3TCPA

Crystal structure of the catalytic domain of the proto-oncogene tyrosine-protein kinase mer in complex with inhibitor unc569
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
287
structure length
256
Chain Sequence
b'LEDVVIDRNLLILGKILGSVMEGNLKQEDGTSLKVAVKTMKLDNSSQREIEEFLSEAACMKDFSHPNVIRLLGVCIEPKPMVILPFMKYGDLHTYLLYSRLETGPKHIPLQTLLKFMVDIALGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFPVKWIAIESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTDPLDRPTFSVLRLQLEKLLESLPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase Mer
publication title Discovery of Novel Small Molecule Mer Kinase Inhibitors for the Treatment of Pediatric Acute Lymphoblastic Leukemia.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 74
structure length 256
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3tcpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tcpA01
3HLLA 2IO6A 4N70A 4DINA 4GT3A 4BGGA 2WMQA 5K5XA 3COIA 4CNHA 4JQ7A 1Q24A 4FNXA 3QGYA 4EHZA 2JDVA 5F95A 2BTRA 3QA8A 5LQFA 3R21A 3R04A 3I79A 4L00A 4X2FA 1P14A 5IA0A 1XQZA 1FVTA 2PVHA 1A48A 5EM8A 4DF3A 5BUEA 2PVKA 2OIBA 3I60A 1DI8A 1WBVA 2PUUA 3VUDA 3BLRA 1CKJA 3MH0A 5DT4A 1PXLA 4L3JA 4JX3A 3LLTA 3UIBA 3VQUA 3PRFA 4PTGA 5CYIA 3SLSA 4HVIA 3PJCA 4CLJA 5FTQA 4BTKA 3U8WA 4MD9E 4B8MA 3W2SA 2B9HA 4R7BA 4GU6A 4EONA 3CBLA 3UYTA 3P4KA 4EKLA 4FKVA 4R3CA 2J50A 3CPBA 3LFQA 4IWQA 4E20A 2QR7A 2G2FA 4FEQA 4QYFA 3PRIA 5JFVA 3K2LA 3D0EA 3KB7A 3R0TA 3GC8A 4YLKA 3VRZA 3V5TA 4C61A 5GZAA 1ZYCA 5LWMA 3BU3A 1W98A 4KSPA 2PZPA 1TQIA 4U80A 4AE9A 4FKRA 4YJVA 4WBOA 4U7ZA 1B39A 4GVAA 2BRMA 3HKOA 3R7YA 1NVSA 3ZOSA 3H3CA 4FTUA 1SNUA 5EI8A 5JFWA 2C0OA 2NO3A 2VGOA 1PYEA 4PF4A 4XP3A 3QRUA 4FA2A 3BYUA 3IDCA 4X0MA 4RZWA 3HDNA 5KO1A 3GCPA 4XHKB 1EH4A 3ZRMA 4D1ZA 4L43A 3KREA 3LQ3A 5IMXA 4CFFA 3BQCA 3NYXA 4UMPA 5CVHA 2CKQA 2WOUA 3OVVA 3OBGA 4YC6A 5AMNA 2UUEA 2PE0A 3L8VA 3HA6A 5EK7A 2AC5A 4NIFA 3EQGA 3QRKA 2IPXA 3DS6A 1OL7A 5GZ9A 3QCSA 4ENYA 3D5XA 4MD8E 2BHHA 3SQQA 3V8TA 3VS6A 1UNGA 3QZGA 5HI2A 2GSFA 2R7BA 2XEYA 3CPCA 2R3HA 3C1XA 5AUVA 5AM7A 3F69A 5I3RA 2ZM1A 2VD5A 3KMUA 4G5JA 4DE4A 1YRPA 4Z55A 3LXKA 2KTYA 4YTCA 3T3VA 1FBNA 2J5FA 3MB6A 4GU9A 2X39A 1OL6A 3ROCA 3CSVA 4UYNA 4Q5EA 2IVUA 3H10A 3TNHA 4X2KA 4KIPA 3PY0A 4GT5A 5HG5A 3ZFXA 3R22A 3R01A 4H36A 4B7TA 4FGRA 4KB8A 3U6JA 2BZIB 2JDRA 1OL5A 2R3JA 3DDPA 3GBZA 3RAIA 4AX8A 4IAYA 4CGAA 5E8WA 2REIA 4D0WA 3FC1X 1M2PA 3GB2A 3O7LD 2JKOA 3ZFMA 3A61A 2Y6MA 3DNEA 4D2VA 3UODA 4YBJA 5I9ZA 4RWKA 3ZUTA 2OG8A 1SVHA 3GCUA 4IM0A 4AFJA 5M51A 2B55A 5FXRA 4RBLA 4C4GA 3KFAA 3DB8A 4FKGA 3R7GA 1H1PA 1P4OA 5K5NA 4XG6A 3FBVA 5CANA 3A62A 4EOPA 1GJOA 1PKGA 2WHBA 3QU0A 4Y83A 3BKBA 3BV2A 3COMA 2W4KA 1OIYA 3L8XA 4CEGA 2XCHA 2EUFB 4AW0A 4EOIA 5CEKA 4WSQA 5TO8A 5EKNA 4NSTA 2YACA 4LUEA 4R5YA 2V7OA 1FQ1B 3F3WA 1CSNA 4JX7A 4ZTMA 4LI5A 3VS3A 4C36A 4EI4A 4ZZMA 5JMSA 1H1SA 4RSSA 4GH2A 4J95A 1JKKA 3FHRA 3R1YA 3ZM9A 2DWBA 2HWPA 4AU8A 3K5VA 2R5TA 2VWZA 4FZ7A 4LFIA 4W8EA 3OXIA 5EYKA 4DH8A 3QKMA 1PMUA 3VUGA 5CSXA 4BCNA 4BN1A 3QF9A 2C3IB 3K5UA 5KCVA 4IDVA 2WQMA 2A2AA 4EQUA 4RX5A 3D5UA 3NW7A 3LXPA 3OWJA 4D4VA 1JVPP 2Y4IB 3GU5A 3AC3A 1KE7A 4K9YA 2C5XA 2UW8A 4X3JA 3QKKA 1RDQE 5D41A 1R0EA 1GIJA 3I0QA 4ZJIA 4NL0A 4KSQA 3Q9ZA 1NA7A 3KRXA 4RJ8A 4DGNA 3ZO3A 3P79A 4D9TA 2VTPA 3PJ1A 3GCSA 3DQXA 4EOQA 3SRVB 2X1NA 4U6RA 4KRDA 3R2BA 4L42A 3SW4A 4E73A 3DXPA 2PSQA 3BIZA 5HQ0A 3FEGA 3CY3A 5C26A 1VEBA 1R39A 4M14A 3DQWA 4ZSJA 4IW0A 2IW6A 4BDCA 5DIAA 4BIDA 4CV9A 4KRCA 5FDXA 4RA5A 4FV6A 1JNKA 1Q99A 1JSVA 1YHWA 2W9FB 2E9NA 3OW4A 4HCUA 2CLXA 3N9XA 4I6HA 4IDTA 3WZEA 3CC6A 3QALE 2A27A 5DPVA 4IX6A 1OKVA 3QYWA 2R3QA 4QYGA 5DGZA 4O21A 4U45A 2Z8CA 3VHEA 1OBDA 3JVSA 2UZVA 3NIEA 5CSVA 1IEPA 2XB7A 2WIPA 2X9EA 4JDHA 1ZRZA 3FKOA 3L8SA 3W2PA 5CEPA 4O7ZA 4O38A 5ICPA 3GXLA 1XWSA 5IA1A 2LGCA 4FYOA 1FOTA 4N6YA 4X6RA 2RL5A 3PPKA 4AZEA 3U6IA 4EORA 3HECA 2C5YA 4UWYA 3LXNA 4X3FC 5KMMA 4O83A 3AOXA 3V04A 4AZWA 4ZTSA 4EHGA 4BDBA 1IG1A 3Q6WA 4BDFA 4HOKA 4KABA 5EQPA 3G5DA 3GU4A 4C58A 2JLDA 5CT0A 2GHLA 4C4JA 4AZSA 4YHTA 2WELA 4W8DA 4ALWA 4I20A 4PPAA 4KUJA 4EHVA 3DBEA 2WNTA 3ENMA 3PG1A 4ANQA 2ZVAA 5CF6A 2R3PA 5DHJA 5M44A 5CSHA 5TT7A 5IQBA 3ZUUA 5CLPA 3D2IA 3QUDA 4HGLA 3E64A 5HIDA 4IBMA 3D94A 3B2TA 4CD0A 2CMWA 2FSLX 3SOCA 3SHEA 5BUJA 1YDSE 3U51A 1PMEA 5E8ZA 4ZTHA 1OKZA 3CKXA 4QYEA 3HAVA 4QTEA 4QMMA 1OUYA 3ZBFA 4AA5A 2B0QA 5FUTA 3DCVA 4RJ5A 3C0IA 4L68A 4RIYA 3U54A 4FNZA 4QMPA 4ANMA 5AX3A 4WT6A 4UMTA 3N51A 4L01A 4XX9A 3BGPA 3HVCA 4WIHA 3JVRA 3ET7A 4XG4A 5EM7A 5J5TA 3TUCA 3NVMB 4FTCA 2C1BA 3NR9A 4XJ0A 3AQVA 5JZNA 3VS1A 4M68A 1OPLA 3MH2A 1WFCA 3O2MA 2R3FA 4HZRA 4PP9A 4K2RA 5FEQA 4CCUA 5HO6A 4ITHA 1RQQA 2CGUA 3FJQE 3M2WA 1OVEA 4B99A 4CFNA 4S34A 4EYMA 1XH5A 4LRJA 4O96A 1RE8A 4USEA 3F66A 1H25A 3UOKA 5J7HA 3TNIA 2ITWA 5CF5A 4TYGA 3ORKA 3C9WA 2YIXA 3G33A 4FSYA 2CDZA 3R7OA 2YDKA 2P3GX 4EK6A 2YERA 4CFUA 3FZOA 3RWQA 4J96A 4FTTA 3SOAA 1YHSA 3PIZA 4YHJA 2C3KA 3NGAA 3F6XA 3MVLA 4O1PA 3BQRA 5M4UA 3NAYA 4C3PA 2PY3A 3FE3A 3W1FA 2WQNA 3PYYA 2UW9A 3LCKA 4ZP5A 2WTDA 1BLXA 5EOLA 4C34A 2GU8A 1R78A 5L2IA 3PSCA 4M67A 2RGPA 4QTDA 3HNGA 5AAEA 2JGZA 2C47A 3GC7A 1J1CA 4WG5A 4MF1A 4QMYA 2VO0A 1ZLTA 4M15A 3C50A 3HMMA 4BDKA 1KE9A 2BZKB 3R30A 4FZFB 2VTQA 4FL1A 1ZWSA 3I5ZA 2BALA 5E91A 3TN8A 3D7TB 2VO7A 3DY7A 3BEGA 4XOZA 3GOKA 5HG9A 3TIZA 3GVUA 3O8TA 3KU2A 3HA8A 3MB7A 1V1KA 4YZDA 3RAHA 2XYUA 1YXVA 4QMZA 4HNIA 5LVMA 4B9DA 5EFQA 1H07A 4JIKA 4O1OA 4YHFA 3O23A 4KBCA 4DH7A 3PA3A 3NUNA 5I4NA 4OAVB 5KHWA 3DKFA 3EB0A 4O0SA 3VUTA 5L4QA 1SYKA 2HXLA 2HZ4A 3LHJA 3EN4A 4S33A 1DI9A 2PZIA 3V8SA 3ATTA 4C57A 4LQMA 3QZFA 4ZZOA 2WTKC 3R9NA 4BYJA 1QL6A 1OPKA 1CKPA 4RJ7A 5C01A 4I23A 3F3VA 3IPHA 4DEBA 3LE6A 3MA3A 4RA4A 3KULA 2WMVA 3A7FA 4XV1A 5AWMA 1H0WA 2CGWA 4FBXA 5E1SA 2GNHA 1FVRA 1H28A 3WF7A 5HORA 2ONLC 4A4XA 4RZVA 1UKIA 5I9XA 3Q2MA 5IPJA 2R3LA 3WI6A 4FV3A 5J9YA 4BDEA 4II5A 3IO7A 4YJRA 5DA3A 4BDIA 4X7QA 4RX9A 1G5SA 5BVDA 2YJRA 3F3ZA 4Y72A 4GCJA 3ZDUA 2YN8A 3H9OA 5CNNA 5EKOA 3CEKA 1ZMWA 3TNQB 3ZCLA 5A4QA 3R00A 4ZS0A 4GKIA 4D2TA 3FSFA 2IZRA 4CT2A 3MW1A 4BWXA 2XK4A 2BAKA 3NUPA 5CS6A 4FKTA 2XZSA 5TE0A 5IQIA 4HZSA 5TR6A 2AUHA 3EL7A 3F9NA 4ZLZA 4BCMA 4TYHA 5LCJA 4O7WA 5L6WL 2VTTA 3CJGA 5FM3A 4EOOA 4I0TA 4CYIA 4JJRA 3RNIA 5I9VA 1JKTA 4RVMA 4GJ3A 1LPUA 2WEVA 4FV9A 4BL1A 4D55A 2PTKA 1R1WA 2ZDTA 4ANBA 4YTHA 3UGCA 3GI3A 3DV3A 3O17A 4JBQA 5FDPA 2OJJA 2YM5A 3MA6A 2YCQA 4YO6A 1T46A 2QOKA 5ANIA 2C6TA 4FKOA 1KWPA 4DFNA 4ENXA 5HIEA 5CXZA 2IWIA 2W17A 4MQ1A 3BU6A 3P0MA 4JRNA 4JLCA 5DR6A 1HCKA 5JGDA 4BY9E 4QNAA 4YZMA 5EI2A 3FMNA 1U54A 3W2CA 4ACCA 1ZZLA 4GT4A 4PMSA 3WIKA 5A6OA 2OKRA 2C4GA 3DJ6A 1WZYA 1P2AA 5HNBA 5AR3A 2XK6A 3PZHA 1OBGA 2OW3A 4L44A 4IVAA 2WZJA 3QX4A 4QQJA 4ASZA 4BZNA 5KNJA 2PVYA 5EYMA 4O6LA 2LAVA 4ZMEA 4UYAA 3I1AA 2YM8A 3Q5IA 5TOZA 2XRUA 3VBWA 2WMUA 1FVVA 3QD0A 5GJFA 5L6PA 4EWHA 2ZMDA 1ZYJA 2BILB 3I81A 2OXDA 4UBAA 5JQ5A 3FXWA 1CDKA 2W99B 3EQDA 5LVOA 2UZTA 2VTLA 3COHA 5JZJA 5CXHA 3S1HA 5D7AA 5DNRA 3WZUA 4YBKA 2H9VA 3HZTA 2C5VA 3RALA 3TUBA 4Z3VA 3Q4ZA 3TDWA 4LOPA 2CSNA 1Q8YA 2WD1A 4R5SA 4PX6A 4XUFA 5HNGA 4F0IA 2X8DA 2RFSA 3OS3A 3WF5A 4DT8A 5KMOA 4NW5A 4UZHA 3AT2A 5DI1A 2WO6A 4BVUA 2C6LA 4C2WA 3DBCA 4J52A 3HAMA 3O0GA 4RX8A 5G1XA 3DU8A 3REPA 2Y8OA 2VUWA 1URCA 5C4KA 1Q8ZA 4FTOA 3FYJX 2O64A 2VTNA 4QQCA 3UTOA 4FL3A 3ZRLA 1CMKE 5H9BA 2XM9A 4APPA 3V6RA 2ITZA 3VUMA 4H3PA 4I5PA 4GG5A 4ANNA 2WMSA 4O2ZA 3BYOA 5EW8A 3BBTB 4QP3A 4USDA 3PZEA 3GEQA 1CTPE 5D12A 3RHXA 3VULA 5K4IA 3DJ7A 2WMWA 1W0XC 2Z7SA 3NUXA 5M55A 4J53A 4ZY6A 1OB3A 5ANEA 1PXIA 3UMWA 5KMLA 5CZIA 2GPHA 2QO9A 4UALA 3Q32A 4QP6A 4AXAA 4FC0A 1ZARA 3OUKA 4IAAA 4RQKA 3IOKA 4FUYA 4DEGA 1UWHA 2Z2WA 4IZ7A 1JSUA 4KNBA 3TG1A 2YHVA 3G90X 3POOA 2C6DA 2O0UA 3RI1A 4YTIA 4ASXA 5IEVA 2XIRA 3CTQA 3MVMA 4YLLA 3P78A 5L8KA 1URWA 1U5RA 3MH1A 2C6KA 3H0ZA 4FVPA 4FMQA 3UVRA 4GL9A 3EN5A 4YJPA 4GMYA 3KRWA 5DR9A 3RAWA 1J7LA 4AP7A 4A9UA 4GK4A 2IZSA 3UBDA 5EDQA 2HK5A 2CPKE 2F49A 3UO4A 3MWUA 5HCXA 2ZYBA 3D5VA 3MSSA 2CGXA 4JDJA 5EH0A 5IISA 2YZLA 5ITAA 5JRSA 1H26A 4XLIA 4BB4A 5IA5A 1BI7A 3FPMA 3C7QA 4Z7GA 5BX0A 3UO5A 5DFPA 2RKUA 3VBXA 3PVGA 3Q6UA 4JAIA 4TYIA 3PJ2A 5D7VA 2UZDA 2WMXA 3VBYA 2X4FA 2PVRA 3GNIB 3DAJA 3F7ZA 4IX4A 4WG3A 4F08A 2R3KA 2VWXA 4TRLA 1UA2A 2XIKA 3CXWA 2EB2A 3KVWA 4GIHA 3ZBXA 4BRXA 4G31A 4DFZE 5KMNA 4WRGA 3SV0A 2XNMA 4O0VA 4U44A 1REJA 3JY9A 4RMZA 5CQWA 5FBOA 3I7CA 2QU6A 4EH4A 2JKMA 1H0VA 2OFUA 5C27A 5IKWA 4EOLA 4F7JA 5M4CA 3NYVA 3JR1A 1PXPA 3UOHA 2UZBA 3HV4A 2H8HA 4IIRA 2BHEA 3CIKA 4ZS4A 2OWBA 4OTPA 5K4JA 4AT3A 3U6HA 2GTMA 4O7RA 5HU9A 2ITQA 4MNFA 4EC8A 5BVOA 4X3FB 3CCNA 4H3BA 3FI8A 5HZNA 3QKLA 4FSQA 4Q9ZA 2F2CB 1PY5A 2R64A 3FLWA 2QC6A 4H1MA 3RPYA 2PPQA 3Q4UA 3TIYA 3ZO2A 4R1VA 3ZXZA 4KIKA 4BKYA 4NM7A 3VBQA 3Q53A 4E7WA 4FG8A 5EYCA 1A06A 4UMQA 5CQUA 5AP3A 4M97A 4IAFA 3Q2JA 2G9XA 3OP5A 4XRJA 4BDDA 2WGJA 3QAME 4NU1A 3AD4A 3QRIA 3RP9A 2VTIA 1MP8A 1WVWA 2XEZA 4MYGA 2QOLA 3UVPA 5A4EA 4HGTA 4KIQA 5AUTA 3QC4A 4NFMA 2R3MA 4DFBA 3BGZA 3IW5A 1R3CA 3KVXA 2OU7A 3NUUA 3ZSGA 3OW3A 2BMCA 3EIDA 3T8OA 4RWLA 4FK6A 3BX5A 1SNXA 3LPBA 2G15A 5GZ8A 1Y8GA 2WIHA 2HOGA 4E93A 3PY1A 3OWPA 2VWUA 1STCE 5B2LA 1H01A 4K11A 3VUHA 5B2MA 3N4TA 4IWDA 4QYHA 1JWHA 4QPAA 5HBJA 3MESA 1K2PA 1ZXEA 3NUSA 4CKIA 3PVWA 2VV9A 4OLIA 3ULIA 3HUBA 3CJFA 4FX3A 1ZY5A 4D2PA 3GU6A 5LMKA 2PK9A 3VW8A 3QD3A 4DTAA 4IC8A 4XP0A 3UIMA 4BCQA 3CTHA 4EYJA 2XK3A 4AN2A 2I0VA 3BHYA 3NCGA 4E4LA 4GK3A 1MQBA 1B6CB 2XNGA 3OD6X 3KMWA 4YZNA 3W8LA 3SG8A 5IQHA 2YFXA 5HG8A 1QPCA 2F9GA 3C5UA 3EOCA 5GJGA 3TZ9A 3UVQA 4UV0A 3ZM4A 3FY0A 1JKLA 3V01A 4M69A 2EU9A 2I40A 2UZEA 1ZY4A 2VX3A 2YWPA 3ORXA 4IVBA 5E8YA 5T68A 3R8VA 3V5JA 4C33A 4F99A 2B1PA 4N6ZA 4QP9A 3UNJA 2WMBA 3M42A 3OROA 4H58A 2VAGA 4QD6A 3WILA 4PNKA 4YZBA 2QR8A 4ZLOA 3UP7A 4YJNA 2PULA 3FLZA 2BDFA 3PA4A 3DFAA 4W4VA 4DHFA 4JR3A 2HZ0A 4JAJA 4D2RA 3ZTXA 4F70A 3UQGA 3TV6A 4ZTLA 4Z7HA 2ZB0A 5J1VA 2IN6A 2PUIA 4UEUA 3G0FA 4QPSA 4ZMFA 2C68A 3TV7A 2BKZA 4EH3A 4F9CA 3LM0A 4XS2A 5CALA 2VZ6A 3PVBA 3NNVA 4AG8A 3Q04A 4U97A 4ASDA 4JL9A 2XJ1A 4ACHA 2ZM3A 1UU7A 2PZYA 5HG7A 1L8TA 5IQDA 5HCZA 2IZUA 2IG7A 1J1BA 4RC4A 1IASA 2VX0A 4FTMA 5DRDA 4AW1A 3ANRA 4FVQA 4R1YA 4I3ZA 4MNEA 4DLIA 1WBOA 4DGGA 3V5QA 4DYMA 3CQEA 2WPAA 4IAIA 5EHYA 2XMYA 2XJ2A 2WTKB 4I94A 4KD1A 2ITTA 4K8AA 4DG3E 2VTSA 3S0OA 4IZAA 2H34A 3TACA 4D1SA 3SX9A 4V0GA 1JSTA 4UB7A 3DZQA 2X9FA 4FZDB 4YZ9A 3BV3A 4NFNA 3HV5A 3EFLA 2B9JA 3AT4A 4JDIA 5AUZA 3MN3A 3QQLA 1TVOA 4TWCA 4FV7A 3VWAA 5JFSA 3LXLA 4I21A 1M14A 4I6BA 3BZ3A 5JK3A 4C0TA 3GGFA 2YAAA 3G9NA 3R7EA 3F3TA 4BYIA 5CEIA 4IFCA 4EL9A 5IDNA 4O0YA 4DBNA 2UW7A 4IJ9A 1Q3DA 2RG5A 3DAEA 3KN6A 2C6OA 2OXXA 2VNYA 2ETKA 3RBWA 3UG2A 5AUXA 3JUHA 4WKQA 4AZTA 4CV8A 4G6NA 3A2CA 5AP6A 4QMLA 3RMFA 3BELA 2W5AA 4NEUA 4PUZA 4R3PA 5I5ZA 2SRCA 1H1QA 3OWLA 4S30A 3LMHA 2V62A 2JBPA 4AT4A 2GS6A 4IB0A 2XIYA 3RK7A 4FIJA 3ZO4A 3LAUA 1KSWA 3DOGA 3RZBA 2CNVA 2GNLA 5HNIX 4H1JA 4FKUA 3RGFA 4UXLA 3CKWA 4KS8A 3LFAA 3P9JA 3DXQA 2RFEA 3KEXA 3RPSA 4ZZNA 4FSZA 5AUUA 1H4LA 1XKKA 2ZV2A 4WSYA 3VS7A 2CN8A 2VU3A 2QD9A 3EN6A 3V8WA 4L6QA 1PKDA 2IZTA 3W16A 4L9IA 4HVGA 3W2QA 4GKHA 4FSNA 4C4HA 4CQGA 3MFTA 4TWNA 3BLQA 1F0QA 3QFVA 4BF2A 1RJBA 3DBDA 4XG7A 2BZHB 3QHRA 4JQ8A 4G3FA 5AJQA 5IMEA 2C1AA 1PMNA 4WNKA 3TZ8A 4ZLYA 3QCYA 3SKCA 2BAQA 3LQ5A 5AV1A 4B6LA 4ACDA 2BRHA 4AQCA 3LFFA 1U54B 1YI3A 4QP4A 1U5QA 4IEBA 4NJDA 4YJQA 4EH8A 5M4FA 4USFA 3BYMA 5DRBA 5BMMA 1W8CA 1V0OA 4NKAA 2VNWA 4F64A 3DDQA 3DXNA 3CY2A 4WD5A 1QMZA 5ANDA 3UO6A 4F6SA 2QHNA 4H05A 3LCTA 5DEWA 2ITVA 5LMBA 3L9PA 4RRVA 4FT5A 3NUAA 1TQMA 2FYSA 2GTNA 1GZNA 4XV2A 3EFJA 5HTCA 5LWNA 4NT4A 5FTGA 4P90A 4R77A 5GNKA 2BRGA 4FKSA 4QNYA 1H8FA 3SC1A 3ZLWA 2QU5A 3FZRA 5D1JA 4BGHA 4BI1A 3CD8A 5I9YA 4C7TA 2JKKA 2EWAA 4GSBA 4JRVA 5FM2A 5HE2A 3BBWA 2QURA 4OTGA 4QMUA 5H2UA 3FMKA 5FG8A 5AV3A 4IE9A 5I3OA 3V5PA 3MFUA 2HW7A 3LKMA 4NKSA 4XG2A 4I5MA 5CAQA 3I0OA 4MXCA 1O6LA 4NM0A 1KV1A 1J3HA 4QO9A 3ZXTA 3BE2A 3FYKX 2X8IA 1ZZ2A 4OUCA 1BKXA 3R6XA 5IZFA 1YI4A 3FKLA 3VQHA 4OW8A 4GK2A 4AW2A 2J0JA 5DR2A 4IXPA 3V3VA 4AGDA 3ZONA 3QWKA 3MIAA 4O7LA 5CSPA 1ZAOA 3OWKA 4HYIA 4AUAA 5L2SA 4EC9A 3WE4A 1F5QA 3EFWA 4BDJA 5KHXA 2X7OA 4BCIA 5D9HA 2PVFA 3VF9A 4AGWA 2PVMA 4J8MA 3FI3A 4AAAA 5HHWA 4MQ2A 2A4LA 4PMTA 5I0BA 2VWYA 3PP1A 4TN6A 2AYPA 5CU2A 3R8PA 3CE3A 4MBLA 3PWDA 5DE2A 2O8YA 4L3PA 4B4LA 4G3GA 2Z7LA 3LZBA 3MYGA 4ID7A 5HE1A 3SXFA 3GUBA 2EXEA 3OCSA 3FLQA 1JQHA 4IB1A 4BWPA 4E5BA 4MWIA 2FO0A 5HCYA 4K77A 4FTRA 2EXMA 3G6HA 3GENA 3VS2A 2VTOA 2I0YA 4MAOA 5DN3A 2GCDA 3TCPA 2PU8A 3LOKA 1TQPA 4EJ7A 2XNOA 3I7BA 3FZ1A 2YCRA 2XUUA 4BCJA 5M09A 4GFOA 3P5KA 4L7SA 4F1OA 3DK7A 4ERWA 2BIYA 2X81A 3C4XA 3G2FA 4F0FA 5BNJA 4FF8A 4KBAA 2BZJA 4CZYB 4XBUA 3W33A 2JFMA 3ALNA 4E5WA 3T9TA 3HL7A 3EQFA 4G2FA 4I24A 3VF8A 3H9RA 1O6YA 2O65A 4L7FA 4C2VA 3NDMA 4U43A 4PY1A 2J6MA 2A0CX 1UU9A 5FP6A 5LXMA 3PP0A 3OBJA 5CNOA 4LMUA 3QTRA 1Y91A 4BBMA 1YXXA 4EZ7A 5BPYA 5FGKA 1H27A 3V6SA 3Q9XA 3KK9A 2JDOA 3D5WA 5FXQA 3QTQA 4OBQA 4O22A 4C38A 2YWVA 4DN5A 3VJOA 3OMVA 3EYGA 2XKDA 5IQGA 3O51A 2XNBA 2C0TA 3L8PA 3FV8A 2W1IA 4CZUA 4DITA 2OZAA 4GEOA 2JITA 5BYLA 2EB3A 4DH5A 1OIQA 3WYYA 3NZ0A 1WBNA 4K18A 4J98A 1OGUA 3HEGA 3UC4A 3QTSA 3OOMA 4RIXB 3SXRA 4E8AA 3PG3A 1K3AA 3KKVA 3MTFA 2AC3A 2OXYA 1LEZA 3F7WA 3FSKA 2F7EE 3LFSA 4APCA 2ZM4A 4YP8A 4CFMA 5A54A 3R8ZA 3SXSA 2BUJA 2VTMA 4YC3A 5BVKA 2OH4A 2QODA 4H3QA 2CHLA 2V22A 4TYEA 3KXNA 4ZEGA 5F1ZA 4PMMA 4QP2A 4MKCA 3V5LA 4M3QA 1JLUE 3E8DA 4U0IA 2GNIA 3FLYA 4DEDA 3UQCA 3GQIA 4AOIA 5HU3A 4ITIA 1SM2A 5DOSA 5ACBC 4OTDA 4C4IA 4G17A 3R9RA 3QLGA 4WA9A 5KUPA 1LP4A 2PVLA 3IK3A 3FI4A 5CF8A 5IH5A 2VO3A 4AZFA 3EYHA 5DBXA 5K3YA 4IACA 5J8IA 2CCIA 1XHAA 4GJ2A 4PDOA 4WNOA 1Y57A 1Y8YA 3OTVA 2ITUA 3VS0A 2QOCA 4BI0A 4DCEA 2PVJA 4F9YA 1VJYA 3VS5A 4LRKA 4ZY5A 4BFMA 4OTQA 4O86A 3G9LX 4RIWA 4C35A 4YSMA 3QTUA 3FQEA 5AAGA 2YM6A 3N4VA 4EH2A 2J0LA 3G6GA 3F2AA 3NNWA 2WFYA 3C4FA 1QPEA 3C0HA 3NEWA 3PXFA 3TNPC 1OI9A 4TXCA 4K33A 5AIKA 1NVRA 2QLQA 5EW9A 5LMAA 5EG3A 2R2PA 2WU7A 2VO6A 5CVFA 4QYYA 3E7OA 5DYJA 1NXKA 4UXQA 4OGRA 3GC9A 5A9UA 3QTXA 4IM2A 3BGQA 2ITOA 3QRJA 3EQRA 5DMZA 4EQCA 4F7SA 4EBVA 3KXMA 4UN0C 4J7BA 2OH0E 3R9OA 2Z7RA 4AACA 4IMYA 3JYAA 5KZIA 3E92A 3O7LB 4YO4A 4E5AX 5EQEA 3CGOA 1K9AA 3FL4A 4IB5A 3FZTA 3LCDA 2Z7QA 2ZOQA 4A7CA 2UW0A 4QQ5A 5FD2A 3Q5ZA 2PVNA 4GYGA 3OY1A 3PUPA 5AR2A 4EZ5A 2W1GA 1YDTE 4Q5HA 2QO2A 3DZOA 3R1NA 4YZCA 3VBTA 3GC0A 5IUIA 5JQ8A 4PTCA 4CG8A 3CGFA 3W55A 4BBEA 4FOBA 5GJDA 3PDTA 4FIGA 3DTWA 3LM5A 4EJNA 2CLQA 3NYNA 4DEAA 4ZOGA 1Q8WA 1UNLA 4AW5A 2ZAZA 3TXOA 4BI2A 5IA4A 3ACKA 3ALOA 3NVKI 3IS5A 4DBXA 1O9UA 2QNJA 2RSVA 3A7GA 3TZ7A 3COKA 3DJ5A 3QL8A 5C4LA 1JKSA 2QG5A 4B8LA 3DA6A 4XG3A 4DEIA 4N4SA 1UU8A 3KXXA 1JBPE 4LMNA 2YIYA 3L1SA 4JG7A 3WZKA 3C5IA 4GG7A 1ZMVA 2WXVA 2HY81 3U87A 4QQTA 5L8JA 3LJ1A 2XM8A 3NS9A 3TUDA 3E88A 2UW4A 4I6FA 3PXQA 4UZDA 1T45A 3SGCA 4A9YA 4EWQA 3P7BA 2J0KA 4M8TA 3KCFA 4YLJA 3KY2A 4NTTA 5CAOA 4O0WA 4LL0A 4NM5A 4IWPA 2HZNA 4BHZA 4FOCA 3NPCA 2B7AA 3M1SA 5CF4A 4R3RA 3FMLA 3RWPA 1YVJA 2UV2A 4DGMA 2BIKB 4TY1A 4U40A 4W4XA 4BWKA 4CFXA 4E4XA 2CKPA 3EJ1A 4EH7A 4GUBA 4D28A 5HE0A 3D7ZA 3IG7A 1AD5A 3THBA 4O7VA 3EH9A 2F7ZE 3IKAA 2GNGA 2YDJA 4FV1A 2QG7A 2UW5A 3HP5A 3FI2A 3FMDA 4FODA 2PMOX 3SW7A 1UU3A 3PPJA 4ZSLA 4XLVA 1Z5MA 4HPTE 2JC6A 4M13A 3ULZA 5AEPA 3U4UA 4QRCA 3ZU7A 3KL8A 2WTJA 4M0YA 4O0RA 4FV8A 2F2UA 5CU0A 1ATPE 1CKIA 4UWBA 4YJSA 1DM2A 3EQIA 1YWRA 4U9AA 3QTZA 4O2PA 4RG0A 1B38A 2QO7A 1Q4LA 4Y8DA 4G6LA 4NIFB 5AA9A 1GZ8A 4G1WA 4IAKA 1XH9A 1FMOE 1YXTA 3G0EA 3LFEA 3ORZA 1PJKA 1PXJA 2BRBA 3MS9A 3P23A 3MFSA 2A1AB 2FUMA 4MCVA 3UP2A 3ZSIA 3TV4A 1I44A 4BR3A 4NWMA 1REKA 3LFDA 3RM6A 4D5KA 3IONA 4I1ZA 3H0YA 2I0HA 3HMIA 3QX2A 4KWPA 4FNYA 4O0UA 2C69A 2G01A 2GQRA 2BDWA 3C4ZA 3MY0A 3A8XA 5IF1A 3ATSA 3QD2B 4RIOA 3ZEPA 5ETIA 3WF8A 5LVPA 3OT8A 5AP0A 3RZFA 5AV2A 5HD4A 4EK8A 3KN5A 1PMVA 2XNNA 2PMIA 2XH5A 4C3FA 1U4DA 4BDHA 3CQWA 1E1XA 1AGWA 3G51A 4V01A 3BU5A 3PE2A 4X2GA 4G5PA 3A7HA 4HGSA 4FGBA 4MBIA 3W2RA 4AGUA 3PSBA 4XMOA 3RM7A 3UZTA 4C59A 3AC5A 3FKNA 4LM5A 2W1HA 5IA2A 4FG7A 3QTIA 1E9HA 5FXSA 5HESA 5M08A 3JY0A 2YM7A 4O0TA 2HELA 3E3BX 3HDMA 4CFVA 2DUVA 4GS6A 4TWOA 3SD0A 4CVAA 3DBQA 4F1TA 4DGOA 1WBWA 2UZWE 4TKSA 4IZYA 3ORLA 4OBPA 5AFVA 4RC2A 1G8SA 4D9UA 4GFGA 2WTIA 4CXAA 2RFNA 1BL7A 4MXXA 4O7TA 3P7CA 4XOYA 4LGGA 1XJDA 2GNFA 4MK0A 4K1BA 2XVDA 3W8QA 4BDAA 3EWHA 5C8MA 2JIIA 2O63A 4U8ZA 2UVZA 4DFLA 2QOBA 5CWZA 4D4YA 4R78A 3RJCA 3H30A 4G9CA 3ZEWA 3GFEA 4RT7A 4UX9A 2PUNA 3PXKA 2B9IA 1PXKA 3SRVA 2RFDA 2XS0A 5HIBA 3TDVA 1KE8A 1Q62A 4BIEA 2OO8X 4M66A 5DVRA 5HICA 3ZRKA 2Z02A 1M17A 3VRYA 3ZLYA 5CY3A 3TKIA 1XBCA 3QQKA 3TM0A 3UZPA 4I0RA 4AN9A 4DA5A 4NM3A 3MVJA 1Z9XA 5IG1A 5HGIA 2OJ9A 4L67A 2FVDA 4JDKA 4MXAA 4KIOA 3QBNA 3NUYA 4FEVA 1AQ1A 3ORTA 5GIPE 2FSTX 4P5ZA 3P1AA 4AFEA 3ROYA 5E90A 5BVFA 3HX4A 2QQ7A 3QXOA 2R7IA 3KCKA 4FTQA 3D83A 4CSVA 5CX9A 3RINA 1FMKA 2F4JA 3OHTA 3S95A 2WQEA 2YISA 3ENHA 4IX3A 2YDIA 5JSMA 3CR0A 4AE6A 2OLCA 4ANOA 4JOAA 1MUOA 1H24A 2GNJA 3HV7A 3IQ7A 4AF3A 2QCSA 2BR1A 4AT5A 3QHWA 3A4OX 3PFQA 4BTFA 4DEEA 5LOHA 4FTNA 1E1VA 4I5CA 4NUSA 3ERKA 5IQAA 3R02A 2QOQA 4EHEA 2XRWA 3ORNA 2F7XE 3OEZA 2PMLX 5G6VA 1NY3A 5I9UA 2BROA 3QZHA 3U55A 4QMWA 5EHLA 4DCAA 2UZUE 4ITJA 1BUHA 5CI7A 4FIIA 4YR8A 3EN9A 5EM6A 4I41A 3SA0A 2R3GA 4I22A 4AZVA 2KULA 4G3EA 1GZOA 4QMQA 3I6UA 5F94A 3F3UA 1M7NA 5DT0A 4XG8A 4DH1A 4Y95A 5HKMA 3MV5A 1IA8A 4CMUA 3WF9A 2CKEA 3R73A 2YJSA 4I6QA 4NJ3A 2I6LA 2IVVA 2X8EA 4K6ZA 5HVKA 5KMKA 2Q83A 3NWWA 2YM3A 3PLSA 4HYHA 5E92A 3GOPA 5E8TA 4O84A 4GIIA 4MWHA 2O5KA 4ANLA 1WMKA 3E8EA 3EQBA 2ACXA 4FKJA 4FT3A 4TTHB 3ORIA 4RFMA 4F65A 3O50A 4F6UA 5A6NA 2ITNA 4JR7A 3AC2A 5AR7A 5JN2A 4PNIA 4EOKA 4P7EA 3BHTA 2CKOA 2ERZE 4NYEA 3A99A 5AM6A 2ETRA 4RFYA 3UIUA 4ANSA 5IH6A 1BMKA 3HV3A 3PIYA 4PDPA 3VO3A 1BYGA 4PWNA 1UWJA 5D10A 3RPVA 2GS2A 4CTCA 2I0EA 2EXCX 2QLUA 1OPJA 2VWWA 3T3UA 4ZJJA 3ZLXA 4HCVA 4F6WA 3AC1A 1I09A 3F88A 2X4ZA 2FH9A 3T9IA 1R0PA 3IW6A 5L2TA 4OAUC 3MPTA 2OF4A 4NCTA 3QWJA 3MTLA 5HE3A 2HENA 1Q8TA 2OZOA 4Y5QA 4C4EA 3OT3A 3CLYA 4MF0A 3RNYA 5IU2A 4QP8A 2NPQA 4RIYB 3RPRA 3FLNC 4O7YA 2FA2A 3II5A 5AR8A 4DC2A 1PYXA 3C0GA 4E6DA 5LMKC 4EH5A 1SVEA 4HNFA 1HOWA 4U81A 4XNEA 2C30A 2RF9A 3FQSA 5D11A 2UW6A 4UMRA 4EUTA 4IHPA 3PSDA 4ZAUA 4JS8A 4E6CA 3F61A 2W4JA 3QQUA 4XV9A 4LYNA 5H8GA 3VVHA 4CYJA 5KKRC 1J91A 3NLBA 2CNQA 1OL1A 2VTRA 4TNDA 2XNEA 2VWBA 1OMWA 4TNBA 4YJUA 4PV0A 4ZTRA 3D7TA 1QPDA 5HOAA 5J7BA 3ACJA 4N0SA 3HGKA 5DG5A 4BGQA 3OCTA 5TKDA 1NW1A 1BI8A 5M56A 2DYLA 3ORMA 3VN9A 4YU2A 2ZV9A 4FNWA 4TZRA 3B2WA 4RJ3A 4DAWA 2X7GA 3NW5A 4RC3A 2W9ZB 4Y85A 5AAFA 3ELJA 4RIWB 4BKZA 4HVHA 3Q4CA 4FSRA 3AXWA 3NNUA 4I0SA 1VR2A 2Q0BA 3L9LA 5AR4A 3TZMA 1S9IA 2XKFA 4L53A 5FEEA 1PXNA 3R28A 3QQGA 3OCBA 3OZ6A 4R7HA 3R8LA 3DFCB 3S4QA 3OFMA 3VHKA 3ZZEA 4XBRA 4ASEA 2XK7A 2B53A 1OITA 2YZAA 4D2WA 1YW2A 3KXHA 5DT3A 5AX9A 3SAYA 3FZPA 3EQCA 3KXZA 5K0XA 5ANGA 4OTIA 3ODYX 2ZDUA 1SMHA 2OJIA 5BMSA 4S32A 3TL8A 2GFCA 4LGDA 1ZOHA 3QTWA 5JGBA 5KMIA 2ETMA 4IB3A 4IVCA 4YPDA 5BUIA 2VWIA 3DTCA 2XKCA 3E63A 1UKHA 3GQLA 3TKUA 4RLKA 2ZB1A 3WF6A 1A9UA 2HW6A 4PL3A 1MRUA 2ZMCA 1WVXA 4OTRA 3NRMA 3OXZA 2IJMA 4J1RA 4QMTA 4GV1A 4AS0A 5BQ0A 4IFGA 2CNUA 3QUEA 5EW3A 4DT9A 2OI4X 3LJ0A 3HV6A 4ACMA 3ZDIA 5HVYA 3KULB 5HO7A 3R83A 2R9SA 4FKQA 1Z57A 2YIRA 3Q4TA 3UG1A 4FT7A 2B4SB 4MTAA 5FQDC 4GFMA 4BICA 1IAJA 4GW8A 4K0YA 1ZYDA 4PQNA 4G3CA 4HVSA 4LRMA 2NNWB 2ESMA 5AIRA 3D14A 2ITPA 5AV4A 4FSMA 3GU8A 1KE5A 4C4FA 1XH8A 2NRYA 2XBAA 1GOLA 3IW7A 3GP0A 2HXQA 3VUIA 4DFXE 3ODZX 5H3QA 4ORKA 2W06A 4XG9A 2YIQA 4D4SA 1OIRA 1W83A 4CQEA 1M52A 4EK3A 4TYHB 4BC6A 1PHKA 1OECA 5EDPA 3R7VA 3R9DA 4X6QC 3QYZA 4WHZA 5HBHA 3ZUVA 2WAJA 1BL6A 3S2PA 5FP5A 3NIZA 4P4CA 3WE8A 4CMTA 2W1ZA 4D4RA 4A4OA 3FPQA 3OF0A 2YABA 4FV4A 4PTEA 4J99A 2X7FA 1M2RA 4ZK5A 5J87A 4LL5A 4YJOA 3ZFYA 3AD6A 2UZLA 5FWKK 1JPAA 2JAMA 5KMJA 2CJMA 1J7UA 3P86A 3JS2A 4EBWA 1DAWA 4L3LA 5CZHA 4FV2A 2QOIA 5H8EA 3D9VA 3EN7A 3NX8A 5GHVA 3W18A 1Y6BA 4FEXA 3QCXA 5HEZA 3E3PA 4YURA 4JNWA 3O8PA 3FZSA 3D2KA 5LCKA 4QMSA 4UMUA 3AMBA 1XH4A 4ONAA 2W1CA 1XO2B 1LEWA 4DH3A 2YM4A 5IDPA 3OTUA 3TI1A 1XH7A 2B54A 3CP9A 4ZIMA 5IUHA 1YHVA 2X6DA 3DPKA 3KA0A 4WUAA 3SDJA 1DAYA 3RK5A 1W7HA 2V55A 3PJ3A 2J9MA 3KRRA 4FR4A 2ITYA 2VTAA 3EZVA 4IWOA 4OTHA 3C4WA 4MX9A 4KINA 2BCJA 2E9PA 2XYNA 4FV5A 4JG8A 4R8QA 3MDYA 3AC8A 3UJGA 5AA8A 5EOBA 4O82A 1IRKA 2OF2A 2J0IA 3NSZA 4ZXTA 2WTVA 2R0IA 2VX1A 4XRLA 2P2IA 1GZKA 4YNOA 4NW6A 4PRJA 4Q2AA 5HVJA 3HUCA 1YKRA 4FTAA 4IC7A 4CRSA 5EQYA 4J97A 3AMAA 5AUYA 4TW9A 4WBBB 1LUFA 3LFNA 3OUNB 5J1WA 5JEBA 3QQFA 4EH6A 3ETAA 3QC9A 5ANKA 2GHGA 3LFBA 4U3YA 2BFXA 4RPVA 4BCHA 2XA4A 3QXPA 4ERKA 3C13A 4PL4A 3DGKA 3EQHA 4JBOA 1JOWB 2V7AA 4R7IA 1BX6A 5KBQA 1V0PA 3BHVA 3MJ1A 1YQJA 4O91A 3E5AA 4U42A 1GY3A 1H00A 5HX6A 2WMRA 4MD7E 3TTJA 1DS5A 4ZSEA 5FLFA 1RW8A 4MXYA 5L2WA 4Z16A 3G15A 3BHUA 5F20A 5HLWA 5CU6A 4Y73A 2E9UA 5JFXA 2JKQA 3OG7A 4L46A 4EUUA 2UW3A 4PMPA 1XR1A 3Q9YA 3KGAA 4CMOA 3RAKA 3OC1A 1YWNA 1Q61A 4OBOA 3LVPA 2J5EA 3FC2A 4KAOA 4E6QA 4G9RA 1G3NA 2FGIA 4QOXA 4G16A 3H9FA 4S31A 3BLHA 3MIYA 3R1QA 4X2JA 3I4BA 3VUKA 2PZ5A 2J51A 3VAPA 4EK5A 5CENA 3POZA 1TKIA 3HRBA 4HYUA 3LMIA 4JI9A 2R3IA 4WOVA 4XCUA 4Y5HA 5C8NA 1UV5A 3PPZA 5M4IA 2P33A 5AUWA 2JDSA 3E8CA 2DS1A 3NMUF 1YDRE 4AA0A 3F2NA 1M2QA 4LG4A 2CN5A 2BFYA 3BCEA 2QI8A 3Q3BA 5KE0A 2O3PA 2QOFA 2YCFA 3KK8A 4FICA 5HLNA 3IGGA 3RK9A 1VYZA 2R3RA 2CCHA 3LW0A 5LARA 4RLLA 4BKJA 4X3FA 4E4MA 1GAGA 3F5GA 4PL5A 2W0JA 3BPRA 4HJOA 5FTOA 1Q97A 3UNZA 4FT0A 4D5HA 4CG9A 3DKOA 2HWOA 2PL0A 2WTWA 4WNPA 3QRTA 3HYHA 1PF8A 5A14A 2ZJWA 1OKYA 2J7TA 4BDGA 4LV8A 4U41A 4BTMA 4C37A 4QMNA 5IQEA 1LR4A 3PXYA 3AT3A 3LIJA 4C3RA 5IEXA 2OSCA 5HTIA 3IECA 4FL2A 2QKRA 2YIWA 1YOJA 2W1DA 4M0ZA 3RTPA 4BIBA 2Y9QA 2W7XA 4UWCA 2OBJA 4EQMA 3DT1A 1YOLA 4AA4A 1MRYA 4O6EA 3R71A 3EMGA 3TKHA 4WG4A 5JRQA 3Q60A 4YGAA 3S3IA 3LFCA 3C4EA 3HRFA 3CQUA 1APME 2X2MA 3BE9A 1XH6A 2C5NA 3MBLA 5L2QA 3Q9WA 1IA9A 2GS7A 3TJCA 2C0IA 5JH6A 3VC4A 4TWPA 1ND4A 5L6OA 3BI6A 4O7NA 4KIKB 2GDOA 2X6EA 4OT5A 5C1QB 2GHMA 2OFVA 3F5UA 3FXXA 2VRXA 3AMYA 2VGPA 4O27B 4AOJA 3FMHA 4E1ZA 2Y0AA 4PDYA 3GU7A 1GNGA 2E9VA 3MJ2A 3P7AA 2PMNX 2VWVA 4IADA 3RCJA 3QLFA 4D2SA 2E2BA 2W1FA 3FY2A 3TT0A 5IH4A 5GINE 4QMXA 4FKIA 5K0KA 4LOQA 4TT7A 3KC3A 4X2NA 5CEMA 1JAMA 3B8RA 1O6KA 4V04A 2UVYA 5H8BA 5E9EA 3NW6A 4DG0E 5IA3A 5E8UA 5CT7A 4ALVA 5CSWA 3AG9A 4N57A 4LGHA 3UNKA 2X2LA 5K9IA 3UMXA 2XCKA 4YNEA 2OK1A 3DB6A 5CEOA 4FKWA 3L9MA 2PHKA 2YLFA 2QVSE 5E4HA 5FBNC 3C51A 2P0CA 3IGOA 4CRLA 4GVJA 4FZ6A 3RVGA 2YA9A 3ZC5A 3ANQA 5E8XA 3A7IA 2WQOA 4LV5A 3WOWA 2B52A 2FSMX 3QUPA 5AP4A 4CKRA 4HW7A 3D15A 3EHAA 3WYXA 5M57A 3QGWA 1QCFA 2PE1A 5F4NA 4RFZA 2NRUA 3R8MA 4DTKA 1PRYA 5M53A 3VNTA 5JGAA 5KKRB 5GIOE 1U46A 4JIAA 5DLSA 4E6AA 1GIIA 4Z9LA 1XBBA 2H96A 4HYSA 4FVRA 3WARA 4W4YA 5L8LA 1PXMA 3FDNA 1H1RA 4M69B 3ZO1A 2E9OA 1WVYA 1FPUA 4FIFA 2G2HA 3DBFA 4IAZA 4MH7A 4FIHA 1QPJA 5AP7A 5IQFA 4YMJA 4KS7A 2C6MA 2XIZA 4F63A 3HRCA 4GRBA 4WNMA 3H4JA 4DG2E 3QQHA 5CVGA 2XJ0A 2XNPA 4QPMA 1G8AA 2WB8A 2XIXA 4F0GA 1HCLA 1SVGA 5BVWA 4DGLC 4F9AA 3IOPA 3HMNA 4J8NA 4FUXA 4A9TA 4BZOA 2VTHA 3LJ2A 3OCGA 3FQHA 3GFWA 4QTBA 2IW8A 2GQSA 4PDSA 2HZIA 4RGJA 3JXWA 3F82A 4O0XA 3LLAA 1H1WA 4XV3A 2H6DA 3FMJA 3MY5A 2ONLA 5A4TA 4IX5A 3AD5A 3V51A 3O71A 5M06A 4FIEA 4KA3A 2V0DA 3UC3A 4L52A 2DQ7X 2ITXA 4G6OA 3PVUA 4IZ5A 3AGLA 3EZRA 3IDBA 4PPCA 4RX7A 3R9HA 3U9NA 2Y7JA 5B7VA 4QMOA 1WBPA 3P08A 2RIOA 2PWLA 4MNEB 5DWRA 1S9JA 5LVNA 3DKCA 4LUDA 5AV0A 3UOJA 4ACGA 1W84A 4RVTA 3UOLA 2JFLA 4P5QA 2J90A 2BDJA 4F9BA 4W9XA 2G2IA 2XK8A 5EYDA 5BYZA 4A9SA 2A19B 4HVDA 4CTBA 3KQ7A 1IAHA 2R3NA 4MBJA 2JD5A 3K3IA 4FK3A 4D0XA 2PUPA 4UY9A 4OTWA 3EQPA 4V0GB 4E3CA 5KX8A 5I9WA 2B9FA 4FSUA 5BVNA 2R0UA 4QMVA 3L9NA 2HAKA 4AGCA 5EI6A 1ZMUA 4DTBA 2UZOA 5ANJA 4FYNA 3MVHA 4JQEA 2BRNA 3DLZA 4G3DA 3D4QA 2UVXA 3OEFX 4XEYA 1OKWA 4O7SA 2C3LA 1PXOA 3TJDA 4M12A 3VIDA 3OY3A 2JDTA 5J9ZA 2G1TA 2QONA 1CM8A 3O8UA 2W5HA 2XF0A 3Q52A 4JVGA 4FKPA 2QKWB 4J71A 4ARKA 4AN3A 4EKKA 1ZYLA 4BCFA 2J4ZA 4F1MA 4ZTQA 3WIGA 2J2IB 5AP5A 3EKKA 5LVLA 5J79A 3MI9A 4IQ6A 3WBLA 4RWJA 4FTIA 4OTFA 5LJJA 4MXZA 3UPZA 1VYWA 3F5XA 4CKJA 1WCCA 4MVFA 3F2RA 4NZWB 3HP2A 4U5JA 5ETCA 5BYYA 4I4EA 3I6WA 3FAAA 4CCBA 3CS9A 4BCOA 5CAUA 1KV2A 5CAVA 3VBVA 4FSWA 4JBPA 2XP2A 3A8WA 3M11A 4WO5A 5C03A 3RKBA 4EOJA 3MFRA 1YOMA 2WKMA 4TL0A 4KKGA 1J7IA 4ZJVA 4FTLA 3VJNA 3MGYA 5CAPA 2NP8A 4DEHA 2HY0A 1ZOGA 4I5HA 2I7QA 1OZ1A 5IQCA 3DLSA 4D1XA 3GCVA 3Q96A 1WAKA 1FGIA 1P4FA 3CTJA 5CTPA 3BWJA 2GFSA 1OIUA 3SVVA 2HCKA 2Z60A 4YSJA 2QOHA 5HLPA 4GUEA 4YJTA 5HTBA 3R7UA 3FL5A 2HIWA 4BTJA 3ZLSA 3GT8A 2P55A 3IDPA 4BCGA 4FEUA 1PW2A 5CU4A 4L45A 3PLAE 4A06A 4FSTA 5E8SA 3UIXA 4V05A 5F9EA 2YAKA 3UPXA 1ERKA 4CZTA 2CGVA 4I93A 5B0XA 5AP1A 3NYOA 5CEQA 4ZSAA 2PYWA 5AADA 1YI6A 3TEIA 4QTCA 4BCPA 3PXZA 2ERKA 1ZYSA 5CASA 3EKNA 2WMTA 1FINA 3QCQA 3K54A 4FKLA 3WZJA 2BVAA 2W05A 4EH9A 4C8BA 1V0BA 3GCQA 4RJ4A 4FZAB 4X21A 4FI1A 3B8QA 3N4UA 2IW9A 4E26A 5ETAA 3FXZA 3C4CA 5EDRA 1KOBA 3K3JA 1L3RE 2ZV8A 5FEDA 2V5QA 4DLJA 5IUGA 5AR5A 4YTFA 3TTIA 5A3XA 4TYJA 3RCDA 4A9RA 3FMEA 2Q0NA 2UZNA 5J9LA 3VS4A 3ZSHA 4OR5A 2JBOA 2X2KA 3R1SA 2BPMA 3BEAA 3DNDA 1YWVA 3ZMMA 3QQJA 4FV0A 4PP7A 4RJ6A 3BYSA 4FEWA 1M7QA 1NVQA 1Q3WA 2WU6A 4FTKA 4HPUE 2QHMA 2Y4IC 4U79A 4EEVA 4L8MA 2BAJA 3AGMA 3CD3A 3U4WA 3ID6C 4XYFA 2YLEA 2J0MB 4YPSA 5HD7A 2PZRA 3KRLA 3EFKA 1OM1A 3A60A 2VTJA 3BRBA 2OJFE 3DAKA 3E62A 5FRIA 3AC4A 3PIXA 2I1MA 4NK9A 3FLSA 4U3ZA 3NAXA 3ZC6A 4EK4A 5HBEA 4I92A 1WBTA 2EVAA 2O2UA 1SZMA 1XBAA 2GMXA 5ACKA 2IVTA 4MXOA 5E8VA 4I4FA 5L3AA 5HX8A 3O96A 3JPVA 3NCZA 4KKEA 4RVLA 4IJPA 5DH3A 4F4PA 4EOMA 3EL8A 5EHOA 3RHKA 3R63A 5ANOA 4GYIA 2W5BA 4XH6A 4ZY4A 3DKGA 4IVDA 5C8KA 1Q41A 2XK9A 2YEXA 4JBVA 4RQVA 5JKGA 3BWFA 4FG9A 5TF9A 4CLIA 5DEYA 4B0GA 1W82A 3PTGA 3QZIA 4F7LA 3VW6A 3DK3A 4IM3A 5AP2A 3LMGA 4Q9SA 1H08A 1Y6AA 1YXUA 3KXGA 3HMOA 5B2KA 4D58A 3MPMA 5A4LA 1P5EA 1YXSA 4YC8A 5M07A 3IW8A 4W4WA 3W32A 4ZSGA 4F9WA 3R2YA 5BVEA 4QP1A 5C9CA 5T6KA 4KKHA 3BYVA 1X8BA 3MH3A 2X0GA 4JG6A 4RIXA 3A4PA 2PE2A 3QD4A 4NH1A 4OT6A 1VZOA 5J95A 2R4BA 2YCSA 2GQGA 4MEDA 4WRSA 4HCTA 5KZ0A 4BZDA 4CFWA 1KOAA 2C6IA 2W4OA 2OIQA 5A4CA 2VN9A 3E87A 3PXRA 4MHAA 4KBKA 3LCSA 3PWYA 1MRVA 4A07A 3KRJA 3S00A 1NT2A 2JEDA 4IANA 5CI6A 1UVRA 4NTSA 2JAVA 4PPBA 3BHHA 3E8NA 2OIDA 3ZH8A 3E7VA 2P4IA 3E93A 3FMMA 4AWIA 2OJGA 4F09A 3PA5A 2XBJA 1ZOEA 4LOOA 4F7NA 3MPAA 2BTSA 2OZAB 1U59A 3HMPA 2FSOX 3W2OA 1IR3A 1Q8UA 2WOTA 3ITZA 4W9WA 3ZS5A 4DFYA 3QA0A 3R7IA 4ALUA 5JT2A 4RVKA 4JT3A 3UQFA 1MQ4A 1FGKA 2WTCA 2Y4PA 4HGEA 1F3MC 3FHIA 4FT9A 4M84A 3IW4A 3TNWA 2RG6A 4P2KA 1UNHA 2YITA 4CT1A 3PE1A 5J5SA 4QT1A 4BHNA 4S2ZA 4YUQA 3A7JA 4FE2A 4FTJA 3ZYAA 4AOTA 3KF4A 5A46A 3ZZWA 1OL2A 1WBSA 5CU3A 2XKEA 3W10A 1OUKA 3FWQA 4H39A 3UDBA 5KBRA 4QP7A 2HYYA 3MY1A 3I5NA 2W96B 4IH8A 5ETFA 4BCKA 1GIHA 4C62A 3ORPA 4G34A 4NCTC 4BBFA 3LCOA 3PJ8A 2C3JA 2JIVA 5E7RA 3OOGA 2C5OA 2OICA 5HO8A 1Q5KA 5IEYA 3V5WA 3LQ8A 2QOOA 3RPOA 3FUPA 3OXTA 2IVSA 3U9CA 4E4NA 4RWIA 3SG9A 4R6VA 2OGVA 2WEIA 5E1EA 4QTAA 5T3QA 4XP2A 3PY3A 3F5PA 3ZHPC 2FB8A 3KMMA 2WMAA 2W1EA 4Y46A 3R8UA 2BKKA 3KF7A 3TWJA 4O81A 4EOSA 2C6EA 4EZ3A 2JIUA 3NNXA 2R3OA 4A4LA 1KUTA 3DK6A 2WQBA 4C02A 4DFUA 2F57A 4WUNA 4TPTA 2ZV7A 4JXFA 3UZRA 4ZTNA 2Y6OA 4M7IA 1KE6A 2P2HA 3WZDA 3UYSA 3UE4A 5EM5A
chains in the Genus database with same CATH superfamily
3HLLA 2IO6A 4N70A 4DINA 4GT3A 4BGGA 2WMQA 5K5XA 3COIA 4CNHA 4JQ7A 3NFGB 1Q24A 4FNXA 3QGYA 4EHZA 2JDVA 5F95A 2BTRA 3QA8A 5LQFA 3R21A 3R04A 3I79A 4L00A 4X2FA 1P14A 5IA0A 1XQZA 1FVTA 2PVHA 1A48A 5EM8A 4DF3A 5BUEA 3NVMB 2PVKA 2OIBA 3I60A 1DI8A 1WBVA 2PUUA 3VUDA 3BLRA 1CKJA 3MH0A 5DT4A 1PXLA 4L3JA 4JX3A 3LLTA 3UIBA 3VQUA 3PRFA 4PTGA 5CYIA 3SLSA 4HVIA 3PJCA 4CLJA 5FTQA 4BTKA 3U8WA 4MD9E 4B8MA 3W2SA 2B9HA 4R7BA 4GU6A 4EONA 3CBLA 3UYTA 3P4KA 4EKLA 4FKVA 4R3CA 2J50A 3CPBA 3LFQA 4IWQA 4E20A 2QR7A 2G2FA 4FEQA 4QYFA 3PRIA 5JFVA 3K2LA 3D0EA 3KB7A 3R0TA 3GC8A 4YLKA 3VRZA 3V5TA 4C61A 5GZAA 1ZYCA 5LWMA 3BU3A 1W98A 4KSPA 2PZPA 1TQIA 4U80A 4AE9A 4FKRA 4YJVA 4WBOA 4U7ZA 1B39A 4GVAA 2BRMA 3HKOA 3R7YA 1NVSA 3ZOSA 3H3CA 4FTUA 1SNUA 5EI8A 5JFWA 2C0OA 2NO3A 2VGOA 1PYEA 4PF4A 4XP3A 3QRUA 4FA2A 3BYUA 3IDCA 4X0MA 4RZWA 3HDNA 5KO1A 3GCPA 4XHKB 1EH4A 3ZRMA 4D1ZA 4L43A 3KREA 3LQ3A 5IMXA 4CFFA 3BQCA 3NYXA 4UMPA 5CVHA 2CKQA 2WOUA 3OVVA 3OBGA 4YC6A 5AMNA 2UUEA 2PE0A 3L8VA 3HA6A 5EK7A 2AC5A 4NIFA 3EQGA 3QRKA 2IPXA 3DS6A 1OL7A 5GZ9A 3QCSA 4ENYA 3D5XA 4MD8E 2BHHA 3SQQA 3V8TA 3VS6A 1UNGA 3QZGA 5HI2A 2GSFA 2R7BA 2XEYA 3CPCA 2R3HA 3C1XA 5AUVA 5AM7A 3F69A 5I3RA 2ZM1A 2VD5A 3KMUA 4G5JA 4DE4A 1YRPA 4Z55A 3LXKA 2KTYA 4YTCA 3T3VA 1FBNA 2J5FA 3MB6A 4GU9A 2X39A 1OL6A 3ROCA 3CSVA 4UYNA 4Q5EA 4QDEA 2IVUA 3H10A 3TNHA 4X2KA 4KIPA 3PY0A 4GT5A 5HG5A 3ZFXA 3R22A 3R01A 4H36A 4B7TA 4FGRA 4KB8A 3U6JA 2BZIB 2JDRA 1OL5A 2R3JA 3DDPA 3GBZA 3RAIA 4AX8A 4IAYA 4CGAA 5E8WA 2REIA 4D0WA 3FC1X 1M2PA 3GB2A 3O7LD 2JKOA 3ZFMA 3A61A 2Y6MA 3W0PA 3DNEA 4D2VA 3UODA 4YBJA 5I9ZA 4RWKA 3ZUTA 2OG8A 1SVHA 3GCUA 4IM0A 4AFJA 5M51A 2B55A 5FXRA 4RBLA 4C4GA 3KFAA 3DB8A 4FKGA 3R7GA 1H1PA 1P4OA 5K5NA 4XG6A 3FBVA 5CANA 3A62A 4EOPA 1GJOA 1PKGA 2WHBA 3QU0A 4Y83A 3BKBA 3BV2A 3COMA 2W4KA 1OIYA 3L8XA 4CEGA 2XCHA 2EUFB 4AW0A 4EOIA 5CEKA 4WSQA 5TO8A 5EKNA 4NSTA 2YACA 4LUEA 4R5YA 2V7OA 1FQ1B 3F3WA 1CSNA 4JX7A 4ZTMA 4LI5A 3VS3A 4C36A 3P5JC 4EI4A 4ZZMA 5JMSA 1H1SA 4RSSA 4GH2A 4J95A 1JKKA 3FHRA 3R1YA 3ZM9A 2DWBA 2HWPA 4AU8A 3K5VA 2R5TA 2VWZA 4FZ7A 4LFIA 4W8EA 3OXIA 5EYKA 4DH8A 3QKMA 1PMUA 3VUGA 5CSXA 4BCNA 4BN1A 1W2DA 3QF9A 4AXEA 4FJVA 2C3IB 3K5UA 5KCVA 4IDVA 2WQMA 2A2AA 4EQUA 4RX5A 3D5UA 3NW7A 3LXPA 3OWJA 4D4VA 1JVPP 2Y4IB 3GU5A 4DDGA 3AC3A 1KE7A 4K9YA 2C5XA 2UW8A 4X3JA 3QKKA 1RDQE 5D41A 1R0EA 1GIJA 3I0QA 4LV7A 4ZJIA 4NL0A 4KSQA 3TMOA 3Q9ZA 1NA7A 3KRXA 4RJ8A 4DGNA 3ZO3A 3P79A 4D9TA 2VTPA 3PJ1A 3GCSA 3DQXA 4EOQA 3SRVB 2X1NA 4U6RA 4KRDA 3R2BA 4L42A 3SW4A 4E73A 3DXPA 2PSQA 3BIZA 5HQ0A 3FEGA 3CY3A 5C26A 1VEBA 1R39A 4M14A 3DQWA 4ZSJA 4IW0A 2IW6A 4BDCA 5DIAA 4BIDA 4CV9A 4KRCA 5FDXA 4RA5A 4FV6A 1JNKA 1Q99A 1JSVA 1YHWA 2W9FB 2E9NA 3OW4A 4HCUA 2CLXA 3N9XA 4I6HA 4IDTA 3WZEA 3CC6A 3QALE 2A27A 5DPVA 4IX6A 1OKVA 3QYWA 2R3QA 4QYGA 5DGZA 4O21A 4U45A 4F78A 2Z8CA 3VHEA 1OBDA 3JVSA 2UZVA 3NIEA 5CSVA 1IEPA 2XB7A 2WIPA 2X9EA 4JDHA 1ZRZA 3FKOA 3L8SA 3W2PA 5CEPA 4O7ZA 4O38A 5ICPA 3GXLA 1XWSA 5IA1A 2LGCA 4FYOA 1FOTA 4N6YA 4X6RA 2RL5A 3PPKA 4AZEA 3U6IA 4EORA 3HECA 2C5YA 4UWYA 3LXNA 4X3FC 5KMMA 4O83A 3AOXA 3V04A 4AZWA 4ZTSA 4EHGA 4BDBA 1IG1A 3Q6WA 4BDFA 4HOKA 4KABA 5EQPA 3G5DA 3GU4A 4C58A 2JLDA 5CT0A 2GHLA 4C4JA 4AZSA 4YHTA 2WELA 4W8DA 4ALWA 4I20A 4PPAA 1ST0A 4KUJA 4EHVA 3DBEA 2WNTA 3ENMA 3PG1A 4ANQA 2ZVAA 5CF6A 2R3PA 5DHJA 5M44A 5CSHA 5TT7A 5IQBA 3ZUUA 5CLPA 3D2IA 3QUDA 4HGLA 3E64A 5HIDA 4IBMA 3D94A 3B2TA 4CD0A 2CMWA 2FSLX 3SOCA 3SHEA 5BUJA 1YDSE 3U51A 1PMEA 5E8ZA 4ZTHA 1OKZA 3CKXA 4QYEA 3HAVA 4QTEA 4QMMA 1OUYA 3ZBFA 4AA5A 2B0QA 5FUTA 3DCVA 4RJ5A 3C0IA 4L68A 4RIYA 3U54A 4FNZA 4QMPA 4ANMA 5AX3A 4WT6A 4UMTA 3N51A 4BJJA 4L01A 4XX9A 3BGPA 3HVCA 4WIHA 3JVRA 3ET7A 2A98A 4XG4A 5EM7A 5J5TA 3TUCA 4FTCA 2C1BA 3NR9A 4XJ0A 3AQVA 5JZNA 3VS1A 4M68A 1OPLA 3MH2A 1WFCA 3O2MA 2R3FA 4HZRA 4PP9A 4K2RA 5FEQA 4CCUA 5HO6A 4ITHA 1RQQA 2CGUA 3FJQE 3M2WA 1OVEA 4B99A 4CFNA 4S34A 4EYMA 1XH5A 4LRJA 4O96A 1RE8A 4USEA 3F66A 1H25A 3UOKA 5J7HA 3TNIA 2ITWA 5CF5A 4TYGA 3ORKA 3C9WA 2YIXA 3G33A 4FSYA 2CDZA 3R7OA 2YDKA 2P3GX 4EK6A 2YERA 4CFUA 3FZOA 3RWQA 4J96A 4FTTA 3SOAA 1YHSA 3PIZA 4YHJA 2C3KA 3NGAA 3F6XA 3MVLA 4O1PA 3BQRA 5M4UA 3NAYA 4C3PA 2PY3A 3FE3A 3W1FA 2WQNA 3PYYA 2UW9A 3LCKA 4ZP5A 2WTDA 1BLXA 5EOLA 4C34A 2GU8A 1R78A 5L2IA 3PSCA 3O5AA 4M67A 2RGPA 4QTDA 3HNGA 5AAEA 2JGZA 2C47A 3GC7A 1J1CA 4WG5A 4MF1A 4QMYA 2VO0A 1ZLTA 4M15A 2X0PA 3C50A 3HMMA 4BDKA 1KE9A 2BZKB 3R30A 4FZFB 2VTQA 4FL1A 1ZWSA 3I5ZA 2BALA 5E91A 3TN8A 3D7TB 2VO7A 3DY7A 3BEGA 4XOZA 3GOKA 5HG9A 3TIZA 3GVUA 3O8TA 3KU2A 3HA8A 3MB7A 1V1KA 4YZDA 3RAHA 2XYUA 1YXVA 4QMZA 4HNIA 5LVMA 4B9DA 5EFQA 1H07A 4JIKA 4O1OA 4YHFA 3O23A 4KBCA 4DH7A 3PA3A 3NUNA 5I4NA 4OAVB 3AKKA 4DHJA 5KHWA 3DKFA 3EB0A 4O0SA 3VUTA 5L4QA 1SYKA 2HXLA 2HZ4A 3LHJA 3EN4A 4S33A 1DI9A 2PZIA 3V8SA 3ATTA 4JMQA 4C57A 4LQMA 3QZFA 4ZZOA 2WTKC 3R9NA 4BYJA 1QL6A 1OPKA 1CKPA 4RJ7A 5C01A 4I23A 3F3VA 3IPHA 4DEBA 3LE6A 3MA3A 4RA4A 3KULA 2WMVA 3A7FA 4XV1A 5AWMA 1H0WA 2CGWA 4FBXA 5E1SA 2GNHA 1FVRA 1H28A 2IF8A 3WF7A 5HORA 2ONLC 4A4XA 4RZVA 1UKIA 5I9XA 3Q2MA 5IPJA 2R3LA 3WI6A 4FV3A 5J9YA 4BDEA 4II5A 3IO7A 4YJRA 5DA3A 4BDIA 4X7QA 4RX9A 1G5SA 5BVDA 2YJRA 3F3ZA 4Y72A 4GCJA 3ZDUA 2YN8A 3H9OA 5CNNA 5EKOA 3CEKA 1ZMWA 3TNQB 3ZCLA 5A4QA 3R00A 4ZS0A 4GKIA 4D2TA 3FSFA 2IZRA 4CT2A 3MW1A 4BWXA 2XK4A 2BAKA 3NUPA 5CS6A 4FKTA 2XZSA 5TE0A 5IQIA 4HZSA 5TR6A 2AUHA 3EL7A 3F9NA 4ZLZA 4BCMA 4TYHA 5LCJA 4O7WA 5L6WL 2VTTA 3CJGA 5FM3A 4EOOA 4I0TA 4CYIA 4JJRA 3RNIA 5I9VA 1JKTA 4RVMA 4GJ3A 1LPUA 2WEVA 4FV9A 4BL1A 4D55A 2PTKA 1R1WA 2ZDTA 4ANBA 4YTHA 3W0SA 3UGCA 3GI3A 3DV3A 3O17A 4JBQA 5FDPA 2OJJA 2YM5A 3MA6A 2YCQA 4YO6A 1T46A 2QOKA 5ANIA 2C6TA 4FKOA 1KWPA 4DFNA 4ENXA 5HIEA 5CXZA 2IWIA 2W17A 4MQ1A 3BU6A 3P0MA 4JRNA 4JLCA 5DR6A 1HCKA 5JGDA 4BY9E 4QNAA 4YZMA 5EI2A 3FMNA 1U54A 3W2CA 4ACCA 1ZZLA 4GT4A 4PMSA 3WIKA 5A6OA 2OKRA 2C4GA 3DJ6A 1WZYA 1P2AA 5HNBA 5AR3A 2XK6A 3PZHA 1OBGA 2OW3A 4L44A 4IVAA 2WZJA 3QX4A 4QQJA 4ASZA 4BZNA 5KNJA 2PVYA 5EYMA 4O6LA 2LAVA 4ZMEA 4UYAA 3I1AA 2YM8A 3Q5IA 1XMLA 5TOZA 2XRUA 3VBWA 2WMUA 1FVVA 3QD0A 5GJFA 5L6PA 4EWHA 2ZMDA 1ZYJA 2BILB 3I81A 2OXDA 4UBAA 5JQ5A 3FXWA 1CDKA 2W99B 3EQDA 5LVOA 2UZTA 2VTLA 3COHA 5JZJA 5CXHA 3S1HA 5D7AA 5DNRA 4O4BB 3WZUA 4YBKA 2H9VA 3BLAA 3HZTA 2C5VA 3RALA 3TUBA 4Z3VA 3Q4ZA 3TDWA 4LOPA 2CSNA 1Q8YA 2WD1A 4R5SA 4PX6A 4XUFA 5HNGA 4F0IA 2X8DA 2RFSA 3OS3A 3WF5A 4DT8A 5KMOA 4NW5A 4UZHA 3AT2A 5DI1A 2WO6A 4BVUA 2C6LA 4C2WA 3DBCA 4J52A 3HAMA 3O0GA 4RX8A 5G1XA 3DU8A 3REPA 2Y8OA 2VUWA 1URCA 5C4KA 1Q8ZA 4FTOA 1OGYA 3FYJX 2O64A 2VTNA 4QQCA 3UTOA 4FL3A 3ZRLA 1CMKE 5H9BA 2XM9A 4APPA 3V6RA 2ITZA 3VUMA 4H3PA 4I5PA 4GG5A 4ANNA 2WMSA 4O2ZA 3BYOA 5EW8A 3BBTB 4QP3A 4USDA 3PZEA 3GEQA 1CTPE 5D12A 3RHXA 3VULA 5K4IA 3DJ7A 2WMWA 1W0XC 2Z7SA 3NUXA 5M55A 4J53A 4ZY6A 1OB3A 5ANEA 1PXIA 3UMWA 5KMLA 5CZIA 2GPHA 2QO9A 4UALA 3Q32A 4QP6A 4AXAA 4FC0A 1ZARA 3OUKA 4IAAA 4RQKA 3IOKA 4FUYA 4DEGA 1VLRA 1UWHA 2Z2WA 4IZ7A 1JSUA 4KNBA 3TG1A 2YHVA 3G90X 3POOA 2C6DA 2O0UA 3RI1A 4YTIA 4ASXA 5IEVA 2XIRA 3CTQA 3MVMA 4YLLA 3P78A 5L8KA 1URWA 1U5RA 3MH1A 2C6KA 3H0ZA 4FVPA 4FMQA 3UVRA 4GL9A 3EN5A 4YJPA 4GMYA 3W0RA 3KRWA 5DR9A 3RAWA 1J7LA 4AP7A 4A9UA 1ST4A 4GK4A 1G8JA 2IZSA 3UBDA 5EDQA 2HK5A 2CPKE 2F49A 3UO4A 3MWUA 5HCXA 2ZYBA 3D5VA 3MSSA 2CGXA 4JDJA 5EH0A 5IISA 2YZLA 5ITAA 5JRSA 1H26A 4XLIA 4BB4A 5IA5A 1BI7A 3FPMA 3C7QA 4Z7GA 5BX0A 3UO5A 5DFPA 2RKUA 3VBXA 3PVGA 3Q6UA 4JAIA 4TYIA 3PJ2A 5D7VA 2UZDA 2WMXA 3VBYA 2X4FA 2PVRA 3GNIB 3DAJA 3F7ZA 4IX4A 4WG3A 4F08A 2R3KA 2VWXA 4TRLA 1UA2A 2XIKA 3CXWA 2EB2A 3KVWA 4GIHA 3ZBXA 4BRXA 4G31A 4DFZE 5KMNA 4WRGA 3SV0A 2XNMA 4O0VA 4U44A 1REJA 3JY9A 4RMZA 5CQWA 5FBOA 3I7CA 2QU6A 4EH4A 2JKMA 1H0VA 2OFUA 5C27A 5IKWA 4EOLA 4F7JA 5M4CA 3NYVA 3W0MA 3JR1A 1PXPA 3UOHA 2UZBA 3HV4A 2H8HA 4IIRA 2BHEA 3CIKA 4ZS4A 2OWBA 4OTPA 5K4JA 4AT3A 3U6HA 2GTMA 4O7RA 5HU9A 2ITQA 4MNFA 4EC8A 5BVOA 4X3FB 3CCNA 4H3BA 3FI8A 5HZNA 3QKLA 4FSQA 4Q9ZA 2F2CB 1PY5A 2R64A 3FLWA 2QC6A 4H1MA 3RPYA 2PPQA 3Q4UA 3TIYA 3ZO2A 4R1VA 3ZXZA 4KIKA 4BKYA 4NM7A 3VBQA 3Q53A 4E7WA 4FG8A 5EYCA 1A06A 4UMQA 5CQUA 5AP3A 4M97A 4IAFA 3Q2JA 2G9XA 3OP5A 4XRJA 4BDDA 2WGJA 3QAME 4NU1A 3AD4A 3QRIA 3RP9A 2VTIA 1MP8A 1WVWA 2XEZA 4MYGA 2QOLA 3UVPA 5A4EA 4HGTA 4KIQA 5AUTA 3QC4A 4NFMA 2R3MA 4DFBA 3BGZA 3IW5A 1R3CA 3KVXA 2OU7A 3NUUA 3ZSGA 3OW3A 2BMCA 3EIDA 3T8OA 4RWLA 4FK6A 3BX5A 1SNXA 3LPBA 2G15A 5GZ8A 1Y8GA 2WIHA 2HOGA 4E93A 3PY1A 3OWPA 2VWUA 1STCE 5B2LA 1H01A 4K11A 3VUHA 5B2MA 3N4TA 4IWDA 4QYHA 1JWHA 4QPAA 5HBJA 3MESA 1K2PA 1ZXEA 3NUSA 4CKIA 3PVWA 2VV9A 4OLIA 3ULIA 3HUBA 3CJFA 4FX3A 1ZY5A 4D2PA 3GU6A 5LMKA 2PK9A 3VW8A 3QD3A 4DTAA 4IC8A 4XP0A 3UIMA 4BCQA 3CTHA 4EYJA 2XK3A 4AN2A 2I0VA 3BHYA 3NCGA 4E4LA 4GK3A 1MQBA 1B6CB 2XNGA 3OD6X 3KMWA 4YZNA 3W8LA 3SG8A 5IQHA 2YFXA 5HG8A 1QPCA 2F9GA 3C5UA 3EOCA 5GJGA 3TZ9A 3UVQA 4UV0A 3ZM4A 3FY0A 1JKLA 3V01A 4M69A 4BJJB 2EU9A 2I40A 2UZEA 1ZY4A 2VX3A 2YWPA 3ORXA 4IVBA 5E8YA 5T68A 3R8VA 3V5JA 4C33A 4F99A 2B1PA 4N6ZA 4QP9A 3UNJA 2WMBA 3M42A 3OROA 4H58A 2VAGA 4QD6A 3WILA 4PNKA 4YZBA 2QR8A 4ZLOA 3UP7A 4YJNA 2PULA 3FLZA 2BDFA 3PA4A 3DFAA 4W4VA 4DHFA 4JR3A 2HZ0A 4JAJA 4D2RA 3ZTXA 4F70A 3UQGA 3TV6A 4ZTLA 4Z7HA 2ZB0A 5J1VA 2IN6A 2PUIA 4UEUA 3G0FA 4QPSA 4ZMFA 2C68A 3TV7A 2BKZA 4EH3A 4F9CA 3LM0A 4XS2A 2AQXA 5CALA 2VZ6A 3PVBA 3NNVA 4AG8A 3Q04A 4U97A 4ASDA 4JL9A 2XJ1A 4ACHA 2ZM3A 1UU7A 2PZYA 5HG7A 1L8TA 5IQDA 5HCZA 2IZUA 2IG7A 1J1BA 4RC4A 1IASA 2VX0A 4FTMA 5DRDA 4AW1A 3ANRA 4FVQA 4R1YA 4I3ZA 4MNEA 4DLIA 1WBOA 4DGGA 3V5QA 4DYMA 3CQEA 2WPAA 4IAIA 5EHYA 2XMYA 2XJ2A 2WTKB 4I94A 4KD1A 2ITTA 4K8AA 4DG3E 2XALA 2VTSA 3S0OA 4IZAA 2H34A 3TACA 4D1SA 3SX9A 4V0GA 1JSTA 4UB7A 3DZQA 2X9FA 4FZDB 4YZ9A 3BV3A 4NFNA 3HV5A 3EFLA 2B9JA 3AT4A 4JDIA 5AUZA 3MN3A 3QQLA 1TVOA 4TWCA 4FV7A 3VWAA 5JFSA 3LXLA 4I21A 1M14A 4I6BA 3BZ3A 5JK3A 4C0TA 3GGFA 2YAAA 3G9NA 3R7EA 3F3TA 4BYIA 5CEIA 4IFCA 4EL9A 5IDNA 4O0YA 4DBNA 2UW7A 4IJ9A 1Q3DA 2RG5A 3DAEA 3KN6A 2C6OA 2OXXA 2VNYA 2ETKA 4O4DA 3RBWA 5AUXA 3JUHA 4WKQA 4AZTA 4CV8A 4G6NA 3A2CA 5AP6A 4QMLA 3RMFA 3BELA 2W5AA 4NEUA 4PUZA 4R3PA 5I5ZA 2SRCA 1H1QA 3OWLA 4S30A 3LMHA 2V62A 2JBPA 4AT4A 2GS6A 4IB0A 2XIYA 3RK7A 4FIJA 3ZO4A 3LAUA 1KSWA 3DOGA 3RZBA 2CNVA 2GNLA 5HNIX 4H1JA 4FKUA 3RGFA 4UXLA 3CKWA 4KS8A 3LFAA 3P9JA 3DXQA 2RFEA 3KEXA 3RPSA 4ZZNA 4FSZA 5AUUA 1H4LA 1XKKA 2ZV2A 4WSYA 3VS7A 2CN8A 2VU3A 2QD9A 3EN6A 3V8WA 4L6QA 1PKDA 2IZTA 3W16A 4L9IA 4HVGA 3W2QA 4GKHA 4FSNA 4C4HA 4CQGA 3MFTA 4TWNA 3BLQA 1F0QA 3QFVA 4BF2A 1RJBA 3DBDA 4XG7A 2BZHB 3QHRA 4JQ8A 4G3FA 5AJQA 5IMEA 2C1AA 1PMNA 4WNKA 3TZ8A 4ZLYA 3QCYA 3SKCA 2BAQA 3LQ5A 5AV1A 4B6LA 4ACDA 2BRHA 4AQCA 3LFFA 1U54B 3W0QA 1YI3A 4QP4A 1U5QA 4IEBA 4NJDA 4YJQA 4EH8A 5M4FA 4USFA 3BYMA 5DRBA 5BMMA 1W8CA 1V0OA 4NKAA 2VNWA 4F64A 3DDQA 3DXNA 3CY2A 4WD5A 1QMZA 5ANDA 3UO6A 4F6SA 2QHNA 4H05A 3LCTA 5DEWA 2ITVA 5LMBA 3L9PA 4RRVA 4FT5A 3NUAA 1TQMA 2FYSA 2GTNA 1GZNA 4XV2A 3EFJA 5HTCA 5LWNA 4NT4A 5FTGA 4P90A 4R77A 5GNKA 2BRGA 4FKSA 4QNYA 1H8FA 3SC1A 3ZLWA 2QU5A 3FZRA 5D1JA 4BGHA 4BI1A 3CD8A 5I9YA 4C7TA 2JKKA 2EWAA 4GSBA 4JRVA 5FM2A 5HE2A 3BBWA 2QURA 4OTGA 4QMUA 5H2UA 3FMKA 5FG8A 5AV3A 4IE9A 5I3OA 3V5PA 3MFUA 2HW7A 3LKMA 4NKSA 4XG2A 4I5MA 5CAQA 3I0OA 4MXCA 1O6LA 4NM0A 1KV1A 1J3HA 4QO9A 3ZXTA 3BE2A 3FYKX 2X8IA 1ZZ2A 4OUCA 1BKXA 3R6XA 5IZFA 1YI4A 3FKLA 3VQHA 4OW8A 4GK2A 4AW2A 2J0JA 5DR2A 4IXPA 3V3VA 4AGDA 3ZONA 3QWKA 3MIAA 4O7LA 5CSPA 1ZAOA 3OWKA 4HYIA 4AUAA 5L2SA 4EC9A 3WE4A 1F5QA 3EFWA 4BDJA 5KHXA 2X7OA 4BCIA 5D9HA 2PVFA 3VF9A 4AGWA 2PVMA 4J8MA 3FI3A 4AAAA 5HHWA 4MQ2A 2A4LA 4PMTA 5I0BA 2VWYA 3PP1A 4TN6A 2AYPA 5CU2A 3R8PA 3CE3A 4MBLA 3PWDA 5DE2A 2O8YA 4L3PA 4B4LA 4LDTA 4G3GA 2Z7LA 3LZBA 3MYGA 4ID7A 5HE1A 3SXFA 3GUBA 2EXEA 3OCSA 3FLQA 1JQHA 4IB1A 4BWPA 4E5BA 4MWIA 2FO0A 5HCYA 4K77A 4FTRA 2EXMA 3G6HA 3GENA 4DHZA 3VS2A 2VTOA 2I0YA 4MAOA 5DN3A 2GCDA 3KIOC 3TCPA 2PU8A 3LOKA 1TQPA 4EJ7A 2XNOA 3I7BA 3FZ1A 2YCRA 2XUUA 2NYAA 4BCJA 5M09A 4GFOA 3P5KA 4L7SA 4F1OA 3DK7A 4ERWA 2BIYA 2X81A 3C4XA 3G2FA 4F0FA 5BNJA 4FF8A 4KBAA 2BZJA 4CZYB 4XBUA 3W33A 2JFMA 3ALNA 4E5WA 3T9TA 3HL7A 3EQFA 4G2FA 4I24A 3VF8A 3H9RA 1O6YA 2O65A 4L7FA 4C2VA 3NDMA 4U43A 4PY1A 2J6MA 2A0CX 1UU9A 5FP6A 5LXMA 3PP0A 3OBJA 5CNOA 4LMUA 3QTRA 1Y91A 4BBMA 1YXXA 4EZ7A 5BPYA 5FGKA 1H27A 3V6SA 3Q9XA 3KK9A 2JDOA 3D5WA 5FXQA 3QTQA 4OBQA 4O22A 4C38A 2YWVA 4DN5A 3VJOA 3OMVA 3EYGA 2XKDA 5IQGA 3O51A 2XNBA 2C0TA 3L8PA 3FV8A 2W1IA 4CZUA 4DITA 2OZAA 4GEOA 2JITA 5BYLA 2EB3A 4DH5A 5BV3A 1OIQA 3WYYA 3NZ0A 1WBNA 4K18A 4I6LA 4J98A 1OGUA 3HEGA 3UC4A 3QTSA 3OOMA 4RIXB 3SXRA 4E8AA 3PG3A 1K3AA 3KKVA 3MTFA 2AC3A 2OXYA 1LEZA 3F7WA 3FSKA 2F7EE 3LFSA 4APCA 2ZM4A 1W2FA 4YP8A 4CFMA 5A54A 4AXCA 3R8ZA 3SXSA 2BUJA 2VTMA 4YC3A 5BVKA 2OH4A 2QODA 4H3QA 2CHLA 2V22A 4TYEA 3KXNA 4ZEGA 5F1ZA 4PMMA 4QP2A 4MKCA 3V5LA 4M3QA 1TFFA 1JLUE 3E8DA 4U0IA 2GNIA 3FLYA 4DEDA 3UQCA 3GQIA 4AOIA 5HU3A 4ITIA 1SM2A 5DOSA 5ACBC 4OTDA 4C4IA 4G17A 3R9RA 3QLGA 4WA9A 5KUPA 1LP4A 2PVLA 3IK3A 3FI4A 5CF8A 5IH5A 2VO3A 4AZFA 3EYHA 5DBXA 5K3YA 4IACA 5J8IA 2CCIA 1XHAA 4GJ2A 4PDOA 4WNOA 1Y57A 1Y8YA 3OTVA 2ITUA 3VS0A 2QOCA 4BI0A 4DCEA 2PVJA 4F9YA 1VJYA 3VS5A 4LRKA 4ZY5A 4BFMA 4OTQA 4O86A 3G9LX 4RIWA 4C35A 4YSMA 3QTUA 3FQEA 5AAGA 2YM6A 3N4VA 4EH2A 2J0LA 3G6GA 3F2AA 3NNWA 2WFYA 3C4FA 1QPEA 3C0HA 3NEWA 3PXFA 3TNPC 1OI9A 4TXCA 4K33A 5AIKA 1NVRA 2QLQA 5EW9A 5LMAA 5EG3A 2R2PA 2WU7A 2VO6A 5CVFA 4QYYA 3E7OA 5DYJA 1NXKA 4UXQA 4OGRA 3GC9A 5A9UA 3QTXA 4IM2A 3BGQA 2ITOA 3QRJA 3EQRA 5DMZA 4EQCA 4F7SA 4EBVA 3KXMA 4UN0C 4J7BA 2OH0E 3R9OA 2Z7RA 4AACA 4IMYA 3JYAA 5KZIA 3E92A 3O7LB 4YO4A 4E5AX 5EQEA 3CGOA 1K9AA 3FL4A 4IB5A 3FZTA 3LCDA 2Z7QA 2ZOQA 4A7CA 2UW0A 4QQ5A 5FD2A 3Q5ZA 2PVNA 4GYGA 3OY1A 3PUPA 5AR2A 4EZ5A 2W1GA 1YDTE 4Q5HA 2QO2A 3DZOA 3R1NA 4YZCA 3VBTA 3GC0A 5IUIA