3TD5A

Crystal structure of ompa-like domain from acinetobacter baumannii in complex with l-ala-gamma-d-glu-m-dap-d-ala-d-ala
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
119
structure length
119
Chain Sequence
b'ELTEDLNMELRVFFDTNKSNIKDQYKPEIAKVAEKLSEYPNATARIEGHTDNTGPRKLNERLSLARANSVKSALVNEYNVDASRLSTQGFAWDQPIADNKTKEGRAMNRRVFATITGSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Outer membrane protein omp38
publication title Mechanism of anchoring of OmpA protein to the cell wall peptidoglycan of the gram-negative bacterial outer membrane
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Membrane protein/peptide binding protein
total genus 41
structure length 119
sequence length 119
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2011-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00691 OmpA OmpA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.60 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; OmpA-like domain 3td5A00
3OONA 3KHNA 2KGWA 2N48A 5EB1B 4PWTA 4R40B 2AIZP 2MQEA 2ZVZA 2L26A 3S06A 3CYPB 5EB0A 2ZOVA 4G4ZA 3LDTA 3IMPA 2K1SA 4G4WA 4RHAA 2W8BC 2ZF8A 2LBTA 4G4VA 4ERHA 5EAZA 4ZHWA 3TD3A 3TD4A 3S0HA 3S0YA 4B62A 4B5CA 4ZHVA 4ZHYB 3S02A 3S03A 3WPXA 4G4YA 3S0WA 3CYQA 2HQSC 4G4XA 3WPWA 4G88A 3TD5A 2ZVYA 1OAPA 1R1MA 2LCAA
chains in the Genus database with same CATH superfamily
1FFXB 5EIBC 3VYUC 4TV8A 3N2KA 3CCVF 2KTVA 3RYHA 2CHTA 3LFOA 3S06A 4ZOLA 4C8EA 3N4YA 4DXDA 4YJ2B 3MBMA 5FNVB 4IIJB 5LOVA 3CCQF 4TV8B 3N2KB 3S0HA 1VQ6F 3JAKA 5FJ4C 3SIUA 2OTLF 4ZOLB 2LBXA 5B8FA 3WPWA 1X52A 3M84A 2YXZA 1YQNA 1H47A 2PHNA 5LOVB 3WXMB 1VQ4F 1VQVA 1JD1A 2RHOA 5LA6A 3P10A 2RHJA 3F0GA 3JAKB 4O4LA 3MQWA 4BT7A 3NK6A 4NWOB 2QEXF 4BT6A 1PXWA 2QTPA 5HXZA 5J2TA 1U3PA 1YJNF 3M1XA 3ZP4A 1T0KB 4WBNA 1NJIH 1VQ5F 4BT4A 3JAWA 2R6R1 1R1MA 3HAXD 2BTOA 3KHNA 5J2TB 3GYQA 3G71F 2HVYD 4X20A 3F0DA 1CLIA 3CCRF 2RB9A 4I4TA 1W2BF 3J80M 2L26A 5IJ0A 3JAWB 1IV2A 3V7EA 4ZHQB 1E7KA 1KQSF 1RLUA 1TVKB 5KMGA 1VQOF 3F0FA 3NVIB 4X20B 5A2QM 3VYSC 1W581 1FSZA 4EB6B 5CA1A 1YITF 2GLZA 4LNUA 5LP6C 1Q86H 1X25A 3CYQA 3OBYA 2VGMA 1SA0A 4BVQA 3N4ZA 4G88A 1DBFA 1X7PA 3D01A 5ITZA 4M8IA 2HP3A 2BO1A 1XBIA 3CCUF 4BY9D 4EI7A 2H8CA 5EB1B 5LXTA 1TUBB 4I55A 3MCQA 4IHJA 4NUTA 5CA0B 3KE1A 2DYYA 3LWRC 2NMUA 1JN1A 3PAFA 1W55A 1QVGF 3HJWC 5C8YA 3P4EA 4ZHVA 1W3EX 2Z01A 3JARA 1VQ9F 1VQNF 4I50A 1XRGA 3JATB 4I55B 1NMUB 4G4XA 2HRYA 1VQKF 2IG8A 3K14A 3IKEA 5JQGA 2I6DA 5C8YB 2CSLA 3JARB 2LBWA 2R751 4F6RB 4I50B 3UT5A 4EI9A 3CMAF 1YHQF 3GHZA 2CZWA 2OHWA 5JQGB 1VH8A 2VAPA 1H7MA 3S02A 3FPIA 5J2UB 3VTIC 1VQLF 1Q8RA 3UT5B 3SIVA 3WGLA 1S72F 4TUYA 4YJ2A 4IIJA 1YJ9F 5HY0A 4BVSA 1GO0A 1QAHA 5EYPA 3LYBA 3VIUA 2ZVZA 3ESJA 3K2XA 5GONA 3CC2F 3CB2A 4TUYB 5KX5A 1W5AA 3RYFA 1XV2A 4G4VA 4ZHWA 3TD3A 2KG4A 4X1IB 4LCKA 5IT9M 5EYPB 1KNKA 1NQ3A 3CPQA 1UFYA 2Z1FA 5GONB 3WGMA 1IV4A 5IJ9B 5KX5B 4O4HA 3RYFB 3R0PA 4O2AA 1RLGA 3M4SA 3E20B 2MQEA 3QHDA 5GANK 4BT3A 3V4DA 5EB0A 1RQ2A 1JJ2F 1YIJF 4O4HB 1Q82H 1W40A 1ONIA 4O2AB 3MCAB 4KWEA 4C4WC 2WALA 3TD4A 3LWVC 1JY8A 3CXCF 5EO3A 3S03A 2EWCA 3HWUA 1YJWF 3S0WA 3IEQA 1VQPF 1X7OA 5GIPC 3K0TA 2CVLA 4ZHQA 5JVDB 3WGNA 2CW4A 1TVKA 2N48A 3HTNA 1FNKA 1PF5A 4EB6A 1GZ0A 4X1YA 5FNVA 3DDNA 3U0OA 1W42A 1U43A 3CG6A 3C8LA 3IR9A 3ERNA 4TV9A 1U3LA 2I6RA 1TUBA 2DT4A 3P0ZA 4X1YB 4XCQA 3CC4F 5CA0A 3KJKA 2VAMA 5HXUA 5MN6A 2IAFA 1W41A 2HS3A 3JVHA 1W5EA 4TV9B 3CCJF 1J7HA 1M90H 1VK3A 3RA5A 2UYPA 3Q8HA 3JATA 2ZOVA 2Z1TA 4G4ZA 2AMTA 3E22B 1FNJA 2OZBA 3WJRA 4C8GA 3JCMM 2LBTA 1SZQA 5HY1A 3JAMM 4ZK7A 2ALEA 2Q1XA 4HNAA 3GTZA 4B5CA 3CCSF 5CB4B 3VYTC 4F6RA 2RHHA 5JCOA 4O2BB 2HRUA 3ELCA 2ZVYA 5GIOC 3HKDA 2G9IA 3HKCA 3NK7A 3CCLF 2JNBA 3IKFA 4BVRA 4HNAB 4PWTA 2VXYA 1K9MH 5J2UA 4YJ3B 2FGYA 5DCVA 3ZO8A 3E1YA 1CN7A 4RHAA 3VOAA 3HKDB 4RQOA 3HKCB 4B45A 1U40A 3RYIB 3CC7F 4EI8A 2Q1YA 1W57A 2RHLA 3CCEF 4C81A 3RE3A 1JFFA 3LWPC 3TD5A 3WJQA 3RYCB 3BYQA 5HP8A 2H6LA 3CPWF 1QVFF 2UYKA 2PMPA 5LP6B 4X1IA 4O4IB 2ZODA 5BMVA 3LWOC 3CCMF 4R40B 5HY4A 2AIZP 4DRXA 5EWRA 4U3JB 5EZYA 3HKBB 1W59A 3JALA 1JFFB 1KNJA 3LDTA 2IQQA 4ZI7A 5IJ9A 2ZF8A 3O85A 3CD6F 1K8AH 4B62A 3JASB 4B46A 5BMVB 1GX1A 1YI2F 3B6NA 4DRXB 5IYZA 4O4JB 3WGKA 1COMA 5EZYB 3JALB 3IEWA 1Z5WA 3VO8A 1OAPA 4X3LA 1H48A 4ZI7B 5G4UC 3OONA 3N2GA 3NVKE 2CHSA 3J81M 4E6EA 2HP0B 1Z5VA 3ON1A 2BTUA 3DC2A 3OBWA 4NQ3A 5IYZB 3KJJA 3AGKA 4X1KB 3C9UA 5JVDA 5EAZA 5GINC 3LMEA 3N2GB 2Z1EA 3RYHB 1IV3A 1XHOA 3F0EA 3V3TA 1KD1H 3L7QA 3OW2F 3RA6A 1VHAA 5HWEA 2KGWA 2F9ZC 5MN5A 3WJPA 3ZOPA 3C9SA 1M1KH 3K12A 1SDSA 2GZLA 1GO1A 2FC3A 3HKEA 4G4WA 3IMPA 2P6YA 5AVMA 1YGYA 3VCZA 3MDOA 4BT5A 5FLXM 1IV1A 3S0YA 5LA6B 2QA4F 2VAWA 4O4LB 4FFBA 3QUWA 1RQ7A 4U39A 3E22A 1IPAA 3HKEB 5JCOC 2QI2A 2UYJA 2KTUA 4C8IA 4WBNB 1VQMF 3KIZA 3I7TA 4FFBB 5CB4A 5GAPK 4O2BA 4BVTA 3FD5A 1KC8H 1T0AA 4C82A 2BTQB 2H8EA 3J7AR 2ZAUA 2UYNA 4I4TB 3ZP7A 2HX0A 3WPXA 4G4YA 3CMEF 3G6EF 2VGNA 3G4SF 3QTYA 4YJ3A 1OFUA 5IJ0B 2HS4A 5MN4A 3D54A 2OTMA 3VI6A 5KMGB 1ZWZA 5CA1B 2UYNB 1DT9A 4LNUB 3RYIA 5G4VC 1SA0B 3CYPB 1K73H 2UZHA 3I3FA 1CK2A 3RYCA 3I56F 5ITZB 2W8BC 1VQ8F 4ERHA 5EIBD 1ODEA 1N8RH 5LXTB 5LP6A 4O4IA 2Z1UA 4ZHYB 3EORA 3FBAA 1UI9A 4IHJB 4U3JA 1QD9A 4TZZA 1QU9A 3HKBA 1VQ7F 1W5BA 3FD6A 1RA4A 3V7QA 4BW0B 2OTJF 5LYJA 2HS0A 2AIFA 3JASA 2YYEA 2B33A 1Q7YH 3VOBA 4O4JA 4X3MA 3T80A 2CWJA 4BT2A 5JH7A 3PLAC 2K1SA 2V9YA 3C9RA 1FFXA 3NMUC 3I55F 1W5FA 2GVIA 5HP7A 5LYJB 2HP0A 3VMFB 3F6MA 3D00A 3FFMA 3LWQC 2HQSC 5HY2A 1Q81H 3WGJA 4X1KA 5JH7B 3C9TA 2LCAA
chains in the Genus database with same CATH topology
3OONA 3KHNA 2KGWA 2N48A 5EB1B 4PWTA 4R40B 2AIZP 2MQEA 2ZVZA 2L26A 3S06A 3CYPB 5EB0A 2ZOVA 4G4ZA 3LDTA 3IMPA 2K1SA 4G4WA 4RHAA 2W8BC 2ZF8A 2LBTA 4G4VA 4ERHA 5EAZA 4ZHWA 3TD3A 3TD4A 3S0HA 3S0YA 4B62A 4B5CA 4ZHVA 4ZHYB 3S02A 3S03A 3WPXA 4G4YA 3S0WA 3CYQA 2HQSC 4G4XA 3WPWA 4G88A 3TD5A 2ZVYA 1OAPA 1R1MA 2LCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OON A;  3KHN A;  2KGW A;  2N48 A;  5EB1 B;  4PWT A;  4R40 B;  2AIZ P;  2MQE A;  2ZVZ A;  2L26 A;  3S06 A;  3CYP B;  5EB0 A;  2ZOV A;  4G4Z A;  3LDT A;  3IMP A;  2K1S A;  4G4W A;  4RHA A;  2W8B C;  2ZF8 A;  2LBT A;  4G4V A;  4ERH A;  5EAZ A;  4ZHW A;  3TD3 A;  3TD4 A;  3S0H A;  3S0Y A;  4B62 A;  4B5C A;  4ZHV A;  4ZHY B;  3S02 A;  3S03 A;  3WPX A;  4G4Y A;  3S0W A;  3CYQ A;  2HQS C;  4G4X A;  3WPW A;  4G88 A;  3TD5 A;  2ZVY A;  1OAP A;  1R1M A;  2LCA A; 
#chains in the Genus database with same CATH topology
 1FFX B;  5EIB C;  3VYU C;  4TV8 A;  3N2K A;  3CCV F;  2KTV A;  3RYH A;  2CHT A;  3LFO A;  3S06 A;  4ZOL A;  4C8E A;  3N4Y A;  4DXD A;  4YJ2 B;  3MBM A;  5FNV B;  4IIJ B;  5LOV A;  3CCQ F;  4TV8 B;  3N2K B;  3S0H A;  1VQ6 F;  3JAK A;  5FJ4 C;  3SIU A;  2OTL F;  4ZOL B;  2LBX A;  5B8F A;  3WPW A;  1X52 A;  3M84 A;  2YXZ A;  1YQN A;  1H47 A;  2PHN A;  5LOV B;  3WXM B;  1VQ4 F;  1VQV A;  1JD1 A;  2RHO A;  5LA6 A;  3P10 A;  2RHJ A;  3F0G A;  3JAK B;  4O4L A;  3MQW A;  4BT7 A;  3NK6 A;  4NWO B;  2QEX F;  4BT6 A;  1PXW A;  2QTP A;  5HXZ A;  5J2T A;  1U3P A;  1YJN F;  3M1X A;  3ZP4 A;  1T0K B;  4WBN A;  1NJI H;  1VQ5 F;  4BT4 A;  3JAW A;  2R6R 1;  1R1M A;  3HAX D;  2BTO A;  3KHN A;  5J2T B;  3GYQ A;  3G71 F;  2HVY D;  4X20 A;  3F0D A;  1CLI A;  3CCR F;  2RB9 A;  4I4T A;  1W2B F;  3J80 M;  2L26 A;  5IJ0 A;  3JAW B;  1IV2 A;  3V7E A;  4ZHQ B;  1E7K A;  1KQS F;  1RLU A;  1TVK B;  5KMG A;  1VQO F;  3F0F A;  3NVI B;  4X20 B;  5A2Q M;  3VYS C;  1W58 1;  1FSZ A;  4EB6 B;  5CA1 A;  1YIT F;  2GLZ A;  4LNU A;  5LP6 C;  1Q86 H;  1X25 A;  3CYQ A;  3OBY A;  2VGM A;  1SA0 A;  4BVQ A;  3N4Z A;  4G88 A;  1DBF A;  1X7P A;  3D01 A;  5ITZ A;  4M8I A;  2HP3 A;  2BO1 A;  1XBI A;  3CCU F;  4BY9 D;  4EI7 A;  2H8C A;  5EB1 B;  5LXT A;  1TUB B;  4I55 A;  3MCQ A;  4IHJ A;  4NUT A;  5CA0 B;  3KE1 A;  2DYY A;  3LWR C;  2NMU A;  1JN1 A;  3PAF A;  1W55 A;  1QVG F;  3HJW C;  5C8Y A;  3P4E A;  4ZHV A;  1W3E X;  2Z01 A;  3JAR A;  1VQ9 F;  1VQN F;  4I50 A;  1XRG A;  3JAT B;  4I55 B;  1NMU B;  4G4X A;  2HRY A;  1VQK F;  2IG8 A;  3K14 A;  3IKE A;  5JQG A;  2I6D A;  5C8Y B;  2CSL A;  3JAR B;  2LBW A;  2R75 1;  4F6R B;  4I50 B;  3UT5 A;  4EI9 A;  3CMA F;  1YHQ F;  3GHZ A;  2CZW A;  2OHW A;  5JQG B;  1VH8 A;  2VAP A;  1H7M A;  3S02 A;  3FPI A;  5J2U B;  3VTI C;  1VQL F;  1Q8R A;  3UT5 B;  3SIV A;  3WGL A;  1S72 F;  4TUY A;  4YJ2 A;  4IIJ A;  1YJ9 F;  5HY0 A;  4BVS A;  1GO0 A;  1QAH A;  5EYP A;  3LYB A;  3VIU A;  2ZVZ A;  3ESJ A;  3K2X A;  5GON A;  3CC2 F;  3CB2 A;  4TUY B;  5KX5 A;  1W5A A;  3RYF A;  1XV2 A;  4G4V A;  4ZHW A;  3TD3 A;  2KG4 A;  4X1I B;  4LCK A;  5IT9 M;  5EYP B;  1KNK A;  1NQ3 A;  3CPQ A;  1UFY A;  2Z1F A;  5GON B;  3WGM A;  1IV4 A;  5IJ9 B;  5KX5 B;  4O4H A;  3RYF B;  3R0P A;  4O2A A;  1RLG A;  3M4S A;  3E20 B;  2MQE A;  3QHD A;  5GAN K;  4BT3 A;  3V4D A;  5EB0 A;  1RQ2 A;  1JJ2 F;  1YIJ F;  4O4H B;  1Q82 H;  1W40 A;  1ONI A;  4O2A B;  3MCA B;  4KWE A;  4C4W C;  2WAL A;  3TD4 A;  3LWV C;  1JY8 A;  3CXC F;  5EO3 A;  3S03 A;  2EWC A;  3HWU A;  1YJW F;  3S0W A;  3IEQ A;  1VQP F;  1X7O A;  5GIP C;  3K0T A;  2CVL A;  4ZHQ A;  5JVD B;  3WGN A;  2CW4 A;  1TVK A;  2N48 A;  3HTN A;  1FNK A;  1PF5 A;  4EB6 A;  1GZ0 A;  4X1Y A;  5FNV A;  3DDN A;  3U0O A;  1W42 A;  1U43 A;  3CG6 A;  3C8L A;  3IR9 A;  3ERN A;  4TV9 A;  1U3L A;  2I6R A;  1TUB A;  2DT4 A;  3P0Z A;  4X1Y B;  4XCQ A;  3CC4 F;  5CA0 A;  3KJK A;  2VAM A;  5HXU A;  5MN6 A;  2IAF A;  1W41 A;  2HS3 A;  3JVH A;  1W5E A;  4TV9 B;  3CCJ F;  1J7H A;  1M90 H;  1VK3 A;  3RA5 A;  2UYP A;  3Q8H A;  3JAT A;  2ZOV A;  2Z1T A;  4G4Z A;  2AMT A;  3E22 B;  1FNJ A;  2OZB A;  3WJR A;  4C8G A;  3JCM M;  2LBT A;  1SZQ A;  5HY1 A;  3JAM M;  4ZK7 A;  2ALE A;  2Q1X A;  4HNA A;  3GTZ A;  4B5C A;  3CCS F;  5CB4 B;  3VYT C;  4F6R A;  2RHH A;  5JCO A;  4O2B B;  2HRU A;  3ELC A;  2ZVY A;  5GIO C;  3HKD A;  2G9I A;  3HKC A;  3NK7 A;  3CCL F;  2JNB A;  3IKF A;  4BVR A;  4HNA B;  4PWT A;  2VXY A;  1K9M H;  5J2U A;  4YJ3 B;  2FGY A;  5DCV A;  3ZO8 A;  3E1Y A;  1CN7 A;  4RHA A;  3VOA A;  3HKD B;  4RQO A;  3HKC B;  4B45 A;  1U40 A;  3RYI B;  3CC7 F;  4EI8 A;  2Q1Y A;  1W57 A;  2RHL A;  3CCE F;  4C81 A;  3RE3 A;  1JFF A;  3LWP C;  3TD5 A;  3WJQ A;  3RYC B;  3BYQ A;  5HP8 A;  2H6L A;  3CPW F;  1QVF F;  2UYK A;  2PMP A;  5LP6 B;  4X1I A;  4O4I B;  2ZOD A;  5BMV A;  3LWO C;  3CCM F;  4R40 B;  5HY4 A;  2AIZ P;  4DRX A;  5EWR A;  4U3J B;  5EZY A;  3HKB B;  1W59 A;  3JAL A;  1JFF B;  1KNJ A;  3LDT A;  2IQQ A;  4ZI7 A;  5IJ9 A;  2ZF8 A;  3O85 A;  3CD6 F;  1K8A H;  4B62 A;  3JAS B;  4B46 A;  5BMV B;  1GX1 A;  1YI2 F;  3B6N A;  4DRX B;  5IYZ A;  4O4J B;  3WGK A;  1COM A;  5EZY B;  3JAL B;  3IEW A;  1Z5W A;  3VO8 A;  1OAP A;  4X3L A;  1H48 A;  4ZI7 B;  5G4U C;  3OON A;  3N2G A;  3NVK E;  2CHS A;  3J81 M;  4E6E A;  2HP0 B;  1Z5V A;  3ON1 A;  2BTU A;  3DC2 A;  3OBW A;  4NQ3 A;  5IYZ B;  3KJJ A;  3AGK A;  4X1K B;  3C9U A;  5JVD A;  5EAZ A;  5GIN C;  3LME A;  3N2G B;  2Z1E A;  3RYH B;  1IV3 A;  1XHO A;  3F0E A;  3V3T A;  1KD1 H;  3L7Q A;  3OW2 F;  3RA6 A;  1VHA A;  5HWE A;  2KGW A;  2F9Z C;  5MN5 A;  3WJP A;  3ZOP A;  3C9S A;  1M1K H;  3K12 A;  1SDS A;  2GZL A;  1GO1 A;  2FC3 A;  3HKE A;  4G4W A;  3IMP A;  2P6Y A;  5AVM A;  1YGY A;  3VCZ A;  3MDO A;  4BT5 A;  5FLX M;  1IV1 A;  3S0Y A;  5LA6 B;  2QA4 F;  2VAW A;  4O4L B;  4FFB A;  3QUW A;  1RQ7 A;  4U39 A;  3E22 A;  1IPA A;  3HKE B;  5JCO C;  2QI2 A;  2UYJ A;  2KTU A;  4C8I A;  4WBN B;  1VQM F;  3KIZ A;  3I7T A;  4FFB B;  5CB4 A;  5GAP K;  4O2B A;  4BVT A;  3FD5 A;  1KC8 H;  1T0A A;  4C82 A;  2BTQ B;  2H8E A;  3J7A R;  2ZAU A;  2UYN A;  4I4T B;  3ZP7 A;  2HX0 A;  3WPX A;  4G4Y A;  3CME F;  3G6E F;  2VGN A;  3G4S F;  3QTY A;  4YJ3 A;  1OFU A;  5IJ0 B;  2HS4 A;  5MN4 A;  3D54 A;  2OTM A;  3VI6 A;  5KMG B;  1ZWZ A;  5CA1 B;  2UYN B;  1DT9 A;  4LNU B;  3RYI A;  5G4V C;  1SA0 B;  3CYP B;  1K73 H;  2UZH A;  3I3F A;  1CK2 A;  3RYC A;  3I56 F;  5ITZ B;  2W8B C;  1VQ8 F;  4ERH A;  5EIB D;  1ODE A;  1N8R H;  5LXT B;  5LP6 A;  4O4I A;  2Z1U A;  4ZHY B;  3EOR A;  3FBA A;  1UI9 A;  4IHJ B;  4U3J A;  1QD9 A;  4TZZ A;  1QU9 A;  3HKB A;  1VQ7 F;  1W5B A;  3FD6 A;  1RA4 A;  3V7Q A;  4BW0 B;  2OTJ F;  5LYJ A;  2HS0 A;  2AIF A;  3JAS A;  2YYE A;  2B33 A;  1Q7Y H;  3VOB A;  4O4J A;  4X3M A;  3T80 A;  2CWJ A;  4BT2 A;  5JH7 A;  3PLA C;  2K1S A;  2V9Y A;  3C9R A;  1FFX A;  3NMU C;  3I55 F;  1W5F A;  2GVI A;  5HP7 A;  5LYJ B;  2HP0 A;  3VMF B;  3F6M A;  3D00 A;  3FFM A;  3LWQ C;  2HQS C;  5HY2 A;  1Q81 H;  3WGJ A;  4X1K A;  5JH7 B;  3C9T A;  2LCA A; 
#chains in the Genus database with same CATH homology
 3OON A;  3KHN A;  2KGW A;  2N48 A;  5EB1 B;  4PWT A;  4R40 B;  2AIZ P;  2MQE A;  2ZVZ A;  2L26 A;  3S06 A;  3CYP B;  5EB0 A;  2ZOV A;  4G4Z A;  3LDT A;  3IMP A;  2K1S A;  4G4W A;  4RHA A;  2W8B C;  2ZF8 A;  2LBT A;  4G4V A;  4ERH A;  5EAZ A;  4ZHW A;  3TD3 A;  3TD4 A;  3S0H A;  3S0Y A;  4B62 A;  4B5C A;  4ZHV A;  4ZHY B;  3S02 A;  3S03 A;  3WPX A;  4G4Y A;  3S0W A;  3CYQ A;  2HQS C;  4G4X A;  3WPW A;  4G88 A;  3TD5 A;  2ZVY A;  1OAP A;  1R1M A;  2LCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...