3TD5A

Crystal structure of ompa-like domain from acinetobacter baumannii in complex with l-ala-gamma-d-glu-m-dap-d-ala-d-ala
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
119
structure length
119
Chain Sequence
ELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGHTDNTGPRKLNERLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADNKTKEGRAMNRRVFATITGSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein omp38
publication title Mechanism of anchoring of OmpA protein to the cell wall peptidoglycan of the gram-negative bacterial outer membrane
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Membrane protein/peptide binding protein
total genus 41
structure length 119
sequence length 119
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3td5A00
3LDTA 3CYQA 3KHNA 2AIZP 3TD5A 4G4ZA 4G88A 2W8BC 3TD4A 2ZF8A 2N48A 4RHAA 4ZHVA 3S0YA 4B62A 4ERHA 4R40B 5EB1B 2ZVYA 4ZHYB 2ZVZA 3IMPA 2KGWA 4G4WA 4G4VA 3CYPB 2MQEA 1R1MA 3S06A 1OAPA 4PWTA 4G4YA 3OONA 2L26A 4G4XA 3TD3A 3WPXA 2LCAA 3S02A 3S03A 2ZOVA 3S0HA 5EB0A 2K1SA 3S0WA 3WPWA 4ZHWA 2HQSC 5EAZA 4B5CA 2LBTA
chains in the Genus database with same CATH superfamily
3RA5A 3V4DA 4ZK7A 2AIZP 3CMAF 3LWVC 3CD6F 3KIZA 1K8AH 4RHAA 1X25A 4TV8B 1Q86H 3VYUC 2LBWA 4IIJA 3OBWA 3C9TA 3WGNA 4NUTA 3IMPA 4G4WA 5HXZA 3PAFA 3I3FA 4G4XA 1JY8A 2YYEA 2CWJA 2OTLF 5JVDA 3D54A 3JAWA 3NK7A 3ZP4A 1IV3A 1ONIA 4FFBB 5HY1A 1KNJA 3K14A 4BVRA 4RQOA 4ZHVA 1W5FA 5IJ0B 3J80M 5HY0A 5EO3A 4NQ3A 2DYYA 2R751 2ZAUA 5LOVB 3IKFA 4TV8A 4I50B 4C8EA 3CYPB 3NMUC 5FJ4C 5EZYB 1KD1H 3WJQA 3C8LA 3QTYA 2Z1UA 3HJWC 2RHHA 3EORA 2QA4F 5KX5B 1QAHA 5CA0B 3IKEA 3HTNA 2PMPA 5MN6A 1YJWF 1UFYA 3CXCF 3JVHA 3N2KB 2N48A 3MCAB 1RA4A 2HRYA 4FFBA 3E22B 5EB1B 2HRUA 3MQWA 3JCMM 1VQVA 2H8CA 5AVMA 1H48A 5GAPK 1IV4A 3MCQA 1NJIH 3WJPA 5LOVA 3JATB 1W40A 4DRXA 3C9RA 1YGYA 2LCAA 2LBXA 4EI9A 1RQ7A 3C9SA 5EZYA 1JN1A 5LA6B 1H7MA 3JAKB 2JNBA 1SA0B 5EYPB 2I6RA 3LWPC 1YJNF 1DBFA 4BT4A 3GYQA 3F6MA 2H8EA 3JALB 5KX5A 3VYSC 1UI9A 4BT3A 4EB6B 5CA1B 2RHOA 5J2TB 5JCOC 4U3JB 3K2XA 3N2KA 1XV2A 4BVQA 5EWRA 5J2UA 4LCKA 2MQEA 3E22A 3S06A 1W5EA 2HP0A 3PLAC 2BO1A 3WPXA 1N8RH 5GIOC 5FNVB 1YQNA 3LYBA 1PF5A 5KMGB 3JATA 2PHNA 3DDNA 3VO8A 3K0TA 2BTOA 5LA6A 2W8BC 1ODEA 1RQ2A 2ZF8A 1RLUA 3F0GA 1M90H 3JAKA 2Z1FA 1SA0A 5EYPA 5G4VC 3RYFB 5GANK 5JQGA 2Z01A 4O4IB 1FFXB 2KG4A 4BVSA 4EB6A 5J2TA 5CA1A 5HY2A 2QTPA 3OBYA 4U3JA 1VQ9F 3J7AR 3LMEA 4PWTA 5HWEA 3F0FA 3CG6A 5HP8A 3KJKA 5B8FA 1VQNF 3CC7F 1GO0A 5FNVA 3CYQA 1X52A 3TD5A 1W57A 5KMGA 4XCQA 3MBMA 1W5BA 2VGNA 3JASB 1U40A 4B62A 1JJ2F 3CC2F 3HAXD 4O4JB 1YIJF 2ZVYA 5GONB 1YHQF 3N4YA 1W55A 3ELCA 3RYFA 4O4IA 1GX1A 1FFXA 1YITF 2L26A 4TV9B 4BT6A 4HNAB 5EIBD 4B45A 3G6EF 1Q8RA 1W581 5BMVA 3FD5A 1TUBB 2DT4A 1VQMF 1FNKA 3I7TA 2QEXF 1Q81H 1NMUB 5IJ9B 2CVLA 1SDSA 3VI6A 4ZHYB 1VQ6F 3JASA 1Q82H 3V7EA 4C4WC 2UYNB 2P6YA 4O2BB 5C8YB 3CMEF 1OAPA 4O4JA 4LNUB 5GONA 2VAMA 3T80A 4X3LA 4WBNB 3HWUA 3S0HA 1W59A 3VOBA 1VQ5F 2AIFA 1JD1A 3OW2F 4TV9A 2OHWA 3CCRF 2RHLA 2HP3A 4HNAA 2I6DA 4O4HB 5IYZB 1CN7A 3SIUA 1VK3A 4TZZA 3NVKE 3HKEB 5IJ9A 1GO1A 5IJ0A 3CCVF 3WJRA 3M1XA 5MN5A 1K73H 3VMFB 3KE1A 3VIUA 1CK2A 4YJ3B 3CCJF 3TD3A 1Q7YH 3C9UA 3IEQA 2F9ZC 2UYNA 5GINC 2KTVA 4O2BA 5C8YA 4I50A 3G71F 3CCEF 2ZOVA 1VQLF 3QUWA 4E6EA 4LNUA 3VOAA 3RYHB 1J7HA 4B5CA 2LBTA 4X1KB 1VQ7F 3WGKA 4G4ZA 4G88A 2GVIA 2H6LA 5HXUA 3P10A 5JH7B 5CA0A 1KNKA 3VYTC 3F0DA 3ZO8A 4F6RB 5LYJB 3WGLA 4O4HA 2GLZA 5LP6C 5IYZA 3JARB 3HKBB 1QVGF 3HKEA 3O85A 1GZ0A 3N4ZA 1IPAA 3IEWA 2K1SA 3V7QA 4YJ3A 1T0KB 2CW4A 1NQ3A 4EI7A 3DC2A 3JAMM 1ZWZA 3VTIC 4TUYB 3RYHA 2VAPA 4X1KA 3UT5B 1IV1A 4O2AB 2VXYA 4R40B 5JH7A 3I55F 3JALA 2GZLA 3HKDB 5LYJA 3G4SF 1R1MA 3RE3A 3CCSF 1QVFF 3LWOC 2RHJA 1E7KA 3JARA 3S02A 3HKBA 3P0ZA 3LWQC 3J81M 1FNJA 4ZHWA 1W5AA 1FSZA 1VH8A 2NMUA 4X1YB 5JCOA 4C82A 4M8IA 2YXZA 4BT5A 1W42A 3E20B 4BVTA 3VCZA 4KWEA 1T0AA 4TUYA 1COMA 4X1IB 2HVYD 3UT5A 3WGJA 4G4VA 4O2AA 3IR9A 2Z1EA 3BYQA 5JVDB 3NVIB 2EWCA 2G9IA 3HKDA 3S0WA 3F0EA 1U43A 3KHNA 4X3MA 2OZBA 4IHJB 1X7OA 4I55B 1W2BF 2CHSA 3B6NA 4X1YA 3CPWF 3QHDA 4YJ2B 5CB4B 2BTUA 4X20B 3ESJA 3ERNA 1XHOA 4X1IA 3ON1A 3FBAA 5MN4A 2ALEA 3LWRC 5IT9M 5G4UC 3FPIA 3ZP7A 5HP7A 3WGMA 2Q1XA 2R6R1 3LDTA 3HKCB 1RLGA 3RYCB 2IG8A 3RYIB 3NK6A 1DT9A 5HY4A 1TUBA 4IHJA 4DRXB 3MDOA 3CCQF 2ZVZA 3AGKA 4I55A 1OFUA 2KGWA 2Q1YA 4I4TB 1H47A 1VQ4F 2IQQA 1W41A 2CZWA 3FFMA 4YJ2A 3OONA 4ZI7B 5LXTB 2UZHA 5ITZB 1S72F 3CCLF 5CB4A 4X20A 1QD9A 5GIPC 1VQKF 2HQSC 4BT7A 5EAZA 3P4EA 5DCVA 1X7PA 4WBNA 1VQ8F 4C8GA 5FLXM 2BTQB 2FGYA 5J2UB 3S0YA 1IV2A 2HS0A 2HS3A 2UYKA 2HP0B 3HKCA 2AMTA 3R0PA 4C8IA 2WALA 4BY9D 3RYCA 1TVKB 3FD6A 3RYIA 2B33A 4BW0B 2UYPA 3CCUF 4G4YA 2IAFA 1QU9A 4I4TA 3S03A 2FC3A 3K12A 4ZI7A 5LXTA 3E1YA 2OTMA 5ITZA 4ZOLB 3RA6A 5LP6B 3GHZA 3V3TA 1YJ9F 1Z5WA 2UYJA 5JQGB 1W3EX 3M84A 3N2GB 2CSLA 3WXMB 1CLIA 3LFOA 1JFFB 2KTUA 2HS4A 3KJJA 1PXWA 3CPQA 3SIVA 3I56F 4B46A 1KC8H 1XRGA 1M1KH 4F6RA 5A2QM 4C81A 4ZHQB 1YI2F 3Q8HA 3CB2A 1U3PA 2VGMA 4O4LB 2QI2A 1TVKA 3ZOPA 5EB0A 4U39A 1K9MH 3U0OA 1KQSF 4NWOB 5EIBC 3TD4A 2RB9A 4IIJB 1VQOF 1U3LA 4EI8A 4ZOLA 3CC4F 3D00A 5LP6A 2Z1TA 4ERHA 2CHTA 1VHAA 1Z5VA 3N2GA 1VQPF 1JFFA 4DXDA 2OTJF 1XBIA 1SZQA 2V9YA 4BT2A 2ZODA 3M4SA 3D01A 5BMVB 3GTZA 3JAWB 3L7QA 3WPWA 2VAWA 4ZHQA 3CCMF 2HX0A 4O4LA
chains in the Genus database with same CATH topology
3LDTA 3CYQA 3KHNA 2AIZP 3TD5A 4G4ZA 4G88A 2W8BC 3TD4A 2ZF8A 2N48A 4RHAA 4ZHVA 3S0YA 4B62A 4ERHA 4R40B 5EB1B 2ZVYA 4ZHYB 2ZVZA 3IMPA 2KGWA 4G4WA 4G4VA 3CYPB 2MQEA 1R1MA 3S06A 1OAPA 4PWTA 4G4YA 3OONA 2L26A 4G4XA 3TD3A 3WPXA 2LCAA 3S02A 3S03A 2ZOVA 3S0HA 5EB0A 2K1SA 3S0WA 3WPWA 4ZHWA 2HQSC 5EAZA 4B5CA 2LBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDT A;  3CYQ A;  3KHN A;  2AIZ P;  3TD5 A;  4G4Z A;  4G88 A;  2W8B C;  3TD4 A;  2ZF8 A;  2N48 A;  4RHA A;  4ZHV A;  3S0Y A;  4B62 A;  4ERH A;  4R40 B;  5EB1 B;  2ZVY A;  4ZHY B;  2ZVZ A;  3IMP A;  2KGW A;  4G4W A;  4G4V A;  3CYP B;  2MQE A;  1R1M A;  3S06 A;  1OAP A;  4PWT A;  4G4Y A;  3OON A;  2L26 A;  4G4X A;  3TD3 A;  3WPX A;  2LCA A;  3S02 A;  3S03 A;  2ZOV A;  3S0H A;  5EB0 A;  2K1S A;  3S0W A;  3WPW A;  4ZHW A;  2HQS C;  5EAZ A;  4B5C A;  2LBT A; 
#chains in the Genus database with same CATH topology
 3RA5 A;  3V4D A;  4ZK7 A;  2AIZ P;  3CMA F;  3LWV C;  3CD6 F;  3KIZ A;  1K8A H;  4RHA A;  1X25 A;  4TV8 B;  1Q86 H;  3VYU C;  2LBW A;  4IIJ A;  3OBW A;  3C9T A;  3WGN A;  4NUT A;  3IMP A;  4G4W A;  5HXZ A;  3PAF A;  3I3F A;  4G4X A;  1JY8 A;  2YYE A;  2CWJ A;  2OTL F;  5JVD A;  3D54 A;  3JAW A;  3NK7 A;  3ZP4 A;  1IV3 A;  1ONI A;  4FFB B;  5HY1 A;  1KNJ A;  3K14 A;  4BVR A;  4RQO A;  4ZHV A;  1W5F A;  5IJ0 B;  3J80 M;  5HY0 A;  5EO3 A;  4NQ3 A;  2DYY A;  2R75 1;  2ZAU A;  5LOV B;  3IKF A;  4TV8 A;  4I50 B;  4C8E A;  3CYP B;  3NMU C;  5FJ4 C;  5EZY B;  1KD1 H;  3WJQ A;  3C8L A;  3QTY A;  2Z1U A;  3HJW C;  2RHH A;  3EOR A;  2QA4 F;  5KX5 B;  1QAH A;  5CA0 B;  3IKE A;  3HTN A;  2PMP A;  5MN6 A;  1YJW F;  1UFY A;  3CXC F;  3JVH A;  3N2K B;  2N48 A;  3MCA B;  1RA4 A;  2HRY A;  4FFB A;  3E22 B;  5EB1 B;  2HRU A;  3MQW A;  3JCM M;  1VQV A;  2H8C A;  5AVM A;  1H48 A;  5GAP K;  1IV4 A;  3MCQ A;  1NJI H;  3WJP A;  5LOV A;  3JAT B;  1W40 A;  4DRX A;  3C9R A;  1YGY A;  2LCA A;  2LBX A;  4EI9 A;  1RQ7 A;  3C9S A;  5EZY A;  1JN1 A;  5LA6 B;  1H7M A;  3JAK B;  2JNB A;  1SA0 B;  5EYP B;  2I6R A;  3LWP C;  1YJN F;  1DBF A;  4BT4 A;  3GYQ A;  3F6M A;  2H8E A;  3JAL B;  5KX5 A;  3VYS C;  1UI9 A;  4BT3 A;  4EB6 B;  5CA1 B;  2RHO A;  5J2T B;  5JCO C;  4U3J B;  3K2X A;  3N2K A;  1XV2 A;  4BVQ A;  5EWR A;  5J2U A;  4LCK A;  2MQE A;  3E22 A;  3S06 A;  1W5E A;  2HP0 A;  3PLA C;  2BO1 A;  3WPX A;  1N8R H;  5GIO C;  5FNV B;  1YQN A;  3LYB A;  1PF5 A;  5KMG B;  3JAT A;  2PHN A;  3DDN A;  3VO8 A;  3K0T A;  2BTO A;  5LA6 A;  2W8B C;  1ODE A;  1RQ2 A;  2ZF8 A;  1RLU A;  3F0G A;  1M90 H;  3JAK A;  2Z1F A;  1SA0 A;  5EYP A;  5G4V C;  3RYF B;  5GAN K;  5JQG A;  2Z01 A;  4O4I B;  1FFX B;  2KG4 A;  4BVS A;  4EB6 A;  5J2T A;  5CA1 A;  5HY2 A;  2QTP A;  3OBY A;  4U3J A;  1VQ9 F;  3J7A R;  3LME A;  4PWT A;  5HWE A;  3F0F A;  3CG6 A;  5HP8 A;  3KJK A;  5B8F A;  1VQN F;  3CC7 F;  1GO0 A;  5FNV A;  3CYQ A;  1X52 A;  3TD5 A;  1W57 A;  5KMG A;  4XCQ A;  3MBM A;  1W5B A;  2VGN A;  3JAS B;  1U40 A;  4B62 A;  1JJ2 F;  3CC2 F;  3HAX D;  4O4J B;  1YIJ F;  2ZVY A;  5GON B;  1YHQ F;  3N4Y A;  1W55 A;  3ELC A;  3RYF A;  4O4I A;  1GX1 A;  1FFX A;  1YIT F;  2L26 A;  4TV9 B;  4BT6 A;  4HNA B;  5EIB D;  4B45 A;  3G6E F;  1Q8R A;  1W58 1;  5BMV A;  3FD5 A;  1TUB B;  2DT4 A;  1VQM F;  1FNK A;  3I7T A;  2QEX F;  1Q81 H;  1NMU B;  5IJ9 B;  2CVL A;  1SDS A;  3VI6 A;  4ZHY B;  1VQ6 F;  3JAS A;  1Q82 H;  3V7E A;  4C4W C;  2UYN B;  2P6Y A;  4O2B B;  5C8Y B;  3CME F;  1OAP A;  4O4J A;  4LNU B;  5GON A;  2VAM A;  3T80 A;  4X3L A;  4WBN B;  3HWU A;  3S0H A;  1W59 A;  3VOB A;  1VQ5 F;  2AIF A;  1JD1 A;  3OW2 F;  4TV9 A;  2OHW A;  3CCR F;  2RHL A;  2HP3 A;  4HNA A;  2I6D A;  4O4H B;  5IYZ B;  1CN7 A;  3SIU A;  1VK3 A;  4TZZ A;  3NVK E;  3HKE B;  5IJ9 A;  1GO1 A;  5IJ0 A;  3CCV F;  3WJR A;  3M1X A;  5MN5 A;  1K73 H;  3VMF B;  3KE1 A;  3VIU A;  1CK2 A;  4YJ3 B;  3CCJ F;  3TD3 A;  1Q7Y H;  3C9U A;  3IEQ A;  2F9Z C;  2UYN A;  5GIN C;  2KTV A;  4O2B A;  5C8Y A;  4I50 A;  3G71 F;  3CCE F;  2ZOV A;  1VQL F;  3QUW A;  4E6E A;  4LNU A;  3VOA A;  3RYH B;  1J7H A;  4B5C A;  2LBT A;  4X1K B;  1VQ7 F;  3WGK A;  4G4Z A;  4G88 A;  2GVI A;  2H6L A;  5HXU A;  3P10 A;  5JH7 B;  5CA0 A;  1KNK A;  3VYT C;  3F0D A;  3ZO8 A;  4F6R B;  5LYJ B;  3WGL A;  4O4H A;  2GLZ A;  5LP6 C;  5IYZ A;  3JAR B;  3HKB B;  1QVG F;  3HKE A;  3O85 A;  1GZ0 A;  3N4Z A;  1IPA A;  3IEW A;  2K1S A;  3V7Q A;  4YJ3 A;  1T0K B;  2CW4 A;  1NQ3 A;  4EI7 A;  3DC2 A;  3JAM M;  1ZWZ A;  3VTI C;  4TUY B;  3RYH A;  2VAP A;  4X1K A;  3UT5 B;  1IV1 A;  4O2A B;  2VXY A;  4R40 B;  5JH7 A;  3I55 F;  3JAL A;  2GZL A;  3HKD B;  5LYJ A;  3G4S F;  1R1M A;  3RE3 A;  3CCS F;  1QVF F;  3LWO C;  2RHJ A;  1E7K A;  3JAR A;  3S02 A;  3HKB A;  3P0Z A;  3LWQ C;  3J81 M;  1FNJ A;  4ZHW A;  1W5A A;  1FSZ A;  1VH8 A;  2NMU A;  4X1Y B;  5JCO A;  4C82 A;  4M8I A;  2YXZ A;  4BT5 A;  1W42 A;  3E20 B;  4BVT A;  3VCZ A;  4KWE A;  1T0A A;  4TUY A;  1COM A;  4X1I B;  2HVY D;  3UT5 A;  3WGJ A;  4G4V A;  4O2A A;  3IR9 A;  2Z1E A;  3BYQ A;  5JVD B;  3NVI B;  2EWC A;  2G9I A;  3HKD A;  3S0W A;  3F0E A;  1U43 A;  3KHN A;  4X3M A;  2OZB A;  4IHJ B;  1X7O A;  4I55 B;  1W2B F;  2CHS A;  3B6N A;  4X1Y A;  3CPW F;  3QHD A;  4YJ2 B;  5CB4 B;  2BTU A;  4X20 B;  3ESJ A;  3ERN A;  1XHO A;  4X1I A;  3ON1 A;  3FBA A;  5MN4 A;  2ALE A;  3LWR C;  5IT9 M;  5G4U C;  3FPI A;  3ZP7 A;  5HP7 A;  3WGM A;  2Q1X A;  2R6R 1;  3LDT A;  3HKC B;  1RLG A;  3RYC B;  2IG8 A;  3RYI B;  3NK6 A;  1DT9 A;  5HY4 A;  1TUB A;  4IHJ A;  4DRX B;  3MDO A;  3CCQ F;  2ZVZ A;  3AGK A;  4I55 A;  1OFU A;  2KGW A;  2Q1Y A;  4I4T B;  1H47 A;  1VQ4 F;  2IQQ A;  1W41 A;  2CZW A;  3FFM A;  4YJ2 A;  3OON A;  4ZI7 B;  5LXT B;  2UZH A;  5ITZ B;  1S72 F;  3CCL F;  5CB4 A;  4X20 A;  1QD9 A;  5GIP C;  1VQK F;  2HQS C;  4BT7 A;  5EAZ A;  3P4E A;  5DCV A;  1X7P A;  4WBN A;  1VQ8 F;  4C8G A;  5FLX M;  2BTQ B;  2FGY A;  5J2U B;  3S0Y A;  1IV2 A;  2HS0 A;  2HS3 A;  2UYK A;  2HP0 B;  3HKC A;  2AMT A;  3R0P A;  4C8I A;  2WAL A;  4BY9 D;  3RYC A;  1TVK B;  3FD6 A;  3RYI A;  2B33 A;  4BW0 B;  2UYP A;  3CCU F;  4G4Y A;  2IAF A;  1QU9 A;  4I4T A;  3S03 A;  2FC3 A;  3K12 A;  4ZI7 A;  5LXT A;  3E1Y A;  2OTM A;  5ITZ A;  4ZOL B;  3RA6 A;  5LP6 B;  3GHZ A;  3V3T A;  1YJ9 F;  1Z5W A;  2UYJ A;  5JQG B;  1W3E X;  3M84 A;  3N2G B;  2CSL A;  3WXM B;  1CLI A;  3LFO A;  1JFF B;  2KTU A;  2HS4 A;  3KJJ A;  1PXW A;  3CPQ A;  3SIV A;  3I56 F;  4B46 A;  1KC8 H;  1XRG A;  1M1K H;  4F6R A;  5A2Q M;  4C81 A;  4ZHQ B;  1YI2 F;  3Q8H A;  3CB2 A;  1U3P A;  2VGM A;  4O4L B;  2QI2 A;  1TVK A;  3ZOP A;  5EB0 A;  4U39 A;  1K9M H;  3U0O A;  1KQS F;  4NWO B;  5EIB C;  3TD4 A;  2RB9 A;  4IIJ B;  1VQO F;  1U3L A;  4EI8 A;  4ZOL A;  3CC4 F;  3D00 A;  5LP6 A;  2Z1T A;  4ERH A;  2CHT A;  1VHA A;  1Z5V A;  3N2G A;  1VQP F;  1JFF A;  4DXD A;  2OTJ F;  1XBI A;  1SZQ A;  2V9Y A;  4BT2 A;  2ZOD A;  3M4S A;  3D01 A;  5BMV B;  3GTZ A;  3JAW B;  3L7Q A;  3WPW A;  2VAW A;  4ZHQ A;  3CCM F;  2HX0 A;  4O4L A; 
#chains in the Genus database with same CATH homology
 3LDT A;  3CYQ A;  3KHN A;  2AIZ P;  3TD5 A;  4G4Z A;  4G88 A;  2W8B C;  3TD4 A;  2ZF8 A;  2N48 A;  4RHA A;  4ZHV A;  3S0Y A;  4B62 A;  4ERH A;  4R40 B;  5EB1 B;  2ZVY A;  4ZHY B;  2ZVZ A;  3IMP A;  2KGW A;  4G4W A;  4G4V A;  3CYP B;  2MQE A;  1R1M A;  3S06 A;  1OAP A;  4PWT A;  4G4Y A;  3OON A;  2L26 A;  4G4X A;  3TD3 A;  3WPX A;  2LCA A;  3S02 A;  3S03 A;  2ZOV A;  3S0H A;  5EB0 A;  2K1S A;  3S0W A;  3WPW A;  4ZHW A;  2HQS C;  5EAZ A;  4B5C A;  2LBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...