3TD5A

Crystal structure of ompa-like domain from acinetobacter baumannii in complex with l-ala-gamma-d-glu-m-dap-d-ala-d-ala
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
119
structure length
119
Chain Sequence
b'ELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGHTDNTGPRKLNERLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADNKTKEGRAMNRRVFATITGSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein omp38
molecule tags Membrane protein/peptide binding protein
source organism Acinetobacter baumannii
publication title Mechanism of anchoring of OmpA protein to the cell wall peptidoglycan of the gram-negative bacterial outer membrane
pubmed doi rcsb
total genus 41
structure length 119
sequence length 119
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3td5A00
4G4WA 2ZVZA 1R1MA 2ZOVA 2ZF8A 3IMPA 2ZVYA 4G4YA 4RHAA 4G4XA 3S0HA 3TD4A 3S06A 2K1SA 3CYQA 3KHNA 5EB0A 4G4ZA 4PWTA 3OONA 3S03A 4G88A 4ZHWA 4R40B 5EB1B 2KGWA 2AIZP 3WPWA 3S0WA 4ZHVA 3TD3A 2HQSC 3WPXA 4B5CA 3CYPB 3S02A 4ERHA 3S0YA 1OAPA 2MQEA 2W8BC 3LDTA 2LBTA 4B62A 4G4VA 4ZHYB 3TD5A 2N48A 2L26A 5EAZA 2LCAA
chains in the Genus database with same CATH superfamily
1VQ4F 3CCEF 2GVIA 4YJ3A 1M90H 3K14A 1KNJA 3U0OA 3ZP7A 2ZVYA 3S0HA 2OTMA 5EYPB 3V3TA 3CC7F 5FLXM 3OONA 4LNUB 4X20B 1JFFB 1T0KB 4LNUA 4X20A 4O4IB 3FD6A 3I7TA 3ESJA 4EI9A 5HY0A 3S02A 4X1KB 3JATB 3NVKE 4BW0B 4HNAB 2HX0A 1K9MH 3VOBA 1NQ3A 1U3PA 3NK7A 5HP8A 1VQKF 4M8IA 1W57A 3WGLA 2CHSA 3CXCF 4RHAA 3C8LA 3CB2A 5C8YA 1KC8H 1SA0A 2Z1UA 2YXZA 1IV4A 2CWJA 3LFOA 1JD1A 5MN4A 5CA1A 4IHJA 3CCSF 1Q81H 1CK2A 3F0DA 2LBWA 2G9IA 4C8GA 4B46A 3M84A 5IJ0B 3WJQA 1W2BF 4X1YA 1JJ2F 4EB6B 4NUTA 3VYTC 4F6RA 3RA5A 3OW2F 4U3JB 5HY2A 3F0EA 1VK3A 5LA6A 2QTPA 3C9RA 5EYPA 4G4YA 1VQNF 3GYQA 1FNJA 3JARA 2Z01A 2OZBA 3J80M 3DDNA 5HWEA 2ALEA 1YHQF 3S03A 2FC3A 1QU9A 2HS4A 2OHWA 1H48A 2VAMA 3VOAA 3TD3A 1XRGA 1YITF 1W55A 3HKCA 3JAWA 2W8BC 5LP6C 1W59A 1YJ9F 4TV8A 5EWRA 3E22B 3CCMF 2OTJF 3ZOPA 2QA4F 1UI9A 1KD1H 3KJKA 1TUBA 4G4WA 5EIBC 3MQWA 5LOVB 3JAMM 1FFXA 5CA0B 2F9ZC 3IMPA 3VI6A 3WGMA 3HKEA 1JN1A 4ZHQA 5G4VC 3Q8HA 2DYYA 2RB9A 4C81A 3WGKA 1U3LA 1YIJF 4HNAA 2RHOA 1VH8A 4TUYB 4TV9B 1CLIA 5EO3A 1RLUA 5LXTA 2BO1A 3G4SF 3IKEA 3JASA 4O4HA 3J81M 5J2UB 5LA6B 2EWCA 4O2BB 1IV2A 5LP6B 3QHDA 2ZF8A 5J2UA 4ZK7A 4O2BA 3VO8A 5KMGB 2HVYD 4G4ZA 4BT2A 3GHZA 1JY8A 3D01A 1X7PA 4WBNA 4X1IA 5A2QM 4X1IB 1H47A 5LYJB 4BVQA 2MQEA 4EB6A 2VAWA 2ZAUA 3N2KA 5GONA 5FJ4C 3KJJA 3WGJA 3RYIA 3JALB 2UYPA 2PMPA 3LWVC 4TZZA 1SZQA 3M4SA 2JNBA 1XV2A 1YJWF 3I3FA 5JVDB 3CCUF 2IAFA 4BVRA 5EB0A 3ZO8A 3SIUA 4X3MA 3VYSC 4YJ2B 3RYCA 3CG6A 3V7EA 3UT5B 4I50B 1RA4A 4O4IA 1IPAA 1YQNA 3K0TA 3S0WA 4ZOLB 3F0FA 1K73H 4FFBB 2UZHA 3FFMA 3I55F 1Q86H 3CPWF 4BT6A 3HKBA 3VIUA 3V7QA 3M1XA 3MBMA 1S72F 1DBFA 1FFXB 1X52A 5CA0A 2BTQB 3LWOC 2Q1YA 4DXDA 2CVLA 2QEXF 3IEWA 2AIFA 3OBWA 5IJ0A 5MN6A 1QAHA 5BMVA 5ITZB 3AGKA 3ON1A 2HS0A 2HQSC 3N2GA 3NMUC 5BMVB 5ITZA 4O4LA 3HKDA 5HXZA 2HRYA 3GTZA 3D54A 1Q8RA 3KE1A 4BY9D 1R1MA 4I4TB 1YJNF 3NK6A 4G4XA 1KQSF 2K1SA 1SA0B 5CB4A 3G6EF 5J2TB 1Q7YH 4DRXB 2HP3A 1PXWA 3UT5A 5J2TA 4RQOA 5GIOC 4EI7A 1W5BA 2Q1XA 3CCVF 4C82A 3K12A 4U39A 1KNKA 2LBTA 3N2GB 4EI8A 3RYHB 3TD5A 2GLZA 5EAZA 1VQLF 3WGNA 2BTUA 4TV8B 3JALA 2CHTA 4XCQA 1QVGF 4ZI7A 3CCQF 4YJ3B 3IEQA 3IKFA 3S06A 4I55B 3R0PA 5JCOA 3VTIC 3KHNA 4C8EA 5GAPK 1W40A 2QI2A 3JARB 1VQVA 1W5AA 3FPIA 4ZHQB 1VQOF 1K8AH 2ZODA 3NVIB 3CCJF 5EZYA 3J7AR 4X1KA 1COMA 4B5CA 4FFBA 1X7OA 4F6RB 4G4VA 1TVKB 3DC2A 1GX1A 2NMUA 5GINC 2L26A 1W3EX 2I6DA 2Z1EA 5LP6A 4C4WC 3VYUC 2V9YA 4O4JB 4NWOB 3LWQC 3CC4F 1VHAA 4BT4A 3TD4A 4DRXA 3QUWA 2VXYA 2KTUA 4IHJB 2HRUA 3JAKA 5EB1B 3B6NA 3ZP4A 3CPQA 5IT9M 2VGNA 5GANK 4O4LB 4U3JA 3I56F 4X3LA 2IQQA 1DT9A 1Z5WA 3LYBA 5GONB 3WXMB 4BT3A 1RLGA 5FNVA 5FNVB 3HTNA 4I55A 3ELCA 5HP7A 2CZWA 3N4YA 2VAPA 1Z5VA 2IG8A 2LBXA 1JFFA 1SDSA 4G88A 3G71F 4R40B 3LWRC 3WJRA 3QTYA 3E1YA 3HKCB 4LCKA 1FSZA 3WPXA 3RA6A 2WALA 3F6MA 5JH7B 2BTOA 4BT5A 1J7HA 2DT4A 5JH7A 3N4ZA 5IJ9B 1M1KH 3N2KB 1W5EA 4ZI7B 2GZLA 3P0ZA 3C9SA 3BYQA 2H6LA 2AMTA 3CCLF 2B33A 1VQ7F 2FGYA 1IV1A 1QVFF 3JAKB 3RYFA 3HKEB 4YJ2A 3RYFB 1ZWZA 1VQ6F 1W581 3CYPB 3ERNA 1E7KA 1VQMF 3CMAF 5JQGB 5KX5A 4TUYA 4TV9A 5HXUA 3P10A 4IIJB 5DCVA 4IIJA 3CMEF 1VQPF 2RHHA 3C9UA 4B45A 2I6RA 1ONIA 1W5FA 2RHJA 3FD5A 5IYZA 1YGYA 3LWPC 3F0GA 3O85A 3CCRF 3IR9A 1CN7A 2OTLF 3JVHA 3CC2F 4O2AB 1GO0A 2CW4A 4WBNB 3HWUA 4O2AA 4ERHA 3RYHA 1OFUA 3LDTA 1W42A 3HAXD 1FNKA 5HY1A 5GIPC 5G4UC 3LMEA 1RQ7A 3V4DA 5LXTB 2R751 1XHOA 3RYIB 4I4TA 3L7QA 1QD9A 3VCZA 3RE3A 4E6EA 1N8RH 1GZ0A 2Z1TA 1NJIH 4NQ3A 2HP0A 1IV3A 3PLAC 3OBYA 2HP0B 1YI2F 5EZYB 1VQ9F 3RYCB 5B8FA 1W41A 4KWEA 5AVMA 4ZOLA 4BVTA 5EIBD 3JATA 2KTVA 3S0YA 1Q82H 4B62A 3JAWB 2H8CA 3EORA 3KIZA 2UYNB 3D00A 2UYNA 3MDOA 1UFYA 2LCAA 2Z1FA 3E22A 2PHNA 4O4JA 2UYKA 2HS3A 1VQ5F 1NMUB 4BT7A 5KMGA 3CD6F 3CYQA 3MCQA 5MN5A 2KG4A 1PF5A 2VGMA 1VQ8F 2CSLA 2AIZP 3T80A 1GO1A 3VMFB 1H7MA 1X25A 3FBAA 1U43A 4X1YB 3HKDB 2N48A 3PAFA 5HY4A 5JQGA 5KX5B 1RQ2A 1T0AA 5JVDA 2ZVZA 4C8IA 2ZOVA 3JASB 4O4HB 3MCAB 3SIVA 2RHLA 2R6R1 1XBIA 3C9TA 3P4EA 5CB4B 5C8YB 5LOVA 4I50A 4PWTA 2P6YA 5IYZB 1U40A 4BVSA 4ZHWA 5CA1B 3WJPA 2KGWA 3WPWA 2H8EA 4ZHVA 3E20B 3JCMM 1TVKA 5IJ9A 1OAPA 3HKBB 3K2XA 3HJWC 4ZHYB 2YYEA 5LYJA 5JCOC 1ODEA 2UYJA 1TUBB
chains in the Genus database with same CATH topology
4G4WA 2ZVZA 1R1MA 2ZOVA 2ZF8A 3IMPA 2ZVYA 4G4YA 4RHAA 4G4XA 3S0HA 3TD4A 3S06A 2K1SA 3CYQA 3KHNA 5EB0A 4G4ZA 4PWTA 3OONA 3S03A 4G88A 4ZHWA 4R40B 5EB1B 2KGWA 2AIZP 3WPWA 3S0WA 4ZHVA 3TD3A 2HQSC 3WPXA 4B5CA 3CYPB 3S02A 4ERHA 3S0YA 1OAPA 2MQEA 2W8BC 3LDTA 2LBTA 4B62A 4G4VA 4ZHYB 3TD5A 2N48A 2L26A 5EAZA 2LCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G4W A;  2ZVZ A;  1R1M A;  2ZOV A;  2ZF8 A;  3IMP A;  2ZVY A;  4G4Y A;  4RHA A;  4G4X A;  3S0H A;  3TD4 A;  3S06 A;  2K1S A;  3CYQ A;  3KHN A;  5EB0 A;  4G4Z A;  4PWT A;  3OON A;  3S03 A;  4G88 A;  4ZHW A;  4R40 B;  5EB1 B;  2KGW A;  2AIZ P;  3WPW A;  3S0W A;  4ZHV A;  3TD3 A;  2HQS C;  3WPX A;  4B5C A;  3CYP B;  3S02 A;  4ERH A;  3S0Y A;  1OAP A;  2MQE A;  2W8B C;  3LDT A;  2LBT A;  4B62 A;  4G4V A;  4ZHY B;  3TD5 A;  2N48 A;  2L26 A;  5EAZ A;  2LCA A; 
#chains in the Genus database with same CATH topology
 1VQ4 F;  3CCE F;  2GVI A;  4YJ3 A;  1M90 H;  3K14 A;  1KNJ A;  3U0O A;  3ZP7 A;  2ZVY A;  3S0H A;  2OTM A;  5EYP B;  3V3T A;  3CC7 F;  5FLX M;  3OON A;  4LNU B;  4X20 B;  1JFF B;  1T0K B;  4LNU A;  4X20 A;  4O4I B;  3FD6 A;  3I7T A;  3ESJ A;  4EI9 A;  5HY0 A;  3S02 A;  4X1K B;  3JAT B;  3NVK E;  4BW0 B;  4HNA B;  2HX0 A;  1K9M H;  3VOB A;  1NQ3 A;  1U3P A;  3NK7 A;  5HP8 A;  1VQK F;  4M8I A;  1W57 A;  3WGL A;  2CHS A;  3CXC F;  4RHA A;  3C8L A;  3CB2 A;  5C8Y A;  1KC8 H;  1SA0 A;  2Z1U A;  2YXZ A;  1IV4 A;  2CWJ A;  3LFO A;  1JD1 A;  5MN4 A;  5CA1 A;  4IHJ A;  3CCS F;  1Q81 H;  1CK2 A;  3F0D A;  2LBW A;  2G9I A;  4C8G A;  4B46 A;  3M84 A;  5IJ0 B;  3WJQ A;  1W2B F;  4X1Y A;  1JJ2 F;  4EB6 B;  4NUT A;  3VYT C;  4F6R A;  3RA5 A;  3OW2 F;  4U3J B;  5HY2 A;  3F0E A;  1VK3 A;  5LA6 A;  2QTP A;  3C9R A;  5EYP A;  4G4Y A;  1VQN F;  3GYQ A;  1FNJ A;  3JAR A;  2Z01 A;  2OZB A;  3J80 M;  3DDN A;  5HWE A;  2ALE A;  1YHQ F;  3S03 A;  2FC3 A;  1QU9 A;  2HS4 A;  2OHW A;  1H48 A;  2VAM A;  3VOA A;  3TD3 A;  1XRG A;  1YIT F;  1W55 A;  3HKC A;  3JAW A;  2W8B C;  5LP6 C;  1W59 A;  1YJ9 F;  4TV8 A;  5EWR A;  3E22 B;  3CCM F;  2OTJ F;  3ZOP A;  2QA4 F;  1UI9 A;  1KD1 H;  3KJK A;  1TUB A;  4G4W A;  5EIB C;  3MQW A;  5LOV B;  3JAM M;  1FFX A;  5CA0 B;  2F9Z C;  3IMP A;  3VI6 A;  3WGM A;  3HKE A;  1JN1 A;  4ZHQ A;  5G4V C;  3Q8H A;  2DYY A;  2RB9 A;  4C81 A;  3WGK A;  1U3L A;  1YIJ F;  4HNA A;  2RHO A;  1VH8 A;  4TUY B;  4TV9 B;  1CLI A;  5EO3 A;  1RLU A;  5LXT A;  2BO1 A;  3G4S F;  3IKE A;  3JAS A;  4O4H A;  3J81 M;  5J2U B;  5LA6 B;  2EWC A;  4O2B B;  1IV2 A;  5LP6 B;  3QHD A;  2ZF8 A;  5J2U A;  4ZK7 A;  4O2B A;  3VO8 A;  5KMG B;  2HVY D;  4G4Z A;  4BT2 A;  3GHZ A;  1JY8 A;  3D01 A;  1X7P A;  4WBN A;  4X1I A;  5A2Q M;  4X1I B;  1H47 A;  5LYJ B;  4BVQ A;  2MQE A;  4EB6 A;  2VAW A;  2ZAU A;  3N2K A;  5GON A;  5FJ4 C;  3KJJ A;  3WGJ A;  3RYI A;  3JAL B;  2UYP A;  2PMP A;  3LWV C;  4TZZ A;  1SZQ A;  3M4S A;  2JNB A;  1XV2 A;  1YJW F;  3I3F A;  5JVD B;  3CCU F;  2IAF A;  4BVR A;  5EB0 A;  3ZO8 A;  3SIU A;  4X3M A;  3VYS C;  4YJ2 B;  3RYC A;  3CG6 A;  3V7E A;  3UT5 B;  4I50 B;  1RA4 A;  4O4I A;  1IPA A;  1YQN A;  3K0T A;  3S0W A;  4ZOL B;  3F0F A;  1K73 H;  4FFB B;  2UZH A;  3FFM A;  3I55 F;  1Q86 H;  3CPW F;  4BT6 A;  3HKB A;  3VIU A;  3V7Q A;  3M1X A;  3MBM A;  1S72 F;  1DBF A;  1FFX B;  1X52 A;  5CA0 A;  2BTQ B;  3LWO C;  2Q1Y A;  4DXD A;  2CVL A;  2QEX F;  3IEW A;  2AIF A;  3OBW A;  5IJ0 A;  5MN6 A;  1QAH A;  5BMV A;  5ITZ B;  3AGK A;  3ON1 A;  2HS0 A;  2HQS C;  3N2G A;  3NMU C;  5BMV B;  5ITZ A;  4O4L A;  3HKD A;  5HXZ A;  2HRY A;  3GTZ A;  3D54 A;  1Q8R A;  3KE1 A;  4BY9 D;  1R1M A;  4I4T B;  1YJN F;  3NK6 A;  4G4X A;  1KQS F;  2K1S A;  1SA0 B;  5CB4 A;  3G6E F;  5J2T B;  1Q7Y H;  4DRX B;  2HP3 A;  1PXW A;  3UT5 A;  5J2T A;  4RQO A;  5GIO C;  4EI7 A;  1W5B A;  2Q1X A;  3CCV F;  4C82 A;  3K12 A;  4U39 A;  1KNK A;  2LBT A;  3N2G B;  4EI8 A;  3RYH B;  3TD5 A;  2GLZ A;  5EAZ A;  1VQL F;  3WGN A;  2BTU A;  4TV8 B;  3JAL A;  2CHT A;  4XCQ A;  1QVG F;  4ZI7 A;  3CCQ F;  4YJ3 B;  3IEQ A;  3IKF A;  3S06 A;  4I55 B;  3R0P A;  5JCO A;  3VTI C;  3KHN A;  4C8E A;  5GAP K;  1W40 A;  2QI2 A;  3JAR B;  1VQV A;  1W5A A;  3FPI A;  4ZHQ B;  1VQO F;  1K8A H;  2ZOD A;  3NVI B;  3CCJ F;  5EZY A;  3J7A R;  4X1K A;  1COM A;  4B5C A;  4FFB A;  1X7O A;  4F6R B;  4G4V A;  1TVK B;  3DC2 A;  1GX1 A;  2NMU A;  5GIN C;  2L26 A;  1W3E X;  2I6D A;  2Z1E A;  5LP6 A;  4C4W C;  3VYU C;  2V9Y A;  4O4J B;  4NWO B;  3LWQ C;  3CC4 F;  1VHA A;  4BT4 A;  3TD4 A;  4DRX A;  3QUW A;  2VXY A;  2KTU A;  4IHJ B;  2HRU A;  3JAK A;  5EB1 B;  3B6N A;  3ZP4 A;  3CPQ A;  5IT9 M;  2VGN A;  5GAN K;  4O4L B;  4U3J A;  3I56 F;  4X3L A;  2IQQ A;  1DT9 A;  1Z5W A;  3LYB A;  5GON B;  3WXM B;  4BT3 A;  1RLG A;  5FNV A;  5FNV B;  3HTN A;  4I55 A;  3ELC A;  5HP7 A;  2CZW A;  3N4Y A;  2VAP A;  1Z5V A;  2IG8 A;  2LBX A;  1JFF A;  1SDS A;  4G88 A;  3G71 F;  4R40 B;  3LWR C;  3WJR A;  3QTY A;  3E1Y A;  3HKC B;  4LCK A;  1FSZ A;  3WPX A;  3RA6 A;  2WAL A;  3F6M A;  5JH7 B;  2BTO A;  4BT5 A;  1J7H A;  2DT4 A;  5JH7 A;  3N4Z A;  5IJ9 B;  1M1K H;  3N2K B;  1W5E A;  4ZI7 B;  2GZL A;  3P0Z A;  3C9S A;  3BYQ A;  2H6L A;  2AMT A;  3CCL F;  2B33 A;  1VQ7 F;  2FGY A;  1IV1 A;  1QVF F;  3JAK B;  3RYF A;  3HKE B;  4YJ2 A;  3RYF B;  1ZWZ A;  1VQ6 F;  1W58 1;  3CYP B;  3ERN A;  1E7K A;  1VQM F;  3CMA F;  5JQG B;  5KX5 A;  4TUY A;  4TV9 A;  5HXU A;  3P10 A;  4IIJ B;  5DCV A;  4IIJ A;  3CME F;  1VQP F;  2RHH A;  3C9U A;  4B45 A;  2I6R A;  1ONI A;  1W5F A;  2RHJ A;  3FD5 A;  5IYZ A;  1YGY A;  3LWP C;  3F0G A;  3O85 A;  3CCR F;  3IR9 A;  1CN7 A;  2OTL F;  3JVH A;  3CC2 F;  4O2A B;  1GO0 A;  2CW4 A;  4WBN B;  3HWU A;  4O2A A;  4ERH A;  3RYH A;  1OFU A;  3LDT A;  1W42 A;  3HAX D;  1FNK A;  5HY1 A;  5GIP C;  5G4U C;  3LME A;  1RQ7 A;  3V4D A;  5LXT B;  2R75 1;  1XHO A;  3RYI B;  4I4T A;  3L7Q A;  1QD9 A;  3VCZ A;  3RE3 A;  4E6E A;  1N8R H;  1GZ0 A;  2Z1T A;  1NJI H;  4NQ3 A;  2HP0 A;  1IV3 A;  3PLA C;  3OBY A;  2HP0 B;  1YI2 F;  5EZY B;  1VQ9 F;  3RYC B;  5B8F A;  1W41 A;  4KWE A;  5AVM A;  4ZOL A;  4BVT A;  5EIB D;  3JAT A;  2KTV A;  3S0Y A;  1Q82 H;  4B62 A;  3JAW B;  2H8C A;  3EOR A;  3KIZ A;  2UYN B;  3D00 A;  2UYN A;  3MDO A;  1UFY A;  2LCA A;  2Z1F A;  3E22 A;  2PHN A;  4O4J A;  2UYK A;  2HS3 A;  1VQ5 F;  1NMU B;  4BT7 A;  5KMG A;  3CD6 F;  3CYQ A;  3MCQ A;  5MN5 A;  2KG4 A;  1PF5 A;  2VGM A;  1VQ8 F;  2CSL A;  2AIZ P;  3T80 A;  1GO1 A;  3VMF B;  1H7M A;  1X25 A;  3FBA A;  1U43 A;  4X1Y B;  3HKD B;  2N48 A;  3PAF A;  5HY4 A;  5JQG A;  5KX5 B;  1RQ2 A;  1T0A A;  5JVD A;  2ZVZ A;  4C8I A;  2ZOV A;  3JAS B;  4O4H B;  3MCA B;  3SIV A;  2RHL A;  2R6R 1;  1XBI A;  3C9T A;  3P4E A;  5CB4 B;  5C8Y B;  5LOV A;  4I50 A;  4PWT A;  2P6Y A;  5IYZ B;  1U40 A;  4BVS A;  4ZHW A;  5CA1 B;  3WJP A;  2KGW A;  3WPW A;  2H8E A;  4ZHV A;  3E20 B;  3JCM M;  1TVK A;  5IJ9 A;  1OAP A;  3HKB B;  3K2X A;  3HJW C;  4ZHY B;  2YYE A;  5LYJ A;  5JCO C;  1ODE A;  2UYJ A;  1TUB B; 
#chains in the Genus database with same CATH homology
 4G4W A;  2ZVZ A;  1R1M A;  2ZOV A;  2ZF8 A;  3IMP A;  2ZVY A;  4G4Y A;  4RHA A;  4G4X A;  3S0H A;  3TD4 A;  3S06 A;  2K1S A;  3CYQ A;  3KHN A;  5EB0 A;  4G4Z A;  4PWT A;  3OON A;  3S03 A;  4G88 A;  4ZHW A;  4R40 B;  5EB1 B;  2KGW A;  2AIZ P;  3WPW A;  3S0W A;  4ZHV A;  3TD3 A;  2HQS C;  3WPX A;  4B5C A;  3CYP B;  3S02 A;  4ERH A;  3S0Y A;  1OAP A;  2MQE A;  2W8B C;  3LDT A;  2LBT A;  4B62 A;  4G4V A;  4ZHY B;  3TD5 A;  2N48 A;  2L26 A;  5EAZ A;  2LCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...