3TCPA

Crystal structure of the catalytic domain of the proto-oncogene tyrosine-protein kinase mer in complex with inhibitor unc569
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
287
structure length
256
Chain Sequence
LEDVVIDRNLLILGKILGSVMEGNLKQEDGTSLKVAVKTMKLDNSSQREIEEFLSEAACMKDFSHPNVIRLLGVCIEPKPMVILPFMKYGDLHTYLLYSRLETGPKHIPLQTLLKFMVDIALGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFPVKWIAIESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTDPLDRPTFSVLRLQLEKLLESLPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase Mer
publication title Discovery of Novel Small Molecule Mer Kinase Inhibitors for the Treatment of Pediatric Acute Lymphoblastic Leukemia.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 74
structure length 256
sequence length 287
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3tcpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tcpA01
3MW1A 1MRVA 5CU4A 3FLSA 5HVJA 2H34A 5IUGA 4FKOA 5E90A 2X6EA 3GGFA 4IZ7A 2BZKB 3S4QA 2CNUA 4OTQA 4CTBA 2FH9A 4LL5A 4ZTSA 3L9MA 1ZMUA 2VTLA 5CQWA 4KRDA 1Q8WA 5AV4A 4XG7A 3NIZA 2RGPA 4J97A 2OF2A 2QURA 4AT5A 5CEOA 2JGZA 3HDMA 4HZSA 3AMAA 4QYHA 3ZMMA 3HUBA 4V01A 4ZTRA 3RPYA 5HIDA 4B6LA 5L2WA 5KMOA 3MFRA 3MESA 3E8DA 3LFSA 2QCSA 4FVPA 2WQEA 5JN2A 1FMKA 4NKAA 5J8IA 4YO6A 4WUAA 5FLFA 3PY0A 1XHAA 3LVPA 2R9SA 3MH1A 3POOA 3QA0A 4QMXA 2EU9A 3SRVA 1TQPA 2UW4A 2XCKA 1JSUA 3A61A 4GCJA 4M12A 3VUTA 4YJSA 4FVRA 4FSYA 2XIRA 1ZARA 3B2TA 4FTLA 5IMXA 3TV6A 3IPHA 3TCPA 4I21A 5CAOA 1YXXA 2PMOX 4IW0A 3BEAA 2BILB 2YN8A 2B9JA 4O6EA 3A8WA 4I4EA 4ZLOA 2W06A 2GCDA 4CV9A 3BBTB 4RC3A 4C3RA 2CLQA 2ETMA 4MX9A 1PYXA 2CGWA 3TG1A 1WBTA 3P0MA 2QU6A 2C6OA 4WSQA 3ANQA 5C27A 4OAUC 3VRYA 4ZTNA 5GJGA 1IA8A 4BDHA 2CKOA 4CFNA 4ZLYA 2GQGA 4CG9A 3NW6A 3DOGA 4F9CA 3FV8A 2YABA 4WKQA 4JQ8A 3MVJA 3BBWA 1Q99A 1H1SA 5LOHA 4FL3A 5EHLA 2R3LA 4FGRA 3OWKA 4AWIA 5BUEA 4LV5A 2V0DA 1G5SA 3ZRMA 2Z7LA 3OCTA 4NTTA 3KMMA 2WNTA 3TZ9A 4L6QA 4PPCA 2J0IA 2XNMA 2UW0A 1G8AA 4X3JA 4WRSA 4XCUA 3EHAA 4RVTA 2GNJA 3TXOA 4S2ZA 2XMYA 4EJ7A 5K3YA 4Z9LA 1R0EA 3ZYAA 4BKZA 4C4HA 4K9YA 1CKJA 4AGUA 2X2LA 4H05A 3KQ7A 5HG8A 3DAEA 3QX4A 3R21A 4FUXA 4I4FA 1VR2A 4LMNA 3OP5A 5CS6A 3L8PA 3VW8A 3QRUA 3SRVB 2GU8A 4EQMA 5LWNA 4YU2A 4O0SA 5HEZA 1H1QA 5L2SA 4S34A 3TKHA 3HUCA 4Z7GA 2PPQA 3COMA 3FMMA 1YOMA 5FD2A 4CQEA 4FV3A 4ID7A 5C8MA 3DJ7A 3V5WA 2O5KA 2QHNA 2X7GA 3OCGA 4LI5A 3BU6A 4PUZA 4XG9A 4B8MA 5M57A 5EDPA 4R78A 3RI1A 4FZ6A 4E7WA 4V04A 2OJJA 4GRBA 3K5UA 5CX9A 1K2PA 4O1OA 3H4JA 4WSYA 4MXYA 3SG8A 3PLSA 4DFYA 4FSRA 2UV2A 4CFUA 4HW7A 3RBWA 3EB0A 5EDRA 1CKIA 5HNBA 2PVJA 2QKRA 4FICA 4W4VA 3HMMA 4ZEGA 3SHEA 2VWWA 5IQAA 4BKYA 3Q5ZA 2UUEA 2WMXA 3MI9A 1APME 2W17A 2ZM4A 4U45A 2PZIA 2QLUA 4CZTA 5HTIA 5AJQA 3TZ7A 4GK2A 3LFDA 4ZP5A 4Y5QA 3VNTA 1OL7A 5CU6A 5I0BA 3UPXA 4QQCA 3F82A 4ANBA 2Z8CA 4E5BA 4AOJA 2UZNA 4FV9A 2VGOA 2I0EA 4L53A 3JVRA 3DZOA 4XG2A 3UVQA 4FSQA 2W4OA 2XF0A 1NY3A 1YOLA 3II5A 3NGAA 1NVSA 3F5UA 5AIRA 4HGSA 4N70A 4DFLA 3IONA 3UNZA 2J0LA 4XOYA 4CLJA 1KV2A 4FTUA 4MKCA 4ZSAA 3DTWA 3VF9A 3DK7A 4BWKA 2HWPA 1IAJA 5TOZA 2CCIA 2QG5A 3FLQA 4OTDA 4MXOA 5E8XA 3BQRA 3V8TA 3EL8A 5DRBA 3IW5A 3QZGA 3UIXA 2QQ7A 2OKRA 5HG7A 2XVDA 2Y6OA 5CSHA 4C38A 4FL2A 4IAFA 4X21A 4YC3A 3VRZA 4AT4A 4L01A 3FSKA 2FSOX 4CGAA 3R9HA 1PMVA 4O0XA 4CVAA 5AX3A 4JI9A 2V22A 4HYIA 5GJFA 4DF3A 5JEBA 1NW1A 1NVQA 4FTRA 4W4WA 5HO8A 3SXRA 4YSJA 2JBOA 4OBOA 2RFEA 5CF4A 2QD9A 4HYSA 5KHXA 3IDCA 3DS6A 3UO4A 4GK3A 3I5NA 1MUOA 3GNIB 1GZ8A 3GP0A 4QTDA 3DXQA 5AUUA 2ZB1A 3EZVA 3NUUA 3B8RA 4ITJA 3LMGA 5ACBC 3OROA 3GQLA 2W99B 5AP6A 3PIXA 3TKUA 4CYJA 4DH3A 2PYWA 2UZVA 4BDFA 5ANDA 3DA6A 1I09A 3BE2A 4M97A 4HNIA 5IISA 4WO5A 2J0JA 3ZUUA 5DEYA 5CEPA 5IQFA 5IA0A 5J79A 4O7SA 1IR3A 3MH2A 5IKWA 1W82A 4IM0A 3R8LA 3IG7A 1HCLA 3UNKA 1BKXA 4I5HA 3EFLA 2YM8A 3Q2MA 3RCJA 5AUTA 1J1BA 5HO7A 4Z7HA 3ZONA 3KREA 5HIBA 4G34A 1PJKA 4RX7A 4F1MA 5FBNC 2W05A 2QHMA 5AP0A 5M44A 2VUWA 4W9WA 2VTTA 2GMXA 4CYIA 2EXCX 3Q04A 2PVNA 4WT6A 1YHVA 3EJ1A 4MTAA 2XNOA 3BI6A 4G5JA 4IZAA 4UALA 5HD4A 3GVUA 4IC7A 3KXZA 4FZDB 4KSQA 4MD8E 4F9YA 3AC5A 4OTWA 1J7LA 3SW7A 3RWQA 4G3GA 2BRHA 4F7SA 5CANA 4M13A 4TNDA 1DAWA 4DG0E 4MEDA 5L3AA 3NS9A 3WF8A 3OY3A 1JKSA 1W0XC 3GCPA 5HTCA 2IZTA 3PE2A 5EDQA 4DG3E 4XRJA 4K77A 4EOOA 1UA2A 3MB7A 1JSVA 2B53A 5T68A 3UIBA 5KO1A 3AGLA 5A9UA 3FEGA 2CCHA 2H9VA 5K4IA 5DT0A 1YW2A 4GVJA 5B7VA 2R3MA 4MXAA 4W9XA 4L52A 1L8TA 4R3PA 3EFJA 3TACA 3R01A 2EVAA 2VZ6A 1PMUA 4L68A 5JK3A 3QZFA 2J0MB 2P55A 4YUQA 2FSLX 1IA9A 2PUPA 4O86A 3CTJA 4JJRA 4FKJA 3F3ZA 1JBPE 1YXSA 4XLVA 3ZHPC 2BAKA 3O8PA 4DCAA 2OBJA 3KMUA 3PRIA 3D4QA 4BB4A 2CKEA 4BCHA 3ROYA 3VS5A 3R0TA 3DBEA 3TUDA 3GCVA 4GG5A 4PMSA 1JKLA 4QQ5A 3GC0A 2GNGA 1AD5A 1Q8ZA 3CR0A 4QMWA 4BDCA 3W2PA 2XKCA 2IN6A 5HE3A 3PA4A 4JQ7A 4PWNA 3FKOA 2EUFB 2WTWA 2SRCA 3R7OA 4PNKA 3C4XA 2YM5A 3PXQA 4NM3A 3BU5A 5AUWA 1Y8GA 3N4VA 1ZOGA 4RSSA 4O82A 4KIOA 4IBMA 4GU6A 4I6QA 2ZAZA 1Q61A 3C0IA 2W4JA 4RJ5A 5KZ0A 2HXLA 2X4ZA 4A9TA 4WIHA 3QUDA 3PWDA 3I1AA 1WBWA 5AA9A 2LGCA 3UIUA 1ERKA 3SXFA 3WIKA 5FTOA 4BCOA 4PRJA 3RTPA 4F65A 5H8BA 4DTBA 4RGJA 1CMKE 2V7AA 3FL4A 4UEUA 3OBGA 4O83A 3LMHA 4MNFA 4OTRA 4DEBA 5CT7A 4FT5A 4CG8A 2G2FA 3DDQA 4AS0A 4QP1A 5EH0A 5IDNA 5ETFA 5HCXA 5K4JA 2VTIA 2FGIA 4BCJA 3PIYA 4AN3A 4XG4A 1KV1A 3O0GA 5D11A 5LMKC 3MA6A 3PVUA 4J99A 2J9MA 3K3IA 3FY0A 4YC6A 4BDEA 2VAGA 3QTXA 1ATPE 4X2KA 5HBJA 4Y5HA 3WYYA 2R3RA 5TF9A 2IW9A 2C47A 3IW7A 3RHKA 3D14A 4P5ZA 3ZLXA 3MS9A 5F1ZA 5M09A 5HNIX 1YHSA 4IM3A 1QL6A 3QD3A 1OKZA 4FV8A 2PVYA 2ZOQA 4RJ8A 3F7WA 2C6KA 4JQEA 1Q5KA 1U4DA 3D2KA 3SQQA 4GV1A 3NNUA 4MXCA 5CT0A 4L3PA 3UQGA 3UYSA 5TKDA 5EM5A 5KUPA 2QOOA 4IZYA 4JNWA 2UZUE 3ZOSA 4RVKA 5H8EA 5JQ8A 2XIYA 2W1HA 3KU2A 3ZU7A 4MQ1A 1URWA 3SX9A 4UZDA 3RGFA 4WOVA 4BTMA 4TL0A 3WZDA 3HKOA 4O0UA 2WFYA 4O2ZA 2NPQA 3V6RA 4GSBA 4L7SA 3TNQB 2IW8A 4FTOA 5G6VA 4NYEA 2XNBA 4PPBA 2G2HA 4DFXE 2B9IA 3KC3A 5HU9A 3GUBA 3ACKA 4CMUA 1TQIA 1ZZLA 3FYJX 3H0ZA 3JYAA 3O96A 4U3ZA 3HEGA 3IO7A 3HECA 3ORZA 3Q4ZA 4DITA 4LGGA 5A4LA 2VX3A 4CMOA 2W4KA 5CXZA 2C5NA 4V05A 2JDSA 4B4LA 2GNFA 4G6LA 4QTCA 3FDNA 5ACKA 4IC8A 5IA2A 4OTFA 3DFAA 1E1XA 3FJQE 5K0KA 3Q6WA 3RCDA 4D2PA 1KWPA 4EZ7A 3LFAA 3I79A 5DYJA 4EKLA 2BRGA 2WMWA 3QZIA 4RMZA 3MWUA 2PULA 1SVHA 3HMOA 3QC9A 2X7FA 1BL7A 1XQZA 4L3JA 4YLLA 4GKHA 5E9EA 5AV1A 2YEXA 4QQTA 3WYXA 5JRQA 5A4TA 1H1RA 5KX8A 2REIA 5T6KA 4UB7A 2OXYA 4UYNA 3MVHA 2RFNA 4CKIA 4J1RA 2BFYA 4BZDA 3D5XA 3FMHA 1RE8A 2PZPA 2QO9A 3IQ7A 4E4NA 4BCKA 5BNJA 1M17A 3NYVA 4TT7A 5AA8A 4GEOA 4UZHA 2BKKA 3P7BA 4CD0A 5IUHA 1SVGA 3LJ2A 3QXOA 4WG3A 3UJGA 4BRXA 4DH5A 3E8NA 3GXLA 3E63A 5EK7A 3UE4A 3CD8A 4I5MA 4YJNA 4D2VA 1OUKA 4Z55A 1H24A 4FKRA 4O6LA 5DT4A 4IJPA 3MN3A 5KMKA 1ZYCA 2NP8A 2WEVA 5GZ9A 1KE6A 3PVBA 4GFOA 3TUBA 3L9NA 3OEFX 4RQVA 5AAGA 2BIKB 2GNIA 3BU3A 3LJ1A 3V01A 3QQKA 4X7QA 1ZLTA 5EYMA 4N57A 1IRKA 3HNGA 3FMKA 3AQVA 3FXZA 3PA3A 4H1JA 3G51A 1U54A 1VEBA 3COHA 4RWLA 4OAVB 3RHXA 2WMUA 4XG8A 3TIZA 3ODYX 3VVHA 4YJVA 4CCBA 1U59A 2BZIB 3QAME 3PA5A 3V8SA 2JKQA 4U79A 2I0HA 1LPUA 3IOKA 5EOBA 4D58A 3UQCA 1XH5A 5HOAA 3E88A 2WQNA 4F7LA 2OJFE 4KRCA 4X6QC 4CFXA 3BYSA 5EKOA 5HI2A 3ZM9A 4GIIA 1ZYSA 1XJDA 5J5TA 5CZHA 2WELA 4R1YA 3TJDA 2VWIA 2X8EA 4ZK5A 3FMEA 4NEUA 5H8GA 3LM0A 3E87A 5CEIA 3A7FA 1Q41A 4EONA 4CRLA 4O7ZA 4FF8A 3JS2A 4BGHA 3F3WA 1SMHA 2XUUA 2CSNA 2F9GA 3DLSA 3G6HA 5FUTA 4II5A 2GHMA 1KOAA 4TYGA 4EOIA 3KY2A 3R63A 3NYNA 4I6HA 4NH1A 2X4FA 3FC2A 1J7IA 2B0QA 3NIEA 3GQIA 4IFGA 4NTSA 2HY81 3FI2A 4O7LA 1EH4A 3HGKA 5E8ZA 4RWKA 3CE3A 2PL0A 2YA9A 2C0OA 2ZV2A 4AOTA 3BLHA 3ATSA 4YHJA 5L4QA 5BPYA 3KMWA 2VNYA 2I0VA 3ETAA 2NNWB 3I0QA 1YI4A 1JPAA 4ZS0A 3OWPA 3P5KA 5HBEA 2AYPA 1PF8A 3SW4A 2O0UA 5DA3A 2E9NA 3K5VA 3VUIA 5I3RA 5M4UA 1WBPA 1YXUA 4UWYA 3N4TA 1DI8A 1FOTA 3PJ3A 4OTGA 1IASA 1UNLA 2VWBA 3LXLA 4ZTMA 2HYYA 2I6LA 4GH2A 2VV9A 3D9VA 1U54B 4WA9A 1PKDA 3BIZA 3EQIA 3QD4A 3OOMA 4FIEA 3DAJA 3V51A 3VS3A 5IDPA 2JKMA 2Z60A 2B1PA 4GS6A 4Y85A 4LQMA 5BUJA 4FYOA 5LWMA 5D41A 3MIAA 4RVLA 3F88A 1UU3A 1TKIA 2P0CA 2FVDA 4E6CA 4G3DA 4QP8A 3KN5A 3QHWA 3V5LA 2O8YA 1KSWA 4QMZA 4ARKA 3UNJA 3BPRA 3R1QA 4FG9A 2CN5A 5AFVA 2WU7A 4C7TA 4LM5A 4P7EA 3H0YA 2G01A 5FQDC 3DB8A 3U55A 5LARA 1OBGA 3SKCA 3OG7A 5CALA 5ANIA 1LP4A 4IEBA 4K8AA 1H25A 4GL9A 4JG7A 4QYFA 3FKLA 4KIKA 1H00A 3AMBA 4QMYA 3W32A 2G15A 3ALNA 4FIIA 3NW5A 4KSPA 2IPXA 2JDVA 1XR1A 2PWLA 2OICA 3E7OA 4U40A 5F95A 3BLRA 2BDWA 3JVSA 4FV5A 5H9BA 5LQFA 3DFCB 2HELA 3QRIA 4K0YA 3VUDA 1P4FA 5E1SA 4USFA 4AG8A 1KE9A 1O6KA 3F2NA 4PDPA 5HO6A 3R22A 4EH9A 3D5VA 3FWQA 4BZNA 3UP7A 4F0IA 4IX6A 4E26A 1PMEA 1UU8A 4EZ5A 3KVXA 1GIIA 3D5WA 2XEZA 4L9IA 4BCFA 3C4EA 2W1GA 5TR6A 1LEWA 4UBAA 3VO3A 4N6ZA 4FSUA 4XUFA 3KK8A 3UO5A 2CDZA 3O71A 2BUJA 4C34A 4WNKA 5CAUA 3WZJA 4OT6A 4YTIA 3QXPA 2JDTA 3QUPA 1SM2A 4QTEA 3VBYA 3EN9A 5EQEA 4NW6A 2C6TA 3SD0A 3IOPA 3WZEA 1OIQA 3TNIA 3U9NA 4IWOA 3UC3A 4F99A 3EQBA 3UZTA 1MP8A 2XK4A 4FKGA 4AZFA 2DS1A 2C3KA 3E8CA 3FC1X 3DKCA 3DDPA 1ZMWA 4P90A 4U9AA 2BKZA 3R8PA 4RJ7A 2Y4IC 4YP8A 3E62A 5BVEA 5KCVA 4QT1A 3Q53A 2XRWA 5JT2A 2VWVA 4LGHA 3DXPA 4M0YA 3DT1A 1H0WA 4PY1A 4F9BA 5DEWA 4G17A 4C57A 3SXSA 3V3VA 3MBLA 3F9NA 3NDMA 4UYAA 2CGUA 3P78A 4BDIA 2QU5A 3TEIA 4KIKB 4DH8A 3FQSA 1OVEA 2X81A 1MQ4A 2VTSA 4Q5HA 4O7RA 3QKKA 3R7EA 2W5HA 3CTHA 4I6FA 4AZEA 3MVLA 3LPBA 3DQXA 2OH4A 4LRJA 3I81A 4C37A 4IDVA 2YIWA 4IQ6A 4IDTA 4IHPA 2AUHA 4G6NA 2WTDA 3M2WA 5CF5A 4UMUA 1Q8TA 1REKA 3UOHA 3TZ8A 2A2AA 3L8XA 4DA5A 1B6CB 3MH0A 4GFGA 5ICPA 2HZ0A 3I7CA 3DK3A 4KABA 4R8QA 3UOKA 3HV7A 1Z57A 3UZPA 4GK4A 2YDIA 2ZMDA 3BHUA 4YLJA 3VHKA 3AOXA 5FDPA 2X1NA 4L67A 4S30A 4YURA 4YZBA 3ZBFA 3R9RA 4A9UA 2QOLA 4EWHA 4DBNA 3FQEA 5IZFA 2C5VA 4YNEA 2WB8A 3RP9A 4AW2A 2WMVA 2YCQA 4L8MA 4H39A 4JBOA 2E9VA 4O22A 5LVNA 2PUIA 1YWRA 5CEKA 2C6DA 2YCSA 4FTKA 5B2LA 4D2TA 2PUNA 3G15A 5IQGA 1OZ1A 1PXIA 1Y6AA 2KTYA 4AGCA 5A6NA 2FO0A 3EH9A 2IVVA 3ZLSA 3UOJA 4JR3A 4FTQA 4BHNA 4JS8A 2OIQA 2GFSA 2WD1A 4CQGA 3FQHA 5IEYA 3DKOA 4UN0C 4QMSA 2OFUA 5HX6A 5IPJA 3MPAA 4WD5A 5CVGA 4HVHA 4GU9A 4F0GA 3MY5A 4TTHB 2VGPA 5ANOA 5ITAA 2X7OA 3SGCA 3NR9A 2XK6A 5L2QA 4C33A 4D1SA 4ALWA 2XEYA 1SNXA 1OPJA 4IX5A 2CJMA 4EHEA 4EWQA 3QX2A 1JLUE 1R3CA 4L44A 5BVKA 3A4PA 5CF8A 5HORA 4B0GA 3PRFA 1BI8A 1GZNA 4IVCA 5C8KA 2XIXA 3VS7A 4OBQA 4XV3A 5FG8A 3CY2A 3D7ZA 5AX9A 4EK5A 4FSZA 3PJCA 4ZJIA 4ANSA 4F1OA 5J9YA 2XM9A 5J7BA 3D2IA 5CXHA 5BMMA 3TZMA 4ACCA 4BWPA 5BQ0A 3WOWA 1WBNA 4CSVA 4C8BA 2F2CB 3D0EA 3AMYA 3MPTA 3OUKA 1OIYA 4GVAA 1ND4A 2PSQA 3TV7A 1XBBA 5JSMA 4ZMEA 4XJ0A 2WMSA 4O0TA 3LZBA 3NNWA 3P7CA 2XK3A 3F5PA 4QYGA 3VS1A 3A62A 3W8QA 1NT2A 4ITHA 3PXRA 4HYUA 5JZJA 3LCOA 4YTCA 1UWJA 3GOPA 2VO7A 3FKNA 1M52A 3I5ZA 3FAAA 4FT9A 4FV1A 1YKRA 1V0BA 1W7HA 2B55A 4QRCA 3AC8A 4KWPA 3COKA 3HV3A 4YZCA 2PUUA 5EI6A 2B4SB 5CNOA 4EOPA 3F66A 3Q9WA 1H1PA 4K1BA 5IF1A 2X39A 2R3FA 4XRLA 4EK6A 2NRUA 1OMWA 2F7EE 3LIJA 4O38A 5E1EA 1P2AA 2QR7A 2Y7JA 2Y9QA 3ZEWA 3F2AA 5FP5A 3MV5A 4PPAA 4RJ3A 5I9ZA 2ITOA 3UG1A 4AE6A 3QKLA 4H1MA 5A6OA 3AGMA 2XA4A 2R64A 4H3BA 4A07A 2OI4X 3P23A 4B9DA 4R7BA 3Q3BA 5LJJA 4HCTA 1Q24A 3PPJA 5HE0A 3QQJA 4RX8A 1WAKA 3LXPA 4QNYA 3C9WA 2ITQA 2JDRA 5AR8A 5LVOA 3O50A 3ZUTA 3RJCA 3QRJA 4LOOA 3SAYA 4GYGA 5HVYA 4UMQA 3WZKA 4IWDA 3A4OX 4RA4A 3BZ3A 5D10A 4D9UA 1WFCA 4RWJA 1YVJA 4R5SA 3G0FA 1XWSA 3R71A 5K9IA 4BDGA 4CNHA 1UKIA 3EQGA 5HIEA 3PG1A 4EKKA 4APCA 1Q97A 2BHEA 2GDOA 3QA8A 5FWKK 1ZY5A 3CCNA 4MBLA 2XKEA 5KMLA 4NIFA 2VU3A 3PZHA 4CEGA 4ACHA 4FTNA 4ONAA 1Q4LA 4XV1A 1YDTE 5E8YA 2YISA 2X9EA 1JKTA 4XOZA 2WPAA 2DUVA 4O0YA 2HXQA 4C4GA 3QU0A 4O84A 3VS0A 3LQ5A 3QKMA 4P5QA 1ZWSA 5HQ0A 3ZC5A 4RT7A 3ORXA 2VO0A 3OFMA 3OW4A 4C4EA 1UVRA 3ORLA 4RIOA 3NUPA 5M4IA 4TRLA 3HAMA 3E93A 5JGDA 4AP7A 4HZRA 4FEUA 3DKGA 2F2UA 2VTJA 4QMLA 3F5XA 2IO6A 5KE0A 2P33A 2OK1A 1Y6BA 1PXOA 3R30A 2UZWE 4ZJJA 4PTGA 5AP7A 3QTZA 2J4ZA 2YLFA 4O0WA 4D2WA 3Q52A 5BMSA 5LVPA 2XYUA 3K2LA 3BX5A 4MHAA 4OTIA 3DXNA 3WZUA 4EK3A 4FSMA 4ASEA 4DT9A 2XKDA 2BFXA 4KBAA 2QOIA 3LCSA 3R7IA 3TTIA 4HVGA 4ZS4A 3LKMA 2UW9A 2XBAA 4C02A 3BV2A 2AC3A 2YIQA 5BX0A 4HPTE 3FMDA 4IVBA 4O27B 5EW9A 2W1EA 5LMAA 2X6DA 4GKIA 4X2NA 1PW2A 3HRCA 4KB8A 3V04A 5AP4A 1QCFA 3FE3A 2ZV7A 4CMTA 5IMEA 3ROCA 3K3JA 3Q96A 2ESMA 4U44A 1OECA 4W8DA 2BRNA 5E8VA 3ZM4A 5J7HA 5M4CA 3EQFA 5JGBA 2F57A 4FTMA 3CLYA 5FGKA 4DFNA 3R9NA 2Z02A 4I3ZA 2O65A 4DH1A 3DNDA 4MK0A 2Q83A 4NIFB 3QCXA 2OSCA 4JT3A 1ZYJA 4Y46A 5HBHA 2JEDA 3QWKA 2WIPA 5CNNA 4ZXTA 3D7TA 4BI1A 4HOKA 4V0GA 3NEWA 3DQWA 3SOCA 3KRJA 4A7CA 3QTUA 4R3RA 3ORKA 4G16A 4J98A 4YMJA 3PZEA 3UOLA 1NA7A 3W2CA 4QMTA 3ZSGA 5M4FA 2W9ZB 1BL6A 1OKVA 5I3OA 4UWCA 4RWIA 1CDKA 1NXKA 3UG2A 3A7HA 4D1XA 1M14A 2XB7A 5EM7A 4D9TA 4DTAA 2R3QA 2Y4IB 3AT2A 4WRGA 4NM5A 4C62A 4Q5EA 2G1TA 2EB2A 4RLLA 3FY2A 4QMMA 4GW8A 2QOBA 4NZWB 3B8QA 1CTPE 3CPBA 3R7GA 5CY3A 1TQMA 2JC6A 5EFQA 5A3XA 3VBQA 3SDJA 4C4FA 3CD3A 2FSTX 4Q9ZA 5EQYA 2HW6A 4FV6A 5DWRA 4HVDA 4QP7A 4ZTQA 3SC1A 3U51A 4BY9E 1WCCA 4AW1A 4PP9A 3LFNA 3KRXA 4K6ZA 3TUCA 2RIOA 5CSVA 3PSDA 3HYHA 5AUYA 3C50A 3OY1A 4L43A 5KZIA 5E8TA 3HP5A 3RAHA 4GUBA 3GCQA 4KIPA 2YZLA 1YWNA 3TI1A 3I60A 4FV0A 4EI4A 4RVMA 3DTCA 1R1WA 5AIKA 4FKIA 3GBZA 3R8VA 4UX9A 3E92A 1H08A 3OBJA 4XYFA 3BHVA 1PY5A 1T45A 4YZMA 4B99A 5A54A 5HX8A 3DBDA 4GT3A 4IH8A 1NVRA 1GIHA 3EN4A 4FODA 5CF6A 2ZM3A 2P2HA 3CP9A 4AZTA 4E5AX 3FZTA 4I23A 1DI9A 3FMNA 4FG7A 4BBMA 5GNKA 2JFLA 3MIYA 4EOMA 3NUNA 5FEDA 4IFCA 4EHGA 5M06A 3Q4UA 1PXKA 3Q4TA 3NSZA 2WO6A 4F6UA 2RFDA 3VULA 3MVMA 3AT4A 3H9RA 3NRMA 5IQDA 3ZFMA 3D7TB 4I0RA 5EW3A 4FTAA 4V0GB 4BZOA 4EC9A 4DFUA 4X3FC 1B38A 4O7YA 1RQQA 4FI1A 4U0IA 3A2CA 3HMIA 4EL9A 3ERKA 4FT0A 1K3AA 2XS0A 4RFMA 3VJOA 5LVMA 3G33A 3QLGA 4OTPA 2C3JA 5D1JA 3VS4A 2ITNA 3KRRA 2C6LA 5L6PA 5F9EA 3BV3A 4KIQA 3NPCA 2CKPA 4RLKA 4NUSA 4FKTA 2YAKA 2C3IB 3W2QA 2XIZA 2I0YA 4I94A 4OTHA 5FDXA 4IJ9A 4FIJA 2FB8A 5FTQA 4C36A 3PUPA 4NJ3A 1H01A 2UW7A 1UNHA 4N4SA 3ENMA 5CENA 4FEQA 3ZFYA 1XH8A 2Y4PA 4FTJA 1BX6A 4ANMA 2HW7A 4XP0A 1REJA 1BYGA 5AV2A 4J8MA 5L6OA 4IAYA 4O1PA 2ITUA 4USEA 5J95A 3NYOA 3M1SA 3R02A 4QP2A 3T3UA 1UV5A 2PVHA 3RNYA 2VRXA 4MYGA 1KUTA 3MYGA 3JPVA 4KS7A 4BTKA 2C3LA 3KB7A 3LQ8A 4IB1A 2UZBA 1OKWA 2ZDUA 3QRKA 4QP3A 4F9AA 5E92A 5IU2A 2X8DA 3G5DA 4I93A 3KN6A 4EH8A 2R3KA 4ANLA 2XP2A 4FVQA 1QPEA 5DFPA 3S95A 3BE9A 3A7JA 3ENHA 4DGLC 2Y0AA 5CAVA 5CEMA 3KGAA 4RBLA 4YZDA 4FKPA 1WBOA 2FSMX 1YOJA 3VQUA 4FC0A 3Q9XA 2CGVA 4LRMA 3NUXA 3VWAA 5DMZA 3S00A 3IGOA 2B9HA 3ORTA 5IA3A 2W1FA 4QTBA 3OCSA 1OM1A 1PMNA 2YDJA 2HZNA 4XV2A 2C69A 2IWIA 2P4IA 4XG3A 1H28A 3GOKA 4UMTA 5AAEA 3C0HA 1Z5MA 2UVXA 4QP9A 5L8JA 2A27A 4EUTA 1LUFA 1O6LA 3U4WA 3P79A 2YM4A 1GIJA 2JIVA 2A0CX 3SLSA 5C26A 2QG7A 3C5IA 4PMMA 5EOLA 4S33A 2XJ2A 4I20A 5C01A 4LL0A 5CI6A 5JZNA 3LMIA 3B2WA 3NUYA 5M07A 4QMOA 5GZ8A 3SVVA 1HOWA 2YIYA 2VX0A 3R8ZA 2F7XE 4YHFA 2G9XA 2OJ9A 5GIOE 4NSTA 2OZOA 4O7WA 1ZOEA 3KRLA 4EHZA 5B2MA 2PVFA 4WNPA 4IE9A 3U4UA 4BCPA 1V0OA 3P4KA 4M14A 3ZZEA 4EK4A 2PVKA 4L00A 4DEGA 3QQUA 4APPA 3T9IA 5DR9A 1GJOA 5HG9A 2PZ5A 4G31A 4U5JA 3C0GA 2ZYBA 3P7AA 4RFYA 5BVWA 5J1WA 4ZTLA 3TDVA 5CQUA 3OW3A 3JXWA 5EKNA 4IADA 3F5GA 3FLWA 2BRMA 4Y95A 4DLJA 4AA5A 4D1ZA 4B7TA 5BYLA 4YJUA 4ERWA 3ZDUA 3P86A 2WMRA 1T46A 2C6MA 2WTCA 3PPZA 4AZVA 4D28A 4FEWA 4KA3A 5AUVA 1WBSA 2OXDA 2JLDA 3FBVA 4DH7A 5JRSA 2I1MA 5IUIA 4O7TA 4PNIA 1LEZA 4FZ7A 3FI8A 5IEXA 4MBIA 1B39A 1U46A 3C4ZA 2GFCA 2JAVA 1VJYA 3AD4A 5HCYA 2VTNA 2PE2A 4MWIA 2WTJA 3ORIA 3QHRA 2W0JA 5LCJA 2H6DA 1STCE 5E8UA 2I7QA 1OL2A 4LG4A 5GZAA 3FLNC 4QMNA 2PZYA 1O9UA 3V6SA 3TKIA 2R3OA 4JVGA 4RIXB 5JFWA 1PRYA 4O0RA 2C6IA 3EYHA 2VN9A 3UP2A 4AN9A 5CSWA 1FVRA 2YIRA 3R00A 2C68A 4TNBA 2YM3A 4U43A 4LV8A 3WF7A 5CASA 2W96B 2ZV9A 2Z7QA 5D7VA 3R1NA 1H4LA 3LJ0A 3MH3A 4RZWA 4DEAA 4E73A 3Q9YA 5HZNA 3W55A 5CVHA 3AD6A 3FZRA 3HV4A 4KBCA 4QNAA 4YZ9A 3CJGA 4HNFA 3FYKX 2OJGA 4LOQA 3TWJA 4WG4A 4NJDA 2YZAA 2VWUA 2ZDTA 2QKWB 3QRTA 5CI7A 4BF2A 1F5QA 2BTSA 4FOBA 4LFIA 4E6QA 4BL1A 2ZVAA 5JFVA 2WOUA 3HA6A 2ITXA 3IK3A 4DGNA 2GPHA 1GY3A 4PL3A 5HNGA 3KA0A 1YXVA 4X3FA 3GENA 5F94A 2HOGA 1M2PA 1IG1A 3C51A 3WF5A 4PDYA 4G6OA 1OL1A 3LOKA 3TNWA 3ZBXA 2B52A 4RA5A 3KVWA 2BR1A 2Z7RA 3E7VA 3U6JA 2R0UA 2XJ0A 2YM6A 3R7YA 3CPCA 4XLIA 2F7ZE 4D4YA 3GB2A 2R3HA 4JIAA 4PQNA 5DR2A 4AGWA 5M55A 1CM8A 1K9AA 3PIZA 4ZIMA 4BCGA 5DR6A 4K33A 4F9WA 2EB3A 4BI0A 1R39A 3NX8A 5AWMA 4M7IA 3GU4A 4E6AA 3QC4A 5AEPA 1I44A 5CLPA 5DN3A 5FP6A 4ASDA 5I9XA 4R77A 2Z7SA 4KNBA 4ZY5A 1H0VA 4QTAA 4M3QA 3POZA 5IH5A 3GU5A 4MAOA 4UY9A 3PE1A 3ORPA 4BKJA 4U80A 1YI6A 5BUIA 3C13A 3EN7A 3FLZA 2GHLA 2PY3A 3CGOA 1ZZ2A 2IZRA 3FPMA 4RQKA 4I0TA 4CFFA 4RIWA 4E6DA 4FEVA 2WHBA 5J87A 3OVVA 1VYWA 4AFJA 5HKMA 2GS2A 3EMGA 3L8VA 1G3NA 4IAAA 3H10A 3UC4A 4QYEA 3R8MA 3JUHA 5ETAA 4O81A 1A9UA 3CIKA 4IWQA 3ZDIA 3O7LB 1SYKA 3AD5A 1W83A 5ANEA 2C4GA 3IDPA 4MBJA 4ZZMA 3VJNA 5B0XA 5AR4A 3RZFA 3RINA 3WI6A 2PMIA 3DCVA 2A4LA 2VNWA 3P08A 3O8TA 3Q9ZA 4EH2A 4O0VA 3OZ6A 1MRUA 4K18A 4TYJA 3VBWA 3QD0A 5FM2A 2BALA 4JBQA 4AZSA 3DZQA 2JKKA 4X3FB 2GTMA 2ONLC 4EQCA 4EUUA 2WTIA 5DGZA 3QTIA 1XO2B 3PVGA 5AV0A 4KUJA 4Y83A 5EI8A 2Z2WA 3MFTA 2UVYA 4WBOA 5IA1A 4EYJA 4GFMA 2PZRA 3QZHA 2HAKA 4CKRA 4FYNA 2WIHA 3MGYA 4MVFA 1UWHA 4CRSA 3KF7A 5BYYA 4AZWA 4DEEA 3M42A 2WQMA 3EFKA 5K5NA 1GZKA 3VIDA 4WBBB 3EQDA 4F7JA 2OF4A 3CC6A 2DQ7X 5AM7A 4XBRA 1KE7A 5HE2A 2OFVA 4FT3A 4FSWA 2C1AA 3FHRA 4NFNA 4H3PA 4NM7A 4W8EA 3GFWA 4BIBA 1CSNA 3I4BA 3V5QA 3SV0A 3QWJA 5HG5A 3ZTXA 3OS3A 3QCSA 5H2UA 3F69A 4BCQA 4HJOA 3EN5A 1Z9XA 4OW8A 4TYEA 2J7TA 4BC6A 4ZLZA 4G9CA 1ZYDA 3DLZA 3TV4A 2ETKA 5JMSA 2Q0BA 1OI9A 3N51A 4RX9A 4F08A 2YWVA 1Q3WA 2OG8A 3G2FA 1DS5A 5TO8A 5F4NA 4DFZE 4RIWB 4DEIA 2JKOA 2B54A 2VWXA 2PVLA 3P9JA 3ZLYA 4BGGA 5ANJA 5C1QB 1PXLA 4KBKA 4FX3A 4RC2A 4FA2A 4FV2A 4ZOGA 5AUZA 4AE9A 4KD1A 2CHLA 4JX3A 3ZEPA 5EHOA 2RSVA 3RKBA 4E5WA 2B9FA 3HRBA 4FIGA 3SG9A 3EQPA 3OF0A 4IXPA 2PE1A 5GJDA 3OEZA 3JY9A 1WVYA 3EKNA 4QPMA 3VW6A 5L8KA 3DGKA 4YZNA 5M56A 4ANNA 4BIEA 4FMQA 3V5TA 2EWAA 3GEQA 2DWBA 3ORMA 5AV3A 3DV3A 1FPUA 5FEQA 3RPSA 5KBRA 1A06A 4ZSEA 4D4SA 3LXKA 3W8LA 4TZRA 5IQBA 5C4LA 5HD7A 4IB5A 3R9DA 3DAKA 2WAJA 5HU3A 2ERKA 4RX5A 2HENA 2IVTA 3PSCA 1X8BA 4A4XA 3BYMA 4NU1A 4E8AA 3U9CA 3KXMA 4BI2A 4C61A 3S2PA 4C3FA 3DBQA 3QQFA 4BVUA 4I5PA 1J7UA 4PMPA 4CXAA 3PJ8A 4NCTC 3LW0A 3N9XA 4DN5A 5KNJA 4IZ5A 4ERKA 3QCYA 4GIHA 4YGAA 3ZSHA 5BVDA 4M68A 3U6HA 3GC9A 2QI8A 5IEVA 4F6SA 1W84A 5CSXA 2CNQA 3R7VA 2VTQA 2CKQA 2GNLA 2HZIA 1UNGA 4I22A 2YACA 2XRUA 3EQHA 2UZLA 4Z3VA 1OITA 2JITA 3F7ZA 5CU3A 3PJ2A 3PVWA 5CVFA 4EJNA 4AW0A 4JDIA 5TE0A 1PXPA 2VO6A 4NKSA 3QALE 3C4CA 5A46A 2JDOA 2VX1A 4QMPA 3FZSA 3NW7A 2AC5A 3QLFA 4AAAA 4HGEA 4C59A 5E7RA 3V5JA 4FUYA 4D0XA 4D5HA 4XP3A 1M2RA 1J3HA 1VYZA 5AUXA 4DAWA 1S9JA 4ANQA 5I9VA 1FBNA 4BYJA 1Y8YA 2E2BA 4ANOA 3VS6A 3V8WA 4C4IA 3QF9A 4EQUA 5BVOA 4J96A 2BTRA 4KS8A 4FR4A 4NM0A 2WMTA 4BIDA 3G0EA 3NAYA 4IB0A 1TVOA 2GS7A 4X6RA 2UZTA 4J95A 4ZMFA 4TWCA 3PY3A 2WMAA 3V5PA 3BGZA 2C30A 2CNVA 1U5RA 2J5EA 3KRWA 4FNWA 4KKEA 4MXXA 4ZSJA 2ZM1A 3ZLWA 4EZ3A 3A99A 1YWVA 2VWZA 3GT8A 2W5AA 3KFAA 3O23A 4XP2A 3FZ1A 2XIKA 2Y8OA 3SOAA 5KMJA 4O7VA 4PDOA 3HAVA 2GS6A 2IG7A 2WOTA 2BAJA 4F70A 5K5XA 3MA3A 3RAWA 5DHJA 3W18A 3VF8A 5JKGA 1PXJA 2X9FA 1JQHA 1DAYA 4ZZNA 3ODZX 2ERZE 3HDNA 4YC8A 3VBXA 4YTHA 4ENXA 4UMRA 4HGTA 3HZTA 5DI1A 4IWPA 4YJTA 3CXWA 2R0IA 4WNOA 2WZJA 5HGIA 2GTNA 3GCUA 3WF6A 2JBPA 2H96A 4NW5A 5C9CA 3U87A 3LM5A 2BHHA 2ONLA 4IACA 2IJMA 3PG3A 4IIRA 5FXQA 4C0TA 4GUEA 2I40A 2FYSA 2HZ4A 3MB6A 3PJ1A 4ITIA 4BR3A 1JVPP 4J71A 2XK8A 2QODA 2RF9A 3UMXA 4CCUA 4C2VA 4S31A 1QPJA 3ET7A 3EN6A 4N0SA 3FI4A 5DNRA 1U5QA 3BHTA 3BHYA 3ZO4A 4EOQA 5J5SA 4Q9SA 3I7BA 1YDSE 3EL7A 3EOCA 4MD9E 1R0PA 2XCHA 3UZRA 2JD5A 3W33A 5I9YA 4G9RA 3VBVA 2CLXA 1OL5A 3QGYA 3KF4A 2BMCA 4MXZA 3CSVA 3NVKI 1OL6A 3LQ3A 4GMYA 4BDBA 2BAQA 2VTPA 2XNEA 4FKUA 3NMUF 2WMBA 3W2SA 4BICA 4WUNA 5BVNA 4QPAA 3I6WA 2GSFA 3R1YA 5L8LA 3PTGA 1H07A 2YERA 3PFQA 3TJCA 2YIXA 4E20A 1MRYA 3WIGA 4M69A 3IECA 3R73A 2VO3A 4X2FA 2IZUA 3OXIA 1JAMA 2W7XA 2FUMA 3LCKA 4E4LA 1XH6A 4BGQA 3TIYA 5L2TA 2GNHA 5E91A 2OIDA 3PLAE 2C5OA 3RWPA 3IW8A 2BVAA 4ZTHA 5KKRB 4WHZA 4JRVA 4YJQA 4M67A 5ETCA 3C4WA 2QOFA 4PL4A 4FG8A 4CFWA 4AGDA 1URCA 1L3RE 1PHKA 1H26A 3BYOA 3D83A 4D4RA 3SA0A 3NCZA 3LFQA 1FQ1B 5AM6A 3DU8A 3BHHA 3F61A 4RJ4A 4I5CA 3S1HA 3VS2A 3BYVA 3HLLA 2OLCA 3H3CA 2J6MA 3L8SA 4KINA 3ZO2A 5LVLA 3QCQA 4IAIA 4LMUA 1Y91A 2IW6A 2XK7A 4R5YA 4JBVA 5AP1A 5J1VA 3FL5A 1ZRZA 5CTPA 5I5ZA 2PK9A 2PVRA 4U7ZA 4O21A 3C7QA 4NL0A 3FMLA 3QD2B 3UQFA 3E3PA 4FKVA 5E4HA 3MPMA 4FL1A 4JL9A 1YXTA 3OCBA 5FRIA 2J50A 5KMMA 4CZYB 4NCTA 1UU7A 1V1KA 1E1VA 3KXGA 1F3MC 3EQRA 3PSBA 4AX8A 4XS2A 3Q2JA 2UW5A 3DNEA 3CKXA 4YJOA 2WEIA 4AW5A 3RPRA 4XHKB 2V62A 3NUSA 4IVDA 3UVPA 4FZAB 4DHFA 4XNEA 5H3QA 4QMUA 5HLWA 2W1IA 3RALA 3BYUA 1FGIA 4M69B 5I9WA 3UODA 3L9PA 3OUNB 3QQHA 3FSFA 1JNKA 3T9TA 2A19B 3AT3A 3I0OA 3UMWA 3H9FA 4BWXA 4LUEA 2GQSA 2E9PA 4IB3A 5IH6A 1BMKA 4RRVA 4S32A 2OGVA 1FGKA 4TN6A 3TTJA 3HMPA 5B2KA 4EEVA 4ZZOA 3VBTA 3ZH8A 4CV8A 4DTKA 2C0TA 3ZO1A 1H1WA 4NK9A 2GQRA 4HYHA 1JOWB 3PYYA 2BZJA 2R2PA 4UXQA 4G5PA 4LOPA 4GG7A 4X2JA 3TDWA 2VTRA 3VUGA 4C35A 4R7IA 2PMNX 3F3VA 4AACA 3CJFA 4I0SA 5CYIA 1P14A 4KKGA 5LCKA 3VUHA 3Q60A 3KULA 4KKHA 4DEHA 4L7FA 4QD6A 3TNPC 3D94A 4TWNA 4A06A 3EIDA 3ZZWA 4YTFA 2NO3A 2JIIA 5D7AA 4FK3A 3RVGA 5E8WA 2ZV8A 4NFMA 4FTTA 3WE8A 3IW4A 4A4OA 3F3TA 3WARA 4DEDA 2LAVA 2KULA 5EHYA 5EM6A 4MWHA 4AU8A 3ULIA 2QO2A 4FNZA 3REPA 4FT7A 2J0KA 4O96A 5HE1A 4DT8A 4D2RA 2ZB0A 3D15A 3QTSA 3RAKA 5DIAA 1S9IA 4F0FA 3WILA 1HCKA 4IX4A 5DBXA 4BCIA 4FNYA 2PVMA 3RPVA 4OBPA 2VTMA 5IG1A 1Y57A 3LFBA 4RIYA 3MJ2A 4OR5A 1QPDA 4ZY6A 5CEQA 2QR8A 3RK9A 4EH5A 4EOLA 4CTCA 4FV7A 1IAHA 3FMJA 4MQ2A 2R4BA 2WKMA 5FEEA 4RZVA 4OLIA 2X0GA 3ACJA 3RM7A 3JY0A 3R28A 4TKSA 4BCMA 5DH3A 3CEKA 2X2MA 3DY7A 3NLBA 2W1ZA 3HX4A 4I1ZA 3M11A 4CZUA 5JQ5A 4PDSA 4X2GA 2WU6A 2FA2A 4C2WA 4DCEA 1DM2A 5FTGA 2EXEA 4RJ6A 5M51A 3OTUA 4YR8A 4PTCA 3FHIA 4TY1A 3WBLA 4BDDA 2R3GA 4EH7A 1P5EA 2XJ1A 2OH0E 3P1AA 5D12A 4PX6A 3RMFA 2QLQA 2W1DA 2WMQA 4DLIA 2XNPA 4I24A 3GI3A 4PTEA 3F6XA 4EOKA 2ZMCA 4RPVA 3PXYA 4YNOA 3ZXTA 2BIYA 4TWOA 3DPKA 4NT4A 5ANKA 5DT3A 3UPZA 2R5TA 3MY0A 3Q4CA 5BYZA 4ACGA 3A60A 4WG5A 4YBKA 5HVKA 5DVRA 4JIKA 1FINA 4D5KA 3KULB 4Y72A 3O51A 4FTIA 1PKGA 3QTWA 5A4EA 4I41A 5CAQA 1PXMA 4TXCA 3EQCA 2QNJA 3RAIA 5AP2A 4O7NA 3BLQA 4FIHA 3QQLA 5FXSA 1KOBA 1O6YA 2IVUA 2YITA 3A7GA 3G90X 1XH7A 3KXNA 4AFEA 2F49A 4L3LA 4IM2A 1E9HA 4D4VA 3UBDA 4I92A 3R83A 4QMQA 4DBXA 4BTJA 4D0WA 4EBWA 3NNVA 4JX7A 5J9ZA 1UU9A 3E3BX 3RM6A 4PMTA 4E93A 3DKFA 3R1SA 1V0PA 3OT8A 3KL8A 1M7QA 3PP1A 2C0IA 1SVEA 4RIYB 3BEGA 3KXHA 5CWZA 3ZRLA 5CU2A 1H27A 4JG6A 1OUYA 4U8ZA 2XNNA 2BCJA 1ZXEA 2UW3A 3LAUA 5HICA 4AA0A 5AADA 5IQCA 2BROA 4DE4A 3PPKA 3C4FA 3R04A 4B8LA 3FZPA 3R2BA 3W2OA 1JKKA 2PE0A 3DJ5A 3BGQA 5DPVA 3A7IA 3DBCA 2J2IB 1WMKA 3ORNA 4BCNA 3FLYA 4BN1A 3FZOA 4CFMA 5C8NA 4FSNA 5JH6A 1WZYA 4M8TA 3LE6A 3QUEA 3VHEA 4A4LA 3ZC6A 3OWJA 3QYZA 4ACDA 1WVWA 1FMOE 5E8SA 4UWBA 3AXWA 4USDA 4M84A 4QQJA 2V7OA 2Y6MA 2RL5A 4L45A 3MY1A 4R1VA 3MTLA 1Q62A 1J1CA 2OO8X 1Q8UA 3CQUA 4FIFA 1OPLA 2ITTA 5ETIA 4MCVA 3ZUVA 1YHWA 4ENYA 4QOXA 2WQOA 4P2KA 4CT1A 3ID6C 2WTVA 5L2IA 3O8UA 4AT3A 4F64A 4E3CA 2HIWA 3RK7A 3MFUA 3KKVA 5BVFA 1J91A 2V55A 4DFBA 4PF4A 5LMBA 3C1XA 3MSSA 4IMYA 3GU6A 3K54A 2ITPA 4PL5A 5LXMA 4FOCA 4K2RA 4J53A 3CBLA 4L42A 4XBUA 2OXXA 2QONA 4M15A 2V5QA 5EM8A 5IQHA 4RIXA 1YRPA 3R8UA 2OIBA 4LYNA 3LCTA 3G9LX 4U97A 3HVCA 3RPOA 3TL8A 2E9UA 2YCFA 3THBA 4F1TA 4CKJA 3R2YA 2R3JA 3FI3A 4JR7A 3I6UA 3WF9A 2WTKC 4JDJA 3VUKA 4XV9A 2BPMA 3OMVA 4JBPA 3ZSIA 4CLIA 3W10A 5CSPA 4IX3A 4YPSA 4ZY4A 3W16A 2XYNA 3A8XA 2YJSA 2O64A 2F4JA 3UTOA 2VTHA 5C03A 4DGMA 2JAMA 4U81A 4G2FA 3IKAA 1FVTA 4PV0A 5AR5A 1M2QA 5I4NA 3BQCA 2XK9A 4FTCA 5T3QA 3UDBA 4DC2A 3U54A 4EH4A 2RKUA 2WXVA 3KXXA 5GIPE 4EOJA 4YSMA 1RJBA 5HHWA 2PU8A 4RG0A 1YI3A 4UXLA 3W2RA 3ZXZA 2YFXA 4R3CA 3AC2A 2QVSE 3LFCA 2O3PA 3N4UA 2R3IA 2RG6A 2G2IA 1ZY4A 2QOQA 3CY3A 1RDQE 1YQJA 4OGRA 2PMLX 1QMZA 4MNEA 4OUCA 4XMOA 2H8HA 5HCZA 3EFWA 4FEXA 3EWHA 4PP7A 3LLTA 3EYGA 4JOAA 4U41A 5EYCA 3ATTA 4DG2E 4UMPA 4HCUA 4FV4A 3CGFA 4XH6A 2R3NA 3T3VA 4EBVA 2J5FA 4QYYA 5FXRA 3FXWA 1GNGA 5HLPA 1RW8A 2YJRA 4KAOA 2W9FB 4LGDA 3ZCLA 4ALUA 4FKSA 4XG6A 4HPUE 4FGBA 3BWJA 2VTAA 3O2MA 5DE2A 4BDJA 4CT2A 4BHZA 5KHWA 2BDJA 2YLEA 2UZEA 2C1BA 4E4MA 3BGPA 3L1SA 3UIMA 1PXNA 3HRFA 3RK5A 2VTOA 2YAAA 4O91A 2A1AB 3E5AA 5G1XA 5C4KA 5EYKA 3O7LD 1OIRA 4TYHA 3QL8A 1BLXA 3NNXA 4F7NA 2PHKA 4AA4A 1UKHA 3U8WA 3QBNA 2YM7A 5AP5A 4ALVA 1OGUA 1AGWA 2OWBA 3G6GA 3BCEA 4N6YA 5EW8A 5K0XA 3LFEA 2W5BA 4C3PA 1P4OA 3GU8A 2CGXA 5FBOA 4YO4A 3ELJA 3C5UA 2R3PA 4EH6A 2ITVA 4M0ZA 4DGOA 4G1WA 4MD7E 4XEYA 3T8OA 3FPQA 3VC4A 4E1ZA 1KE5A 4IANA 5AMNA 4AQCA 4DYMA 4ZSLA 3LFFA 4BYIA 4BBEA 1GOLA 4RFZA 3CQEA 3OD6X 3QYWA 4Y8DA 4EK8A 3QTRA 5EG3A 3WE4A 4HVSA 3PP0A 3Q32A 1OPKA 2Q0NA 2VD5A 1IEPA 2HWOA 1ZMVA 3RNIA 3IW6A 3UO6A 4AXAA 4CFVA 3HP2A 2C5XA 2XM8A 5DRDA 4EORA 4F6WA 3E64A 4MNEB 3HL7A 4JXFA 4FK6A 4BTFA 3QGWA 5ANGA 2B7AA 5DG5A 4NWMA 3LHJA 2X2KA 5AAFA 2GHGA 2OU7A 2UZOA 3IS5A 3PXKA 3DJ6A 4A9SA 5DOSA 4ZJVA 5KMIA 2OJIA 2C5YA 4Q2AA 3HA8A 2OW3A 4WNMA 3O17A 4AUAA 4W4XA 2UVZA 2QOHA 3OTVA 1OB3A 4HGLA 4K11A 4AN2A 4DGGA 2QO7A 1JWHA 2RG5A 3HV5A 2XKFA 4YJRA 2O2UA 3UYTA 5HTBA 2DYLA 2E9OA 4FNXA 3EKKA 4UV0A 5JFSA 2ITYA 4H36A 2R7BA 2NRYA 3DB6A 4GJ2A 1YDRE 3F2RA 5IA5A 3OC1A 5M53A 3D5UA 3COIA 3ZS5A 1SZMA 2JFMA 2YWPA 5GINE 3NCGA 3OWLA 1PYEA 4GJ3A 4QMVA 2HK5A 4ASXA 3HMNA 3AC1A 4IAKA 4JDKA 1GZOA 3MDYA 2P3GX 4IVAA 3AC3A 2WQBA 3IDBA 1ZYLA 1Q3DA 4TYHB 4F09A 4EYMA 1ZAOA 3VQHA 4FSTA 4RC4A 5J9LA 3PDTA 4JDHA 4YBJA 4BDAA 4J52A 5KMNA 5KKRC 2BZHB 3AG9A 4AF3A 3FUPA 2ACXA 4U42A 1XBAA 3UVRA 3TNHA 4MH7A 4U3YA 5TT7A 4GYIA 5IA4A 5A4QA 2YCRA 5AR3A 5M08A 4I6BA 4ORKA 3R6XA 4IAZA 5FM3A 1OKYA 5DLSA 2IVSA 2OZAA 3MTFA 3Q5IA 3FXXA 4Y73A 3S3IA 4A9RA 3UGCA 2CPKE 4C4JA 1BUHA 4LRKA 5AR2A 4FZFB 4F4PA 1WVXA 3KCKA 4U6RA 3R9OA 5IH4A 3NYXA 4W4YA 5LMKA 5D9HA 3PXZA 5AP3A 4QPSA 4E4XA 3OXTA 3PWYA 4FBXA 5EI2A 3ITZA 3ZFXA 2J51A 3CQWA 1H8FA 2HY0A 1OBDA 3CS9A 1Q8YA 2UW6A 4XX9A 3KEXA 3F3UA 5CU0A 3ZO3A 2ETRA 5JGAA 3GU7A 4R7HA 1ZOHA 3TT0A 1QPCA 4TW9A 2ITWA 4ZAUA 3NAXA 5JFXA 2IZSA 4YHTA 4JG8A 4ASZA 2QOCA 3ZRKA 2ZJWA 1F0QA 3Q6UA 3W1FA 3TM0A 3OXZA 2XZSA 1KE8A 4P4CA 4DINA 4EOSA 3GFEA 4QO9A 3LCDA 3HV6A 4JAJA 4M66A 4EH3A 1XH9A 3QFVA 3GC7A 5KBQA 3H30A 4YPDA 3E8EA 1W98A 4EHVA 5L6WL 3ANRA 4ZSGA 4BBFA 4FKQA 4L46A 4QP4A 4FE2A 4YLKA 4GT4A 1MQBA 5I9UA 4C58A 4H58A 1A48A 4D55A 4A9YA 3MFSA 3VAPA 3GC8A 5EQPA 1GAGA 4HCVA 3BKBA 2JIUA 4JAIA 4ACMA 1FVVA 2R7IA 4JLCA 4R6VA 4TPTA 1M7NA 4J7BA 5AR7A 3G9NA 3DK6A 2OZAB 5A14A 2XBJA 2BDFA 2VWYA 3IGGA 2YHVA 3OOGA 1CKPA 2PTKA 4FKLA 4MF0A 3BWFA 1XH4A 4BDKA 4EC8A 4JRNA 2QOKA 3KK9A 2UW8A 2CMWA 3RZBA 4F63A 1XBCA 3QQGA 3VN9A 1SNUA 4OT5A 3ALOA 3NWWA 2P2IA 2BRBA 2WGJA 4TWPA 3S0OA 3LXNA 3PY1A 4LUDA 3H9OA 4HVIA 2UZDA 3OT3A 3QTQA 2X8IA 4FKWA 2WTKB 3AC4A 4O2PA 1R78A 2QC6A 4J8NA 5IQEA 4Z16A 5HLNA 3NZ0A 5IQIA 3JR1A 1LR4A 5A4CA 3PXFA 2XNGA 5CAPA 3L9LA 3BRBA 4MF1A 4AOIA 4H3QA 4G3EA 3NVMB 2CN8A 3OHTA 3KCFA 1JSTA 1AQ1A 3LLAA 4BFMA 3VUMA 1W8CA 2EXMA 2YDKA 2ITZA 1WBVA 2J90A 3BELA 4YJPA 3GCSA 3NUAA 4GT5A 5HESA 2O63A 4TYIA 1XKKA 3R7UA 2W1CA 4G3FA 3TN8A 2C6EA 3CTQA 5EYDA 5GHVA 3MJ1A 1BI7A 3CKWA 3EZRA 3U6IA 4G3CA 4D2SA 2XH5A 1OIUA 4X0MA 3DBFA 2RFSA 5F20A 4QP6A 3ULZA 5CZIA 1VZOA 2HCKA 1G8SA
chains in the Genus database with same CATH superfamily
3MW1A 1MRVA 1ST0A 5CU4A 3FLSA 5HVJA 2H34A 5IUGA 4FKOA 5E90A 2X6EA 3GGFA 4IZ7A 2BZKB 3S4QA 2CNUA 4OTQA 4CTBA 2FH9A 4LL5A 4ZTSA 3L9MA 1ZMUA 2VTLA 5CQWA 4KRDA 1Q8WA 5AV4A 4XG7A 3NIZA 2RGPA 4J97A 2OF2A 2QURA 4AT5A 5CEOA 2JGZA 3HDMA 4HZSA 3AMAA 4QYHA 3ZMMA 3HUBA 4V01A 4ZTRA 3RPYA 5HIDA 4B6LA 5L2WA 5KMOA 3MFRA 3MESA 3E8DA 3LFSA 2QCSA 4FVPA 2WQEA 5JN2A 1FMKA 4NKAA 5J8IA 4YO6A 4WUAA 5FLFA 3PY0A 1XHAA 3LVPA 2R9SA 3MH1A 3POOA 3QA0A 4QMXA 1XMMA 2EU9A 3SRVA 1TQPA 2UW4A 2XCKA 1JSUA 3A61A 4GCJA 4M12A 3VUTA 4YJSA 4FVRA 4FSYA 2XIRA 1ZARA 3B2TA 4FTLA 5IMXA 3TV6A 3IPHA 3TCPA 4I21A 5CAOA 1YXXA 2PMOX 4IW0A 3BEAA 2BILB 2YN8A 2B9JA 4O6EA 3A8WA 4I4EA 4ZLOA 2W06A 2GCDA 4CV9A 3BBTB 4RC3A 4C3RA 2CLQA 2ETMA 4MX9A 1PYXA 2CGWA 3TG1A 1WBTA 3P0MA 3PUFC 2QU6A 2C6OA 4WSQA 3ANQA 5C27A 4OAUC 3VRYA 4ZTNA 5GJGA 1IA8A 4BDHA 2CKOA 4CFNA 4ZLYA 2GQGA 4CG9A 3NW6A 3DOGA 4F9CA 3FV8A 2YABA 4WKQA 4JQ8A 3MVJA 3BBWA 1Q99A 1H1SA 5LOHA 4FL3A 5EHLA 2R3LA 4FGRA 3OWKA 4AWIA 5BUEA 4LV5A 2V0DA 1G5SA 3ZRMA 2Z7LA 3OCTA 4NTTA 3KMMA 2WNTA 3TZ9A 4L6QA 4PPCA 2J0IA 2XNMA 2UW0A 1G8AA 4X3JA 4WRSA 4XCUA 3EHAA 4RVTA 2GNJA 3TXOA 4S2ZA 2XMYA 4EJ7A 5K3YA 4Z9LA 1R0EA 3ZYAA 4BKZA 4C4HA 3UDTA 4K9YA 1CKJA 4AGUA 2X2LA 4H05A 3KQ7A 5HG8A 3DAEA 3QX4A 3R21A 4FUXA 4I4FA 1VR2A 4LMNA 3OP5A 5CS6A 3L8PA 3VW8A 3QRUA 3SRVB 2GU8A 4EQMA 5LWNA 4YU2A 4O0SA 5HEZA 1H1QA 5L2SA 4S34A 3TKHA 3HUCA 4Z7GA 2PPQA 3COMA 3FMMA 1YOMA 5FD2A 4CQEA 3W0RA 4FV3A 4ID7A 5C8MA 3DJ7A 3V5WA 2O5KA 2QHNA 2X7GA 3OCGA 4LI5A 3BU6A 4PUZA 4XG9A 4B8MA 5M57A 5EDPA 4R78A 3RI1A 4FZ6A 4E7WA 4V04A 2OJJA 4GRBA 3K5UA 5CX9A 1K2PA 4O1OA 3H4JA 4WSYA 4MXYA 3SG8A 3PLSA 4DFYA 4FSRA 2UV2A 4CFUA 4HW7A 3RBWA 3EB0A 5EDRA 1CKIA 5HNBA 2PVJA 2QKRA 4FICA 4W4VA 3HMMA 4ZEGA 3SHEA 2VWWA 5IQAA 4BKYA 3Q5ZA 2UUEA 2WMXA 3MI9A 1APME 2W17A 2ZM4A 4FRFA 4U45A 2PZIA 2QLUA 4CZTA 5HTIA 5AJQA 3TZ7A 4GK2A 3LFDA 4ZP5A 4Y5QA 3VNTA 1OL7A 5CU6A 5I0BA 3UPXA 4QQCA 3F82A 4ANBA 2Z8CA 4E5BA 4AOJA 2UZNA 4FV9A 2VGOA 2I0EA 4L53A 5BV3A 3JVRA 3DZOA 4XG2A 3UVQA 4FSQA 2W4OA 2XF0A 1NY3A 1YOLA 3II5A 3NGAA 1NVSA 2AQXA 3F5UA 5AIRA 4HGSA 4N70A 4DFLA 3IONA 3UNZA 2J0LA 4XOYA 4CLJA 1KV2A 4FTUA 4MKCA 3W0PA 4ZSAA 3DTWA 3VF9A 3DK7A 4BWKA 2HWPA 1IAJA 5TOZA 2CCIA 2QG5A 3FLQA 4OTDA 4MXOA 5E8XA 3BQRA 3V8TA 3EL8A 5DRBA 3IW5A 3QZGA 3UIXA 2QQ7A 2OKRA 5HG7A 2XVDA 2Y6OA 5CSHA 4C38A 4FL2A 4IAFA 4X21A 4YC3A 3VRZA 4AT4A 4L01A 3FSKA 2FSOX 4CGAA 3R9HA 1PMVA 4O0XA 4CVAA 5AX3A 4JI9A 2V22A 4HYIA 5GJFA 4DF3A 5JEBA 1NW1A 1NVQA 4FTRA 4W4WA 5HO8A 3SXRA 4YSJA 2JBOA 4OBOA 2RFEA 5CF4A 2QD9A 4HYSA 5KHXA 3IDCA 3DS6A 3UO4A 4GK3A 3I5NA 1MUOA 3GNIB 1GZ8A 3GP0A 4QTDA 3DXQA 5AUUA 2ZB1A 3EZVA 3NUUA 3B8RA 4ITJA 3LMGA 5ACBC 3OROA 3GQLA 2W99B 5AP6A 3PIXA 3TKUA 4CYJA 4DH3A 2PYWA 2UZVA 4BDFA 5ANDA 3DA6A 1I09A 3BE2A 4M97A 4HNIA 5IISA 4WO5A 2J0JA 3ZUUA 5DEYA 5CEPA 3P5JC 5IQFA 5IA0A 5J79A 4O7SA 1IR3A 3MH2A 5IKWA 1W82A 4IM0A 3R8LA 3IG7A 1HCLA 3UNKA 1BKXA 4I5HA 3EFLA 2YM8A 3Q2MA 3RCJA 5AUTA 1J1BA 5HO7A 4Z7HA 3ZONA 3KREA 5HIBA 4G34A 1PJKA 4RX7A 4F1MA 5FBNC 2W05A 2QHMA 4AXDA 5AP0A 5M44A 2VUWA 4W9WA 2VTTA 2GMXA 4CYIA 2EXCX 3Q04A 2PVNA 4WT6A 1YHVA 3EJ1A 4MTAA 2XNOA 3BI6A 4G5JA 4IZAA 4UALA 5HD4A 3GVUA 4IC7A 3KXZA 4FZDB 4KSQA 4MD8E 4F9YA 3AC5A 4OTWA 1J7LA 3SW7A 3RWQA 4G3GA 4AQKA 2BRHA 4F7SA 5CANA 4M13A 4TNDA 1DAWA 4DG0E 4MEDA 5L3AA 3NS9A 3WF8A 3OY3A 1JKSA 1W0XC 4CFFA 3GCPA 5HTCA 2IZTA 3PE2A 5EDQA 4DG3E 4XRJA 4K77A 4EOOA 1UA2A 3MB7A 1JSVA 2B53A 5T68A 3UIBA 5KO1A 3AGLA 5A9UA 3FEGA 2CCHA 2H9VA 5K4IA 5DT0A 1YW2A 4GVJA 5B7VA 2R3MA 4MXAA 4W9XA 4L52A 1L8TA 4R3PA 3EFJA 3TACA 3R01A 2EVAA 2VZ6A 1PMUA 4L68A 5JK3A 3QZFA 2J0MB 2P55A 4YUQA 2FSLX 1IA9A 2PUPA 4O86A 3CTJA 4JJRA 4FKJA 3F3ZA 1JBPE 1YXSA 4XLVA 3ZHPC 2BAKA 3O8PA 4DCAA 2OBJA 3KMUA 3PRIA 3D4QA 4BB4A 2CKEA 4BCHA 3ROYA 3VS5A 3R0TA 3DBEA 3TUDA 3GCVA 4GG5A 4PMSA 1JKLA 4QQ5A 3W0OA 3GC0A 2GNGA 1AD5A 1Q8ZA 3CR0A 4QMWA 4BDCA 3W2PA 2XKCA 2IN6A 5HE3A 3PA4A 4JQ7A 4PWNA 3FKOA 2EUFB 2WTWA 2SRCA 3R7OA 4PNKA 3C4XA 2YM5A 3PXQA 4NM3A 3BU5A 5AUWA 1Y8GA 3N4VA 1ZOGA 4RSSA 4O82A 4KIOA 4IBMA 4GU6A 4I6QA 2ZAZA 1Q61A 3C0IA 2W4JA 4RJ5A 5KZ0A 2HXLA 2X4ZA 4A9TA 4WIHA 3QUDA 3PWDA 3I1AA 1WBWA 5AA9A 2LGCA 3UIUA 1ERKA 3SXFA 3WIKA 5FTOA 4BCOA 4PRJA 3RTPA 4F65A 5H8BA 4DTBA 4RGJA 1CMKE 2V7AA 3FL4A 4UEUA 3OBGA 4O83A 3LMHA 4MNFA 4OTRA 4DEBA 5CT7A 4FT5A 4CG8A 2G2FA 3DDQA 4AS0A 4QP1A 5EH0A 5IDNA 5ETFA 5HCXA 5K4JA 2VTIA 2FGIA 4BCJA 3PIYA 4AN3A 4XG4A 1KV1A 3O0GA 5D11A 5LMKC 3MA6A 3PVUA 4J99A 2J9MA 3K3IA 3FY0A 4YC6A 4BDEA 2VAGA 3QTXA 1ATPE 4X2KA 5HBJA 4Y5HA 3WYYA 2R3RA 5TF9A 2IW9A 2C47A 3IW7A 3RHKA 3D14A 4P5ZA 3ZLXA 3MS9A 5F1ZA 5M09A 5HNIX 1YHSA 4IM3A 1QL6A 3QD3A 1OKZA 4FV8A 2PVYA 2ZOQA 4RJ8A 3F7WA 2C6KA 4JQEA 1Q5KA 1U4DA 3D2KA 3SQQA 4GV1A 3NNUA 4MXCA 3TMOA 5CT0A 4L3PA 3UQGA 3UYSA 5TKDA 5EM5A 5KUPA 2QOOA 4IZYA 4JNWA 3AKJA 2UZUE 3ZOSA 4RVKA 5H8EA 5JQ8A 2XIYA 2W1HA 3KU2A 3ZU7A 4MQ1A 1URWA 3SX9A 4UZDA 3RGFA 4WOVA 4BTMA 4TL0A 3WZDA 3HKOA 4O0UA 2WFYA 4O2ZA 2NPQA 3V6RA 4GSBA 4L7SA 3TNQB 2IW8A 4FTOA 5G6VA 4NYEA 2XNBA 4PPBA 2G2HA 4DFXE 2B9IA 3KC3A 5HU9A 3GUBA 3ACKA 4CMUA 1TQIA 1ZZLA 3FYJX 3H0ZA 3JYAA 3O96A 4U3ZA 3HEGA 3IO7A 3HECA 3ORZA 3Q4ZA 4DITA 4LGGA 5A4LA 2VX3A 4CMOA 2W4KA 5CXZA 2C5NA 4V05A 2JDSA 4B4LA 2GNFA 4G6LA 4QTCA 3FDNA 5ACKA 4IC8A 5IA2A 4OTFA 3DFAA 1E1XA 3FJQE 5K0KA 3Q6WA 3RCDA 4D2PA 1KWPA 4EZ7A 3LFAA 3I79A 5DYJA 4EKLA 2BRGA 2WMWA 3QZIA 4RMZA 3MWUA 2PULA 1SVHA 3HMOA 3QC9A 2X7FA 1BL7A 1XQZA 4L3JA 4YLLA 4GKHA 5E9EA 5AV1A 2YEXA 4QQTA 3WYXA 5JRQA 5A4TA 1H1RA 5KX8A 2REIA 5T6KA 4UB7A 2OXYA 4UYNA 3MVHA 2RFNA 4CKIA 4J1RA 2BFYA 4BZDA 3D5XA 3FMHA 1RE8A 2PZPA 2QO9A 3IQ7A 4E4NA 4BCKA 5BNJA 1M17A 2X0QA 3NYVA 4TT7A 5AA8A 3BLAA 4GEOA 1W2DA 4UZHA 2BKKA 4QEBA 1TFFA 3P7BA 4CD0A 5IUHA 1SVGA 1XMLA 3LJ2A 3QXOA 4WG3A 3UJGA 4BRXA 4DH5A 3E8NA 3GXLA 3E63A 5EK7A 3UE4A 3CD8A 4I5MA 4YJNA 4D2VA 1OUKA 4Z55A 1H24A 4FKRA 4O6LA 4I6LA 5DT4A 4IJPA 3MN3A 5KMKA 1ZYCA 2NP8A 2WEVA 5GZ9A 1KE6A 3PVBA 4GFOA 3TUBA 3L9NA 3OEFX 4RQVA 5AAGA 2BIKB 2GNIA 3BU3A 3LJ1A 3V01A 3QQKA 4X7QA 1ZLTA 5EYMA 4N57A 1IRKA 3HNGA 3FMKA 3AQVA 3FXZA 3PA3A 4H1JA 3G51A 1U54A 1VEBA 3COHA 4RWLA 2X0OA 4OAVB 3RHXA 2WMUA 4XG8A 3TIZA 3ODYX 3VVHA 4YJVA 4CCBA 1U59A 2BZIB 3QAME 3PA5A 3V8SA 2JKQA 4U79A 2I0HA 1LPUA 3IOKA 5EOBA 4D58A 3UQCA 1XH5A 5HOAA 3E88A 2WQNA 4F7LA 2OJFE 4KRCA 4X6QC 4CFXA 3BYSA 5EKOA 5HI2A 3ZM9A 4GIIA 1ZYSA 1XJDA 5J5TA 5CZHA 2WELA 4R1YA 3TJDA 2VWIA 2X8EA 4ZK5A 3FMEA 4NEUA 5H8GA 3LM0A 3E87A 5CEIA 3A7FA 1Q41A 4EONA 4CRLA 4O7ZA 4FF8A 3JS2A 4BGHA 3F3WA 1SMHA 2XUUA 2CSNA 2F9GA 3DLSA 3G6HA 5FUTA 4II5A 2GHMA 1KOAA 4TYGA 4EOIA 3KY2A 3R63A 3NYNA 4I6HA 4NH1A 2X4FA 3FC2A 1J7IA 2B0QA 3NIEA 3GQIA 4IFGA 4NTSA 2HY81 3FI2A 4O7LA 1EH4A 3HGKA 5E8ZA 4RWKA 3CE3A 2PL0A 2YA9A 2C0OA 2ZV2A 4AOTA 3BLHA 3ATSA 4YHJA 5L4QA 5BPYA 3KMWA 2VNYA 2I0VA 3ETAA 2NNWB 3I0QA 1YI4A 1JPAA 4ZS0A 3OWPA 3P5KA 5HBEA 2AYPA 1PF8A 3SW4A 2O0UA 5DA3A 2E9NA 3K5VA 3VUIA 5I3RA 5M4UA 1WBPA 1YXUA 4UWYA 3N4TA 1DI8A 1FOTA 3PJ3A 4OTGA 1IASA 1UNLA 2VWBA 3LXLA 4ZTMA 2HYYA 2I6LA 4BJJA 4GH2A 2VV9A 3D9VA 1U54B 4WA9A 1PKDA 3BIZA 3EQIA 3QD4A 3OOMA 4FIEA 3DAJA 3V51A 3VS3A 5IDPA 2JKMA 2Z60A 2B1PA 4GS6A 4Y85A 4LQMA 5BUJA 4DHZA 4FYOA 5LWMA 5D41A 3MIAA 4RVLA 3F88A 1UU3A 1TKIA 2P0CA 2FVDA 4E6CA 4G3DA 4QP8A 3KN5A 3QHWA 3V5LA 2O8YA 1KSWA 4QMZA 4ARKA 3UNJA 3BPRA 3R1QA 4FG9A 2CN5A 5AFVA 2WU7A 4C7TA 4LM5A 4P7EA 3H0YA 2G01A 5FQDC 3DB8A 3U55A 5LARA 1OBGA 3SKCA 3OG7A 5CALA 4O4DA 5ANIA 1LP4A 4IEBA 4K8AA 1H25A 4GL9A 4JG7A 4QYFA 3FKLA 4KIKA 2XALA 1H00A 3AMBA 4QMYA 3W32A 2G15A 3ALNA 4FIIA 3NW5A 4KSPA 2IPXA 2JDVA 1XR1A 2PWLA 2OICA 3E7OA 4U40A 5F95A 3BLRA 2BDWA 3JVSA 4FV5A 5H9BA 5LQFA 3DFCB 2HELA 3QRIA 4K0YA 3VUDA 1P4FA 5E1SA 4USFA 4AG8A 1KE9A 1O6KA 3F2NA 4PDPA 5HO6A 3R22A 4EH9A 3D5VA 3FWQA 4BZNA 3UP7A 4F0IA 4IX6A 4E26A 1PMEA 1UU8A 4EZ5A 3KVXA 1GIIA 3D5WA 2XEZA 4L9IA 4BCFA 3C4EA 2W1GA 5TR6A 1LEWA 4UBAA 3VO3A 4N6ZA 4FSUA 4XUFA 3KK8A 3UO5A 2CDZA 3O71A 4BJJB 2BUJA 4C34A 4WNKA 5CAUA 3WZJA 4OT6A 4YTIA 3QXPA 2JDTA 3QUPA 1SM2A 4QTEA 3VBYA 3EN9A 5EQEA 4NW6A 2C6TA 3SD0A 3IOPA 3WZEA 1OIQA 3TNIA 3U9NA 4IWOA 3UC3A 4F99A 3EQBA 3UZTA 1MP8A 2XK4A 4FKGA 4AZFA 2DS1A 2C3KA 3E8CA 3FC1X 3DKCA 3DDPA 1ZMWA 4P90A 3KIOC 4U9AA 2BKZA 3R8PA 4RJ7A 2Y4IC 4YP8A 3E62A 5BVEA 5KCVA 4QT1A 3Q53A 2XRWA 5JT2A 2VWVA 4LGHA 3DXPA 4M0YA 3DT1A 1H0WA 4PY1A 4F9BA 5DEWA 4G17A 4C57A 3SXSA 3V3VA 3MBLA 2IF8A 3F9NA 3NDMA 4UYAA 2CGUA 3P78A 4BDIA 4DHIB 2QU5A 3TEIA 4KIKB 4DH8A 3FQSA 1OVEA 2X81A 1MQ4A 2VTSA 4Q5HA 4O7RA 3QKKA 3R7EA 2W5HA 3CTHA 4I6FA 4AZEA 3MVLA 3LPBA 3DQXA 3W0QA 2OH4A 4LRJA 3I81A 4C37A 4IDVA 2YIWA 4IQ6A 4IDTA 4IHPA 2AUHA 4G6NA 2WTDA 3M2WA 5CF5A 4UMUA 1Q8TA 1REKA 3UOHA 3TZ8A 2A2AA 3L8XA 4DA5A 1B6CB 3MH0A 4GFGA 5ICPA 2HZ0A 3I7CA 3DK3A 4KABA 4R8QA 3UOKA 3HV7A 1Z57A 3UZPA 4GK4A 2YDIA 2ZMDA 3BHUA 4YLJA 3VHKA 3AOXA 5FDPA 2X1NA 4L67A 4S30A 4YURA 4YZBA 3ZBFA 3R9RA 4A9UA 2QOLA 4EWHA 4DBNA 3FQEA 5IZFA 2C5VA 4YNEA 2WB8A 3RP9A 4AW2A 2WMVA 2YCQA 4L8MA 4H39A 4JBOA 2E9VA 4O22A 5LVNA 2PUIA 1YWRA 5CEKA 2C6DA 2YCSA 4FTKA 5B2LA 4D2TA 2PUNA 3G15A 5IQGA 1OZ1A 1PXIA 1Y6AA 2KTYA 4AGCA 5A6NA 2FO0A 3EH9A 2IVVA 3ZLSA 3UOJA 4JR3A 4FTQA 4BHNA 4JS8A 2OIQA 2GFSA 2WD1A 4CQGA 3FQHA 5IEYA 3DKOA 4UN0C 4QMSA 2OFUA 5HX6A 5IPJA 3MPAA 4WD5A 5CVGA 4HVHA 4GU9A 4F0GA 3MY5A 4TTHB 2VGPA 5ANOA 5ITAA 2X7OA 3SGCA 3NR9A 3AKLA 2XK6A 5L2QA 4C33A 4D1SA 4ALWA 2XEYA 1SNXA 1OPJA 4IX5A 2CJMA 4EHEA 4EWQA 3QX2A 1JLUE 1R3CA 4L44A 5BVKA 3A4PA 5CF8A 5HORA 4B0GA 3PRFA 4DDGA 1BI8A 1GZNA 4IVCA 5C8KA 2XIXA 3VS7A 4OBQA 4XV3A 5FG8A 3CY2A 3D7ZA 5AX9A 4EK5A 4FSZA 3PJCA 4ZJIA 4ANSA 4F1OA 5J9YA 2XM9A 5J7BA 3D2IA 5CXHA 5BMMA 3TZMA 4ACCA 4BWPA 5BQ0A 3WOWA 1WBNA 4CSVA 4C8BA 2F2CB 3D0EA 3AMYA 3MPTA 3OUKA 1OIYA 4GVAA 1ND4A 2PSQA 3TV7A 1XBBA 5JSMA 4ZMEA 4XJ0A 2WMSA 4O0TA 3LZBA 3NNWA 3P7CA 2XK3A 3F5PA 4QYGA 3VS1A 3A62A 3W8QA 1NT2A 4ITHA 3VONA 3PXRA 4HYUA 5JZJA 3LCOA 4YTCA 1UWJA 3GOPA 2VO7A 3FKNA 1M52A 3I5ZA 3FAAA 4FT9A 4FV1A 1YKRA 1V0BA 1W7HA 2B55A 4QRCA 3AC8A 4KWPA 3COKA 3HV3A 4O4EA 2PUUA 4YZCA 2B4SB 5CNOA 5EI6A 4EOPA 3F66A 3Q9WA 1H1PA 4K1BA 5IF1A 2X39A 2R3FA 4XRLA 4EK6A 2NRUA 1OMWA 2F7EE 3LIJA 4O38A 5E1EA 1P2AA 2QR7A 2Y7JA 2Y9QA 3ZEWA 3F2AA 5FP5A 3MV5A 4PPAA 4RJ3A 5I9ZA 2ITOA 3UG1A 4AE6A 3QKLA 4H1MA 5A6OA 3AGMA 2XA4A 2R64A 4H3BA 4A07A 2OI4X 3P23A 4B9DA 4R7BA 3Q3BA 5LJJA 4HCTA 1Q24A 3PPJA 5HE0A 3QQJA 4RX8A 1WAKA 3LXPA 4QNYA 3C9WA 2ITQA 2JDRA 5AR8A 5LVOA 4DDIA 3O50A 3ZUTA 3RJCA 3QRJA 4LOOA 3SAYA 4GYGA 5HVYA 4UMQA 3WZKA 4IWDA 3A4OX 4RA4A 3BZ3A 5D10A 4D9UA 1WFCA 4RWJA 1YVJA 4R5SA 3G0FA 1XWSA 3R71A 5K9IA 4BDGA 4CNHA 1UKIA 3EQGA 5HIEA 3PG1A 4EKKA 4APCA 1Q97A 2BHEA 2GDOA 3QA8A 5FWKK 1ZY5A 3CCNA 4MBLA 2XKEA 5KMLA 4NIFA 2VU3A 3PZHA 4CEGA 4ACHA 4FTNA 4ONAA 1Q4LA 4XV1A 1YDTE 5E8YA 2YISA 2X9EA 1JKTA 4XOZA 2WPAA 2DUVA 4O0YA 2HXQA 4C4GA 3QU0A 4O84A 3VS0A 3LQ5A 3QKMA 4P5QA 1ZWSA 5HQ0A 3ZC5A 4RT7A 3ORXA 2VO0A 3OFMA 3OW4A 4C4EA 1UVRA 3ORLA 4RIOA 3NUPA 5M4IA 4TRLA 3HAMA 3E93A 5JGDA 4AP7A 4HZRA 4FEUA 3DKGA 2F2UA 2VTJA 4QMLA 3F5XA 2IO6A 5KE0A 2P33A 2OK1A 1Y6BA 1PXOA 3R30A 2UZWE 4ZJJA 4PTGA 5AP7A 3QTZA 2J4ZA 2YLFA 4O0WA 4D2WA 3Q52A 5BMSA 5LVPA 2XYUA 3K2LA 3BX5A 4MHAA 4OTIA 3DXNA 3WZUA 4EK3A 4FSMA 4ASEA 4DT9A 2XKDA 2BFXA 4KBAA 2QOIA 3LCSA 3R7IA 3TTIA 4HVGA 4ZS4A 3LKMA 2UW9A 2XBAA 4C02A 3BV2A 2AC3A 2YIQA 5BX0A 4HPTE 3FMDA 4IVBA 4O27B 5EW9A 2W1EA 5LMAA 2X6DA 4GKIA 4X2NA 1PW2A 3HRCA 4KB8A 3V04A 5AP4A 1QCFA 3FE3A 2ZV7A 4CMTA 5IMEA 3ROCA 3K3JA 3Q96A 2ESMA 4U44A 1OECA 4W8DA 2BRNA 5E8VA 3ZM4A 5J7HA 5M4CA 3EQFA 5JGBA 2F57A 4FTMA 3CLYA 5FGKA 4DFNA 3R9NA 2Z02A 4I3ZA 2O65A 4DH1A 3DNDA 4MK0A 2Q83A 4F78A 4NIFB 3QCXA 2OSCA 4JT3A 1ZYJA 4Y46A 5HBHA 2JEDA 3QWKA 2WIPA 5CNNA 4ZXTA 3D7TA 4BI1A 4HOKA 4V0GA 3NEWA 3DQWA 3SOCA 3KRJA 4A7CA 3QTUA 4R3RA 3ORKA 4G16A 4J98A 4YMJA 3PZEA 3UOLA 1NA7A 3W2CA 3O5AA 4QMTA 3ZSGA 5M4FA 2W9ZB 1BL6A 1OKVA 5I3OA 4UWCA 4RWIA 1CDKA 1NXKA 3UG2A 3A7HA 4D1XA 1M14A 2XB7A 5EM7A 4D9TA 4DTAA 2R3QA 2Y4IB 3AT2A 4WRGA 4NM5A 4C62A 4Q5EA 2G1TA 2EB2A 4RLLA 3FY2A 4QMMA 4GW8A 2QOBA 4NZWB 3B8QA 1CTPE 3CPBA 3R7GA 5CY3A 1TQMA 2JC6A 5EFQA 5A3XA 3VBQA 3SDJA 4C4FA 3CD3A 2FSTX 4Q9ZA 5EQYA 2HW6A 4FV6A 5DWRA 4HVDA 4QP7A 4ZTQA 3SC1A 3U51A 4BY9E 1WCCA 4AW1A 4PP9A 3LFNA 3KRXA 4K6ZA 3TUCA 2RIOA 5CSVA 3PSDA 3HYHA 5AUYA 3C50A 3OY1A 4L43A 5KZIA 5E8TA 3HP5A 3RAHA 4GUBA 3GCQA 4KIPA 2YZLA 1YWNA 3TI1A 3I60A 4FV0A 4EI4A 4RVMA 3DTCA 1R1WA 5AIKA 4FKIA 3GBZA 3R8VA 4UX9A 3E92A 1H08A 3OBJA 4XYFA 3BHVA 1PY5A 1T45A 4YZMA 4B99A 5A54A 5HX8A 3DBDA 4GT3A 4IH8A 1NVRA 1GIHA 3EN4A 4FODA 5CF6A 2ZM3A 2P2HA 3CP9A 4AZTA 4E5AX 3FZTA 4I23A 1DI9A 3FMNA 4FG7A 4BBMA 5GNKA 2JFLA 3MIYA 4EOMA 3NUNA 5FEDA 4IFCA 4EHGA 5M06A 3Q4UA 1PXKA 3Q4TA 3NSZA 2WO6A 4F6UA 2RFDA 3VULA 3MVMA 3AT4A 3H9RA 3NRMA 5IQDA 3ZFMA 3D7TB 4I0RA 5EW3A 4FTAA 4V0GB 4BZOA 4EC9A 4DFUA 4X3FC 1B38A 4O7YA 1RQQA 4FI1A 4U0IA 3A2CA 3HMIA 4EL9A 3ERKA 4FT0A 1K3AA 2XS0A 4RFMA 3VJOA 5LVMA 3G33A 3QLGA 4OTPA 2C3JA 5D1JA 3VS4A 2XAMA 2ITNA 3KRRA 2C6LA 5L6PA 5F9EA 3BV3A 4KIQA 3NPCA 2CKPA 4RLKA 4NUSA 4FKTA 2YAKA 2C3IB 3W2QA 2XIZA 2I0YA 4I94A 4OTHA 5FDXA 4IJ9A 4FIJA 2FB8A 5FTQA 4C36A 3PUPA 4NJ3A 1H01A 2UW7A 1UNHA 4N4SA 3ENMA 5CENA 4FEQA 3ZFYA 1XH8A 2Y4PA 4FTJA 1BX6A 4ANMA 2HW7A 4XP0A 1REJA 1BYGA 5AV2A 4J8MA 5L6OA 4IAYA 4O1PA 2ITUA 4USEA 5J95A 3NYOA 3M1SA 3R02A 4QP2A 3T3UA 1UV5A 2PVHA 3RNYA 2VRXA 4MYGA 1KUTA 3MYGA 3JPVA 4KS7A 4BTKA 2C3LA 3KB7A 3LQ8A 4IB1A 2UZBA 1OKWA 2ZDUA 3QRKA 4QP3A 4F9AA 5E92A 5IU2A 2X8DA 3G5DA 4I93A 3KN6A 4EH8A 2R3KA 4ANLA 2XP2A 4FVQA 1QPEA 5DFPA 3S95A 3BE9A 3A7JA 3ENHA 4DGLC 2Y0AA 5CAVA 5CEMA 3KGAA 4RBLA 4YZDA 4FKPA 1WBOA 2FSMX 1YOJA 3VQUA 4FC0A 3Q9XA 2CGVA 4LRMA 3NUXA 3VWAA 5DMZA 3S00A 3IGOA 2B9HA 3ORTA 5IA3A 2W1FA 4QTBA 3OCSA 1OM1A 1PMNA 2YDJA 2HZNA