3TDBA

Human pin1 bound to trans peptidomimetic inhibitor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
146
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Kinetic Analysis of Prolyl-isomerization/Phosphorylation Cross-Talk in the CTD Code.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/inhibitor
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
total genus 47
structure length 146
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3tdbA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3tdbA02
2DG4A 3O5RA 2PPPA 1F8AB 1ROUA 1TCOC 2M8IA 3GPKA 2M2AA 2MNTA 5HW7A 1C9HA 1FKGA 4W9QA 3UI6A 1O6WA 1PINA 2DK1A 2RQSA 4FN2A 4JFLA 2XPAA 4REXA 1M5YA 3NRKA 4ODMA 4DH0A 1A7XA 3TDBA 1JMQA 1PBKA 3O5IA 2JXWA 2JZVA 3MDYB 1FD9A 3CGNA 4QT3A 2DMVA 2MDIA 1K9QA 4N19A 4ODQA 3FAPA 3CGMA 4DRNA 2DWVA 2PPNA 4DRJA 4DRPA 3I6CA 1Q1CA 4JYSA 5D75A 2XP3A 3KADA 1J4RA 2ZR6A 1Q6UA 2OFNA 4TX0A 3M7NA 4LAXA 4TW7A 4TW8A 1JNTA 2VN1A 2LPVA 2XP9A 3B7XA 2DG3A 2MF9A 2ZAJA 1NMVA 1ZCNA 5HT1A 4DZ2A 2ZQUA 1N1AA 3CNGA 1P5QA 3EY6A 5HKGA 4U84A 4TYOA 1J4IA 4G50A 3KABA 1R9HA 1QPLA 4ODNA 3UF8A 3KACA 2KGJA 3O5MA 2XP5A 3KAHA 1NSGA 3O5PA 2YSIA 4G2PA 3UQBA 1HXVA 5HW8A 2LKNA 1BKFA 4LAYA 1FKLA 3NTPA 4ODPA 1FKKA 1FKTA 1B6CA 5HW6A 5AHTA 1U79A 4TW6A 1FAPA 1FKBA 2F4EA 1J4HA 2JX8A 2F21A 5B8IC 2LAJA 2D9FA 3O5OA 2IF4A 5DITA 2MLYA 5DIUA 3TCZA 2K8IA 2MLXA 1EG4A 3NI6A 3UI4A 3KAIA 3WH0A 4LAWA 3H9RB 3IKGA 2KE0A 4JFKA 3TC5A 2YSBA 1FKSA 2KO7A 2LJ4A 2RSEA 4JFMA 1W26A 2XP6A 3JYJA 4JFIA 4ODLA 3KZ7A 2PPOA 4DRIA 1T11A 4U85A 3M85A 3UQIA 1JNSA 3KCEA 4QIBA 4U86A 2JV4A 1FKFA 3IHZA 1FJDA 1FKIA 1KT0A 4GIVA 2KR7A 1D7JA 1D6OA 2DG9A 2AWGA 4ODKA 1JVWA 2DK7A 3O5DA 1EG3A 4MGVA 1FKHA 1KT1A 4DRKA 3RGCA 4TNSA 5I98A 5J6EA 4MSPA 2F2DA 2EZ5W 2RE3A 5CQ2A 2M08A 3LUOA 1D7HA 4DRQA 2DJYA 4DT4A 1FKRA 2ZQVA 4BF8A 1ZK6A 2FAPA 4QT2A 2JMFA 2ZQTA 2KFWA 5GPGA 2L4JA 1F40A 1ROTA 3RFWA 2MLZA 5HTGA 3PA7A 4GGQA 4DRMA 2PBCA 2PV3A 3IK8A 3L4HA 2UZ5A 3O5EA 3ODKA 2RUDA 4IPXA 4JFJA 4LAVA 5BXJA 2YSHA 3O5LA 4DROA 2ITKA 4ITZA 4DZ3A 1YW5A 2M3OW 1EYMA 2YSGA 1FKDA 3IKDA 5DIVA 3UI5A 1Q6IA 5HWCA 3KAGA 2PV2A 2KI3A 1D7IA 5HWBA 4W9PA 4J4OA 2Y78A 4C02B 3O5QA 3KAFA 2L2SA 2M8JA 2MPHA 2XPBA 2ZQSA 2VCDA 1NMWA 3O5KA 3LE4A 2LGOA 3VAWA 1TK7A 4J4NA 3JYMA 4IQCA 1EQ3A 2ZR4A 3O5GA 3O5FA 2XP8A 4IQ2A 1WR7A 1L1PA 2BA1A 2RURA 2ZR5A 4E5RA 1I5HW 2XP4A 2FKEA 4DIPA 4FAPA 2RUQA 2PV1A 4O2TA 2N87A 2Q5AA 1K9RA 1QPFA 1Q6HA 1QZ2A 1FKJA 2RUCA 2M1IA 4ODOA 3JXVA 4R0XA 4NNRA 3O5JA 3UQAA 1BL4A 1Y0OA 2E45A 5HUAA 4ODRA 2KXQA 3OOBA 1YATA 4W9OA 2XP7A 3PRDA 4DRHA 1J6YA 2YSFA 3PRBA 1WMVA
chains in the Genus database with same CATH superfamily
3AS0A 1F8AB 5DO2A 3B9EA 4HARA 1FKGA 2DK1A 4URIA 1W1TA 4FN2A 4REXA 1LJYA 2Y8NB 3FSBA 2JXWA 3CGNA 1E44A 2MDIA 4ODQA 2OLHA 4Q7NA 3I6CA 1Q1CA 3KADA 2ZR6A 1LQ0A 4TX0A 1GOIA 3B9AA 2VN1A 5HT1A 4DZ2A 3WD2A 5E62A 2DT3A 4TYOA 1J4IA 3UF8A 3O5MA 4DWSA 2G8ZA 5HW8A 2LKNA 4LAYA 2YBUA 3NTPA 1D2KA 1FKKA 2WADA 2ETNA 1JNEA 3ARWA 3CHEA 2F21A 2IF4A 5HBFA 2MLXA 3KAIA 3LKXB 3WH0A 3AROA 3RM4A 3TC5A 2YSBA 1FKSA 2KO7A 3WQWA 4Z2LA 4JFIA 2ESCA 4ZPVR 4U85A 1ZL1A 5E5WA 3IHZA 1FKIA 1D7JA 1D6OA 2AWGA 1JVWA 2DSVA 4TNSA 4WIWA 5CQ2A 2RE3A 2DJYA 3ARQA 1HKMA 2JMFA 2ZQTA 2L4JA 1XHGA 3O5EA 1E6PA 3UQBA 3L4HA 4JFJA 3ODKA 3B8SA 3O5LA 1YW5A 2M3OW 5DIVA 1FKDA 3IKDA 4L72B 5HWCA 2PV2A 2KI3A 2Y78A 4C02B 4A0UA 4LGXA 1ZB5A 1TK7A 3BXWA 1NH6A 2B31A 1GPFA 4FAPA 2RUQA 1K9RA 1HJVA 1HKIA 2G41A 1QZ2A 3ALFA 4W5UA 4ZPTR 3O5JA 1BL4A 2E45A 4WJXA 1YATA 4R5EA 3AS3A 2XP7A 3PRDA 4DRHA 2YSFA 3CH9A 4PTMA 4MNJA 4WKHA 3RMEA 3GPKA 1W1PA 2M2AA 2A3EA 2MNTA 5HW7A 4NZCA 3WKZA 1O6WA 2XPAA 1M5YA 3WD0A 1E6RA 3GU0A 2JZVA 3B9DA 4L3NA 4Z2JA 3FAPA 3CGMA 2DWVA 3WD3A 1WNOA 3MCBA 4IT4A 4MAVA 5D75A 2XP3A 3M7NA 1UR8A 2MF9A 2ZQUA 1N1AA 3ARSA 2DSWA 4G50A 3KABA 1WAWA 4ODNA 1TFVA 3MCBB 4ZS6A 1EDQA 3WIJA 4ODPA 1FKTA 1B6CA 1FAPA 2F4EA 3CHDA 2LAJA 5DITA 2MLYA 1EG4A 3IKGA 2DSZA 2RSEA 3WD1A 4ZPWR 1LL4A 3ARVA 4DRIA 1T11A 3ARYA 3UQIA 1JNSA 2F23A 2JV4A 3GTYX 1FJDA 2KR7A 3ARZA 2DG9A 1EG3A 1RP5A 1HKJA 2EZ5W 1D7HA 4MNKA 4QT2A 2KFWA 2B5UB 1ROTA 2MLZA 2O92A 3IK8A 2UZ5A 2RUDA 3G6LA 4LAVA 2YSHA 4DROA 2ITKA 1GRJA 4DZ3A 1K9TA 5HWBA 3ARUA 4MNMA 3O5QA 2MPHA 2VCDA 1HJWA 1EQ3A 1JCHB 2ZR4A 1FFRA 1VF8A 2XP8A 4IQ2A 4Z2IA 3PRAA 1ZU8A 2ZR5A 3WD4A 4O2TA 3CZ8A 1H0GA 1QPFA 1FKJA 4ODOA 4KQZA 1W1VA 2IUZA 2DT2A 3UQAA 5GPRA 4W9OA 4P8UA 1WMVA 1NWRA 2DG4A 1ROUA 1NWUA 3ALGA 2DPEA 1SYTA 1C9HA 1WB0A 2DSUA 4W9QA 3UI6A 1PINA 2RQSA 4JFLA 1JMQA 2OWOA 1PBKA 4QT3A 1K9QA 2PN0A 4N19A 1W9UA 4XAKA 4DRPA 4DRJA 4JYSA 1J4RA 1Q6UA 4DWSB 4LAXA 4IT6A 5E66A 1JNTA 2LPVA 4WKAA 3B7XA 2ZAJA 1NMVA 4Z2KA 5HKGA 3CNGA 1P5QA 4U84A 2DT1A 2A3BA 3KACA 4UDMA 2XP5A 3KAHA 3ARPA 3O5PA 1ZBKA 4G2PA 1HXVA 3EIPA 1E6NA 1FKLA 1X6LA 3LKXA 5HW6A 1ZBVA 5B8IC 2JX8A 3ARTA 4P8WA 2D9FA 3O5OA 3TCZA 2K8IA 1ZBWA 4Z2GA 1OGBA 3CHCA 4JFKA 4QZVB 1L1PA 4JFMA 3UI5A 4ODLA 1W26A 2XP6A 2PPOA 3MQGA 3M85A 1FKFA 4P8XA 1EIBA 1KT0A 3O5DA 4MGVA 1IX5A 1FKHA 5J6EA 5I98A 4KR0B 4S3KA 4MSPA 2F2DA 4DRQA 3LUOA 1ZBCA 1FKRA 2ZQVA 4BF8A 1ZK6A 1E15A 2FAPA 5U47A 3RFWA 3PA7A 4GGQA 4P8VA 5DEZA 3BMBA 2PV3A 4DT4A 3W4RA 3ARXA 5BXJA 3PR9A 1EYMA 2A3AA 2YSGA 4MPKA 3KAGA 1OWQA 1D7IA 2P4VA 2L2SA 2M8JA 2XPBA 2ZQSA 1W1YA 3O5KA 3VAWA 3LE4A 2LGOA 3WL0A 4J4NA 3JYMA 3O5GA 3O5FA 1NWSA 1WR7A 3FSCA 2BA1A 2RURA 2FDMA 1LG2A 2XP4A 2FKEA 4DIPA 1W9PA 2PV1A 3FXYA 1HKKA 4DWSD 2O9OA 2M1IA 4MNLA 4R0XA 4NNRA 1E6ZA 2AOSA 1Y0OA 5E65A 3OOBA 1J6YA 2WAEA 1FLCA 3PRBA 1HJXA 2YAJB 3O5RA 2PPPA 1KFWA 1TCOC 2M8IA 1E9LA 3G6MA 1GUVA 1OGGA 1XRVA 5E64A 3RM8A 1W9VA 2QF8A 4ODMA 5HUAA 3NRKA 4DH0A 1A7XA 4MTVA 3TDBA 3O5IA 3MDYB 1FD9A 2WLYA 2DMVA 4Z2HA 4A0TA 4DRNA 2PPNA 3AS1A 2OFNA 3QOKA 4TW8A 4TW7A 4HBEA 2XP9A 2DG3A 1LL7A 1ZCNA 3EY6A 1LG1A 1CTNA 1R9HA 1QPLA 2KGJA 5JH8A 1NSGA 2YSIA 1BKFA 2WM0A 3FS8A 4NSBA 5AHTA 1U79A 4TW6A 4S3JA 1FKBA 1J4HA 3RM9A 5GQBA 5DIUA 3NI6A 5DF0A 3UI4A 2DT0A 4LAWA 3H9RB 2KE0A 2LJ4A 4WKFA 1NWTA 3JYJA 3KZ7A 1H0IA 2WLZA 3KCEA 4QIBA 4U86A 1O6IA 1JNDA 3ARRA 1FFQA 4GIVA 4Q22A 4ODKA 3WQVA 2DK7A 2YBTA 4DRKA 4GLXA 1KT1A 1X6NA 2WK2A 3RGCA 2EULA 2M08A 3PQHA 4ML4A 5GPGA 4HBOA 1F40A 5HTGA 2A3CA 1SR0A 4DRMA 2PBCA 4IPXA 3OA5A 3FY1A 4ITZA 3AQUA 1Q6IA 4W9PA 4J4OA 3KAFA 1NMWA 4IQCA 2QRVA 4E5RA 1I5HW 3MQHA 3WL1A 1EHNA 1UR9A 2N87A 2Q5AA 1TR8A 1Q6HA 2RUCA 4AY1A 3CHFA 3JXVA 1LL6A 2PI6A 4DWSC 1RD6A 4ODRA 2KXQA 4WK9A 1ITXA 3AS2A
chains in the Genus database with same CATH topology
3AS0A 1F8AB 5DO2A 3B9EA 4HARA 1FKGA 2DK1A 4URIA 1W1TA 4FN2A 4REXA 1LJYA 2Y8NB 3FSBA 2JXWA 3CGNA 2MDIA 4ODQA 2OLHA 4Q7NA 3I6CA 1Q1CA 3KADA 2ZR6A 1LQ0A 4TX0A 1GOIA 3B9AA 2VN1A 5HT1A 4DZ2A 3WD2A 5E62A 2DT3A 4TYOA 1J4IA 3UF8A 3O5MA 4DWSA 2G8ZA 5HW8A 2LKNA 4LAYA 2YBUA 3NTPA 1D2KA 1FKKA 2WADA 1JNEA 3ARWA 3CHEA 2F21A 2IF4A 5HBFA 2MLXA 3KAIA 3LKXB 3WH0A 3AROA 3RM4A 3TC5A 2YSBA 1FKSA 2KO7A 3WQWA 4Z2LA 4JFIA 2ESCA 4ZPVR 4U85A 1ZL1A 5E5WA 3IHZA 1FKIA 1D7JA 1D6OA 2AWGA 1JVWA 2DSVA 4TNSA 4WIWA 5CQ2A 2RE3A 2DJYA 3ARQA 1HKMA 2JMFA 2ZQTA 2L4JA 1XHGA 3O5EA 1E6PA 3UQBA 3L4HA 4JFJA 3ODKA 3B8SA 3O5LA 1YW5A 2M3OW 5DIVA 1FKDA 3IKDA 4L72B 5HWCA 2PV2A 2KI3A 2Y78A 4C02B 4A0UA 4LGXA 1ZB5A 1TK7A 3BXWA 1NH6A 2B31A 1GPFA 4FAPA 2RUQA 1K9RA 1HJVA 1HKIA 2G41A 1QZ2A 3ALFA 4W5UA 4ZPTR 3O5JA 1BL4A 2E45A 4WJXA 1YATA 4R5EA 3AS3A 2XP7A 3PRDA 4DRHA 2YSFA 3CH9A 4PTMA 4MNJA 4WKHA 3RMEA 3GPKA 1W1PA 2M2AA 2A3EA 2MNTA 5HW7A 4NZCA 3WKZA 1O6WA 2XPAA 1M5YA 3WD0A 1E6RA 2JZVA 3B9DA 4L3NA 4Z2JA 3FAPA 3CGMA 2DWVA 3WD3A 1WNOA 3MCBA 4IT4A 4MAVA 5D75A 2XP3A 3M7NA 1UR8A 2MF9A 2ZQUA 1N1AA 3ARSA 2DSWA 4G50A 3KABA 1WAWA 4ODNA 1TFVA 3MCBB 4ZS6A 1EDQA 3WIJA 4ODPA 1FKTA 1B6CA 1FAPA 2F4EA 3CHDA 2LAJA 5DITA 2MLYA 1EG4A 3IKGA 2DSZA 2RSEA 3WD1A 4ZPWR 1LL4A 3ARVA 4DRIA 1T11A 3ARYA 3UQIA 1JNSA 2JV4A 1FJDA 2KR7A 3ARZA 2DG9A 1EG3A 1RP5A 1HKJA 2EZ5W 1D7HA 4MNKA 4QT2A 2KFWA 1ROTA 2MLZA 2O92A 3IK8A 2UZ5A 2RUDA 3G6LA 4LAVA 2YSHA 4DROA 2ITKA 4DZ3A 1K9TA 5HWBA 3ARUA 4MNMA 3O5QA 2MPHA 2VCDA 1HJWA 1EQ3A 2ZR4A 1FFRA 1VF8A 2XP8A 4IQ2A 4Z2IA 3PRAA 1ZU8A 2ZR5A 3WD4A 4O2TA 3CZ8A 1H0GA 1QPFA 1FKJA 4ODOA 4KQZA 1W1VA 2IUZA 2DT2A 3UQAA 5GPRA 4W9OA 4P8UA 1WMVA 1NWRA 2DG4A 1ROUA 1NWUA 3ALGA 2DPEA 1SYTA 1C9HA 1WB0A 2DSUA 4W9QA 3UI6A 1PINA 2RQSA 4JFLA 1JMQA 2OWOA 1PBKA 4QT3A 1K9QA 4N19A 1W9UA 4XAKA 4DRPA 4DRJA 4JYSA 1J4RA 1Q6UA 4DWSB 4LAXA 4IT6A 5E66A 1JNTA 2LPVA 4WKAA 3B7XA 2ZAJA 1NMVA 4Z2KA 5HKGA 3CNGA 1P5QA 4U84A 2DT1A 2A3BA 3KACA 2XP5A 3KAHA 3ARPA 3O5PA 1ZBKA 4G2PA 1HXVA 1E6NA 1FKLA 1X6LA 3LKXA 5HW6A 1ZBVA 5B8IC 2JX8A 3ARTA 4P8WA 2D9FA 3O5OA 3TCZA 2K8IA 1ZBWA 4Z2GA 1OGBA 3CHCA 4JFKA 4QZVB 1L1PA 4JFMA 3UI5A 4ODLA 1W26A 2XP6A 2PPOA 3MQGA 3M85A 1FKFA 4P8XA 1EIBA 1KT0A 3O5DA 4MGVA 1IX5A 1FKHA 5J6EA 5I98A 4KR0B 4S3KA 4MSPA 2F2DA 4DRQA 3LUOA 1ZBCA 1FKRA 2ZQVA 4BF8A 1ZK6A 1E15A 2FAPA 5U47A 3RFWA 3PA7A 4GGQA 4P8VA 5DEZA 2PV3A 4DT4A 3W4RA 3ARXA 5BXJA 3PR9A 1EYMA 2A3AA 2YSGA 4MPKA 3KAGA 1OWQA 1D7IA 2L2SA 2M8JA 2XPBA 2ZQSA 1W1YA 3O5KA 3VAWA 3LE4A 2LGOA 3WL0A 4J4NA 3JYMA 3O5GA 3O5FA 1NWSA 1WR7A 3FSCA 2BA1A 2RURA 2FDMA 1LG2A 2XP4A 2FKEA 4DIPA 1W9PA 2PV1A 3FXYA 1HKKA 4DWSD 2O9OA 2M1IA 4MNLA 4R0XA 4NNRA 1E6ZA 2AOSA 1Y0OA 5E65A 3OOBA 1J6YA 2WAEA 1FLCA 3PRBA 1HJXA 2YAJB 3O5RA 2PPPA 1KFWA 1TCOC 2M8IA 1E9LA 3G6MA 1GUVA 1OGGA 1XRVA 5E64A 3RM8A 1W9VA 2QF8A 4ODMA 5HUAA 3NRKA 4DH0A 1A7XA 4MTVA 3TDBA 3O5IA 3MDYB 1FD9A 2WLYA 2DMVA 4Z2HA 4A0TA 4DRNA 2PPNA 3AS1A 2OFNA 3QOKA 4TW8A 4TW7A 4HBEA 2XP9A 2DG3A 1LL7A 1ZCNA 3EY6A 1LG1A 1CTNA 1R9HA 1QPLA 2KGJA 5JH8A 1NSGA 2YSIA 1BKFA 2WM0A 3FS8A 4NSBA 5AHTA 1U79A 4TW6A 4S3JA 1FKBA 1J4HA 3RM9A 5GQBA 5DIUA 3NI6A 5DF0A 3UI4A 2DT0A 4LAWA 3H9RB 2KE0A 2LJ4A 4WKFA 1NWTA 3JYJA 3KZ7A 1H0IA 2WLZA 3KCEA 4QIBA 4U86A 1O6IA 3ARRA 1JNDA 1FFQA 4GIVA 4Q22A 4ODKA 3WQVA 2DK7A 2YBTA 4DRKA 4GLXA 1KT1A 1X6NA 2WK2A 3RGCA 2M08A 3PQHA 4ML4A 5GPGA 4HBOA 1F40A 5HTGA 2A3CA 1SR0A 4DRMA 2PBCA 4IPXA 3OA5A 3FY1A 4ITZA 3AQUA 1Q6IA 4W9PA 4J4OA 3KAFA 1NMWA 4IQCA 2QRVA 4E5RA 1I5HW 3MQHA 3WL1A 1EHNA 1UR9A 2N87A 2Q5AA 1TR8A 1Q6HA 2RUCA 4AY1A 3CHFA 3JXVA 1LL6A 2PI6A 4DWSC 1RD6A 4ODRA 2KXQA 4WK9A 1ITXA 3AS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DG4 A;  3O5R A;  2PPP A;  1F8A B;  1ROU A;  1TCO C;  2M8I A;  3GPK A;  2M2A A;  2MNT A;  5HW7 A;  1C9H A;  1FKG A;  4W9Q A;  3UI6 A;  1O6W A;  1PIN A;  2DK1 A;  2RQS A;  4FN2 A;  4JFL A;  2XPA A;  4REX A;  1M5Y A;  3NRK A;  4ODM A;  4DH0 A;  1A7X A;  3TDB A;  1JMQ A;  1PBK A;  3O5I A;  2JXW A;  2JZV A;  3MDY B;  1FD9 A;  3CGN A;  4QT3 A;  2DMV A;  2MDI A;  1K9Q A;  4N19 A;  4ODQ A;  3FAP A;  3CGM A;  4DRN A;  2DWV A;  2PPN A;  4DRJ A;  4DRP A;  3I6C A;  1Q1C A;  4JYS A;  5D75 A;  2XP3 A;  3KAD A;  1J4R A;  2ZR6 A;  1Q6U A;  2OFN A;  4TX0 A;  3M7N A;  4LAX A;  4TW7 A;  4TW8 A;  1JNT A;  2VN1 A;  2LPV A;  2XP9 A;  3B7X A;  2DG3 A;  2MF9 A;  2ZAJ A;  1NMV A;  1ZCN A;  5HT1 A;  4DZ2 A;  2ZQU A;  1N1A A;  3CNG A;  1P5Q A;  3EY6 A;  5HKG A;  4U84 A;  4TYO A;  1J4I A;  4G50 A;  3KAB A;  1R9H A;  1QPL A;  4ODN A;  3UF8 A;  3KAC A;  2KGJ A;  3O5M A;  2XP5 A;  3KAH A;  1NSG A;  3O5P A;  2YSI A;  4G2P A;  3UQB A;  1HXV A;  5HW8 A;  2LKN A;  1BKF A;  4LAY A;  1FKL A;  3NTP A;  4ODP A;  1FKK A;  1FKT A;  1B6C A;  5HW6 A;  5AHT A;  1U79 A;  4TW6 A;  1FAP A;  1FKB A;  2F4E A;  1J4H A;  2JX8 A;  2F21 A;  5B8I C;  2LAJ A;  2D9F A;  3O5O A;  2IF4 A;  5DIT A;  2MLY A;  5DIU A;  3TCZ A;  2K8I A;  2MLX A;  1EG4 A;  3NI6 A;  3UI4 A;  3KAI A;  3WH0 A;  4LAW A;  3H9R B;  3IKG A;  2KE0 A;  4JFK A;  3TC5 A;  2YSB A;  1FKS A;  2KO7 A;  2LJ4 A;  2RSE A;  4JFM A;  1W26 A;  2XP6 A;  3JYJ A;  4JFI A;  4ODL A;  3KZ7 A;  2PPO A;  4DRI A;  1T11 A;  4U85 A;  3M85 A;  3UQI A;  1JNS A;  3KCE A;  4QIB A;  4U86 A;  2JV4 A;  1FKF A;  3IHZ A;  1FJD A;  1FKI A;  1KT0 A;  4GIV A;  2KR7 A;  1D7J A;  1D6O A;  2DG9 A;  2AWG A;  4ODK A;  1JVW A;  2DK7 A;  3O5D A;  1EG3 A;  4MGV A;  1FKH A;  1KT1 A;  4DRK A;  3RGC A;  4TNS A;  5I98 A;  5J6E A;  4MSP A;  2F2D A;  2EZ5 W;  2RE3 A;  5CQ2 A;  2M08 A;  3LUO A;  1D7H A;  4DRQ A;  2DJY A;  4DT4 A;  1FKR A;  2ZQV A;  4BF8 A;  1ZK6 A;  2FAP A;  4QT2 A;  2JMF A;  2ZQT A;  2KFW A;  5GPG A;  2L4J A;  1F40 A;  1ROT A;  3RFW A;  2MLZ A;  5HTG A;  3PA7 A;  4GGQ A;  4DRM A;  2PBC A;  2PV3 A;  3IK8 A;  3L4H A;  2UZ5 A;  3O5E A;  3ODK A;  2RUD A;  4IPX A;  4JFJ A;  4LAV A;  5BXJ A;  2YSH A;  3O5L A;  4DRO A;  2ITK A;  4ITZ A;  4DZ3 A;  1YW5 A;  2M3O W;  1EYM A;  2YSG A;  1FKD A;  3IKD A;  5DIV A;  3UI5 A;  1Q6I A;  5HWC A;  3KAG A;  2PV2 A;  2KI3 A;  1D7I A;  5HWB A;  4W9P A;  4J4O A;  2Y78 A;  4C02 B;  3O5Q A;  3KAF A;  2L2S A;  2M8J A;  2MPH A;  2XPB A;  2ZQS A;  2VCD A;  1NMW A;  3O5K A;  3LE4 A;  2LGO A;  3VAW A;  1TK7 A;  4J4N A;  3JYM A;  4IQC A;  1EQ3 A;  2ZR4 A;  3O5G A;  3O5F A;  2XP8 A;  4IQ2 A;  1WR7 A;  1L1P A;  2BA1 A;  2RUR A;  2ZR5 A;  4E5R A;  1I5H W;  2XP4 A;  2FKE A;  4DIP A;  4FAP A;  2RUQ A;  2PV1 A;  4O2T A;  2N87 A;  2Q5A A;  1K9R A;  1QPF A;  1Q6H A;  1QZ2 A;  1FKJ A;  2RUC A;  2M1I A;  4ODO A;  3JXV A;  4R0X A;  4NNR A;  3O5J A;  3UQA A;  1BL4 A;  1Y0O A;  2E45 A;  5HUA A;  4ODR A;  2KXQ A;  3OOB A;  1YAT A;  4W9O A;  2XP7 A;  3PRD A;  4DRH A;  1J6Y A;  2YSF A;  3PRB A;  1WMV A; 
#chains in the Genus database with same CATH topology
 3AS0 A;  1F8A B;  5DO2 A;  3B9E A;  4HAR A;  1FKG A;  2DK1 A;  4URI A;  1W1T A;  4FN2 A;  4REX A;  1LJY A;  2Y8N B;  3FSB A;  2JXW A;  3CGN A;  1E44 A;  2MDI A;  4ODQ A;  2OLH A;  4Q7N A;  3I6C A;  1Q1C A;  3KAD A;  2ZR6 A;  1LQ0 A;  4TX0 A;  1GOI A;  3B9A A;  2VN1 A;  5HT1 A;  4DZ2 A;  3WD2 A;  5E62 A;  2DT3 A;  4TYO A;  1J4I A;  3UF8 A;  3O5M A;  4DWS A;  2G8Z A;  5HW8 A;  2LKN A;  4LAY A;  2YBU A;  3NTP A;  1D2K A;  1FKK A;  2WAD A;  2ETN A;  1JNE A;  3ARW A;  3CHE A;  2F21 A;  2IF4 A;  5HBF A;  2MLX A;  3KAI A;  3LKX B;  3WH0 A;  3ARO A;  3RM4 A;  3TC5 A;  2YSB A;  1FKS A;  2KO7 A;  3WQW A;  4Z2L A;  4JFI A;  2ESC A;  4ZPV R;  4U85 A;  1ZL1 A;  5E5W A;  3IHZ A;  1FKI A;  1D7J A;  1D6O A;  2AWG A;  1JVW A;  2DSV A;  4TNS A;  4WIW A;  5CQ2 A;  2RE3 A;  2DJY A;  3ARQ A;  1HKM A;  2JMF A;  2ZQT A;  2L4J A;  1XHG A;  3O5E A;  1E6P A;  3UQB A;  3L4H A;  4JFJ A;  3ODK A;  3B8S A;  3O5L A;  1YW5 A;  2M3O W;  5DIV A;  1FKD A;  3IKD A;  4L72 B;  5HWC A;  2PV2 A;  2KI3 A;  2Y78 A;  4C02 B;  4A0U A;  4LGX A;  1ZB5 A;  1TK7 A;  3BXW A;  1NH6 A;  2B31 A;  1GPF A;  4FAP A;  2RUQ A;  1K9R A;  1HJV A;  1HKI A;  2G41 A;  1QZ2 A;  3ALF A;  4W5U A;  4ZPT R;  3O5J A;  1BL4 A;  2E45 A;  4WJX A;  1YAT A;  4R5E A;  3AS3 A;  2XP7 A;  3PRD A;  4DRH A;  2YSF A;  3CH9 A;  4PTM A;  4MNJ A;  4WKH A;  3RME A;  3GPK A;  1W1P A;  2M2A A;  2A3E A;  2MNT A;  5HW7 A;  4NZC A;  3WKZ A;  1O6W A;  2XPA A;  1M5Y A;  3WD0 A;  1E6R A;  3GU0 A;  2JZV A;  3B9D A;  4L3N A;  4Z2J A;  3FAP A;  3CGM A;  2DWV A;  3WD3 A;  1WNO A;  3MCB A;  4IT4 A;  4MAV A;  5D75 A;  2XP3 A;  3M7N A;  1UR8 A;  2MF9 A;  2ZQU A;  1N1A A;  3ARS A;  2DSW A;  4G50 A;  3KAB A;  1WAW A;  4ODN A;  1TFV A;  3MCB B;  4ZS6 A;  1EDQ A;  3WIJ A;  4ODP A;  1FKT A;  1B6C A;  1FAP A;  2F4E A;  3CHD A;  2LAJ A;  5DIT A;  2MLY A;  1EG4 A;  3IKG A;  2DSZ A;  2RSE A;  3WD1 A;  4ZPW R;  1LL4 A;  3ARV A;  4DRI A;  1T11 A;  3ARY A;  3UQI A;  1JNS A;  2F23 A;  2JV4 A;  3GTY X;  1FJD A;  2KR7 A;  3ARZ A;  2DG9 A;  1EG3 A;  1RP5 A;  1HKJ A;  2EZ5 W;  1D7H A;  4MNK A;  4QT2 A;  2KFW A;  2B5U B;  1ROT A;  2MLZ A;  2O92 A;  3IK8 A;  2UZ5 A;  2RUD A;  3G6L A;  4LAV A;  2YSH A;  4DRO A;  2ITK A;  1GRJ A;  4DZ3 A;  1K9T A;  5HWB A;  3ARU A;  4MNM A;  3O5Q A;  2MPH A;  2VCD A;  1HJW A;  1EQ3 A;  1JCH B;  2ZR4 A;  1FFR A;  1VF8 A;  2XP8 A;  4IQ2 A;  4Z2I A;  3PRA A;  1ZU8 A;  2ZR5 A;  3WD4 A;  4O2T A;  3CZ8 A;  1H0G A;  1QPF A;  1FKJ A;  4ODO A;  4KQZ A;  1W1V A;  2IUZ A;  2DT2 A;  3UQA A;  5GPR A;  4W9O A;  4P8U A;  1WMV A;  1NWR A;  2DG4 A;  1ROU A;  1NWU A;  3ALG A;  2DPE A;  1SYT A;  1C9H A;  1WB0 A;  2DSU A;  4W9Q A;  3UI6 A;  1PIN A;  2RQS A;  4JFL A;  1JMQ A;  2OWO A;  1PBK A;  4QT3 A;  1K9Q A;  2PN0 A;  4N19 A;  1W9U A;  4XAK A;  4DRP A;  4DRJ A;  4JYS A;  1J4R A;  1Q6U A;  4DWS B;  4LAX A;  4IT6 A;  5E66 A;  1JNT A;  2LPV A;  4WKA A;  3B7X A;  2ZAJ A;  1NMV A;  4Z2K A;  5HKG A;  3CNG A;  1P5Q A;  4U84 A;  2DT1 A;  2A3B A;  3KAC A;  4UDM A;  2XP5 A;  3KAH A;  3ARP A;  3O5P A;  1ZBK A;  4G2P A;  1HXV A;  3EIP A;  1E6N A;  1FKL A;  1X6L A;  3LKX A;  5HW6 A;  1ZBV A;  5B8I C;  2JX8 A;  3ART A;  4P8W A;  2D9F A;  3O5O A;  3TCZ A;  2K8I A;  1ZBW A;  4Z2G A;  1OGB A;  3CHC A;  4JFK A;  4QZV B;  1L1P A;  4JFM A;  3UI5 A;  4ODL A;  1W26 A;  2XP6 A;  2PPO A;  3MQG A;  3M85 A;  1FKF A;  4P8X A;  1EIB A;  1KT0 A;  3O5D A;  4MGV A;  1IX5 A;  1FKH A;  5J6E A;  5I98 A;  4KR0 B;  4S3K A;  4MSP A;  2F2D A;  4DRQ A;  3LUO A;  1ZBC A;  1FKR A;  2ZQV A;  4BF8 A;  1ZK6 A;  1E15 A;  2FAP A;  5U47 A;  3RFW A;  3PA7 A;  4GGQ A;  4P8V A;  5DEZ A;  3BMB A;  2PV3 A;  4DT4 A;  3W4R A;  3ARX A;  5BXJ A;  3PR9 A;  1EYM A;  2A3A A;  2YSG A;  4MPK A;  3KAG A;  1OWQ A;  1D7I A;  2P4V A;  2L2S A;  2M8J A;  2XPB A;  2ZQS A;  1W1Y A;  3O5K A;  3VAW A;  3LE4 A;  2LGO A;  3WL0 A;  4J4N A;  3JYM A;  3O5G A;  3O5F A;  1NWS A;  1WR7 A;  3FSC A;  2BA1 A;  2RUR A;  2FDM A;  1LG2 A;  2XP4 A;  2FKE A;  4DIP A;  1W9P A;  2PV1 A;  3FXY A;  1HKK A;  4DWS D;  2O9O A;  2M1I A;  4MNL A;  4R0X A;  4NNR A;  1E6Z A;  2AOS A;  1Y0O A;  5E65 A;  3OOB A;  1J6Y A;  2WAE A;  1FLC A;  3PRB A;  1HJX A;  2YAJ B;  3O5R A;  2PPP A;  1KFW A;  1TCO C;  2M8I A;  1E9L A;  3G6M A;  1GUV A;  1OGG A;  1XRV A;  5E64 A;  3RM8 A;  1W9V A;  2QF8 A;  4ODM A;  5HUA A;  3NRK A;  4DH0 A;  1A7X A;  4MTV A;  3TDB A;  3O5I A;  3MDY B;  1FD9 A;  2WLY A;  2DMV A;  4Z2H A;  4A0T A;  4DRN A;  2PPN A;  3AS1 A;  2OFN A;  3QOK A;  4TW8 A;  4TW7 A;  4HBE A;  2XP9 A;  2DG3 A;  1LL7 A;  1ZCN A;  3EY6 A;  1LG1 A;  1CTN A;  1R9H A;  1QPL A;  2KGJ A;  5JH8 A;  1NSG A;  2YSI A;  1BKF A;  2WM0 A;  3FS8 A;  4NSB A;  5AHT A;  1U79 A;  4TW6 A;  4S3J A;  1FKB A;  1J4H A;  3RM9 A;  5GQB A;  5DIU A;  3NI6 A;  5DF0 A;  3UI4 A;  2DT0 A;  4LAW A;  3H9R B;  2KE0 A;  2LJ4 A;  4WKF A;  1NWT A;  3JYJ A;  3KZ7 A;  1H0I A;  2WLZ A;  3KCE A;  4QIB A;  4U86 A;  1O6I A;  1JND A;  3ARR A;  1FFQ A;  4GIV A;  4Q22 A;  4ODK A;  3WQV A;  2DK7 A;  2YBT A;  4DRK A;  4GLX A;  1KT1 A;  1X6N A;  2WK2 A;  3RGC A;  2EUL A;  2M08 A;  3PQH A;  4ML4 A;  5GPG A;  4HBO A;  1F40 A;  5HTG A;  2A3C A;  1SR0 A;  4DRM A;  2PBC A;  4IPX A;  3OA5 A;  3FY1 A;  4ITZ A;  3AQU A;  1Q6I A;  4W9P A;  4J4O A;  3KAF A;  1NMW A;  4IQC A;  2QRV A;  4E5R A;  1I5H W;  3MQH A;  3WL1 A;  1EHN A;  1UR9 A;  2N87 A;  2Q5A A;  1TR8 A;  1Q6H A;  2RUC A;  4AY1 A;  3CHF A;  3JXV A;  1LL6 A;  2PI6 A;  4DWS C;  1RD6 A;  4ODR A;  2KXQ A;  4WK9 A;  1ITX A;  3AS2 A; 
#chains in the Genus database with same CATH homology
 3AS0 A;  1F8A B;  5DO2 A;  3B9E A;  4HAR A;  1FKG A;  2DK1 A;  4URI A;  1W1T A;  4FN2 A;  4REX A;  1LJY A;  2Y8N B;  3FSB A;  2JXW A;  3CGN A;  2MDI A;  4ODQ A;  2OLH A;  4Q7N A;  3I6C A;  1Q1C A;  3KAD A;  2ZR6 A;  1LQ0 A;  4TX0 A;  1GOI A;  3B9A A;  2VN1 A;  5HT1 A;  4DZ2 A;  3WD2 A;  5E62 A;  2DT3 A;  4TYO A;  1J4I A;  3UF8 A;  3O5M A;  4DWS A;  2G8Z A;  5HW8 A;  2LKN A;  4LAY A;  2YBU A;  3NTP A;  1D2K A;  1FKK A;  2WAD A;  1JNE A;  3ARW A;  3CHE A;  2F21 A;  2IF4 A;  5HBF A;  2MLX A;  3KAI A;  3LKX B;  3WH0 A;  3ARO A;  3RM4 A;  3TC5 A;  2YSB A;  1FKS A;  2KO7 A;  3WQW A;  4Z2L A;  4JFI A;  2ESC A;  4ZPV R;  4U85 A;  1ZL1 A;  5E5W A;  3IHZ A;  1FKI A;  1D7J A;  1D6O A;  2AWG A;  1JVW A;  2DSV A;  4TNS A;  4WIW A;  5CQ2 A;  2RE3 A;  2DJY A;  3ARQ A;  1HKM A;  2JMF A;  2ZQT A;  2L4J A;  1XHG A;  3O5E A;  1E6P A;  3UQB A;  3L4H A;  4JFJ A;  3ODK A;  3B8S A;  3O5L A;  1YW5 A;  2M3O W;  5DIV A;  1FKD A;  3IKD A;  4L72 B;  5HWC A;  2PV2 A;  2KI3 A;  2Y78 A;  4C02 B;  4A0U A;  4LGX A;  1ZB5 A;  1TK7 A;  3BXW A;  1NH6 A;  2B31 A;  1GPF A;  4FAP A;  2RUQ A;  1K9R A;  1HJV A;  1HKI A;  2G41 A;  1QZ2 A;  3ALF A;  4W5U A;  4ZPT R;  3O5J A;  1BL4 A;  2E45 A;  4WJX A;  1YAT A;  4R5E A;  3AS3 A;  2XP7 A;  3PRD A;  4DRH A;  2YSF A;  3CH9 A;  4PTM A;  4MNJ A;  4WKH A;  3RME A;  3GPK A;  1W1P A;  2M2A A;  2A3E A;  2MNT A;  5HW7 A;  4NZC A;  3WKZ A;  1O6W A;  2XPA A;  1M5Y A;  3WD0 A;  1E6R A;  2JZV A;  3B9D A;  4L3N A;  4Z2J A;  3FAP A;  3CGM A;  2DWV A;  3WD3 A;  1WNO A;  3MCB A;  4IT4 A;  4MAV A;  5D75 A;  2XP3 A;  3M7N A;  1UR8 A;  2MF9 A;  2ZQU A;  1N1A A;  3ARS A;  2DSW A;  4G50 A;  3KAB A;  1WAW A;  4ODN A;  1TFV A;  3MCB B;  4ZS6 A;  1EDQ A;  3WIJ A;  4ODP A;  1FKT A;  1B6C A;  1FAP A;  2F4E A;  3CHD A;  2LAJ A;  5DIT A;  2MLY A;  1EG4 A;  3IKG A;  2DSZ A;  2RSE A;  3WD1 A;  4ZPW R;  1LL4 A;  3ARV A;  4DRI A;  1T11 A;  3ARY A;  3UQI A;  1JNS A;  2JV4 A;  1FJD A;  2KR7 A;  3ARZ A;  2DG9 A;  1EG3 A;  1RP5 A;  1HKJ A;  2EZ5 W;  1D7H A;  4MNK A;  4QT2 A;  2KFW A;  1ROT A;  2MLZ A;  2O92 A;  3IK8 A;  2UZ5 A;  2RUD A;  3G6L A;  4LAV A;  2YSH A;  4DRO A;  2ITK A;  4DZ3 A;  1K9T A;  5HWB A;  3ARU A;  4MNM A;  3O5Q A;  2MPH A;  2VCD A;  1HJW A;  1EQ3 A;  2ZR4 A;  1FFR A;  1VF8 A;  2XP8 A;  4IQ2 A;  4Z2I A;  3PRA A;  1ZU8 A;  2ZR5 A;  3WD4 A;  4O2T A;  3CZ8 A;  1H0G A;  1QPF A;  1FKJ A;  4ODO A;  4KQZ A;  1W1V A;  2IUZ A;  2DT2 A;  3UQA A;  5GPR A;  4W9O A;  4P8U A;  1WMV A;  1NWR A;  2DG4 A;  1ROU A;  1NWU A;  3ALG A;  2DPE A;  1SYT A;  1C9H A;  1WB0 A;  2DSU A;  4W9Q A;  3UI6 A;  1PIN A;  2RQS A;  4JFL A;  1JMQ A;  2OWO A;  1PBK A;  4QT3 A;  1K9Q A;  4N19 A;  1W9U A;  4XAK A;  4DRP A;  4DRJ A;  4JYS A;  1J4R A;  1Q6U A;  4DWS B;  4LAX A;  4IT6 A;  5E66 A;  1JNT A;  2LPV A;  4WKA A;  3B7X A;  2ZAJ A;  1NMV A;  4Z2K A;  5HKG A;  3CNG A;  1P5Q A;  4U84 A;  2DT1 A;  2A3B A;  3KAC A;  2XP5 A;  3KAH A;  3ARP A;  3O5P A;  1ZBK A;  4G2P A;  1HXV A;  1E6N A;  1FKL A;  1X6L A;  3LKX A;  5HW6 A;  1ZBV A;  5B8I C;  2JX8 A;  3ART A;  4P8W A;  2D9F A;  3O5O A;  3TCZ A;  2K8I A;  1ZBW A;  4Z2G A;  1OGB A;  3CHC A;  4JFK A;  4QZV B;  1L1P A;  4JFM A;  3UI5 A;  4ODL A;  1W26 A;  2XP6 A;  2PPO A;  3MQG A;  3M85 A;  1FKF A;  4P8X A;  1EIB A;  1KT0 A;  3O5D A;  4MGV A;  1IX5 A;  1FKH A;  5J6E A;  5I98 A;  4KR0 B;  4S3K A;  4MSP A;  2F2D A;  4DRQ A;  3LUO A;  1ZBC A;  1FKR A;  2ZQV A;  4BF8 A;  1ZK6 A;  1E15 A;  2FAP A;  5U47 A;  3RFW A;  3PA7 A;  4GGQ A;  4P8V A;  5DEZ A;  2PV3 A;  4DT4 A;  3W4R A;  3ARX A;  5BXJ A;  3PR9 A;  1EYM A;  2A3A A;  2YSG A;  4MPK A;  3KAG A;  1OWQ A;  1D7I A;  2L2S A;  2M8J A;  2XPB A;  2ZQS A;  1W1Y A;  3O5K A;  3VAW A;  3LE4 A;  2LGO A;  3WL0 A;  4J4N A;  3JYM A;  3O5G A;  3O5F A;  1NWS A;  1WR7 A;  3FSC A;  2BA1 A;  2RUR A;  2FDM A;  1LG2 A;  2XP4 A;  2FKE A;  4DIP A;  1W9P A;  2PV1 A;  3FXY A;  1HKK A;  4DWS D;  2O9O A;  2M1I A;  4MNL A;  4R0X A;  4NNR A;  1E6Z A;  2AOS A;  1Y0O A;  5E65 A;  3OOB A;  1J6Y A;  2WAE A;  1FLC A;  3PRB A;  1HJX A;  2YAJ B;  3O5R A;  2PPP A;  1KFW A;  1TCO C;  2M8I A;  1E9L A;  3G6M A;  1GUV A;  1OGG A;  1XRV A;  5E64 A;  3RM8 A;  1W9V A;  2QF8 A;  4ODM A;  5HUA A;  3NRK A;  4DH0 A;  1A7X A;  4MTV A;  3TDB A;  3O5I A;  3MDY B;  1FD9 A;  2WLY A;  2DMV A;  4Z2H A;  4A0T A;  4DRN A;  2PPN A;  3AS1 A;  2OFN A;  3QOK A;  4TW8 A;  4TW7 A;  4HBE A;  2XP9 A;  2DG3 A;  1LL7 A;  1ZCN A;  3EY6 A;  1LG1 A;  1CTN A;  1R9H A;  1QPL A;  2KGJ A;  5JH8 A;  1NSG A;  2YSI A;  1BKF A;  2WM0 A;  3FS8 A;  4NSB A;  5AHT A;  1U79 A;  4TW6 A;  4S3J A;  1FKB A;  1J4H A;  3RM9 A;  5GQB A;  5DIU A;  3NI6 A;  5DF0 A;  3UI4 A;  2DT0 A;  4LAW A;  3H9R B;  2KE0 A;  2LJ4 A;  4WKF A;  1NWT A;  3JYJ A;  3KZ7 A;  1H0I A;  2WLZ A;  3KCE A;  4QIB A;  4U86 A;  1O6I A;  3ARR A;  1JND A;  1FFQ A;  4GIV A;  4Q22 A;  4ODK A;  3WQV A;  2DK7 A;  2YBT A;  4DRK A;  4GLX A;  1KT1 A;  1X6N A;  2WK2 A;  3RGC A;  2M08 A;  3PQH A;  4ML4 A;  5GPG A;  4HBO A;  1F40 A;  5HTG A;  2A3C A;  1SR0 A;  4DRM A;  2PBC A;  4IPX A;  3OA5 A;  3FY1 A;  4ITZ A;  3AQU A;  1Q6I A;  4W9P A;  4J4O A;  3KAF A;  1NMW A;  4IQC A;  2QRV A;  4E5R A;  1I5H W;  3MQH A;  3WL1 A;  1EHN A;  1UR9 A;  2N87 A;  2Q5A A;  1TR8 A;  1Q6H A;  2RUC A;  4AY1 A;  3CHF A;  3JXV A;  1LL6 A;  2PI6 A;  4DWS C;  1RD6 A;  4ODR A;  2KXQ A;  4WK9 A;  1ITX A;  3AS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...