QAW A;  12GS A;  2C0D A;  3HA9 A;  1F9M A;  3ERG A;  2I4A A;  4DVC A;  4IP6 A;  5IPG A;  2PWJ A;  3QR6 A;  1DUG A;  4EC0 A;  5G31 A;  4ZXG A;  1NHY A;  1ZYE A;  4V2M A;  3U6V A;  2R6K A;  1IYI A;  4YH2 A;  3DVW A;  3DEX A;  4BWS A;  1GRX A;  4K0G A;  3CSH A;  4POB A;  1GUM A;  1FB6 A;  2DSA A;  3U5R E;  1SD9 A;  3GH9 A;  3V1W A;  1GL8 A;  3D5J A;  1MTC A;  1TU8 A;  1GSU A;  4MH3 A;  1OC3 A;  2PPT A;  4GQC A;  3TJF A;  4BVY A;  5JWQ B;  1TRW A;  3O6T A;  3UOM A;  4BPY A;  3GX8 A;  3FZA A;  4ZB9 A;  1K3L A;  2YV7 A;  4QL9 A;  3C73 A;  1T3B A;  2VD1 A;  4KDU A;  5CNW A;  2JAC A;  2GSR A;  4LMW A;  1PA3 A;  5EPF A;  3HD5 A;  3ZRE A;  1EV4 A;  4LL1 B;  2JZT A;  4IKH A;  2GSS A;  1FW1 A;  1GSQ A;  2A4V A;  3FR6 A;  2JZR A;  3NZN A;  4ECC A;  1F2E A;  4L5L A;  5G1K A;  2FLS A;  3M8N A;  4EXJ A;  1GSE A;  2C3Q A;  2LKU A;  3J7Y b;  1RW1 A;  3GKX A;  1YEX A;  3I43 A;  5LCZ A;  2C3N A;  3M3M A;  1E6B A;  1M7T A;  4OD7 A;  2H1D A;  2AHE A;  1XBS A;  1BYE A;  2P0G A;  5HFK A;  2CZ3 A;  2N5F A;  3APS A;  2EIQ A;  4POK A;  3ED3 A;  2L5O A;  5JCG A;  4HJM A;  2LQO A;  4WEY A;  3EYT A;  3A3T A;  4ILF A;  3IK7 A;  2ON7 A;  5D9W A;  2RLI A;  4KW6 A;  4MJE A;  5D9V A;  2JSY A;  4J56 E;  3W8J A;  1OKD A;  4TN8 A;  1XW5 A;  2K18 A;  1O8W A;  2TIR A;  5COH A;  5J4U A;  2JZS A;  1R5A A;  5IOW A;  2K8V A;  1XXU A;  10GS A;  1KEB A;  1SEN A;  4KUN A;  1FVJ A;  2BJX A;  1F3A A;  2C0E A;  4NHW A;  1HNC A;  4ULX A;  1A8Y A;  4F2I A;  2WS2 A;  4NWY A;  2C0F A;  2VLU A;  1EEJ A;  1A8L A;  3ERW A;  1NW2 A;  4OO4 A;  5GZZ B;  1ZMA A;  4O5R A;  3DRN A;  5ECR B;  3TJK A;  3E3E A;  5ECQ B;  4ECI A;  2IMF A;  4JE1 A;  2IMK A;  2C0G A;  3TKS E;  2FGX A;  1OAZ A;  1TRU A;  1GUL A;  3QFA C;  3D4T A;  4IQA A;  1TK5 B;  1FG4 A;  3WGD A;  2HYX A;  1VGL A;  3M1G A;  2H70 A;  3MNG A;  3IV4 A;  4XS6 A;  5DVB A;  3C1S A;  3QAG A;  1K0A A;  1GH2 A;  2L4Q A;  4HUA A;  2VCW A;  3GN3 A;  4JR6 A;  4NMU A;  2HE3 A;  1BQ7 A;  1G0T A;  1AC1 A;  4L8E A;  3TCO A;  2HZE B;  1AUC A;  1YDK A;  2LRT A;  5GAP D;  6GSS A;  1THO A;  5IM9 A;  5CP1 A;  3HVS A;  4Q5Q A;  1ZGN A;  1M9A A;  3FRC A;  1XFL A;  5ECI B;  3UJ1 A;  1LU4 A;  4N11 A;  4DSQ A;  3A2X A;  4O7H A;  2C80 A;  1F6M C;  4KDY A;  1K0M A;  2YPM A;  1SL2 B;  1ERV A;  1TI3 A;  4ZIJ A;  2H1G A;  5ABR A;  2E2G A;  1MD4 A;  2L6C A;  4OFN A;  3GKM A;  2H6Y A;  3HHV A;  17GS A;  4X43 A;  3TJJ A;  3HJM A;  6GST A;  5CAX A;  3HJO A;  5CYY A;  5G1L A;  3Q6O A;  5IMF A;  2IWT A;  4TKY A;  4ZIL A;  4RI7 A;  3FR3 A;  4X1U A;  2CX4 A;  4XCS A;  4K0N A;  2PU9 C;  4HQS A;  2LRN A;  3Q74 A;  4D73 B;  2DJJ A;  3L4N A;  3EMX A;  3WT1 A;  4TXV A;  1X5E A;  3BD2 A;  5B8A A;  2VLT A;  3GFK A;  1Y25 A;  2C1Y A;  2I3Y A;  4Z7X A;  4K7N A;  3GL3 A;  3GRX A;  5HR3 A;  3IA1 A;  4ECB A;  5DAK A;  4HS1 A;  1XVW A;  3SWL A;  1YEP A;  2DJ3 A;  3HCZ A;  2VCT A;  5H5S A;  5LNK e;  7GSS A;  3I69 A;  3VI5 A;  2KOK A;  3LJR A;  5D96 A;  3FZ5 A;  4MLY A;  9GSS A;  2HFD A;  1XW6 A;  3BCK A;  5D9X A;  1TJD A;  4JRR A;  3UMA A;  5DAL B;  1X9S B;  4O92 A;  1XWK A;  2PMT A;  3K8N A;  4F0B A;  5DQY A;  2FWH A;  3HVV A;  3J7Y k;  2CVK A;  3CRT A;  3LGC A;  1R26 A;  1V40 A;  1U3I A;  2QSI A;  3NOF A;  3CTF A;  1PRX A;  4K7O A;  5DAL A;  1T7P B;  1PX7 A;  2G0F A;  2O85 A;  4G19 A;  5C04 A;  1ACV A;  3LWA A;  3TOU A;  2PGT A;  16GS A;  3MWH A;  14GS A;  2PVO C;  3ISO A;  3TRX A;  4WET A;  3H93 A;  5ID2 B;  2NBS A;  5C00 A;  1Z9H A;  1A2M A;  1OE8 A;  4N30 A;  1I5G A;  3R2Q A;  5KN0 A;  1U88 A;  2V1M A;  3I9V 2;  1QGV A;  3VK9 A;  2OA7 A;  5AGY A;  2XHF A;  1PQN A;  1M2D A;  3M9J A;  5ID2 A;  8GSS A;  1HD2 A;  1V58 A;  4HEA 2;  4IGJ A;  2NVL A;  4HU7 A;  3EU4 A;  1C72 A;  1JZO A;  2IIY A;  5D8I A;  2PER A;  3SBC A;  4WBJ A;  2H72 A;  4EKZ A;  3KMN A;  1OE7 A;  2B1K A;  4FH8 A;  1ILO A;  2H0I A;  2CZ2 A;  4PQI A;  1M2A A;  4BVX A;  4TR3 A;  1MDK A;  4BL7 A;  1YZX A;  4LMV A;  3GUS A;  4TR1 B;  1A23 A;  4GRF A;  3KXO A;  4MP4 A;  4XIH A;  4J57 E;  2MBT A;  1FO5 A;  4CDO A;  3GSS A;  1NSW A;  4OCF A;  3UEM A;  4EE0 A;  1PD2 1;  1OC9 B;  3GX0 A;  3FK8 A;  3RPP A;  4GF0 A;  1JZW A;  2KUC A;  2LJK A;  2H6Z A;  2WB9 A;  3D22 A;  3VPT A;  1TKD B;  1Q98 A;  2VCV A;  2YAN A;  4TR0 A;  5HR2 A;  3TKS C;  1U87 A;  1SL0 B;  1PMT A;  1VF3 A;  2MYG A;  4WR4 A;  5HFG A;  1A0F A;  2H19 A;  2MMA A;  3F4R A;  4HZ2 A;  2MMO A;  4KCE A;  3H4K A;  1WRY A;  2V2G A;  5B8B A;  2LNS A;  2E0Q A;  5IPH A;  5IOX A;  4TRX A;  3W8S A;  1XWG A;  4KA0 A;  3ZVJ D;  1YF0 A;  2L57 A;  1YJ6 A;  2LJA A;  1ABA A;  1SU9 A;  1MD3 A;  1G7O A;  1GTA A;  3HKR A;  2ON5 A;  1V9W A;  1NHO A;  1HNB A;  1THX A;  2CQ9 A;  1TU7 A;  2RUE A;  2YV9 A;  1GSD A;  2AUV A;  4G2E A;  4MA9 A;  1AQX A;  2EC4 A;  1BX9 A;  4MPG A;  1Z6N A;  4IW9 A;  2F8F A;  3G7Y A;  3GHA A;  2QKE A;  1XW9 A;  4KSM A;  2XBQ A;  3UVT A;  2HT9 A;  2A2S A;  2J9H A;  3EC3 A;  3D6I A;  3GKN A;  2H0H A;  3H79 A;  4I5Q A;  3G7I A;  3PH9 A;  1GSF A;  5DDL A;  1ZZY A;  3QPM A;  3LXT A;  3RHC A;  4IVF A;  1ERT A;  3F3Q A;  4XS4 A;  5ECO B;  1PKZ A;  5A4W A;  5E59 A;  4NAX A;  4EO3 A;  4I97 A;  4LLR A;  5HQP A;  4GLT A;  5CRW A;  3IOS A;  2RM6 A;  3EUR A;  1AXD A;  5FWG A;  2AV4 A;  4F03 A;  2OBI A;  4CW9 A;  2DML A;  2F3M A;  1EWX A;  3Q18 A;  5DJM A;  1S3C A;  4KX4 A;  1AQW A;  3VWX A;  1K3O A;  4IP1 A;  3WGE A;  4F9Z A;  1G7E A;  4TW5 A;  4MF7 A;  2GT5 A;  3GV1 A;  2IMD A;  1J08 A;  2LTK A;  2HRF A;  3FKF A;  1HNA A;  4PQ1 A;  2HSH A;  2E7P A;  5F06 A;  1AW9 A;  4GSS A;  4JBB A;  4MCU A;  4FYB A;  3H1N A;  4WXT A;  1XVQ A;  3EVI A;  4ML6 A;  3CRU A;  2XBI A;  2HI7 A;  3TKS A;  3ZLP A;  4G10 A;  4GST A;  1UA5 A;  1G6W A;  3QD9 A;  4PXO A;  2NTO A;  5JCW A;  4MZB A;  3QMX A;  1M99 A;  2YZU A;  3UAR A;  3DKS A;  2DJ0 A;  1HQO A;  1ERU A;  2L4C A;  5IQY A;  2JSZ A;  3GNJ A;  3HZ8 A;  4HU9 A;  4HDE A;  2H71 A;  4YQV A;  3GL5 A;  3IK9 A;  5B6M A;  2GLR A;  3HVX A;  1WOU A;  2FWF A;  5A4U A;  1Z5Y E;  1FOV A;  4IN0 A;  4AJ7 A;  4ID0 A;  2L6D A;  5HR1 A;  1PL2 A;  5J9C A;  4MJC A;  2VIM A;  1UC7 A;  2BTO T;  3GA4 A;  3C8E A;  4IEL A;  20GS A;  4WBR D;  4F82 A;  1Z7P A;  3TJG A;  2F51 A;  3ZFL A;  2K8S A;  5KN1 A;  2M46 A;  1M9B A;  2H30 A;  5B7C A;  3KTL A;  4EF0 A;  3N9J A;  2VM1 A;  1N2A A;  2FA8 A;  2LQQ A;  1OC8 A;  2OAD A;  1PGT A;  1JHB A;  2H75 A;  1WMJ A;  3F3R A;  2ZCT A;  1IYH A;  1SJI A;  1JLW A;  2KHP A;  2FWG A;  2XPE A;  4EDY A;  4NHZ A;  1BAY A;  1Z3E A;  5HR0 A;  2B5X A;  4XTS A;  2PUK C;  2OBK A;  2Z9S A;  2MBS A;  3EWL A;  1B8X A;  1GTB A;  4MZC A;  3HYP A;  1VRS D;  3GST A;  4ML1 A;  1S3D A;  2VL2 A;  5G2Z A;  3C7M A;  1T8E B;  1EEM A;  2LUS A;  3KP8 A;  3KZQ A;  3MAK A;  3QAV A;  4WF4 A;  5ECS A;  3ZZX A;  3BCI A;  1ST9 A;  5F8B A;  1K0C A;  2C4J A;  1QMV A;  3ME8 A;  4GWR A;  4KB3 A;  3A5W A;  1Q4J A;  1EZK A;  1XIY A;  2HXK A;  2H0G A;  4MF5 A;  3DYR A;  3PIN A;  3P90 A;  5CRD A;  1B9X C;  1XZO A;  1WE0 A;  3IE3 A;  4MJA A;  1DSB A;  2RUF A;  3GH6 A;  3G9B A;  1S3A A;  2WUL A;  1NM3 A;  4HZ4 A;  5ELG A;  1QUW A;  2OE0 A;  3DML A;  4O32 A;  1ZCP A;  2CAQ A;  4RQR A;  2VCX A;  1FHE A;  3KJY A;  3TOT A;  4JED A;  2DIZ A;  3WYW A;  4PNG A;  3TRP A;  3KCM A;  2CVB A;  5GST A;  2DJ2 A;  1EV9 A;  2H01 A;  1BED A;  4GXZ A;  1A24 A;  3LYK A; 
#chains in the Genus database with same CATH topology
 2DIY A;  2IME A;  2R4V A;  3FR9 A;  2MMN A;  4N0Z A;  5H5R A;  4HOJ A;  1TRS A;  2VD0 A;  4PUR A;  5DAK B;  3IDV A;  2R5G A;  4DSR A;  1GNW A;  5IMC A;  4I2T A;  4DSS B;  5A4V A;  5CRH A;  5IO0 A;  3VWW A;  2DMM A;  5CO3 A;  2OAC A;  5EL8 A;  3G7J A;  1SK2 A;  1YY7 A;  4Z2U A;  1X9M B;  1H75 A;  1KTE A;  2B6M A;  1FB0 A;  3F8U A;  2B5E A;  1W4V A;  4GQF A;  1GLP A;  3UBL A;  3GIX A;  3F0I A;  4DSS A;  3CYN A;  1Z7R A;  1XG8 A;  3AY8 A;  3O3T A;  1XOA A;  2M72 A;  3EU3 A;  2OE1 A;  3GTU A;  1ZL9 A;  1TRV A;  5G30 A;  4GSN A;  2DJK A;  4KF9 A;  2VOC A;  1J0F A;  2OJL A;  3OR5 A;  3F6D A;  4HQZ A;  3MDK A;  4TXO A;  5ECM B;  4TR4 A;  3D4M A;  3PR8 A;  2GT6 A;  3DIE A;  2TRC P;  1E2Y A;  4PGT A;  5L71 A;  3KM6 A;  4JZQ A;  5J41 A;  2WGR A;  5KOW A;  5F05 A;  2GQK A;  1SYR A;  3CMI A;  3C1R A;  22GS A;  1F37 A;  5KN3 A;  2VL3 A;  2HRK A;  3KH9 A;  3BBY A;  4N10 A;  2YWI A;  4AJ8 A;  2PVQ A;  2AB6 A;  2C3T A;  4V2N A;  1AQV A;  2IFQ A;  3EMP A;  3IRA A;  2O8V B;  2HSY A;  1EGR A;  2GQL A;  2ALB A;  1GUH A;  4FIW A;  5BMU A;  5IMD A;  1TW9 A;  3TUE A;  3F9U A;  3IXR A;  4BA7 A;  2VO4 A;  1RK4 A;  2BMX A;  2O89 A;  5ECL B;  2K9F A;  1DE2 A;  2AYT A;  1O6J A;  1GSY A;  2JL4 A;  2UZ8 A;  3CSI A;  2A4H A;  3O76 A;  4Z2T A;  2GZP A;  1Z6M A;  3IR4 A;  4MPF A;  2FNO A;  4G9H A;  2WRT A;  3LXZ A;  1SJ6 A;  4NV2 A;  3KGK A;  4BVX B;  2P5R A;  3ZML A;  4BL7 B;  3FZ4 A;  4CHS A;  2K6V A;  1K0N A;  5ECP B;  2FCH A;  3I6A A;  2WJU A;  4Q5R A;  2WDU A;  1XOB A;  3E9J B;  3A5I A;  3TB2 A;  3VFI A;  1KNG A;  4PUF C;  3A2W A;  2DLX A;  4QQ7 A;  4ISD A;  1B4Q A;  3CSJ A;  2H66 A;  4ZL8 A;  4L0U A;  4H86 A;  4EUY A;  1SYX A;  1GWC A;  2C8U A;  1CQG A;  1EOG A;  2MMZ A;  3ERF A;  2YJH A;  3ZL5 A;  4EVM A;  1YQ1 A;  1B4P A;  2YNX A;  1BJX A;  1SK1 A;  4HJ2 A;  2IJY A;  2X8G A;  4K8M A;  3LYP A;  2LNT A;  2X8H A;  5KOX A;  4OWY A;  3CXG A;  5ECN B;  2V32 A;  1EP7 A;  1EGO A;  2QGV A;  2O87 A;  2GST A;  3PGT A;  2B3S A;  2DKI A;  1K3Y A;  1PKW A;  1VF1 A;  18GS A;  3ZVJ A;  3Q19 A;  1PL1 A;  2H8L A;  4K6X A;  1X5D A;  1T1V A;  2VAF A;  1A2L A;  3LOR A;  6GSU A;  4K1F A;  4E8E A;  1SL1 B;  4NPB A;  3UIW A;  2H6X A;  1M3I A;  4V1A p;  2YJ7 A;  4MMM A;  3CBU A;  1XWB A;  4KDX A;  1WP0 A;  5D73 A;  4YQM A;  2H1B A;  2EIO A;  2CA8 A;  3TKR A;  5EY6 A;  1TK0 B;  2WCI A;  2LST A;  4RQX A;  1YKC A;  5IMZ A;  6GSY A;  5DCG A;  3QOU A;  4MF6 A;  4NV5 A;  5GSS A;  1LBK A;  4O5U A;  4IJ3 A;  1X0R A;  4PNF A;  4XS4 B;  5A5K A;  3KEB A;  1TOF A;  1TDI A;  5J3R A;  2CAI A;  1A0R P;  2TRX A;  3GUR A;  5AIX A;  3HZ4 A;  3IBH A;  2LS5 A;  3ZIT A;  2IPA A;  3FY7 A;  4MDC A;  3HXS A;  1GSS A;  1ZOF A;  3P8W A;  2A2R A;  1M2B A;  5IIZ A;  3HY2 A;  5J9B A;  1X5C A;  3L78 A;  1URM A;  2X99 A;  4ZBD A;  3BJ5 A;  2VL2 C;  4IS0 A;  3ZIJ A;  1SKS B;  2HNL A;  2QA1 A;  3IHQ A;  1GUK A;  2YZH A;  1EP8 A;  5KEJ A;  1BG5 A;  4KSO A;  1K0D A;  2P31 A;  3F4T A;  2NDO A;  3IC4 A;  3UL3 A;  3MSZ A;  4KCA A;  2HLS A;  4OMV A;  2PBJ A;  1XPV A;  3IC8 A;  3ZRD A;  2M80 A;  4EL1 A;  1GNE A;  4LL4 B;  2WZ9 A;  3TGZ A;  2R2J A;  3RAZ A;  3KH7 A;  3P7X A;  3A2V A;  4OO5 A;  4F0C A;  3LG6 A;  4P3Y B;  1GTU A;  4MK3 A;  3C71 A;  1FVK A;  1GP1 A;  2H74 A;  1MDI A;  2G2Q A;  2CVD A;  5ECH B;  3VI7 A;  4TVE A;  4PQH A;  4L5O A;  1T4Z A;  5G5E A;  2CV4 A;  2GZZ A;  2RM5 A;  3DWV A;  3F6F A;  2EIR A;  3FEU A;  1JLV A;  1WPI A;  3NIV A;  4POM A;  3UBK A;  4RUV A;  4XRD A;  5JCU A;  4PX1 A;  3WGX A;  5H5Q A;  5IO2 A;  1MEK A;  4ACS A;  5B6N A;  1ZYN A;  3TDG A;  1PN9 A;  3L0H A;  2YP6 A;  4CY8 A;  3L9S A;  4AF2 A;  1HYU A;  2RII A;  13GS A;  3US3 A;  2V6O A;  2R3X A;  4FYC A;  3HDC A;  3DGQ A;  1ERW A;  1OVN A;  4ZBA A;  2CX3 A;  1XCC A;  2VCQ A;  2LEG A;  2GQM A;  4FO5 A;  3F63 A;  2I1U A;  2FA4 A;  2FUG 2;  3VWV A;  3W6G A;  4AGS A;  1V98 A;  2VUP A;  4OFM A;  2GVP A;  3L9U A;  5IMV A;  3KMO A;  3F4S A;  5F07 A;  4GTU A;  2IMI A;  2VL9 A;  4MAB A;  1PX6 A;  1TI1 A;  3QFB C;  3RHB A;  3APO A;  1DE1 A;  2KLX A;  4K9Z A;  4HI7 A;  4NXI A;  4GCI A;  5ELA A;  4ZL9 A;  1CQH A;  1O7U A;  6GSV A;  3LFL A;  2X4A A;  4Q5F A;  4IBP A;  3GKK A;  4LA1 A;  1G6Y A;  4DEJ A;  5AN1 A;  2B5Y A;  1AAZ A;  2R37 A;  1SKW B;  3UAP A;  1GLQ A;  2GS3 A;  4QL7 A;  3M0F A;  1ML6 A;  2V6K A;  1YKA A;  1TTZ A;  3HJP A;  6GSW A;  3GYK A;  1YF1 A;  3N5O A;  2HRN A;  3TJB A;  1QFN A;  1O81 A;  2ES7 A;  2IL3 A;  2D2Z A;  1S3R A;  3LQ7 A;  3IPZ A;  4EDZ A;  1K0O A;  2LJR A;  5EVO A;  1UN2 A;  1Y6E A;  3VWU A;  6GSX A;  1F3B A;  3KIJ A;  4YQU A;  3TKP A;  1ON4 A;  2HZE A;  5D9T A;  2KP1 A;  4K2D A;  2JAD A;  5DBQ A;  1R4W A;  1N8J A;  5CRE A;  4KND A;  2GDR A;  4K5R A;  5G5F A;  4L0W A;  1GTI A;  3L9V A;  1J9B A;  3DXB A;  2B7K A;  3GTU B;  1O85 A;  2H76 A;  4G0K A;  1WWJ A;  4AJ6 A;  5DQS A;  2OE3 A;  4ECJ A;  3EE2 A;  2I81 A;  4TXO B;  3E0U A;  4I8B A;  3EIN A;  4ZL7 A;  2PN8 A;  2REM A;  1JZR A;  3KTB A;  1T00 A;  1QQ2 A;  3JCM L;  3DD3 A;  2GSQ A;  3VUR A;  2J23 A;  2DC5 A;  2V41 A;  3S9F A;  5HFI A;  1V2A A;  2F8A A;  1TXX A;  1MDJ A;  2F9S A;  1OKT A;  2L59 A;  4X0X A;  3FYG A;  5CRG A;  3LSZ A;  3RPN A;  2AJQ B;  3IHG A;  1H4O A;  1A2J A;  2IFQ B;  4D73 A;  2H73 A;  3FZ9 A;  2OKA A;  2YWM A;  4J2F A;  1SKR B;  4OFT A;  1JFU A;  4ZB8 A;  3ZIV A;  2LRC A;  3RBT A;  1K0B A;  1XWC A;  2DKH A;  1U3A A;  1LJR A;  3QDN A;  4MJB A;  2YCD A;  3ZMK A;  5D93 A;  2YN1 A;  2XPD A;  2YWN A;  4XRA A;  3EPT A;  3LEF A;  1O8X A;  1QK8 A;  1I9D A;  1SD8 A;  1AIU A;  5FT3 A;  5IMA A;  4X4J A;  4KE3 A;  1DBY A;  2FD3 A;  3P2A A;  4ZB6 A;  1JZD A;  3UVH A;  2WFC A;  5AIV A;  2FHE A;  5E4W A;  5JWR B;  2AAW A;  5KN2 A;  3IAS 2;  4IJI A;  2ZNM A;  3TKQ A;  1SK0 A;  2N5B A;  2NPB A;  4WF5 A;  2XC2 A;  3ZTL A;  5INY A;  2X8C A;  4E8H A;  4KGI A;  4N0V A;  4KH7 A;  3BOA A;  1KBN A;  4PUA A;  1X9W B;  5ENU A;  4XHM A;  2VCZ A;  3GMF A;  4K2X A;  3KD0 A;  2FWE A;  3D0Z A;  3FHK A;  5DJL A;  2L5L A;  4BWQ A;  1VF4 A;  4TOP A;  5LD0 A;  3LW9 A;  3WD6 A;  1VF2 A;  2KP2 A;  2MZC A;  3ZYW A;  1PSQ A;  4POL A;  3VPQ A;  4JR4 A;  2QC7 A;  1B48 A;  2DBC A;  5J5N A;  3WT2 A;  3ME7 A;  3ZFB A;  3M9K A;  3TRQ A;  2YWO A;  1RQM A;  2GGT A;  2X64 A;  1USB A;  4I6X A;  3PPU A;  1R5P A;  3HVN A;  4Q5N A;  1V57 A;  1ZYQ B;  2YOI A;  4V2L A;  2B1L A;  4MH2 A;  2I9H A;  2FY6 A;  2CT6 A;  3KP9 A;  3QCP A;  1EOH A;  19GS A;  5GAN D;  3VLN A;  2GZY A;  4USS A;  3FW2 A;  3H8Q A;  2H1A A;  2O7K A;  2IN3 A;  2JU5 A;  2GTU A;  1W89 A;  11GS A;  2N5A A;  1SJZ A;  2ZUP A;  4K7I A;  5JWO B;  4WR5 A;  1TP9 A;  1O73 A;  5F0G A;  1OYJ A;  4V1A g;  5ECK B;  1T4Y A;  5DCH A;  4XS1 A;  3APQ A;  4RI6 A;  1QXH A;  1WJK A;  1U6T A;  3RDW A;  1FAA A;  4JU5 A;  2VM2 A;  1WIK A;  3CTG A;  2LV3 A;  2B7J A;  2P5Q A;  1UVZ A;  4TR1 A;  4ZBB A;  4FYU A;  3DVX A;  4WKW A;  1TK8 B;  1M0U A;  2E2M A;  4I2U A;  4MZW A;  2DJ1 A;  2HZF A;  3R3E A;  1B9Y C;  4YAV A;  4IHU A;  4YKF A;  4EIP A;  1XWA A;  3D21 A;  4KAE A;  4IQ1 A;  5AIS A;  4OCE A;  1OC9 A;  5FHI A;  4YAP A;  3IAM 2;  1R7H A;  2VLV A;  3QAW A;  12GS A;  2C0D A;  3HA9 A;  1F9M A;  3ERG A;  2I4A A;  4DVC A;  4IP6 A;  5IPG A;  2PWJ A;  3QR6 A;  1DUG A;  4EC0 A;  5G31 A;  4ZXG A;  1NHY A;  1ZYE A;  4V2M A;  3U6V A;  2R6K A;  1IYI A;  4YH2 A;  3DVW A;  3DEX A;  4BWS A;  1GRX A;  4K0G A;  3CSH A;  4POB A;  1GUM A;  1FB6 A;  2DSA A;  3U5R E;  1SD9 A;  3GH9 A;  3V1W A;  1GL8 A;  3D5J A;  1MTC A;  1TU8 A;  1GSU A;  4MH3 A;  1OC3 A;  2PPT A;  4GQC A;  3TJF A;  4BVY A;  5JWQ B;  1TRW A;  3O6T A;  3UOM A;  4BPY A;  3GX8 A;  3FZA A;  4ZB9 A;  1K3L A;  2YV7 A;  4QL9 A;  3C73 A;  1T3B A;  2VD1 A;  4KDU A;  5CNW A;  2JAC A;  2GSR A;  4LMW A;  1PA3 A;  3MIX A;  5EPF A;  3HD5 A;  3ZRE A;  1EV4 A;  4LL1 B;  2JZT A;  4IKH A;  2GSS A;  1FW1 A;  1GSQ A;  2A4V A;  3FR6 A;  2JZR A;  3NZN A;  4ECC A;  1F2E A;  4L5L A;  5G1K A;  2FLS A;  3M8N A;  4EXJ A;  1GSE A;  4CY6 A;  2C3Q A;  2LKU A;  3J7Y b;  1RW1 A;  3GKX A;  1YEX A;  3I43 A;  5LCZ A;  2C3N A;  3M3M A;  1E6B A;  1M7T A;  4OD7 A;  2H1D A;  2AHE A;  1XBS A;  1BYE A;  2P0G A;  5HFK A;  2CZ3 A;  2N5F A;  3APS A;  2EIQ A;  4POK A;  3ED3 A;  2L5O A;  5JCG A;  4HJM A;  2LQO A;  4WEY A;  3EYT A;  1M3J A;  3A3T A;  4BIK A;  4ILF A;  3IK7 A;  2ON7 A;  5D9W A;  2RLI A;  4KW6 A;  4MJE A;  5D9V A;  2JSY A;  4J56 E;  3W8J A;  1OKD A;  4TN8 A;  1XW5 A;  2K18 A;  1O8W A;  2TIR A;  5COH A;  5J4U A;  2JZS A;  1R5A A;  5IOW A;  2K8V A;  4PTS A;  1XXU A;  10GS A;  1KEB A;  1SEN A;  4KUN A;  1FVJ A;  2BJX A;  1F3A A;  2C0E A;  4NHW A;  1HNC A;  4ULX A;  1A8Y A;  4F2I A;  2WS2 A;  4NWY A;  5BRT A;  2C0F A;  2VLU A;  1EEJ A;  1A8L A;  3ERW A;  1NW2 A;  4OO4 A;  5GZZ B;  1ZMA A;  4O5R A;  3DRN A;  5ECR B;  3TJK A;  3E3E A;  5ECQ B;  4ECI A;  2IMF A;  4JE1 A;  2IMK A;  2C0G A;  3TKS E;  2FGX A;  1OAZ A;  1TRU A;  1GUL A;  3QFA C;  3D4T A;  4IQA A;  1TK5 B;  1FG4 A;  3WGD A;  2HYX A;  1VGL A;  3M1G A;  2H70 A;  3MNG A;  3IV4 A;  4XS6 A;  5DVB A;  3C1S A;  3QAG A;  1K0A A;  1GH2 A;  2L4Q A;  4HUA A;  2VCW A;  3GN3 A;  4JR6 A;  4NMU A;  2HE3 A;  1BQ7 A;  1G0T A;  1AC1 A;  4L8E A;  3TCO A;  2HZE B;  1AUC A;  1YDK A;  2LRT A;  5GAP D;  6GSS A;  1THO A;  5IM9 A;  5CP1 A;  4ICY A;  3HVS A;  4Q5Q A;  1ZGN A;  1M9A A;  3FRC A;  1XFL A;  5ECI B;  3UJ1 A;  1LU4 A;  4N11 A;  4DSQ A;  3A2X A;  4O7H A;  2C80 A;  1F6M C;  4KDY A;  1K0M A;  2YPM A;  1SL2 B;  1ERV A;  1TI3 A;  4ZIJ A;  2H1G A;  5ABR A;  2E2G A;  1MD4 A;  2L6C A;  4OFN A;  3GKM A;  2H6Y A;  4EIQ A;  3HHV A;  17GS A;  4X43 A;  3TJJ A;  3HJM A;  6GST A;  5CAX A;  3HJO A;  5CYY A;  5G1L A;  3Q6O A;  5IMF A;  2IWT A;  4TKY A;  4ZIL A;  4RI7 A;  3FR3 A;  4X1U A;  2CX4 A;  4XCS A;  4K0N A;  2PU9 C;  4HQS A;  2LRN A;  3Q74 A;  4D73 B;  2DJJ A;  3MYD A;  3L4N A;  3EMX A;  3WT1 A;  4TXV A;  1X5E A;  3BD2 A;  5B8A A;  2VLT A;  3GFK A;  1Y25 A;  2C1Y A;  2I3Y A;  4Z7X A;  4K7N A;  3GL3 A;  3GRX A;  5HR3 A;  3IA1 A;  4A5P A;  4ECB A;  5DAK A;  4HS1 A;  1XVW A;  3SWL A;  1YEP A;  2DJ3 A;  3HCZ A;  2VCT A;  5H5S A;  5LNK e;  7GSS A;  3I69 A;  2HRA A;  3VI5 A;  2KOK A;  3LJR A;  3FZ5 A;  4MLY A;  5D96 A;  9GSS A;  2HFD A;  1XW6 A;  3BCK A;  5D9X A;  1TJD A;  4JRR A;  3UMA A;  5DAL B;  1X9S B;  4G0L A;  4O92 A;  1XWK A;  2PMT A;  3K8N A;  4F0B A;  5DQY A;  2FWH A;  3HVV A;  4HSC X;  3J7Y k;  2CVK A;  3CRT A;  3LGC A;  1R26 A;  1V40 A;  1U3I A;  2QSI A;  3NOF A;  3CTF A;  1PRX A;  4K7O A;  4YKG A;  5DAL A;  1T7P B;  1PX7 A;  2G0F A;  2O85 A;  4G19 A;  5C04 A;  1ACV A;  3LWA A;  2R0G A;  3TOU A;  2PGT A;  16GS A;  3MWH A;  14GS A;  2PVO C;  3ISO A;  3TRX A;  4WET A;  3H93 A;  5ID2 B;  2NBS A;  5C00 A;  1Z9H A;  1A2M A;  1OE8 A;  4N30 A;  1I5G A;  3R2Q A;  5KN0 A;  4Z2R A;  1U88 A;  2V1M A;  3I9V 2;  1QGV A;  3VK9 A;  2OA7 A;  5AGY A;  2XHF A;  1PQN A;  1M2D A;  3M9J A;  5ID2 A;  8GSS A;  1HD2 A;  1V58 A;  4HEA 2;  4IGJ A;  2NVL A;  4HU7 A;  3EU4 A;  1C72 A;  1JZO A;  2IIY A;  5D8I A;  3FMW A;  2PER A;  3SBC A;  4WBJ A;  2H72 A;  4EKZ A;  3KMN A;  1OE7 A;  2B1K A;  4FH8 A;  1ILO A;  2H0I A;  2CZ2 A;  4PQI A;  1M2A A;  4BVX A;  4TR3 A;  1MDK A;  4BL7 A;  1YZX A;  4LMV A;  3GUS A;  4TR1 B;  1A23 A;  4GRF A;  3KXO A;  4MP4 A;  4XIH A;  4J57 E;  2MBT A;  1FO5 A;  4CDO A;  3GSS A;  1NSW A;  4OCF A;  3UEM A;  4EE0 A;  1PD2 1;  1OC9 B;  3GX0 A;  3FK8 A;  3RPP A;  4GF0 A;  1JZW A;  2KUC A;  2LJK A;  2H6Z A;  2WB9 A;  3D22 A;  3VPT A;  1TKD B;  1Q98 A;  2VCV A;  2YAN A;  4TR0 A;  5HR2 A;  3TKS C;  1U87 A;  1SL0 B;  1PMT A;  1VF3 A;  2MYG A;  4WR4 A;  5HFG A;  1A0F A;  2H19 A;  2MMA A;  3F4R A;  4HZ2 A;  2MMO A;  4KCE A;  3H4K A;  1WRY A;  2V2G A;  5B8B A;  2LNS A;  2E0Q A;  5IPH A;  5IOX A;  4TRX A;  3W8S A;  1XWG A;  4KA0 A;  3ZVJ D;  1YF0 A;  2L57 A;  1YJ6 A;  2LJA A;  1ABA A;  1SU9 A;  1MD3 A;  1G7O A;  1GTA A;  3HKR A;  2ON5 A;  4BVY B;  1V9W A;  1NHO A;  1HNB A;  1THX A;  2CQ9 A;  1TU7 A;  2RUE A;  2YV9 A;  1GSD A;  2AUV A;  4G2E A;  4MA9 A;  1AQX A;  2EC4 A;  1BX9 A;  4MPG A;  1Z6N A;  4IW9 A;  2F8F A;  3G7Y A;  3GHA A;  2QKE A;  1XW9 A;  4KSM A;  2XBQ A;  3UVT A;  2HT9 A;  2A2S A;  4O5Q A;  2J9H A;  3EC3 A;  3D6I A;  1FOH A;  3GKN A;  2H0H A;  3H79 A;  4I5Q A;  3G7I A;  3PH9 A;  1GSF A;  5DDL A;  1ZZY A;  3QPM A;  3LXT A;  3RHC A;  4IVF A;  1ERT A;  3F3Q A;  4XS4 A;  5ECO B;  1PKZ A;  5A4W A;  5E59 A;  4NAX A;  4EO3 A;  4I97 A;  4LLR A;  5HQP A;  4GLT A;  5CRW A;  3IOS A;  2RM6 A;  3EUR A;  1AXD A;  5FWG A;  2AV4 A;  4F03 A;  2OBI A;  4CW9 A;  2DML A;  2F3M A;  1EWX A;  3Q18 A;  5DJM A;  1S3C A;  4KX4 A;  1AQW A;  3VWX A;  2X49 A;  1K3O A;  4IP1 A;  3WGE A;  4F9Z A;  1G7E A;  4TW5 A;  4MF7 A;  2GT5 A;  3GV1 A;  2IMD A;  1J08 A;  2LTK A;  2HRF A;  3FKF A;  1HNA A;  4PQ1 A;  2HSH A;  2E7P A;  5F06 A;  1AW9 A;  4GSS A;  4JBB A;  4MCU A;  4FYB A;  3H1N A;  4WXT A;  1XVQ A;  3EVI A;  4ML6 A;  3CRU A;  2XBI A;  4K5S A;  2HI7 A;  3TKS A;  3ZLP A;  4G10 A;  4GST A;  1UA5 A;  1G6W A;  3QD9 A;  4PXO A;  2NTO A;  5JCW A;  4MZB A;  3QMX A;  1M99 A;  2YZU A;  3UAR A;  2A2P A;  3DKS A;  1ZYP A;  2DJ0 A;  3CQF A;  1HQO A;  1ERU A;  2L4C A;  5IQY A;  2JSZ A;  3GNJ A;  3HZ8 A;  4HU9 A;  4HDE A;  2H71 A;  2HSM A;  4YQV A;  3GL5 A;  3IK9 A;  5B6M A;  2GLR A;  3HVX A;  1WOU A;  2FWF A;  5A4U A;  2R0P A;  1Z5Y E;  1FOV A;  4IN0 A;  4MNN A;  4AJ7 A;  4ID0 A;  2L6D A;  5HR1 A;  1PL2 A;  5J9C A;  4MJC A;  1PN0 A;  1UC7 A;  2BTO T;  2VIM A;  3GA4 A;  3C8E A;  4IEL A;  20GS A;  4WBR D;  4F82 A;  1Z7P A;  1PFO A;  3TJG A;  2F51 A;  3ZFL A;  2K8S A;  5KN1 A;  2M46 A;  1M9B A;  2H30 A;  5B7C A;  3KTL A;  4EF0 A;  3N9J A;  2VM1 A;  1N2A A;  2FA8 A;  2LQQ A;  1OC8 A;  2OAD A;  1PGT A;  1JHB A;  2H75 A;  1WMJ A;  3F3R A;  2ZCT A;  1IYH A;  1SJI A;  1JLW A;  2KHP A;  2FWG A;  2XPE A;  4G0I A;  4EDY A;  4NHZ A;  1BAY A;  1Z3E A;  5HR0 A;  2B5X A;  4XTS A;  2PUK C;  2OBK A;  2Z9S A;  2MBS A;  3EWL A;  1B8X A;  1GTB A;  4MZC A;  3HYP A;  1VRS D;  3GST A;  4ML1 A;  1S3D A;  2VL2 A;  2QA2 A;  5G2Z A;  3C7M A;  1T8E B;  1EEM A;  2LUS A;  3KP8 A;  3KZQ A;  3MAK A;  3QAV A;  4WF4 A;  5ECS A;  3ZZX A;  3BCI A;  1ST9 A;  5F8B A;  1K0C A;  2C4J A;  1QMV A;  3ME8 A;  4GWR A;  4KB3 A;  3A5W A;  1Q4J A;  1EZK A;  1XIY A;  2HXK A;  2H0G A;  4MF5 A;  3DYR A;  3PIN A;  3P90 A;  5CRD A;  1B9X C;  1XZO A;  1WE0 A;  3IE3 A;  4MJA A;  1DSB A;  2R0C A;  2RUF A;  3GH6 A;  3G9B A;  1S3A A;  2WUL A;  1NM3 A;  4HZ4 A;  5ELG A;  1QUW A;  2OE0 A;  3DML A;  4O32 A;  1ZCP A;  2CAQ A;  4RQR A;  2VCX A;  1FHE A;  3KJY A;  3TOT A;  4JED A;  2DIZ A;  3WYW A;  4PNG A;  3TRP A;  3KCM A;  2CVB A;  5GST A;  2DJ2 A;  1EV9 A;  2H01 A;  1BED A;  4GXZ A;  1A24 A;  4FQU A;  3LYK A; 
#chains in the Genus database with same CATH homology
 2DIY A;  2IME A;  2R4V A;  3FR9 A;  2MMN A;  4N0Z A;  5H5R A;  4HOJ A;  1TRS A;  2VD0 A;  4PUR A;  5DAK B;  3IDV A;  2R5G A;  4DSR A;  1GNW A;  5IMC A;  4I2T A;  4DSS B;  5A4V A;  5CRH A;  5IO0 A;  3VWW A;  2DMM A;  5CO3 A;  2OAC A;  5EL8 A;  3G7J A;  1SK2 A;  1YY7 A;  4Z2U A;  1X9M B;  1H75 A;  1KTE A;  2B6M A;  1FB0 A;  3F8U A;  2B5E A;  1W4V A;  4GQF A;  1GLP A;  3UBL A;  3GIX A;  3F0I A;  4DSS A;  3CYN A;  1Z7R A;  3AY8 A;  3O3T A;  1XOA A;  2M72 A;  3EU3 A;  2OE1 A;  3GTU A;  1ZL9 A;  1TRV A;  5G30 A;  4GSN A;  2DJK A;  4KF9 A;  2VOC A;  1J0F A;  2OJL A;  3OR5 A;  3F6D A;  4HQZ A;  3MDK A;  4TXO A;  5ECM B;  4TR4 A;  3D4M A;  3PR8 A;  2GT6 A;  3DIE A;  2TRC P;  1E2Y A;  4PGT A;  5L71 A;  3KM6 A;  4JZQ A;  5J41 A;  2WGR A;  5KOW A;  5F05 A;  2GQK A;  1SYR A;  3CMI A;  3C1R A;  22GS A;  1F37 A;  5KN3 A;  2VL3 A;  2HRK A;  3KH9 A;  3BBY A;  4N10 A;  2YWI A;  4AJ8 A;  2PVQ A;  2AB6 A;  2C3T A;  4V2N A;  1AQV A;  2IFQ A;  3EMP A;  3IRA A;  2O8V B;  2HSY A;  1EGR A;  2GQL A;  2ALB A;  1GUH A;  4FIW A;  5BMU A;  5IMD A;  1TW9 A;  3TUE A;  3F9U A;  3IXR A;  4BA7 A;  2VO4 A;  1RK4 A;  2BMX A;  2O89 A;  5ECL B;  2K9F A;  1DE2 A;  2AYT A;  1O6J A;  1GSY A;  2JL4 A;  2UZ8 A;  3CSI A;  2A4H A;  3O76 A;  4Z2T A;  2GZP A;  1Z6M A;  3IR4 A;  4MPF A;  2FNO A;  4G9H A;  2WRT A;  3LXZ A;  1SJ6 A;  4NV2 A;  3KGK A;  4BVX B;  2P5R A;  3ZML A;  4BL7 B;  3FZ4 A;  4CHS A;  2K6V A;  1K0N A;  5ECP B;  2FCH A;  3I6A A;  2WJU A;  4Q5R A;  2WDU A;  1XOB A;  3E9J B;  3A5I A;  3TB2 A;  3VFI A;  1KNG A;  4PUF C;  3A2W A;  2DLX A;  4QQ7 A;  4ISD A;  1B4Q A;  3CSJ A;  2H66 A;  4ZL8 A;  4L0U A;  4H86 A;  4EUY A;  1SYX A;  1GWC A;  2C8U A;  1CQG A;  1EOG A;  2MMZ A;  3ERF A;  2YJH A;  3ZL5 A;  4EVM A;  1YQ1 A;  1B4P A;  2YNX A;  1BJX A;  1SK1 A;  4HJ2 A;  2IJY A;  2X8G A;  4K8M A;  3LYP A;  2LNT A;  2X8H A;  5KOX A;  4OWY A;  3CXG A;  5ECN B;  2V32 A;  1EP7 A;  1EGO A;  2QGV A;  2O87 A;  2GST A;  3PGT A;  2B3S A;  2DKI A;  1K3Y A;  1PKW A;  1VF1 A;  18GS A;  3ZVJ A;  3Q19 A;  1PL1 A;  2H8L A;  4K6X A;  1X5D A;  1T1V A;  2VAF A;  1A2L A;  3LOR A;  6GSU A;  4K1F A;  4E8E A;  1SL1 B;  4NPB A;  3UIW A;  2H6X A;  4V1A p;  2YJ7 A;  4MMM A;  3CBU A;  1XWB A;  4KDX A;  1WP0 A;  5D73 A;  4YQM A;  2H1B A;  2EIO A;  2CA8 A;  3TKR A;  5EY6 A;  1TK0 B;  2WCI A;  2LST A;  4RQX A;  1YKC A;  5IMZ A;  6GSY A;  5DCG A;  3QOU A;  4MF6 A;  4NV5 A;  5GSS A;  1LBK A;  4O5U A;  4IJ3 A;  1X0R A;  4PNF A;  4XS4 B;  5A5K A;  3KEB A;  1TOF A;  1TDI A;  5J3R A;  2CAI A;  1A0R P;  2TRX A;  3GUR A;  5AIX A;  3HZ4 A;  3IBH A;  2LS5 A;  3ZIT A;  2IPA A;  3FY7 A;  4MDC A;  3HXS A;  1GSS A;  1ZOF A;  3P8W A;  2A2R A;  1M2B A;  5IIZ A;  3HY2 A;  5J9B A;  1X5C A;  3L78 A;  1URM A;  2X99 A;  4ZBD A;  3BJ5 A;  2VL2 C;  4IS0 A;  3ZIJ A;  1SKS B;  2HNL A;  2QA1 A;  3IHQ A;  1GUK A;  2YZH A;  1EP8 A;  5KEJ A;  1BG5 A;  4KSO A;  1K0D A;  2P31 A;  3F4T A;  2NDO A;  3IC4 A;  3UL3 A;  3MSZ A;  4KCA A;  2HLS A;  4OMV A;  2PBJ A;  1XPV A;  3IC8 A;  3ZRD A;  2M80 A;  4EL1 A;  1GNE A;  4LL4 B;  2WZ9 A;  3TGZ A;  2R2J A;  3RAZ A;  3KH7 A;  3P7X A;  3A2V A;  4OO5 A;  4F0C A;  3LG6 A;  4P3Y B;  1GTU A;  4MK3 A;  3C71 A;  1FVK A;  1GP1 A;  2H74 A;  1MDI A;  2G2Q A;  2CVD A;  5ECH B;  3VI7 A;  4TVE A;  4PQH A;  4L5O A;  1T4Z A;  5G5E A;  2CV4 A;  2GZZ A;  2RM5 A;  3DWV A;  3F6F A;  2EIR A;  3FEU A;  1JLV A;  1WPI A;  3NIV A;  4POM A;  3UBK A;  4RUV A;  4XRD A;  5JCU A;  4PX1 A;  3WGX A;  5H5Q A;  5IO2 A;  1MEK A;  4ACS A;  5B6N A;  1ZYN A;  3TDG A;  1PN9 A;  3L0H A;  2YP6 A;  4CY8 A;  3L9S A;  4AF2 A;  1HYU A;  2RII A;  13GS A;  3US3 A;  2V6O A;  2R3X A;  4FYC A;  3HDC A;  3DGQ A;  1ERW A;  1OVN A;  4ZBA A;  2CX3 A;  1XCC A;  2VCQ A;  2LEG A;  2GQM A;  4FO5 A;  3F63 A;  2I1U A;  2FA4 A;  2FUG 2;  3VWV A;  3W6G A;  4AGS A;  1V98 A;  2VUP A;  4OFM A;  2GVP A;  3L9U A;  5IMV A;  3KMO A;  3F4S A;  5F07 A;  4GTU A;  2IMI A;  2VL9 A;  4MAB A;  1PX6 A;  1TI1 A;  3QFB C;  3RHB A;  3APO A;  1DE1 A;  2KLX A;  4K9Z A;  4HI7 A;  4NXI A;  4GCI A;  5ELA A;  4ZL9 A;  1CQH A;  1O7U A;  6GSV A;  3LFL A;  2X4A A;  4Q5F A;  4IBP A;  3GKK A;  4LA1 A;  1G6Y A;  4DEJ A;  5AN1 A;  2B5Y A;  1AAZ A;  2R37 A;  1SKW B;  3UAP A;  1GLQ A;  2GS3 A;  4QL7 A;  3M0F A;  1ML6 A;  2V6K A;  1YKA A;  1TTZ A;  3HJP A;  6GSW A;  3GYK A;  1YF1 A;  3N5O A;  2HRN A;  3TJB A;  1QFN A;  1O81 A;  2ES7 A;  2IL3 A;  2D2Z A;  3LQ7 A;  3IPZ A;  4EDZ A;  1K0O A;  2LJR A;  5EVO A;  1UN2 A;  1Y6E A;  3VWU A;  6GSX A;  1F3B A;  3KIJ A;  4YQU A;  3TKP A;  1ON4 A;  2HZE A;  5D9T A;  2KP1 A;  4K2D A;  2JAD A;  5DBQ A;  1R4W A;  1N8J A;  5CRE A;  4KND A;  2GDR A;  4K5R A;  5G5F A;  4L0W A;  1GTI A;  3L9V A;  1J9B A;  3DXB A;  2B7K A;  3GTU B;  1O85 A;  2H76 A;  4G0K A;  1WWJ A;  4AJ6 A;  5DQS A;  2OE3 A;  4ECJ A;  3EE2 A;  2I81 A;  4TXO B;  3E0U A;  4I8B A;  3EIN A;  4ZL7 A;  2PN8 A;  2REM A;  1JZR A;  3KTB A;  1T00 A;  1QQ2 A;  3JCM L;  3DD3 A;  2GSQ A;  3VUR A;  2J23 A;  2DC5 A;  2V41 A;  3S9F A;  5HFI A;  1V2A A;  2F8A A;  1TXX A;  1MDJ A;  2F9S A;  1OKT A;  2L59 A;  4X0X A;  3FYG A;  5CRG A;  3LSZ A;  3RPN A;  2AJQ B;  3IHG A;  1H4O A;  1A2J A;  2IFQ B;  4D73 A;  2H73 A;  3FZ9 A;  2OKA A;  2YWM A;  4J2F A;  1SKR B;  4OFT A;  1JFU A;  4ZB8 A;  3ZIV A;  2LRC A;  3RBT A;  1K0B A;  1XWC A;  2DKH A;  1U3A A;  1LJR A;  3QDN A;  4MJB A;  2YCD A;  3ZMK A;  5D93 A;  2YN1 A;  2XPD A;  2YWN A;  4XRA A;  3EPT A;  3LEF A;  1O8X A;  1QK8 A;  1I9D A;  1SD8 A;  1AIU A;  5FT3 A;  5IMA A;  4X4J A;  4KE3 A;  1DBY A;  2FD3 A;  3P2A A;  4ZB6 A;  1JZD A;  3UVH A;  2WFC A;  5AIV A;  2FHE A;  5E4W A;  5JWR B;  2AAW A;  5KN2 A;  3IAS 2;  4IJI A;  2ZNM A;  3TKQ A;  1SK0 A;  2N5B A;  2NPB A;  4WF5 A;  2XC2 A;  3ZTL A;  5INY A;  2X8C A;  4E8H A;  4KGI A;  4N0V A;  4KH7 A;  3BOA A;  1KBN A;  4PUA A;  1X9W B;  5ENU A;  4XHM A;  2VCZ A;  3GMF A;  4K2X A;  3KD0 A;  2FWE A;  3D0Z A;  3FHK A;  5DJL A;  2L5L A;  4BWQ A;  1VF4 A;  4TOP A;  5LD0 A;  3LW9 A;  3WD6 A;  1VF2 A;  2KP2 A;  2MZC A;  3ZYW A;  1PSQ A;  4POL A;  3VPQ A;  4JR4 A;  2QC7 A;  1B48 A;  2DBC A;  5J5N A;  3WT2 A;  3ME7 A;  3ZFB A;  3M9K A;  3TRQ A;  2YWO A;  1RQM A;  2GGT A;  2X64 A;  1USB A;  4I6X A;  3PPU A;  1R5P A;  4Q5N A;  1V57 A;  1ZYQ B;  2YOI A;  4V2L A;  2B1L A;  4MH2 A;  2I9H A;  2FY6 A;  2CT6 A;  3KP9 A;  3QCP A;  1EOH A;  19GS A;  5GAN D;  3VLN A;  2GZY A;  4USS A;  3FW2 A;  3H8Q A;  2H1A A;  2O7K A;  2IN3 A;  2JU5 A;  2GTU A;  1W89 A;  11GS A;  2N5A A;  1SJZ A;  2ZUP A;  4K7I A;  5JWO B;  4WR5 A;  1TP9 A;  1O73 A;  5F0G A;  1OYJ A;  4V1A g;  5ECK B;  1T4Y A;  5DCH A;  4XS1 A;  3APQ A;  4RI6 A;  1QXH A;  1WJK A;  1U6T A;  3RDW A;  1FAA A;  4JU5 A;  2VM2 A;  1WIK A;  3CTG A;  2LV3 A;  2B7J A;  2P5Q A;  1UVZ A;  4TR1 A;  4ZBB A;  4FYU A;  3DVX A;  4WKW A;  1TK8 B;  1M0U A;  2E2M A;  4I2U A;  4MZW A;  2DJ1 A;  2HZF A;  4YAV A;  1B9Y C;  3R3E A;  4IHU A;  4YKF A;  4EIP A;  1XWA A;  3D21 A;  4KAE A;  4IQ1 A;  5AIS A;  4OCE A;  1OC9 A;  5FHI A;  4YAP A;  3IAM 2;  1R7H A;  2VLV A;  3QAW A;  12GS A;  2C0D A;  3HA9 A;  1F9M A;  3ERG A;  2I4A A;  4DVC A;  4IP6 A;  5IPG A;  2PWJ A;  3QR6 A;  1DUG A;  4EC0 A;  5G31 A;  4ZXG A;  1NHY A;  1ZYE A;  4V2M A;  3U6V A;  2R6K A;  1IYI A;  4YH2 A;  3DVW A;  3DEX A;  4BWS A;  1GRX A;  4K0G A;  3CSH A;  4POB A;  1GUM A;  1FB6 A;  2DSA A;  3U5R E;  1SD9 A;  3GH9 A;  3V1W A;  1GL8 A;  3D5J A;  1MTC A;  1TU8 A;  1GSU A;  4MH3 A;  1OC3 A;  2PPT A;  4GQC A;  3TJF A;  4BVY A;  5JWQ B;  1TRW A;  3O6T A;  3UOM A;  4BPY A;  3GX8 A;  3FZA A;  4ZB9 A;  1K3L A;  2YV7 A;  4QL9 A;  3C73 A;  1T3B A;  2VD1 A;  4KDU A;  5CNW A;  2JAC A;  2GSR A;  4LMW A;  1PA3 A;  3MIX A;  5EPF A;  3HD5 A;  3ZRE A;  1EV4 A;  4LL1 B;  2JZT A;  4IKH A;  2GSS A;  1FW1 A;  1GSQ A;  2A4V A;  3FR6 A;  2JZR A;  3NZN A;  4ECC A;  1F2E A;  4L5L A;  5G1K A;  2FLS A;  3M8N A;  4EXJ A;  1GSE A;  4CY6 A;  2C3Q A;  2LKU A;  3J7Y b;  1RW1 A;  3GKX A;  1YEX A;  3I43 A;  5LCZ A;  2C3N A;  3M3M A;  1E6B A;  1M7T A;  4OD7 A;  2H1D A;  2AHE A;  1XBS A;  1BYE A;  2P0G A;  5HFK A;  2CZ3 A;  2N5F A;  3APS A;  2EIQ A;  4POK A;  3ED3 A;  2L5O A;  5JCG A;  4HJM A;  2LQO A;  4WEY A;  3EYT A;  3A3T A;  4ILF A;  3IK7 A;  2ON7 A;  5D9W A;  2RLI A;  4KW6 A;  4MJE A;  5D9V A;  2JSY A;  4J56 E;  3W8J A;  1OKD A;  4TN8 A;  1XW5 A;  2K18 A;  1O8W A;  2TIR A;  5COH A;  5J4U A;  2JZS A;  1R5A A;  5IOW A;  2K8V A;  4PTS A;  1XXU A;  10GS A;  1KEB A;  1SEN A;  4KUN A;  1FVJ A;  2BJX A;  1F3A A;  2C0E A;  4NHW A;  1HNC A;  4ULX A;  1A8Y A;  4F2I A;  2WS2 A;  4NWY A;  5BRT A;  2C0F A;  2VLU A;  1EEJ A;  1A8L A;  3ERW A;  1NW2 A;  4OO4 A;  5GZZ B;  1ZMA A;  4O5R A;  3DRN A;  5ECR B;  3TJK A;  3E3E A;  5ECQ B;  4ECI A;  2IMF A;  4JE1 A;  2IMK A;  2C0G A;  3TKS E;  2FGX A;  1OAZ A;  1TRU A;  1GUL A;  3QFA C;  3D4T A;  4IQA A;  1TK5 B;  1FG4 A;  3WGD A;  2HYX A;  1VGL A;  3M1G A;  2H70 A;  3MNG A;  3IV4 A;  4XS6 A;  5DVB A;  3C1S A;  3QAG A;  1K0A A;  1GH2 A;  2L4Q A;  4HUA A;  2VCW A;  3GN3 A;  4JR6 A;  4NMU A;  2HE3 A;  1BQ7 A;  1G0T A;  1AC1 A;  4L8E A;  3TCO A;  2HZE B;  1AUC A;  1YDK A;  2LRT A;  5GAP D;  6GSS A;  1THO A;  5IM9 A;  5CP1 A;  4ICY A;  3HVS A;  4Q5Q A;  1ZGN A;  1M9A A;  3FRC A;  1XFL A;  5ECI B;  3UJ1 A;  1LU4 A;  4N11 A;  4DSQ A;  3A2X A;  4O7H A;  2C80 A;  1F6M C;  4KDY A;  1K0M A;  2YPM A;  1SL2 B;  1ERV A;  1TI3 A;  4ZIJ A;  2H1G A;  5ABR A;  2E2G A;  1MD4 A;  2L6C A;  4OFN A;  3GKM A;  2H6Y A;  4EIQ A;  3HHV A;  17GS A;  4X43 A;  3TJJ A;  3HJM A;  6GST A;  5CAX A;  3HJO A;  5CYY A;  5G1L A;  3Q6O A;  5IMF A;  2IWT A;  4TKY A;  4ZIL A;  4RI7 A;  3FR3 A;  4X1U A;  2CX4 A;  4XCS A;  4K0N A;  2PU9 C;  4HQS A;  2LRN A;  3Q74 A;  4D73 B;  2DJJ A;  3MYD A;  3L4N A;  3EMX A;  3WT1 A;  4TXV A;  1X5E A;  3BD2 A;  5B8A A;  2VLT A;  3GFK A;  1Y25 A;  2C1Y A;  2I3Y A;  4Z7X A;  4K7N A;  3GL3 A;  3GRX A;  5HR3 A;  3IA1 A;  4A5P A;  4ECB A;  5DAK A;  4HS1 A;  1XVW A;  3SWL A;  1YEP A;  2DJ3 A;  3HCZ A;  2VCT A;  5H5S A;  5LNK e;  7GSS A;  3I69 A;  2HRA A;  3VI5 A;  2KOK A;  3LJR A;  5D96 A;  3FZ5 A;  4MLY A;  9GSS A;  2HFD A;  1XW6 A;  3BCK A;  5D9X A;  1TJD A;  4JRR A;  3UMA A;  5DAL B;  1X9S B;  4G0L A;  4O92 A;  1XWK A;  2PMT A;  3K8N A;  4F0B A;  5DQY A;  2FWH A;  3HVV A;  3J7Y k;  2CVK A;  3CRT A;  3LGC A;  1R26 A;  1V40 A;  1U3I A;  2QSI A;  3NOF A;  3CTF A;  1PRX A;  4K7O A;  4YKG A;  5DAL A;  1T7P B;  1PX7 A;  2G0F A;  2O85 A;  4G19 A;  5C04 A;  1ACV A;  3LWA A;  2R0G A;  3TOU A;  2PGT A;  16GS A;  3MWH A;  14GS A;  2PVO C;  3ISO A;  3TRX A;  4WET A;  3H93 A;  5ID2 B;  2NBS A;  5C00 A;  1Z9H A;  1A2M A;  1OE8 A;  4N30 A;  1I5G A;  3R2Q A;  5KN0 A;  4Z2R A;  1U88 A;  2V1M A;  3I9V 2;  1QGV A;  3VK9 A;  2OA7 A;  5AGY A;  2XHF A;  1PQN A;  1M2D A;  3M9J A;  5ID2 A;  8GSS A;  1HD2 A;  1V58 A;  4HEA 2;  4IGJ A;  2NVL A;  4HU7 A;  3EU4 A;  1C72 A;  1JZO A;  2IIY A;  5D8I A;  3FMW A;  2PER A;  3SBC A;  4WBJ A;  2H72 A;  4EKZ A;  3KMN A;  1OE7 A;  2B1K A;  4FH8 A;  1ILO A;  2H0I A;  2CZ2 A;  4PQI A;  1M2A A;  4BVX A;  4TR3 A;  1MDK A;  4BL7 A;  1YZX A;  4LMV A;  3GUS A;  4TR1 B;  1A23 A;  4GRF A;  3KXO A;  4MP4 A;  4XIH A;  4J57 E;  2MBT A;  1FO5 A;  4CDO A;  3GSS A;  1NSW A;  4OCF A;  3UEM A;  4EE0 A;  1PD2 1;  1OC9 B;  3GX0 A;  3FK8 A;  3RPP A;  4GF0 A;  1JZW A;  2KUC A;  2LJK A;  2H6Z A;  2WB9 A;  3D22 A;  3VPT A;  1TKD B;  1Q98 A;  2VCV A;  2YAN A;  4TR0 A;  5HR2 A;  3TKS C;  1U87 A;  1SL0 B;  1PMT A;  1VF3 A;  2MYG A;  4WR4 A;  5HFG A;  1A0F A;  2H19 A;  2MMA A;  3F4R A;  4HZ2 A;  2MMO A;  4KCE A;  3H4K A;  1WRY A;  2V2G A;  5B8B A;  2LNS A;  2E0Q A;  5IPH A;  5IOX A;  4TRX A;  3W8S A;  1XWG A;  4KA0 A;  3ZVJ D;  1YF0 A;  2L57 A;  1YJ6 A;  2LJA A;  1ABA A;  1SU9 A;  1MD3 A;  1G7O A;  1GTA A;  3HKR A;  2ON5 A;  4BVY B;  1V9W A;  1NHO A;  1HNB A;  1THX A;  2CQ9 A;  1TU7 A;  2RUE A;  2YV9 A;  1GSD A;  2AUV A;  4G2E A;  4MA9 A;  1AQX A;  2EC4 A;  1BX9 A;  4MPG A;  1Z6N A;  4IW9 A;  2F8F A;  3G7Y A;  3GHA A;  2QKE A;  1XW9 A;  4KSM A;  2XBQ A;  3UVT A;  2HT9 A;  2A2S A;  4O5Q A;  2J9H A;  3EC3 A;  3D6I A;  1FOH A;  3GKN A;  2H0H A;  3H79 A;  4I5Q A;  3G7I A;  3PH9 A;  1GSF A;  5DDL A;  1ZZY A;  3QPM A;  3LXT A;  3RHC A;  4IVF A;  1ERT A;  3F3Q A;  4XS4 A;  5ECO B;  1PKZ A;  5A4W A;  5E59 A;  4NAX A;  4EO3 A;  4I97 A;  4LLR A;  5HQP A;  4GLT A;  5CRW A;  3IOS A;  2RM6 A;  3EUR A;  1AXD A;  5FWG A;  2AV4 A;  4F03 A;  2OBI A;  4CW9 A;  2DML A;  2F3M A;  1EWX A;  3Q18 A;  5DJM A;  1S3C A;  4KX4 A;  1AQW A;  3VWX A;  2X49 A;  1K3O A;  4IP1 A;  3WGE A;  4F9Z A;  1G7E A;  4TW5 A;  4MF7 A;  2GT5 A;  3GV1 A;  2IMD A;  1J08 A;  2LTK A;  2HRF A;  3FKF A;  1HNA A;  4PQ1 A;  2HSH A;  2E7P A;  5F06 A;  1AW9 A;  4GSS A;  4JBB A;  4MCU A;  4FYB A;  3H1N A;  4WXT A;  1XVQ A;  3EVI A;  4ML6 A;  3CRU A;  2XBI A;  4K5S A;  2HI7 A;  3TKS A;  3ZLP A;  4G10 A;  4GST A;  1UA5 A;  1G6W A;  3QD9 A;  4PXO A;  2NTO A;  5JCW A;  4MZB A;  3QMX A;  1M99 A;  2YZU A;  3UAR A;  2A2P A;  3DKS A;  1ZYP A;  2DJ0 A;  1HQO A;  1ERU A;  2L4C A;  5IQY A;  2JSZ A;  3GNJ A;  3HZ8 A;  4HU9 A;  4HDE A;  2H71 A;  2HSM A;  4YQV A;  3GL5 A;  3IK9 A;  5B6M A;  2GLR A;  3HVX A;  1WOU A;  2FWF A;  5A4U A;  2R0P A;  1Z5Y E;  1FOV A;  4IN0 A;  4MNN A;  4AJ7 A;  4ID0 A;  2L6D A;  5HR1 A;  1PL2 A;  5J9C A;  4MJC A;  1PN0 A;  1UC7 A;  2BTO T;  2VIM A;  3GA4 A;  3C8E A;  4IEL A;  20GS A;  4WBR D;  4F82 A;  1Z7P A;  3TJG A;  2F51 A;  3ZFL A;  2K8S A;  5KN1 A;  2M46 A;  1M9B A;  2H30 A;  5B7C A;  3KTL A;  4EF0 A;  3N9J A;  2VM1 A;  1N2A A;  2FA8 A;  2LQQ A;  1OC8 A;  2OAD A;  1PGT A;  1JHB A;  2H75 A;  1WMJ A;  3F3R A;  2ZCT A;  1IYH A;  1SJI A;  1JLW A;  2KHP A;  2FWG A;  2XPE A;  4G0I A;  4EDY A;  4NHZ A;  1BAY A;  1Z3E A;  5HR0 A;  2B5X A;  4XTS A;  2PUK C;  2OBK A;  2Z9S A;  2MBS A;  3EWL A;  1B8X A;  1GTB A;  4MZC A;  3HYP A;  1VRS D;  3GST A;  4ML1 A;  1S3D A;  2VL2 A;  2QA2 A;  5G2Z A;  3C7M A;  1T8E B;  1EEM A;  2LUS A;  3KP8 A;  3KZQ A;  3MAK A;  3QAV A;  4WF4 A;  5ECS A;  3ZZX A;  3BCI A;  1ST9 A;  5F8B A;  1K0C A;  2C4J A;  1QMV A;  3ME8 A;  4GWR A;  4KB3 A;  3A5W A;  1Q4J A;  1EZK A;  1XIY A;  2HXK A;  2H0G A;  4MF5 A;  3DYR A;  3PIN A;  3P90 A;  5CRD A;  1B9X C;  1XZO A;  1WE0 A;  3IE3 A;  4MJA A;  1DSB A;  2R0C A;  2RUF A;  3GH6 A;  3G9B A;  1S3A A;  2WUL A;  1NM3 A;  4HZ4 A;  5ELG A;  1QUW A;  2OE0 A;  3DML A;  4O32 A;  1ZCP A;  2CAQ A;  4RQR A;  2VCX A;  1FHE A;  3KJY A;  3TOT A;  4JED A;  2DIZ A;  3WYW A;  4PNG A;  3TRP A;  3KCM A;  2CVB A;  5GST A;  2DJ2 A;  1EV9 A;  2H01 A;  1BED A;  4GXZ A;  1A24 A;  4FQU A;  3LYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...