3TDBA

Human pin1 bound to trans peptidomimetic inhibitor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
146
Chain Sequence
b'KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural and Kinetic Analysis of Prolyl-isomerization/Phosphorylation Cross-Talk in the CTD Code.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/inhibitor
total genus 47
structure length 146
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3tdbA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3tdbA02
4U85A 4R0XA 1PINA 1KT1A 2KE0A 2MLZA 2JX8A 1FKKA 3LE4A 5HUAA 2ZAJA 1EQ3A 4ODLA 3H9RB 1NMVA 2OFNA 2LPVA 1FD9A 3RFWA 3O5KA 3NTPA 2JMFA 2PV1A 3IHZA 4JFLA 3M7NA 1YATA 2M8IA 4ODKA 5HW7A 1D7JA 1L1PA 4GGQA 5I98A 5HKGA 3JYMA 2KO7A 2M8JA 3ODKA 1KT0A 1FKIA 3O5QA 1F8AB 1C9HA 2YSHA 2RUDA 1D7IA 3EY6A 3TCZA 4NNRA 2XP7A 3UQAA 4DROA 2F21A 2ZQUA 4C02B 2ITKA 3L4HA 4MGVA 4LAXA 5HT1A 2K8IA 2DWVA 3CNGA 2BA1A 3KAHA 5B8IC 3O5EA 4J4OA 1B6CA 3O5IA 4N19A 4LAWA 5CQ2A 2RUQA 4ITZA 3NI6A 4JFIA 4O2TA 1TCOC 4DT4A 1FJDA 2Y78A 3O5LA 4BF8A 4DZ3A 2UZ5A 4DRJA 3WH0A 1FKDA 1Q6HA 3IK8A 3KZ7A 4IQCA 2FAPA 1R9HA 1N1AA 2ZR4A 1BKFA 1FKRA 4ODRA 2XP3A 4E5RA 1EG3A 1ROUA 4ODPA 5HW8A 2L2SA 2PPOA 2RE3A 2VCDA 1FKLA 4W9OA 4TNSA 2KFWA 3CGMA 3MDYB 4JFMA 4LAYA 2YSFA 1EG4A 3KAIA 4QT2A 3FAPA 1FKBA 3KABA 4DH0A 1J4HA 3UQIA 2MNTA 1Q1CA 4IQ2A 3OOBA 2FKEA 2ZQVA 2DG3A 1FKFA 2ZR5A 3TC5A 1ZK6A 1QPLA 4LAVA 3KAFA 1D6OA 1Q6UA 2XP6A 2E45A 1FKTA 2YSBA 1QPFA 2D9FA 4JYSA 3UI5A 4GIVA 4DIPA 1TK7A 2IF4A 1FKSA 3PRBA 2AWGA 3B7XA 1EYMA 3UI4A 1WR7A 3UQBA 1ROTA 3RGCA 1JNSA 1FKGA 3LUOA 1FKJA 2MLYA 2M3OW 3O5MA 2XP4A 2PV3A 4FN2A 3CGNA 4W9PA 2KR7A 4DRQA 2ZR6A 2ZQSA 4G2PA 4TX0A 2JV4A 3M85A 3GPKA 2XP9A 2PPNA 2RSEA 4DRMA 1PBKA 3UI6A 2PPPA 2KGJA 2LAJA 1JMQA 3O5JA 2JXWA 1Q6IA 2ZQTA 4ODQA 4TW8A 5D75A 1HXVA 2LGOA 3NRKA 3KAGA 2JZVA 1F40A 2YSIA 4U86A 4DRKA 1J4IA 2XPAA 5HWCA 2KI3A 2DJYA 1O6WA 3O5DA 5AHTA 5HWBA 4FAPA 5BXJA 2RURA 1M5YA 1FAPA 2DG9A 2Q5AA 2DG4A 3O5OA 4J4NA 2DMVA 1A7XA 2PBCA 3KCEA 2PV2A 2MLXA 1Y0OA 5DIUA 3PA7A 5DITA 1J4RA 2RUCA 4TW7A 2KXQA 2XPBA 2M1IA 3KADA 2DK7A 4G50A 1J6YA 1P5QA 2M08A 2XP5A 1I5HW 4QIBA 1JNTA 4TYOA 4ODMA 3I6CA 3PRDA 3JXVA 3KACA 4DRHA 5DIVA 2YSGA 1YW5A 4JFKA 5GPGA 1FKHA 2N87A 3O5GA 2MDIA 1BL4A 4DRIA 5J6EA 3IKDA 2RQSA 1WMVA 1T11A 2LJ4A 4U84A 3VAWA 2MPHA 2LKNA 3IKGA 5HW6A 4IPXA 4REXA 1QZ2A 2M2AA 4DRPA 4JFJA 3O5RA 3TDBA 4ODNA 1NMWA 2DK1A 1D7HA 4W9QA 2MF9A 1K9QA 4DZ2A 2VN1A 2L4JA 2EZ5W 3UF8A 3O5FA 2F2DA 1ZCNA 4MSPA 4TW6A 4DRNA 2F4EA 3JYJA 3O5PA 2XP8A 5HTGA 1NSGA 4QT3A 1W26A 1K9RA 1U79A 4ODOA 1JVWA
chains in the Genus database with same CATH superfamily
4DWSB 2DSWA 4U85A 4R0XA 1PINA 1KT1A 2KE0A 2MLZA 2A3AA 2JX8A 1FKKA 4W5UA 3LE4A 3OA5A 1HJVA 5HBFA 2A3BA 5HUAA 1IX5A 2ZAJA 3AS1A 1EQ3A 3QOKA 4ODLA 3H9RB 1NMVA 2OFNA 5U47A 5GQBA 2LPVA 2EULA 1CTNA 2WLZA 1ZBVA 1FD9A 4Q7NA 3RFWA 1GOIA 3NTPA 2JMFA 3O5KA 3GTYX 2PV1A 3IHZA 2WK2A 3WQWA 4IT4A 5E64A 4WKFA 4JFLA 1ITXA 3M7NA 1YATA 1HJWA 2M8IA 4ODKA 5HW7A 1D7JA 1L1PA 4GGQA 5I98A 1SYTA 5HKGA 3JYMA 1H0IA 2B5UB 4Q22A 2KO7A 2M8JA 4DWSC 3ODKA 4URIA 4A0TA 1KT0A 1E6RA 3RM9A 1FKIA 3WQVA 3O5QA 3MCBB 1JCHB 1F8AB 2A3CA 1C9HA 2YSHA 1OGGA 4XAKA 2RUDA 1D7IA 3EY6A 3TCZA 4NNRA 2XP7A 3UQAA 4DROA 2F21A 2ZQUA 4C02B 1OWQA 2ITKA 3L4HA 3ARQA 4MGVA 4LAXA 1GRJA 5HT1A 1W9VA 1WNOA 2K8IA 3CHCA 1ZBCA 2DWVA 1EIBA 3CNGA 2BA1A 4WIWA 3KAHA 1ZBWA 5B8IC 3B9EA 3O5EA 4MNLA 4J4OA 5DEZA 4Z2HA 4PTMA 1B6CA 3O5IA 4N19A 4LAWA 5CQ2A 2RUQA 4ITZA 3NI6A 1XHGA 2DT2A 4JFIA 3WIJA 1TFVA 4O2TA 1TCOC 3BXWA 4DT4A 3PQHA 1K9TA 1FJDA 4L3NA 5JH8A 2Y78A 3PRAA 3O5LA 4BF8A 4DZ3A 2UZ5A 4DRJA 3RMEA 3WH0A 1FKDA 1X6LA 1Q6HA 1RP5A 3IK8A 3KZ7A 4S3KA 3MCBA 1NWSA 3FY1A 4IQCA 4R5EA 4DWSD 2DT1A 2FAPA 3CHEA 1R9HA 1HKJA 1N1AA 1JNDA 2ZR4A 1BKFA 1FKRA 3PR9A 4ODRA 2XP3A 3B8SA 1VF8A 1TR8A 4Z2LA 4E5RA 1EG3A 2DPEA 1ROUA 4ODPA 2G8ZA 1E6NA 4P8VA 2B31A 4MTVA 5HW8A 1UR8A 2WM0A 2L2SA 2PPOA 2RE3A 1FLCA 4MNKA 2VCDA 1FKLA 4W9OA 4TNSA 1E44A 3WD1A 3W4RA 1W1VA 2KFWA 3CGMA 3ARUA 3MDYB 3CHFA 4JFMA 1HKIA 4LAYA 2YSFA 1EG4A 3KAIA 4QT2A 3FAPA 1FKBA 3WD0A 3KABA 4DH0A 1J4HA 4MNJA 2WAEA 1NWUA 1KFWA 2DSUA 1E15A 1OGBA 3UQIA 2MNTA 1Q1CA 4IQ2A 3CH9A 2DSZA 3RM8A 2WADA 3OOBA 2FKEA 1LL7A 2ZQVA 2DG3A 1FKFA 2ZR5A 3TC5A 3MQGA 1ZK6A 1QPLA 4WJXA 4LAVA 3KAFA 1D6OA 1LG2A 4UDMA 2A3EA 3RM4A 1Q6UA 4ZPWR 2XP6A 1W9UA 2O92A 2E45A 2OLHA 1FKTA 2YSBA 1QPFA 2D9FA 1HJXA 4JYSA 3UI5A 2F23A 3ARZA 2G41A 4ZPTR 4GIVA 4Z2JA 4DIPA 1TK7A 2IF4A 1FKSA 3PRBA 2AWGA 4QZVB 3B7XA 1EYMA 3UI4A 1W9PA 3ARRA 1WR7A 3UQBA 4S3JA 1ROTA 3RGCA 1JNSA 1FKGA 4MAVA 3LUOA 1FKJA 2YBTA 2MLYA 1RD6A 2M3OW 3EIPA 3O5MA 2XP4A 2PV3A 4ZPVR 4FN2A 3LKXB 3CGNA 4W9PA 5DO2A 4NSBA 2KR7A 3ARVA 4DRQA 1NWRA 1SR0A 2ZR6A 2ZQSA 3ARTA 3WL1A 4MNMA 4G2PA 1HKKA 4TX0A 3GU0A 4Z2KA 4P8UA 2JV4A 3M85A 4WKAA 1W1PA 1LJYA 3GPKA 2XP9A 2PPNA 2RSEA 4DRMA 1PBKA 3WKZA 3UI6A 3ALFA 2PPPA 2KGJA 2LAJA 1JMQA 2IUZA 3O5JA 2JXWA 1Q6IA 2ZQTA 4ODQA 2YAJB 4TW8A 3ARYA 3AS2A 5D75A 2PI6A 4WK9A 4Z2GA 1HXVA 2LGOA 5E62A 1JNEA 1NWTA 3AQUA 3NRKA 3KAGA 1LG1A 2JZVA 2YBUA 1F40A 2YSIA 1LL4A 1E6ZA 4U86A 4DRKA 1J4IA 3G6MA 3LKXA 2XPAA 5HWCA 3G6LA 1E6PA 1FFRA 2KI3A 5DF0A 4NZCA 2DJYA 1O6WA 1ZU8A 3B9AA 1HKMA 3ARWA 3O5DA 5AHTA 3FXYA 4GLXA 5HWBA 1ZBKA 1O6IA 4FAPA 5BXJA 2RURA 1M5YA 1EDQA 1FAPA 2Y8NB 3WD3A 2DG9A 1WB0A 2Q5AA 2DG4A 3O5OA 4J4NA 2DMVA 1A7XA 2PBCA 1H0GA 3KCEA 2PV2A 2ESCA 2MLXA 1Y0OA 1UR9A 4L72B 5DIUA 3PA7A 3WD4A 4IT6A 5DITA 2P4VA 1J4RA 2RUCA 4HBEA 4TW7A 3CZ8A 4P8WA 2KXQA 2XPBA 2M1IA 3KADA 2DK7A 4G50A 1J6YA 1P5QA 1EHNA 3WL0A 2QRVA 2M08A 4KR0B 1LL6A 2XP5A 3ARPA 1I5HW 4QIBA 1JNTA 4TYOA 5E66A 2OWOA 4ODMA 2ETNA 2O9OA 1GPFA 3I6CA 3PRDA 3JXVA 3KACA 3FSBA 1LQ0A 4DRHA 5DIVA 2YSGA 1D2KA 1YW5A 4JFKA 5GPGA 1FKHA 2N87A 3B9DA 3O5GA 4DWSA 2MDIA 1XRVA 1BL4A 1FFQA 3AROA 4DRIA 2AOSA 5J6EA 3IKDA 4HARA 4LGXA 2PN0A 2RQSA 4WKHA 1WMVA 3ALGA 4AY1A 1T11A 2QF8A 1E9LA 3AS3A 3BMBA 4ZS6A 2LJ4A 1GUVA 4U84A 3VAWA 1ZB5A 2MPHA 2LKNA 3IKGA 1ZL1A 5HW6A 4KQZA 4IPXA 4REXA 1QZ2A 3CHDA 2M2AA 4DRPA 5E65A 4JFJA 3O5RA 3TDBA 2DT0A 4ODNA 1NMWA 3WD2A 3AS0A 2DK1A 2WLYA 4P8XA 5GPRA 1D7HA 4W9QA 2MF9A 1K9QA 4DZ2A 4Z2IA 2VN1A 4MPKA 2DSVA 2L4JA 2EZ5W 1W1YA 3ARXA 3UF8A 1W1TA 3O5FA 2F2DA 4ML4A 4HBOA 1ZCNA 1NH6A 4MSPA 4TW6A 1X6NA 4DRNA 2F4EA 3JYJA 3FSCA 3O5PA 2FDMA 2XP8A 3FS8A 1WAWA 2DT3A 5HTGA 1NSGA 3MQHA 4A0UA 4QT3A 1W26A 5E5WA 1K9RA 1U79A 3ARSA 4ODOA 1JVWA
chains in the Genus database with same CATH topology
4DWSB 2DSWA 4U85A 4R0XA 1PINA 1KT1A 2KE0A 2MLZA 2A3AA 2JX8A 1FKKA 4W5UA 3LE4A 3OA5A 1HJVA 5HBFA 2A3BA 5HUAA 1IX5A 2ZAJA 3AS1A 1EQ3A 3QOKA 4ODLA 3H9RB 1NMVA 2OFNA 5U47A 5GQBA 2LPVA 1CTNA 2WLZA 1ZBVA 1FD9A 4Q7NA 3RFWA 1GOIA 3NTPA 2JMFA 3O5KA 2PV1A 3IHZA 2WK2A 3WQWA 4IT4A 5E64A 4WKFA 4JFLA 1ITXA 3M7NA 1YATA 1HJWA 2M8IA 4ODKA 5HW7A 1D7JA 1L1PA 4GGQA 5I98A 1SYTA 5HKGA 3JYMA 1H0IA 4Q22A 2KO7A 2M8JA 4DWSC 3ODKA 4URIA 4A0TA 1KT0A 1E6RA 3RM9A 1FKIA 3WQVA 3O5QA 3MCBB 1F8AB 2A3CA 1C9HA 2YSHA 1OGGA 4XAKA 2RUDA 1D7IA 3EY6A 3TCZA 4NNRA 2XP7A 3UQAA 4DROA 2F21A 2ZQUA 4C02B 1OWQA 2ITKA 3L4HA 3ARQA 4MGVA 4LAXA 5HT1A 1W9VA 1WNOA 2K8IA 3CHCA 1ZBCA 2DWVA 1EIBA 3CNGA 2BA1A 4WIWA 3KAHA 1ZBWA 5B8IC 3B9EA 3O5EA 4MNLA 4J4OA 5DEZA 4Z2HA 4PTMA 1B6CA 3O5IA 4N19A 4LAWA 5CQ2A 2RUQA 4ITZA 3NI6A 1XHGA 2DT2A 4JFIA 3WIJA 1TFVA 4O2TA 1TCOC 3BXWA 4DT4A 3PQHA 1K9TA 1FJDA 4L3NA 5JH8A 2Y78A 3PRAA 3O5LA 4BF8A 4DZ3A 2UZ5A 4DRJA 3RMEA 3WH0A 1FKDA 1X6LA 1Q6HA 1RP5A 3IK8A 3KZ7A 4S3KA 3MCBA 1NWSA 3FY1A 4IQCA 4R5EA 4DWSD 2DT1A 2FAPA 3CHEA 1R9HA 1HKJA 1N1AA 1JNDA 2ZR4A 1BKFA 1FKRA 3PR9A 4ODRA 2XP3A 3B8SA 1VF8A 1TR8A 4Z2LA 4E5RA 1EG3A 2DPEA 1ROUA 4ODPA 2G8ZA 1E6NA 4P8VA 2B31A 4MTVA 5HW8A 1UR8A 2WM0A 2L2SA 2PPOA 2RE3A 1FLCA 4MNKA 2VCDA 1FKLA 4W9OA 4TNSA 3WD1A 3W4RA 1W1VA 2KFWA 3CGMA 3ARUA 3MDYB 3CHFA 4JFMA 1HKIA 4LAYA 2YSFA 1EG4A 3KAIA 4QT2A 3FAPA 1FKBA 3WD0A 3KABA 4DH0A 1J4HA 4MNJA 2WAEA 1NWUA 1KFWA 2DSUA 1E15A 1OGBA 3UQIA 2MNTA 1Q1CA 4IQ2A 3CH9A 2DSZA 3RM8A 2WADA 3OOBA 2FKEA 1LL7A 2ZQVA 2DG3A 1FKFA 2ZR5A 3TC5A 3MQGA 1ZK6A 1QPLA 4WJXA 4LAVA 3KAFA 1D6OA 1LG2A 2A3EA 3RM4A 1Q6UA 4ZPWR 2XP6A 1W9UA 2O92A 2E45A 2OLHA 1FKTA 2YSBA 1QPFA 2D9FA 1HJXA 4JYSA 3UI5A 3ARZA 2G41A 4ZPTR 4GIVA 4Z2JA 4DIPA 1TK7A 2IF4A 1FKSA 3PRBA 2AWGA 4QZVB 3B7XA 1EYMA 3UI4A 1W9PA 3ARRA 1WR7A 3UQBA 4S3JA 1ROTA 3RGCA 1JNSA 1FKGA 4MAVA 3LUOA 1FKJA 2YBTA 2MLYA 1RD6A 2M3OW 3O5MA 2XP4A 2PV3A 4ZPVR 4FN2A 3LKXB 3CGNA 4W9PA 5DO2A 4NSBA 2KR7A 3ARVA 4DRQA 1NWRA 1SR0A 2ZR6A 2ZQSA 3ARTA 3WL1A 4MNMA 4G2PA 1HKKA 4TX0A 4Z2KA 4P8UA 2JV4A 3M85A 4WKAA 1W1PA 1LJYA 3GPKA 2XP9A 2PPNA 2RSEA 4DRMA 1PBKA 3WKZA 3UI6A 3ALFA 2PPPA 2KGJA 2LAJA 1JMQA 2IUZA 3O5JA 2JXWA 1Q6IA 2ZQTA 4ODQA 2YAJB 4TW8A 3ARYA 3AS2A 5D75A 2PI6A 4WK9A 4Z2GA 1HXVA 2LGOA 5E62A 1JNEA 1NWTA 3AQUA 3NRKA 3KAGA 1LG1A 2JZVA 2YBUA 1F40A 2YSIA 1LL4A 1E6ZA 4U86A 4DRKA 1J4IA 3G6MA 3LKXA 2XPAA 5HWCA 3G6LA 1E6PA 1FFRA 2KI3A 5DF0A 4NZCA 2DJYA 1O6WA 1ZU8A 3B9AA 1HKMA 3ARWA 3O5DA 5AHTA 3FXYA 4GLXA 5HWBA 1ZBKA 1O6IA 4FAPA 5BXJA 2RURA 1M5YA 1EDQA 1FAPA 2Y8NB 3WD3A 2DG9A 1WB0A 2Q5AA 2DG4A 3O5OA 4J4NA 2DMVA 1A7XA 2PBCA 1H0GA 3KCEA 2PV2A 2ESCA 2MLXA 1Y0OA 1UR9A 4L72B 5DIUA 3PA7A 3WD4A 4IT6A 5DITA 1J4RA 2RUCA 4HBEA 4TW7A 3CZ8A 4P8WA 2KXQA 2XPBA 2M1IA 3KADA 2DK7A 4G50A 1J6YA 1P5QA 1EHNA 3WL0A 2QRVA 2M08A 4KR0B 1LL6A 2XP5A 3ARPA 1I5HW 4QIBA 1JNTA 4TYOA 5E66A 2OWOA 4ODMA 2O9OA 1GPFA 3I6CA 3PRDA 3JXVA 3KACA 3FSBA 1LQ0A 4DRHA 5DIVA 2YSGA 1D2KA 1YW5A 4JFKA 5GPGA 1FKHA 2N87A 3B9DA 3O5GA 4DWSA 2MDIA 1XRVA 1BL4A 1FFQA 3AROA 4DRIA 2AOSA 5J6EA 3IKDA 4HARA 4LGXA 2RQSA 4WKHA 1WMVA 3ALGA 4AY1A 1T11A 2QF8A 1E9LA 3AS3A 4ZS6A 2LJ4A 1GUVA 4U84A 3VAWA 1ZB5A 2MPHA 2LKNA 3IKGA 1ZL1A 5HW6A 4KQZA 4IPXA 4REXA 1QZ2A 3CHDA 2M2AA 4DRPA 5E65A 4JFJA 3O5RA 3TDBA 2DT0A 4ODNA 1NMWA 3WD2A 3AS0A 2DK1A 2WLYA 4P8XA 5GPRA 1D7HA 4W9QA 2MF9A 1K9QA 4DZ2A 4Z2IA 2VN1A 4MPKA 2DSVA 2L4JA 2EZ5W 1W1YA 3ARXA 3UF8A 1W1TA 3O5FA 2F2DA 4ML4A 4HBOA 1ZCNA 1NH6A 4MSPA 4TW6A 1X6NA 4DRNA 2F4EA 3JYJA 3FSCA 3O5PA 2FDMA 2XP8A 3FS8A 1WAWA 2DT3A 5HTGA 1NSGA 3MQHA 4A0UA 4QT3A 1W26A 5E5WA 1K9RA 1U79A 3ARSA 4ODOA 1JVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U85 A;  4R0X A;  1PIN A;  1KT1 A;  2KE0 A;  2MLZ A;  2JX8 A;  1FKK A;  3LE4 A;  5HUA A;  2ZAJ A;  1EQ3 A;  4ODL A;  3H9R B;  1NMV A;  2OFN A;  2LPV A;  1FD9 A;  3RFW A;  3O5K A;  3NTP A;  2JMF A;  2PV1 A;  3IHZ A;  4JFL A;  3M7N A;  1YAT A;  2M8I A;  4ODK A;  5HW7 A;  1D7J A;  1L1P A;  4GGQ A;  5I98 A;  5HKG A;  3JYM A;  2KO7 A;  2M8J A;  3ODK A;  1KT0 A;  1FKI A;  3O5Q A;  1F8A B;  1C9H A;  2YSH A;  2RUD A;  1D7I A;  3EY6 A;  3TCZ A;  4NNR A;  2XP7 A;  3UQA A;  4DRO A;  2F21 A;  2ZQU A;  4C02 B;  2ITK A;  3L4H A;  4MGV A;  4LAX A;  5HT1 A;  2K8I A;  2DWV A;  3CNG A;  2BA1 A;  3KAH A;  5B8I C;  3O5E A;  4J4O A;  1B6C A;  3O5I A;  4N19 A;  4LAW A;  5CQ2 A;  2RUQ A;  4ITZ A;  3NI6 A;  4JFI A;  4O2T A;  1TCO C;  4DT4 A;  1FJD A;  2Y78 A;  3O5L A;  4BF8 A;  4DZ3 A;  2UZ5 A;  4DRJ A;  3WH0 A;  1FKD A;  1Q6H A;  3IK8 A;  3KZ7 A;  4IQC A;  2FAP A;  1R9H A;  1N1A A;  2ZR4 A;  1BKF A;  1FKR A;  4ODR A;  2XP3 A;  4E5R A;  1EG3 A;  1ROU A;  4ODP A;  5HW8 A;  2L2S A;  2PPO A;  2RE3 A;  2VCD A;  1FKL A;  4W9O A;  4TNS A;  2KFW A;  3CGM A;  3MDY B;  4JFM A;  4LAY A;  2YSF A;  1EG4 A;  3KAI A;  4QT2 A;  3FAP A;  1FKB A;  3KAB A;  4DH0 A;  1J4H A;  3UQI A;  2MNT A;  1Q1C A;  4IQ2 A;  3OOB A;  2FKE A;  2ZQV A;  2DG3 A;  1FKF A;  2ZR5 A;  3TC5 A;  1ZK6 A;  1QPL A;  4LAV A;  3KAF A;  1D6O A;  1Q6U A;  2XP6 A;  2E45 A;  1FKT A;  2YSB A;  1QPF A;  2D9F A;  4JYS A;  3UI5 A;  4GIV A;  4DIP A;  1TK7 A;  2IF4 A;  1FKS A;  3PRB A;  2AWG A;  3B7X A;  1EYM A;  3UI4 A;  1WR7 A;  3UQB A;  1ROT A;  3RGC A;  1JNS A;  1FKG A;  3LUO A;  1FKJ A;  2MLY A;  2M3O W;  3O5M A;  2XP4 A;  2PV3 A;  4FN2 A;  3CGN A;  4W9P A;  2KR7 A;  4DRQ A;  2ZR6 A;  2ZQS A;  4G2P A;  4TX0 A;  2JV4 A;  3M85 A;  3GPK A;  2XP9 A;  2PPN A;  2RSE A;  4DRM A;  1PBK A;  3UI6 A;  2PPP A;  2KGJ A;  2LAJ A;  1JMQ A;  3O5J A;  2JXW A;  1Q6I A;  2ZQT A;  4ODQ A;  4TW8 A;  5D75 A;  1HXV A;  2LGO A;  3NRK A;  3KAG A;  2JZV A;  1F40 A;  2YSI A;  4U86 A;  4DRK A;  1J4I A;  2XPA A;  5HWC A;  2KI3 A;  2DJY A;  1O6W A;  3O5D A;  5AHT A;  5HWB A;  4FAP A;  5BXJ A;  2RUR A;  1M5Y A;  1FAP A;  2DG9 A;  2Q5A A;  2DG4 A;  3O5O A;  4J4N A;  2DMV A;  1A7X A;  2PBC A;  3KCE A;  2PV2 A;  2MLX A;  1Y0O A;  5DIU A;  3PA7 A;  5DIT A;  1J4R A;  2RUC A;  4TW7 A;  2KXQ A;  2XPB A;  2M1I A;  3KAD A;  2DK7 A;  4G50 A;  1J6Y A;  1P5Q A;  2M08 A;  2XP5 A;  1I5H W;  4QIB A;  1JNT A;  4TYO A;  4ODM A;  3I6C A;  3PRD A;  3JXV A;  3KAC A;  4DRH A;  5DIV A;  2YSG A;  1YW5 A;  4JFK A;  5GPG A;  1FKH A;  2N87 A;  3O5G A;  2MDI A;  1BL4 A;  4DRI A;  5J6E A;  3IKD A;  2RQS A;  1WMV A;  1T11 A;  2LJ4 A;  4U84 A;  3VAW A;  2MPH A;  2LKN A;  3IKG A;  5HW6 A;  4IPX A;  4REX A;  1QZ2 A;  2M2A A;  4DRP A;  4JFJ A;  3O5R A;  3TDB A;  4ODN A;  1NMW A;  2DK1 A;  1D7H A;  4W9Q A;  2MF9 A;  1K9Q A;  4DZ2 A;  2VN1 A;  2L4J A;  2EZ5 W;  3UF8 A;  3O5F A;  2F2D A;  1ZCN A;  4MSP A;  4TW6 A;  4DRN A;  2F4E A;  3JYJ A;  3O5P A;  2XP8 A;  5HTG A;  1NSG A;  4QT3 A;  1W26 A;  1K9R A;  1U79 A;  4ODO A;  1JVW A; 
#chains in the Genus database with same CATH topology
 4DWS B;  2DSW A;  4U85 A;  4R0X A;  1PIN A;  1KT1 A;  2KE0 A;  2MLZ A;  2A3A A;  2JX8 A;  1FKK A;  4W5U A;  3LE4 A;  3OA5 A;  1HJV A;  5HBF A;  2A3B A;  5HUA A;  1IX5 A;  2ZAJ A;  3AS1 A;  1EQ3 A;  3QOK A;  4ODL A;  3H9R B;  1NMV A;  2OFN A;  5U47 A;  5GQB A;  2LPV A;  2EUL A;  1CTN A;  2WLZ A;  1ZBV A;  1FD9 A;  4Q7N A;  3RFW A;  1GOI A;  3NTP A;  2JMF A;  3O5K A;  3GTY X;  2PV1 A;  3IHZ A;  2WK2 A;  3WQW A;  4IT4 A;  5E64 A;  4WKF A;  4JFL A;  1ITX A;  3M7N A;  1YAT A;  1HJW A;  2M8I A;  4ODK A;  5HW7 A;  1D7J A;  1L1P A;  4GGQ A;  5I98 A;  1SYT A;  5HKG A;  3JYM A;  1H0I A;  2B5U B;  4Q22 A;  2KO7 A;  2M8J A;  4DWS C;  3ODK A;  4URI A;  4A0T A;  1KT0 A;  1E6R A;  3RM9 A;  1FKI A;  3WQV A;  3O5Q A;  3MCB B;  1JCH B;  1F8A B;  2A3C A;  1C9H A;  2YSH A;  1OGG A;  4XAK A;  2RUD A;  1D7I A;  3EY6 A;  3TCZ A;  4NNR A;  2XP7 A;  3UQA A;  4DRO A;  2F21 A;  2ZQU A;  4C02 B;  1OWQ A;  2ITK A;  3L4H A;  3ARQ A;  4MGV A;  4LAX A;  1GRJ A;  5HT1 A;  1W9V A;  1WNO A;  2K8I A;  3CHC A;  1ZBC A;  2DWV A;  1EIB A;  3CNG A;  2BA1 A;  4WIW A;  3KAH A;  1ZBW A;  5B8I C;  3B9E A;  3O5E A;  4MNL A;  4J4O A;  5DEZ A;  4Z2H A;  4PTM A;  1B6C A;  3O5I A;  4N19 A;  4LAW A;  5CQ2 A;  2RUQ A;  4ITZ A;  3NI6 A;  1XHG A;  2DT2 A;  4JFI A;  3WIJ A;  1TFV A;  4O2T A;  1TCO C;  3BXW A;  4DT4 A;  3PQH A;  1K9T A;  1FJD A;  4L3N A;  5JH8 A;  2Y78 A;  3PRA A;  3O5L A;  4BF8 A;  4DZ3 A;  2UZ5 A;  4DRJ A;  3RME A;  3WH0 A;  1FKD A;  1X6L A;  1Q6H A;  1RP5 A;  3IK8 A;  3KZ7 A;  4S3K A;  3MCB A;  1NWS A;  3FY1 A;  4IQC A;  4R5E A;  4DWS D;  2DT1 A;  2FAP A;  3CHE A;  1R9H A;  1HKJ A;  1N1A A;  1JND A;  2ZR4 A;  1BKF A;  1FKR A;  3PR9 A;  4ODR A;  2XP3 A;  3B8S A;  1VF8 A;  1TR8 A;  4Z2L A;  4E5R A;  1EG3 A;  2DPE A;  1ROU A;  4ODP A;  2G8Z A;  1E6N A;  4P8V A;  2B31 A;  4MTV A;  5HW8 A;  1UR8 A;  2WM0 A;  2L2S A;  2PPO A;  2RE3 A;  1FLC A;  4MNK A;  2VCD A;  1FKL A;  4W9O A;  4TNS A;  1E44 A;  3WD1 A;  3W4R A;  1W1V A;  2KFW A;  3CGM A;  3ARU A;  3MDY B;  3CHF A;  4JFM A;  1HKI A;  4LAY A;  2YSF A;  1EG4 A;  3KAI A;  4QT2 A;  3FAP A;  1FKB A;  3WD0 A;  3KAB A;  4DH0 A;  1J4H A;  4MNJ A;  2WAE A;  1NWU A;  1KFW A;  2DSU A;  1E15 A;  1OGB A;  3UQI A;  2MNT A;  1Q1C A;  4IQ2 A;  3CH9 A;  2DSZ A;  3RM8 A;  2WAD A;  3OOB A;  2FKE A;  1LL7 A;  2ZQV A;  2DG3 A;  1FKF A;  2ZR5 A;  3TC5 A;  3MQG A;  1ZK6 A;  1QPL A;  4WJX A;  4LAV A;  3KAF A;  1D6O A;  1LG2 A;  4UDM A;  2A3E A;  3RM4 A;  1Q6U A;  4ZPW R;  2XP6 A;  1W9U A;  2O92 A;  2E45 A;  2OLH A;  1FKT A;  2YSB A;  1QPF A;  2D9F A;  1HJX A;  4JYS A;  3UI5 A;  2F23 A;  3ARZ A;  2G41 A;  4ZPT R;  4GIV A;  4Z2J A;  4DIP A;  1TK7 A;  2IF4 A;  1FKS A;  3PRB A;  2AWG A;  4QZV B;  3B7X A;  1EYM A;  3UI4 A;  1W9P A;  3ARR A;  1WR7 A;  3UQB A;  4S3J A;  1ROT A;  3RGC A;  1JNS A;  1FKG A;  4MAV A;  3LUO A;  1FKJ A;  2YBT A;  2MLY A;  1RD6 A;  2M3O W;  3EIP A;  3O5M A;  2XP4 A;  2PV3 A;  4ZPV R;  4FN2 A;  3LKX B;  3CGN A;  4W9P A;  5DO2 A;  4NSB A;  2KR7 A;  3ARV A;  4DRQ A;  1NWR A;  1SR0 A;  2ZR6 A;  2ZQS A;  3ART A;  3WL1 A;  4MNM A;  4G2P A;  1HKK A;  4TX0 A;  3GU0 A;  4Z2K A;  4P8U A;  2JV4 A;  3M85 A;  4WKA A;  1W1P A;  1LJY A;  3GPK A;  2XP9 A;  2PPN A;  2RSE A;  4DRM A;  1PBK A;  3WKZ A;  3UI6 A;  3ALF A;  2PPP A;  2KGJ A;  2LAJ A;  1JMQ A;  2IUZ A;  3O5J A;  2JXW A;  1Q6I A;  2ZQT A;  4ODQ A;  2YAJ B;  4TW8 A;  3ARY A;  3AS2 A;  5D75 A;  2PI6 A;  4WK9 A;  4Z2G A;  1HXV A;  2LGO A;  5E62 A;  1JNE A;  1NWT A;  3AQU A;  3NRK A;  3KAG A;  1LG1 A;  2JZV A;  2YBU A;  1F40 A;  2YSI A;  1LL4 A;  1E6Z A;  4U86 A;  4DRK A;  1J4I A;  3G6M A;  3LKX A;  2XPA A;  5HWC A;  3G6L A;  1E6P A;  1FFR A;  2KI3 A;  5DF0 A;  4NZC A;  2DJY A;  1O6W A;  1ZU8 A;  3B9A A;  1HKM A;  3ARW A;  3O5D A;  5AHT A;  3FXY A;  4GLX A;  5HWB A;  1ZBK A;  1O6I A;  4FAP A;  5BXJ A;  2RUR A;  1M5Y A;  1EDQ A;  1FAP A;  2Y8N B;  3WD3 A;  2DG9 A;  1WB0 A;  2Q5A A;  2DG4 A;  3O5O A;  4J4N A;  2DMV A;  1A7X A;  2PBC A;  1H0G A;  3KCE A;  2PV2 A;  2ESC A;  2MLX A;  1Y0O A;  1UR9 A;  4L72 B;  5DIU A;  3PA7 A;  3WD4 A;  4IT6 A;  5DIT A;  2P4V A;  1J4R A;  2RUC A;  4HBE A;  4TW7 A;  3CZ8 A;  4P8W A;  2KXQ A;  2XPB A;  2M1I A;  3KAD A;  2DK7 A;  4G50 A;  1J6Y A;  1P5Q A;  1EHN A;  3WL0 A;  2QRV A;  2M08 A;  4KR0 B;  1LL6 A;  2XP5 A;  3ARP A;  1I5H W;  4QIB A;  1JNT A;  4TYO A;  5E66 A;  2OWO A;  4ODM A;  2ETN A;  2O9O A;  1GPF A;  3I6C A;  3PRD A;  3JXV A;  3KAC A;  3FSB A;  1LQ0 A;  4DRH A;  5DIV A;  2YSG A;  1D2K A;  1YW5 A;  4JFK A;  5GPG A;  1FKH A;  2N87 A;  3B9D A;  3O5G A;  4DWS A;  2MDI A;  1XRV A;  1BL4 A;  1FFQ A;  3ARO A;  4DRI A;  2AOS A;  5J6E A;  3IKD A;  4HAR A;  4LGX A;  2PN0 A;  2RQS A;  4WKH A;  1WMV A;  3ALG A;  4AY1 A;  1T11 A;  2QF8 A;  1E9L A;  3AS3 A;  3BMB A;  4ZS6 A;  2LJ4 A;  1GUV A;  4U84 A;  3VAW A;  1ZB5 A;  2MPH A;  2LKN A;  3IKG A;  1ZL1 A;  5HW6 A;  4KQZ A;  4IPX A;  4REX A;  1QZ2 A;  3CHD A;  2M2A A;  4DRP A;  5E65 A;  4JFJ A;  3O5R A;  3TDB A;  2DT0 A;  4ODN A;  1NMW A;  3WD2 A;  3AS0 A;  2DK1 A;  2WLY A;  4P8X A;  5GPR A;  1D7H A;  4W9Q A;  2MF9 A;  1K9Q A;  4DZ2 A;  4Z2I A;  2VN1 A;  4MPK A;  2DSV A;  2L4J A;  2EZ5 W;  1W1Y A;  3ARX A;  3UF8 A;  1W1T A;  3O5F A;  2F2D A;  4ML4 A;  4HBO A;  1ZCN A;  1NH6 A;  4MSP A;  4TW6 A;  1X6N A;  4DRN A;  2F4E A;  3JYJ A;  3FSC A;  3O5P A;  2FDM A;  2XP8 A;  3FS8 A;  1WAW A;  2DT3 A;  5HTG A;  1NSG A;  3MQH A;  4A0U A;  4QT3 A;  1W26 A;  5E5W A;  1K9R A;  1U79 A;  3ARS A;  4ODO A;  1JVW A; 
#chains in the Genus database with same CATH homology
 4DWS B;  2DSW A;  4U85 A;  4R0X A;  1PIN A;  1KT1 A;  2KE0 A;  2MLZ A;  2A3A A;  2JX8 A;  1FKK A;  4W5U A;  3LE4 A;  3OA5 A;  1HJV A;  5HBF A;  2A3B A;  5HUA A;  1IX5 A;  2ZAJ A;  3AS1 A;  1EQ3 A;  3QOK A;  4ODL A;  3H9R B;  1NMV A;  2OFN A;  5U47 A;  5GQB A;  2LPV A;  1CTN A;  2WLZ A;  1ZBV A;  1FD9 A;  4Q7N A;  3RFW A;  1GOI A;  3NTP A;  2JMF A;  3O5K A;  2PV1 A;  3IHZ A;  2WK2 A;  3WQW A;  4IT4 A;  5E64 A;  4WKF A;  4JFL A;  1ITX A;  3M7N A;  1YAT A;  1HJW A;  2M8I A;  4ODK A;  5HW7 A;  1D7J A;  1L1P A;  4GGQ A;  5I98 A;  1SYT A;  5HKG A;  3JYM A;  1H0I A;  4Q22 A;  2KO7 A;  2M8J A;  4DWS C;  3ODK A;  4URI A;  4A0T A;  1KT0 A;  1E6R A;  3RM9 A;  1FKI A;  3WQV A;  3O5Q A;  3MCB B;  1F8A B;  2A3C A;  1C9H A;  2YSH A;  1OGG A;  4XAK A;  2RUD A;  1D7I A;  3EY6 A;  3TCZ A;  4NNR A;  2XP7 A;  3UQA A;  4DRO A;  2F21 A;  2ZQU A;  4C02 B;  1OWQ A;  2ITK A;  3L4H A;  3ARQ A;  4MGV A;  4LAX A;  5HT1 A;  1W9V A;  1WNO A;  2K8I A;  3CHC A;  1ZBC A;  2DWV A;  1EIB A;  3CNG A;  2BA1 A;  4WIW A;  3KAH A;  1ZBW A;  5B8I C;  3B9E A;  3O5E A;  4MNL A;  4J4O A;  5DEZ A;  4Z2H A;  4PTM A;  1B6C A;  3O5I A;  4N19 A;  4LAW A;  5CQ2 A;  2RUQ A;  4ITZ A;  3NI6 A;  1XHG A;  2DT2 A;  4JFI A;  3WIJ A;  1TFV A;  4O2T A;  1TCO C;  3BXW A;  4DT4 A;  3PQH A;  1K9T A;  1FJD A;  4L3N A;  5JH8 A;  2Y78 A;  3PRA A;  3O5L A;  4BF8 A;  4DZ3 A;  2UZ5 A;  4DRJ A;  3RME A;  3WH0 A;  1FKD A;  1X6L A;  1Q6H A;  1RP5 A;  3IK8 A;  3KZ7 A;  4S3K A;  3MCB A;  1NWS A;  3FY1 A;  4IQC A;  4R5E A;  4DWS D;  2DT1 A;  2FAP A;  3CHE A;  1R9H A;  1HKJ A;  1N1A A;  1JND A;  2ZR4 A;  1BKF A;  1FKR A;  3PR9 A;  4ODR A;  2XP3 A;  3B8S A;  1VF8 A;  1TR8 A;  4Z2L A;  4E5R A;  1EG3 A;  2DPE A;  1ROU A;  4ODP A;  2G8Z A;  1E6N A;  4P8V A;  2B31 A;  4MTV A;  5HW8 A;  1UR8 A;  2WM0 A;  2L2S A;  2PPO A;  2RE3 A;  1FLC A;  4MNK A;  2VCD A;  1FKL A;  4W9O A;  4TNS A;  3WD1 A;  3W4R A;  1W1V A;  2KFW A;  3CGM A;  3ARU A;  3MDY B;  3CHF A;  4JFM A;  1HKI A;  4LAY A;  2YSF A;  1EG4 A;  3KAI A;  4QT2 A;  3FAP A;  1FKB A;  3WD0 A;  3KAB A;  4DH0 A;  1J4H A;  4MNJ A;  2WAE A;  1NWU A;  1KFW A;  2DSU A;  1E15 A;  1OGB A;  3UQI A;  2MNT A;  1Q1C A;  4IQ2 A;  3CH9 A;  2DSZ A;  3RM8 A;  2WAD A;  3OOB A;  2FKE A;  1LL7 A;  2ZQV A;  2DG3 A;  1FKF A;  2ZR5 A;  3TC5 A;  3MQG A;  1ZK6 A;  1QPL A;  4WJX A;  4LAV A;  3KAF A;  1D6O A;  1LG2 A;  2A3E A;  3RM4 A;  1Q6U A;  4ZPW R;  2XP6 A;  1W9U A;  2O92 A;  2E45 A;  2OLH A;  1FKT A;  2YSB A;  1QPF A;  2D9F A;  1HJX A;  4JYS A;  3UI5 A;  3ARZ A;  2G41 A;  4ZPT R;  4GIV A;  4Z2J A;  4DIP A;  1TK7 A;  2IF4 A;  1FKS A;  3PRB A;  2AWG A;  4QZV B;  3B7X A;  1EYM A;  3UI4 A;  1W9P A;  3ARR A;  1WR7 A;  3UQB A;  4S3J A;  1ROT A;  3RGC A;  1JNS A;  1FKG A;  4MAV A;  3LUO A;  1FKJ A;  2YBT A;  2MLY A;  1RD6 A;  2M3O W;  3O5M A;  2XP4 A;  2PV3 A;  4ZPV R;  4FN2 A;  3LKX B;  3CGN A;  4W9P A;  5DO2 A;  4NSB A;  2KR7 A;  3ARV A;  4DRQ A;  1NWR A;  1SR0 A;  2ZR6 A;  2ZQS A;  3ART A;  3WL1 A;  4MNM A;  4G2P A;  1HKK A;  4TX0 A;  4Z2K A;  4P8U A;  2JV4 A;  3M85 A;  4WKA A;  1W1P A;  1LJY A;  3GPK A;  2XP9 A;  2PPN A;  2RSE A;  4DRM A;  1PBK A;  3WKZ A;  3UI6 A;  3ALF A;  2PPP A;  2KGJ A;  2LAJ A;  1JMQ A;  2IUZ A;  3O5J A;  2JXW A;  1Q6I A;  2ZQT A;  4ODQ A;  2YAJ B;  4TW8 A;  3ARY A;  3AS2 A;  5D75 A;  2PI6 A;  4WK9 A;  4Z2G A;  1HXV A;  2LGO A;  5E62 A;  1JNE A;  1NWT A;  3AQU A;  3NRK A;  3KAG A;  1LG1 A;  2JZV A;  2YBU A;  1F40 A;  2YSI A;  1LL4 A;  1E6Z A;  4U86 A;  4DRK A;  1J4I A;  3G6M A;  3LKX A;  2XPA A;  5HWC A;  3G6L A;  1E6P A;  1FFR A;  2KI3 A;  5DF0 A;  4NZC A;  2DJY A;  1O6W A;  1ZU8 A;  3B9A A;  1HKM A;  3ARW A;  3O5D A;  5AHT A;  3FXY A;  4GLX A;  5HWB A;  1ZBK A;  1O6I A;  4FAP A;  5BXJ A;  2RUR A;  1M5Y A;  1EDQ A;  1FAP A;  2Y8N B;  3WD3 A;  2DG9 A;  1WB0 A;  2Q5A A;  2DG4 A;  3O5O A;  4J4N A;  2DMV A;  1A7X A;  2PBC A;  1H0G A;  3KCE A;  2PV2 A;  2ESC A;  2MLX A;  1Y0O A;  1UR9 A;  4L72 B;  5DIU A;  3PA7 A;  3WD4 A;  4IT6 A;  5DIT A;  1J4R A;  2RUC A;  4HBE A;  4TW7 A;  3CZ8 A;  4P8W A;  2KXQ A;  2XPB A;  2M1I A;  3KAD A;  2DK7 A;  4G50 A;  1J6Y A;  1P5Q A;  1EHN A;  3WL0 A;  2QRV A;  2M08 A;  4KR0 B;  1LL6 A;  2XP5 A;  3ARP A;  1I5H W;  4QIB A;  1JNT A;  4TYO A;  5E66 A;  2OWO A;  4ODM A;  2O9O A;  1GPF A;  3I6C A;  3PRD A;  3JXV A;  3KAC A;  3FSB A;  1LQ0 A;  4DRH A;  5DIV A;  2YSG A;  1D2K A;  1YW5 A;  4JFK A;  5GPG A;  1FKH A;  2N87 A;  3B9D A;  3O5G A;  4DWS A;  2MDI A;  1XRV A;  1BL4 A;  1FFQ A;  3ARO A;  4DRI A;  2AOS A;  5J6E A;  3IKD A;  4HAR A;  4LGX A;  2RQS A;  4WKH A;  1WMV A;  3ALG A;  4AY1 A;  1T11 A;  2QF8 A;  1E9L A;  3AS3 A;  4ZS6 A;  2LJ4 A;  1GUV A;  4U84 A;  3VAW A;  1ZB5 A;  2MPH A;  2LKN A;  3IKG A;  1ZL1 A;  5HW6 A;  4KQZ A;  4IPX A;  4REX A;  1QZ2 A;  3CHD A;  2M2A A;  4DRP A;  5E65 A;  4JFJ A;  3O5R A;  3TDB A;  2DT0 A;  4ODN A;  1NMW A;  3WD2 A;  3AS0 A;  2DK1 A;  2WLY A;  4P8X A;  5GPR A;  1D7H A;  4W9Q A;  2MF9 A;  1K9Q A;  4DZ2 A;  4Z2I A;  2VN1 A;  4MPK A;  2DSV A;  2L4J A;  2EZ5 W;  1W1Y A;  3ARX A;  3UF8 A;  1W1T A;  3O5F A;  2F2D A;  4ML4 A;  4HBO A;  1ZCN A;  1NH6 A;  4MSP A;  4TW6 A;  1X6N A;  4DRN A;  2F4E A;  3JYJ A;  3FSC A;  3O5P A;  2FDM A;  2XP8 A;  3FS8 A;  1WAW A;  2DT3 A;  5HTG A;  1NSG A;  3MQH A;  4A0U A;  4QT3 A;  1W26 A;  5E5W A;  1K9R A;  1U79 A;  3ARS A;  4ODO A;  1JVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...