3TDBA

Human pin1 bound to trans peptidomimetic inhibitor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
158
structure length
146
Chain Sequence
KLPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
publication title Structural and Kinetic Analysis of Prolyl-isomerization/Phosphorylation Cross-Talk in the CTD Code.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/inhibitor
total genus 47
structure length 146
sequence length 158
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2011-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 3tdbA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3tdbA02
2XP4A 2PPPA 1L1PA 1M5YA 3NI6A 1C9HA 1KT0A 3O5DA 1NMVA 1QZ2A 2AWGA 2KFWA 1HXVA 1F40A 1FKHA 3MDYB 4DT4A 4REXA 2DK7A 2ZQVA 2RURA 4ODKA 2KGJA 3UI6A 5HKGA 3RFWA 5CQ2A 1D7IA 2JXWA 5AHTA 2ZAJA 1FKIA 3O5MA 4DRMA 2ZQUA 3OOBA 2PV2A 3O5FA 1EYMA 4QIBA 2DG3A 1FKTA 5HW8A 1BL4A 4JFJA 2OFNA 5HTGA 2F2DA 1P5QA 1J4HA 5I98A 5J6EA 4DZ2A 1Q1CA 1PINA 3L4HA 4JFKA 3O5GA 2Q5AA 4TNSA 3TDBA 1YW5A 2BA1A 1FD9A 1FKGA 1FKFA 1FKLA 5HW6A 2RUCA 3O5IA 2ZR4A 5HWCA 1BKFA 4JFIA 2XP5A 1Q6UA 2MDIA 4MGVA 4GIVA 1FKJA 1D7JA 2D9FA 2XP7A 4DRIA 3TCZA 3O5LA 1J4RA 1R9HA 4JYSA 2YSGA 1TCOC 3TC5A 2M8JA 1EG3A 2F4EA 4BF8A 2KO7A 2EZ5W 1QPLA 2VCDA 3O5JA 3O5OA 2K8IA 1F8AB 2YSHA 1WR7A 2VN1A 1O6WA 3CGNA 3NRKA 2JX8A 1TK7A 3IHZA 2LPVA 1FKSA 1FKDA 4E5RA 4IQCA 2YSIA 4C02B 3O5PA 2DK1A 3CGMA 1FKKA 1T11A 1N1AA 4DRHA 4JFLA 2MLYA 2M8IA 3JYMA 2DWVA 3O5QA 4TX0A 3M7NA 5DITA 4FN2A 2JZVA 2LJ4A 1K9RA 2KI3A 4GGQA 3KADA 3UQBA 4J4NA 4TW8A 2L4JA 4W9PA 4W9QA 5B8IC 3EY6A 3UF8A 1K9QA 3ODKA 1ROTA 2F21A 4DH0A 1ROUA 2PV3A 2XP9A 4G2PA 3KABA 4FAPA 3IKDA 2XPAA 4IPXA 2ZR5A 4QT2A 2XP8A 4O2TA 2KR7A 2ZQTA 2PV1A 5HWBA 2Y78A 3KAGA 3PRBA 2XP3A 5DIUA 1EQ3A 4QT3A 3JXVA 2MLXA 3KCEA 3O5KA 1JNSA 4U84A 4ODRA 4DRPA 4DROA 3VAWA 2RSEA 3FAPA 4U86A 1KT1A 3UI5A 3M85A 3GPKA 1PBKA 2DMVA 2FKEA 2PBCA 4U85A 1ZK6A 2ZR6A 3B7XA 3LE4A 2M3OW 3O5EA 4J4OA 2LKNA 3WH0A 2YSBA 1B6CA 2DG4A 4LAXA 1JMQA 3H9RB 1ZCNA 4ODPA 5HUAA 2DG9A 4ODQA 2KE0A 2MF9A 4JFMA 2RQSA 1Y0OA 2XP6A 4DZ3A 2LGOA 2ZQSA 1YATA 4LAVA 1NMWA 2M08A 3LUOA 1A7XA 1I5HW 2RE3A 1J6YA 2XPBA 5BXJA 2M2AA 2FAPA 4LAYA 5HT1A 3NTPA 3UQAA 3JYJA 1NSGA 3CNGA 3KACA 3PRDA 5HW7A 4ITZA 4G50A 3UI4A 1D7HA 4W9OA 4ODMA 1J4IA 2PPNA 2YSFA 4TW7A 2JV4A 3I6CA 3IKGA 4DIPA 2E45A 3KAFA 2LAJA 1WMVA 2L2SA 2RUQA 1Q6IA 4TYOA 3PA7A 2N87A 1QPFA 2UZ5A 2IF4A 4MSPA 1JVWA 1Q6HA 3KAIA 1FKBA 3UQIA 3RGCA 3KAHA 1W26A 1FJDA 2JMFA 4DRQA 3O5RA 2ITKA 4DRJA 1FAPA 2MNTA 2DJYA 2RUDA 4ODLA 4ODNA 5DIVA 5D75A 4ODOA 1D6OA 2M1IA 4TW6A 4LAWA 2MLZA 4N19A 4R0XA 4NNRA 5GPGA 3IK8A 2PPOA 1EG4A 4DRKA 2KXQA 1FKRA 1U79A 4DRNA 2MPHA 4IQ2A 3KZ7A 1JNTA
chains in the Genus database with same CATH superfamily
2XP4A 1E6RA 4Q7NA 4WK9A 2PPPA 1L1PA 3ARPA 1M5YA 3NI6A 3CHEA 1C9HA 1KT0A 1E6NA 3O5DA 1NMVA 1W9UA 1QZ2A 2AWGA 2KFWA 3GTYX 1HXVA 2DSZA 2B5UB 1F40A 1FKHA 4WIWA 3MDYB 4DT4A 3WIJA 4REXA 2DK7A 2ZQVA 2RURA 4ZS6A 4ODKA 2KGJA 3UI6A 4DWSA 5HKGA 3RFWA 5CQ2A 3B9EA 1D7IA 2JXWA 5AHTA 2ZAJA 1ZL1A 1EHNA 1FKIA 3O5MA 4DRMA 2ZQUA 3OOBA 2PV2A 2O9OA 1UR8A 3O5FA 4KR0B 1EYMA 4QIBA 2DG3A 1FKTA 2G41A 4MPKA 5HW8A 1BL4A 4ZPVR 4JFJA 2A3CA 2OFNA 4S3KA 4P8WA 5HTGA 2WLZA 2A3BA 2F2DA 1P5QA 2A3AA 3FXYA 3WD3A 1J4HA 5I98A 3CHCA 1W1PA 4AY1A 5J6EA 3CHFA 4DZ2A 3PR9A 1Q1CA 4URIA 1TR8A 1PINA 1ZU8A 3L4HA 1D2KA 4JFKA 3O5GA 2Q5AA 4TNSA 3TDBA 1LQ0A 1ZB5A 1YW5A 3BMBA 2BA1A 1JCHB 1FD9A 1FKGA 1FKFA 1FKLA 1HJWA 5HW6A 2RUCA 3O5IA 2ZR4A 5HWCA 1BKFA 4L72B 4JFIA 2XP5A 4DWSC 1Q6UA 1ZBVA 2MDIA 1H0GA 1KFWA 4MGVA 4GIVA 1FKJA 5JH8A 1D7JA 2D9FA 4XAKA 2XP7A 5DF0A 4DRIA 3TCZA 3O5LA 1HJXA 1J4RA 1R9HA 3CH9A 4JYSA 2YSGA 1TCOC 1O6IA 3TC5A 1CTNA 2M8JA 2ESCA 1LG2A 1EG3A 5E66A 4A0UA 2F4EA 4QZVB 4BF8A 2KO7A 3MCBB 3ARWA 2EZ5W 4WKHA 1QPLA 3RMEA 3WD0A 1W1VA 2VCDA 1SR0A 3O5JA 3O5OA 2K8IA 1LJYA 1F8AB 3ARYA 2YSHA 4PTMA 1WR7A 2VN1A 4WKAA 2DT2A 1LG1A 3MCBA 1JNEA 1LL7A 2WADA 3QOKA 4UDMA 1O6WA 1E6PA 2DSWA 5DO2A 1ZBWA 3FSBA 3CGNA 3NRKA 2JX8A 4IT4A 1RP5A 1TK7A 4DWSB 3IHZA 4MTVA 4Z2IA 2LPVA 1FKSA 3AS0A 3LKXA 1H0IA 3G6LA 1FKDA 4E5RA 1FFRA 4IQCA 2YSIA 1W1TA 2Y8NB 4HBEA 4C02B 3RM8A 3O5PA 4P8VA 2DK1A 4ZPWR 1UR9A 3CGMA 1FKKA 3ARQA 1T11A 1X6NA 1W1YA 1N1AA 4DRHA 4JFLA 2MLYA 2WM0A 2PI6A 2M8IA 3JYMA 3OA5A 2DWVA 5U47A 3B8SA 3O5QA 4TX0A 3M7NA 5DITA 4FN2A 2JZVA 2LJ4A 1K9RA 2KI3A 2EULA 4GGQA 3KADA 3UQBA 4J4NA 4KQZA 4TW8A 3WD4A 2L4JA 4W9PA 4W9QA 3RM9A 3WKZA 5B8IC 3EY6A 3UF8A 1K9QA 3ODKA 2QF8A 1E6ZA 1ROTA 2F21A 4DH0A 1ROUA 2PV3A 3CZ8A 2XP9A 4G2PA 3KABA 4FAPA 3B9AA 3IKDA 2XPAA 1FLCA 1NWTA 2FDMA 4IPXA 2ZR5A 4QT2A 1WB0A 2XP8A 4O2TA 2QRVA 2KR7A 4WKFA 2ZQTA 2PV1A 4S3JA 5HWBA 2Y78A 3KAGA 1ITXA 2IUZA 3PRBA 2XP3A 4Z2HA 2YAJB 5DIUA 4GLXA 1EQ3A 4QT3A 3JXVA 2MLXA 3KCEA 3O5KA 1JNSA 4U84A 4Z2JA 3WL1A 2WAEA 2OLHA 1HKKA 4WJXA 4ODRA 4DRPA 4DROA 4MAVA 3VAWA 3WQVA 3ARUA 4Z2LA 2RSEA 3FAPA 4U86A 1GPFA 1KT1A 4L3NA 3UI5A 3M85A 1XHGA 2AOSA 3GPKA 5E65A 1PBKA 2DMVA 2ETNA 4P8UA 2FKEA 3MQHA 2PBCA 4U85A 1ZK6A 2ZR6A 3WD2A 3LKXB 2YBUA 3B7XA 3BXWA 1FFQA 1HKIA 3LE4A 2DSUA 2O92A 1GOIA 2M3OW 5DEZA 3O5EA 3PQHA 4J4OA 4NZCA 2LKNA 3ALGA 2P4VA 3WH0A 2YSBA 3FY1A 1B6CA 2DG4A 1OGBA 4LAXA 1JMQA 3WD1A 3H9RB 1ZCNA 3ARZA 4ODPA 3EIPA 5GPRA 5HUAA 2B31A 2DG9A 1ZBCA 4ODQA 2F23A 1E9LA 2KE0A 2MF9A 4JFMA 1VF8A 3B9DA 1OWQA 2DT0A 4LGXA 2RQSA 1Y0OA 1LL4A 4NSBA 2XP6A 3CHDA 1K9TA 4DZ3A 2LGOA 2ZQSA 1YATA 4MNKA 4LAVA 1NMWA 2DSVA 2M08A 3LUOA 1A7XA 1I5HW 4MNLA 4P8XA 2RE3A 5E5WA 3ARXA 1J6YA 2XPBA 1HKMA 5BXJA 1NWSA 2A3EA 3WL0A 2M2AA 2DT3A 2FAPA 4LAYA 2PN0A 4Z2GA 5HT1A 4MNJA 3NTPA 3UQAA 5E62A 3ARSA 3JYJA 1NSGA 4Q22A 1GRJA 3CNGA 3KACA 1W9VA 3PRDA 5HW7A 4ITZA 4G50A 3UI4A 1D7HA 4W9OA 4ODMA 1J4IA 2DT1A 2PPNA 3AS1A 2YSFA 1NWRA 1X6LA 4MNMA 1EIBA 4TW7A 2WLYA 3MQGA 2JV4A 3I6CA 3IKGA 1EDQA 2DPEA 3AROA 4DIPA 2E45A 3KAFA 1HJVA 2LAJA 1WMVA 2L2SA 2RUQA 1Q6IA 4TYOA 3PA7A 4DWSD 4HBOA 3W4RA 2N87A 2G8ZA 4HARA 1QPFA 2UZ5A 2IF4A 4MSPA 1WNOA 5E64A 3ARRA 2OWOA 1JVWA 3ARTA 1Q6HA 1E15A 3KAIA 1FKBA 3GU0A 4Z2KA 3UQIA 3RGCA 3KAHA 1W9PA 1W26A 1FJDA 2JMFA 1RD6A 4DRQA 3AS2A 3O5RA 2ITKA 4DRJA 1FAPA 2MNTA 1HKJA 2DJYA 1OGGA 1XRVA 5GQBA 3G6MA 1GUVA 2RUDA 4ML4A 3ARVA 5HBFA 4ODLA 4ODNA 5DIVA 3PRAA 1IX5A 5D75A 4ODOA 4W5UA 1D6OA 4R5EA 2M1IA 4TW6A 1NWUA 2MLZA 4LAWA 4N19A 4R0XA 1NH6A 3RM4A 3FSCA 4NNRA 3WQWA 5GPGA 3IK8A 2PPOA 4A0TA 1EG4A 4DRKA 1LL6A 4IT6A 2KXQA 1FKRA 1ZBKA 4ZPTR 1U79A 4DRNA 1WAWA 2WK2A 3FS8A 2MPHA 3AQUA 4IQ2A 1SYTA 1JNDA 1E44A 3KZ7A 3ALFA 1JNTA 2YBTA 1TFVA 3AS3A
chains in the Genus database with same CATH topology
2XP4A 1E6RA 4Q7NA 4WK9A 2PPPA 1L1PA 3ARPA 1M5YA 3NI6A 3CHEA 1C9HA 1KT0A 1E6NA 3O5DA 1NMVA 1W9UA 1QZ2A 2AWGA 2KFWA 1HXVA 2DSZA 1F40A 1FKHA 4WIWA 3MDYB 4DT4A 3WIJA 4REXA 2DK7A 2ZQVA 2RURA 4ZS6A 4ODKA 2KGJA 3UI6A 4DWSA 5HKGA 3RFWA 5CQ2A 3B9EA 1D7IA 2JXWA 5AHTA 2ZAJA 1ZL1A 1EHNA 1FKIA 3O5MA 4DRMA 2ZQUA 3OOBA 2PV2A 2O9OA 1UR8A 3O5FA 4KR0B 1EYMA 4QIBA 2DG3A 1FKTA 2G41A 4MPKA 5HW8A 1BL4A 4ZPVR 4JFJA 2A3CA 2OFNA 4S3KA 4P8WA 5HTGA 2WLZA 2A3BA 2F2DA 1P5QA 2A3AA 3FXYA 3WD3A 1J4HA 5I98A 3CHCA 1W1PA 4AY1A 5J6EA 3CHFA 4DZ2A 3PR9A 1Q1CA 4URIA 1TR8A 1PINA 1ZU8A 3L4HA 1D2KA 4JFKA 3O5GA 2Q5AA 4TNSA 3TDBA 1LQ0A 1ZB5A 1YW5A 2BA1A 1FD9A 1FKGA 1FKFA 1FKLA 1HJWA 5HW6A 2RUCA 3O5IA 2ZR4A 5HWCA 1BKFA 4L72B 4JFIA 2XP5A 4DWSC 1Q6UA 1ZBVA 2MDIA 1H0GA 1KFWA 4MGVA 4GIVA 1FKJA 5JH8A 1D7JA 2D9FA 4XAKA 2XP7A 5DF0A 4DRIA 3TCZA 3O5LA 1HJXA 1J4RA 1R9HA 3CH9A 4JYSA 2YSGA 1TCOC 1O6IA 3TC5A 1CTNA 2M8JA 2ESCA 1LG2A 1EG3A 5E66A 4A0UA 2F4EA 4QZVB 4BF8A 2KO7A 3MCBB 3ARWA 2EZ5W 4WKHA 1QPLA 3RMEA 3WD0A 1W1VA 2VCDA 1SR0A 3O5JA 3O5OA 2K8IA 1LJYA 1F8AB 3ARYA 2YSHA 4PTMA 1WR7A 2VN1A 4WKAA 2DT2A 1LG1A 3MCBA 1JNEA 1LL7A 2WADA 3QOKA 1O6WA 1E6PA 2DSWA 5DO2A 1ZBWA 3FSBA 3CGNA 3NRKA 2JX8A 4IT4A 1RP5A 1TK7A 4DWSB 3IHZA 4MTVA 4Z2IA 2LPVA 1FKSA 3AS0A 3LKXA 1H0IA 3G6LA 1FKDA 4E5RA 1FFRA 4IQCA 2YSIA 1W1TA 2Y8NB 4HBEA 4C02B 3RM8A 3O5PA 4P8VA 2DK1A 4ZPWR 1UR9A 3CGMA 1FKKA 3ARQA 1T11A 1X6NA 1W1YA 1N1AA 4DRHA 4JFLA 2MLYA 2WM0A 2PI6A 2M8IA 3JYMA 3OA5A 2DWVA 5U47A 3B8SA 3O5QA 4TX0A 3M7NA 5DITA 4FN2A 2JZVA 2LJ4A 1K9RA 2KI3A 4GGQA 3KADA 3UQBA 4J4NA 4KQZA 4TW8A 3WD4A 2L4JA 4W9PA 4W9QA 3RM9A 3WKZA 5B8IC 3EY6A 3UF8A 1K9QA 3ODKA 2QF8A 1E6ZA 1ROTA 2F21A 4DH0A 1ROUA 2PV3A 3CZ8A 2XP9A 4G2PA 3KABA 4FAPA 3B9AA 3IKDA 2XPAA 1FLCA 1NWTA 2FDMA 4IPXA 2ZR5A 4QT2A 1WB0A 2XP8A 4O2TA 2QRVA 2KR7A 4WKFA 2ZQTA 2PV1A 4S3JA 5HWBA 2Y78A 3KAGA 1ITXA 2IUZA 3PRBA 2XP3A 4Z2HA 2YAJB 5DIUA 4GLXA 1EQ3A 4QT3A 3JXVA 2MLXA 3KCEA 3O5KA 1JNSA 4U84A 4Z2JA 3WL1A 2WAEA 2OLHA 1HKKA 4WJXA 4ODRA 4DRPA 4DROA 4MAVA 3VAWA 3WQVA 3ARUA 4Z2LA 2RSEA 3FAPA 4U86A 1GPFA 1KT1A 4L3NA 3UI5A 3M85A 1XHGA 2AOSA 3GPKA 5E65A 1PBKA 2DMVA 4P8UA 2FKEA 3MQHA 2PBCA 4U85A 1ZK6A 2ZR6A 3WD2A 3LKXB 2YBUA 3B7XA 3BXWA 1FFQA 1HKIA 3LE4A 2DSUA 2O92A 1GOIA 2M3OW 5DEZA 3O5EA 3PQHA 4J4OA 4NZCA 2LKNA 3ALGA 3WH0A 2YSBA 3FY1A 1B6CA 2DG4A 1OGBA 4LAXA 1JMQA 3WD1A 3H9RB 1ZCNA 3ARZA 4ODPA 5GPRA 5HUAA 2B31A 2DG9A 1ZBCA 4ODQA 1E9LA 2KE0A 2MF9A 4JFMA 1VF8A 3B9DA 1OWQA 2DT0A 4LGXA 2RQSA 1Y0OA 1LL4A 4NSBA 2XP6A 3CHDA 1K9TA 4DZ3A 2LGOA 2ZQSA 1YATA 4MNKA 4LAVA 1NMWA 2DSVA 2M08A 3LUOA 1A7XA 1I5HW 4MNLA 4P8XA 2RE3A 5E5WA 3ARXA 1J6YA 2XPBA 1HKMA 5BXJA 1NWSA 2A3EA 3WL0A 2M2AA 2DT3A 2FAPA 4LAYA 4Z2GA 5HT1A 4MNJA 3NTPA 3UQAA 5E62A 3ARSA 3JYJA 1NSGA 4Q22A 3CNGA 3KACA 1W9VA 3PRDA 5HW7A 4ITZA 4G50A 3UI4A 1D7HA 4W9OA 4ODMA 1J4IA 2DT1A 2PPNA 3AS1A 2YSFA 1NWRA 1X6LA 4MNMA 1EIBA 4TW7A 2WLYA 3MQGA 2JV4A 3I6CA 3IKGA 1EDQA 2DPEA 3AROA 4DIPA 2E45A 3KAFA 1HJVA 2LAJA 1WMVA 2L2SA 2RUQA 1Q6IA 4TYOA 3PA7A 4DWSD 4HBOA 3W4RA 2N87A 2G8ZA 4HARA 1QPFA 2UZ5A 2IF4A 4MSPA 1WNOA 5E64A 3ARRA 2OWOA 1JVWA 3ARTA 1Q6HA 1E15A 3KAIA 1FKBA 4Z2KA 3UQIA 3RGCA 3KAHA 1W9PA 1W26A 1FJDA 2JMFA 1RD6A 4DRQA 3AS2A 3O5RA 2ITKA 4DRJA 1FAPA 2MNTA 1HKJA 2DJYA 1OGGA 1XRVA 5GQBA 3G6MA 1GUVA 2RUDA 4ML4A 3ARVA 5HBFA 4ODLA 4ODNA 5DIVA 3PRAA 1IX5A 5D75A 4ODOA 4W5UA 1D6OA 4R5EA 2M1IA 4TW6A 1NWUA 2MLZA 4LAWA 4N19A 4R0XA 1NH6A 3RM4A 3FSCA 4NNRA 3WQWA 5GPGA 3IK8A 2PPOA 4A0TA 1EG4A 4DRKA 1LL6A 4IT6A 2KXQA 1FKRA 1ZBKA 4ZPTR 1U79A 4DRNA 1WAWA 2WK2A 3FS8A 2MPHA 3AQUA 4IQ2A 1SYTA 1JNDA 3KZ7A 3ALFA 1JNTA 2YBTA 1TFVA 3AS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP4 A;  2PPP A;  1L1P A;  1M5Y A;  3NI6 A;  1C9H A;  1KT0 A;  3O5D A;  1NMV A;  1QZ2 A;  2AWG A;  2KFW A;  1HXV A;  1F40 A;  1FKH A;  3MDY B;  4DT4 A;  4REX A;  2DK7 A;  2ZQV A;  2RUR A;  4ODK A;  2KGJ A;  3UI6 A;  5HKG A;  3RFW A;  5CQ2 A;  1D7I A;  2JXW A;  5AHT A;  2ZAJ A;  1FKI A;  3O5M A;  4DRM A;  2ZQU A;  3OOB A;  2PV2 A;  3O5F A;  1EYM A;  4QIB A;  2DG3 A;  1FKT A;  5HW8 A;  1BL4 A;  4JFJ A;  2OFN A;  5HTG A;  2F2D A;  1P5Q A;  1J4H A;  5I98 A;  5J6E A;  4DZ2 A;  1Q1C A;  1PIN A;  3L4H A;  4JFK A;  3O5G A;  2Q5A A;  4TNS A;  3TDB A;  1YW5 A;  2BA1 A;  1FD9 A;  1FKG A;  1FKF A;  1FKL A;  5HW6 A;  2RUC A;  3O5I A;  2ZR4 A;  5HWC A;  1BKF A;  4JFI A;  2XP5 A;  1Q6U A;  2MDI A;  4MGV A;  4GIV A;  1FKJ A;  1D7J A;  2D9F A;  2XP7 A;  4DRI A;  3TCZ A;  3O5L A;  1J4R A;  1R9H A;  4JYS A;  2YSG A;  1TCO C;  3TC5 A;  2M8J A;  1EG3 A;  2F4E A;  4BF8 A;  2KO7 A;  2EZ5 W;  1QPL A;  2VCD A;  3O5J A;  3O5O A;  2K8I A;  1F8A B;  2YSH A;  1WR7 A;  2VN1 A;  1O6W A;  3CGN A;  3NRK A;  2JX8 A;  1TK7 A;  3IHZ A;  2LPV A;  1FKS A;  1FKD A;  4E5R A;  4IQC A;  2YSI A;  4C02 B;  3O5P A;  2DK1 A;  3CGM A;  1FKK A;  1T11 A;  1N1A A;  4DRH A;  4JFL A;  2MLY A;  2M8I A;  3JYM A;  2DWV A;  3O5Q A;  4TX0 A;  3M7N A;  5DIT A;  4FN2 A;  2JZV A;  2LJ4 A;  1K9R A;  2KI3 A;  4GGQ A;  3KAD A;  3UQB A;  4J4N A;  4TW8 A;  2L4J A;  4W9P A;  4W9Q A;  5B8I C;  3EY6 A;  3UF8 A;  1K9Q A;  3ODK A;  1ROT A;  2F21 A;  4DH0 A;  1ROU A;  2PV3 A;  2XP9 A;  4G2P A;  3KAB A;  4FAP A;  3IKD A;  2XPA A;  4IPX A;  2ZR5 A;  4QT2 A;  2XP8 A;  4O2T A;  2KR7 A;  2ZQT A;  2PV1 A;  5HWB A;  2Y78 A;  3KAG A;  3PRB A;  2XP3 A;  5DIU A;  1EQ3 A;  4QT3 A;  3JXV A;  2MLX A;  3KCE A;  3O5K A;  1JNS A;  4U84 A;  4ODR A;  4DRP A;  4DRO A;  3VAW A;  2RSE A;  3FAP A;  4U86 A;  1KT1 A;  3UI5 A;  3M85 A;  3GPK A;  1PBK A;  2DMV A;  2FKE A;  2PBC A;  4U85 A;  1ZK6 A;  2ZR6 A;  3B7X A;  3LE4 A;  2M3O W;  3O5E A;  4J4O A;  2LKN A;  3WH0 A;  2YSB A;  1B6C A;  2DG4 A;  4LAX A;  1JMQ A;  3H9R B;  1ZCN A;  4ODP A;  5HUA A;  2DG9 A;  4ODQ A;  2KE0 A;  2MF9 A;  4JFM A;  2RQS A;  1Y0O A;  2XP6 A;  4DZ3 A;  2LGO A;  2ZQS A;  1YAT A;  4LAV A;  1NMW A;  2M08 A;  3LUO A;  1A7X A;  1I5H W;  2RE3 A;  1J6Y A;  2XPB A;  5BXJ A;  2M2A A;  2FAP A;  4LAY A;  5HT1 A;  3NTP A;  3UQA A;  3JYJ A;  1NSG A;  3CNG A;  3KAC A;  3PRD A;  5HW7 A;  4ITZ A;  4G50 A;  3UI4 A;  1D7H A;  4W9O A;  4ODM A;  1J4I A;  2PPN A;  2YSF A;  4TW7 A;  2JV4 A;  3I6C A;  3IKG A;  4DIP A;  2E45 A;  3KAF A;  2LAJ A;  1WMV A;  2L2S A;  2RUQ A;  1Q6I A;  4TYO A;  3PA7 A;  2N87 A;  1QPF A;  2UZ5 A;  2IF4 A;  4MSP A;  1JVW A;  1Q6H A;  3KAI A;  1FKB A;  3UQI A;  3RGC A;  3KAH A;  1W26 A;  1FJD A;  2JMF A;  4DRQ A;  3O5R A;  2ITK A;  4DRJ A;  1FAP A;  2MNT A;  2DJY A;  2RUD A;  4ODL A;  4ODN A;  5DIV A;  5D75 A;  4ODO A;  1D6O A;  2M1I A;  4TW6 A;  4LAW A;  2MLZ A;  4N19 A;  4R0X A;  4NNR A;  5GPG A;  3IK8 A;  2PPO A;  1EG4 A;  4DRK A;  2KXQ A;  1FKR A;  1U79 A;  4DRN A;  2MPH A;  4IQ2 A;  3KZ7 A;  1JNT A; 
#chains in the Genus database with same CATH topology
 2XP4 A;  1E6R A;  4Q7N A;  4WK9 A;  2PPP A;  1L1P A;  3ARP A;  1M5Y A;  3NI6 A;  3CHE A;  1C9H A;  1KT0 A;  1E6N A;  3O5D A;  1NMV A;  1W9U A;  1QZ2 A;  2AWG A;  2KFW A;  3GTY X;  1HXV A;  2DSZ A;  2B5U B;  1F40 A;  1FKH A;  4WIW A;  3MDY B;  4DT4 A;  3WIJ A;  4REX A;  2DK7 A;  2ZQV A;  2RUR A;  4ZS6 A;  4ODK A;  2KGJ A;  3UI6 A;  4DWS A;  5HKG A;  3RFW A;  5CQ2 A;  3B9E A;  1D7I A;  2JXW A;  5AHT A;  2ZAJ A;  1ZL1 A;  1EHN A;  1FKI A;  3O5M A;  4DRM A;  2ZQU A;  3OOB A;  2PV2 A;  2O9O A;  1UR8 A;  3O5F A;  4KR0 B;  1EYM A;  4QIB A;  2DG3 A;  1FKT A;  2G41 A;  4MPK A;  5HW8 A;  1BL4 A;  4ZPV R;  4JFJ A;  2A3C A;  2OFN A;  4S3K A;  4P8W A;  5HTG A;  2WLZ A;  2A3B A;  2F2D A;  1P5Q A;  2A3A A;  3FXY A;  3WD3 A;  1J4H A;  5I98 A;  3CHC A;  1W1P A;  4AY1 A;  5J6E A;  3CHF A;  4DZ2 A;  3PR9 A;  1Q1C A;  4URI A;  1TR8 A;  1PIN A;  1ZU8 A;  3L4H A;  1D2K A;  4JFK A;  3O5G A;  2Q5A A;  4TNS A;  3TDB A;  1LQ0 A;  1ZB5 A;  1YW5 A;  3BMB A;  2BA1 A;  1JCH B;  1FD9 A;  1FKG A;  1FKF A;  1FKL A;  1HJW A;  5HW6 A;  2RUC A;  3O5I A;  2ZR4 A;  5HWC A;  1BKF A;  4L72 B;  4JFI A;  2XP5 A;  4DWS C;  1Q6U A;  1ZBV A;  2MDI A;  1H0G A;  1KFW A;  4MGV A;  4GIV A;  1FKJ A;  5JH8 A;  1D7J A;  2D9F A;  4XAK A;  2XP7 A;  5DF0 A;  4DRI A;  3TCZ A;  3O5L A;  1HJX A;  1J4R A;  1R9H A;  3CH9 A;  4JYS A;  2YSG A;  1TCO C;  1O6I A;  3TC5 A;  1CTN A;  2M8J A;  2ESC A;  1LG2 A;  1EG3 A;  5E66 A;  4A0U A;  2F4E A;  4QZV B;  4BF8 A;  2KO7 A;  3MCB B;  3ARW A;  2EZ5 W;  4WKH A;  1QPL A;  3RME A;  3WD0 A;  1W1V A;  2VCD A;  1SR0 A;  3O5J A;  3O5O A;  2K8I A;  1LJY A;  1F8A B;  3ARY A;  2YSH A;  4PTM A;  1WR7 A;  2VN1 A;  4WKA A;  2DT2 A;  1LG1 A;  3MCB A;  1JNE A;  1LL7 A;  2WAD A;  3QOK A;  4UDM A;  1O6W A;  1E6P A;  2DSW A;  5DO2 A;  1ZBW A;  3FSB A;  3CGN A;  3NRK A;  2JX8 A;  4IT4 A;  1RP5 A;  1TK7 A;  4DWS B;  3IHZ A;  4MTV A;  4Z2I A;  2LPV A;  1FKS A;  3AS0 A;  3LKX A;  1H0I A;  3G6L A;  1FKD A;  4E5R A;  1FFR A;  4IQC A;  2YSI A;  1W1T A;  2Y8N B;  4HBE A;  4C02 B;  3RM8 A;  3O5P A;  4P8V A;  2DK1 A;  4ZPW R;  1UR9 A;  3CGM A;  1FKK A;  3ARQ A;  1T11 A;  1X6N A;  1W1Y A;  1N1A A;  4DRH A;  4JFL A;  2MLY A;  2WM0 A;  2PI6 A;  2M8I A;  3JYM A;  3OA5 A;  2DWV A;  5U47 A;  3B8S A;  3O5Q A;  4TX0 A;  3M7N A;  5DIT A;  4FN2 A;  2JZV A;  2LJ4 A;  1K9R A;  2KI3 A;  2EUL A;  4GGQ A;  3KAD A;  3UQB A;  4J4N A;  4KQZ A;  4TW8 A;  3WD4 A;  2L4J A;  4W9P A;  4W9Q A;  3RM9 A;  3WKZ A;  5B8I C;  3EY6 A;  3UF8 A;  1K9Q A;  3ODK A;  2QF8 A;  1E6Z A;  1ROT A;  2F21 A;  4DH0 A;  1ROU A;  2PV3 A;  3CZ8 A;  2XP9 A;  4G2P A;  3KAB A;  4FAP A;  3B9A A;  3IKD A;  2XPA A;  1FLC A;  1NWT A;  2FDM A;  4IPX A;  2ZR5 A;  4QT2 A;  1WB0 A;  2XP8 A;  4O2T A;  2QRV A;  2KR7 A;  4WKF A;  2ZQT A;  2PV1 A;  4S3J A;  5HWB A;  2Y78 A;  3KAG A;  1ITX A;  2IUZ A;  3PRB A;  2XP3 A;  4Z2H A;  2YAJ B;  5DIU A;  4GLX A;  1EQ3 A;  4QT3 A;  3JXV A;  2MLX A;  3KCE A;  3O5K A;  1JNS A;  4U84 A;  4Z2J A;  3WL1 A;  2WAE A;  2OLH A;  1HKK A;  4WJX A;  4ODR A;  4DRP A;  4DRO A;  4MAV A;  3VAW A;  3WQV A;  3ARU A;  4Z2L A;  2RSE A;  3FAP A;  4U86 A;  1GPF A;  1KT1 A;  4L3N A;  3UI5 A;  3M85 A;  1XHG A;  2AOS A;  3GPK A;  5E65 A;  1PBK A;  2DMV A;  2ETN A;  4P8U A;  2FKE A;  3MQH A;  2PBC A;  4U85 A;  1ZK6 A;  2ZR6 A;  3WD2 A;  3LKX B;  2YBU A;  3B7X A;  3BXW A;  1FFQ A;  1HKI A;  3LE4 A;  2DSU A;  2O92 A;  1GOI A;  2M3O W;  5DEZ A;  3O5E A;  3PQH A;  4J4O A;  4NZC A;  2LKN A;  3ALG A;  2P4V A;  3WH0 A;  2YSB A;  3FY1 A;  1B6C A;  2DG4 A;  1OGB A;  4LAX A;  1JMQ A;  3WD1 A;  3H9R B;  1ZCN A;  3ARZ A;  4ODP A;  3EIP A;  5GPR A;  5HUA A;  2B31 A;  2DG9 A;  1ZBC A;  4ODQ A;  2F23 A;  1E9L A;  2KE0 A;  2MF9 A;  4JFM A;  1VF8 A;  3B9D A;  1OWQ A;  2DT0 A;  4LGX A;  2RQS A;  1Y0O A;  1LL4 A;  4NSB A;  2XP6 A;  3CHD A;  1K9T A;  4DZ3 A;  2LGO A;  2ZQS A;  1YAT A;  4MNK A;  4LAV A;  1NMW A;  2DSV A;  2M08 A;  3LUO A;  1A7X A;  1I5H W;  4MNL A;  4P8X A;  2RE3 A;  5E5W A;  3ARX A;  1J6Y A;  2XPB A;  1HKM A;  5BXJ A;  1NWS A;  2A3E A;  3WL0 A;  2M2A A;  2DT3 A;  2FAP A;  4LAY A;  2PN0 A;  4Z2G A;  5HT1 A;  4MNJ A;  3NTP A;  3UQA A;  5E62 A;  3ARS A;  3JYJ A;  1NSG A;  4Q22 A;  1GRJ A;  3CNG A;  3KAC A;  1W9V A;  3PRD A;  5HW7 A;  4ITZ A;  4G50 A;  3UI4 A;  1D7H A;  4W9O A;  4ODM A;  1J4I A;  2DT1 A;  2PPN A;  3AS1 A;  2YSF A;  1NWR A;  1X6L A;  4MNM A;  1EIB A;  4TW7 A;  2WLY A;  3MQG A;  2JV4 A;  3I6C A;  3IKG A;  1EDQ A;  2DPE A;  3ARO A;  4DIP A;  2E45 A;  3KAF A;  1HJV A;  2LAJ A;  1WMV A;  2L2S A;  2RUQ A;  1Q6I A;  4TYO A;  3PA7 A;  4DWS D;  4HBO A;  3W4R A;  2N87 A;  2G8Z A;  4HAR A;  1QPF A;  2UZ5 A;  2IF4 A;  4MSP A;  1WNO A;  5E64 A;  3ARR A;  2OWO A;  1JVW A;  3ART A;  1Q6H A;  1E15 A;  3KAI A;  1FKB A;  3GU0 A;  4Z2K A;  3UQI A;  3RGC A;  3KAH A;  1W9P A;  1W26 A;  1FJD A;  2JMF A;  1RD6 A;  4DRQ A;  3AS2 A;  3O5R A;  2ITK A;  4DRJ A;  1FAP A;  2MNT A;  1HKJ A;  2DJY A;  1OGG A;  1XRV A;  5GQB A;  3G6M A;  1GUV A;  2RUD A;  4ML4 A;  3ARV A;  5HBF A;  4ODL A;  4ODN A;  5DIV A;  3PRA A;  1IX5 A;  5D75 A;  4ODO A;  4W5U A;  1D6O A;  4R5E A;  2M1I A;  4TW6 A;  1NWU A;  2MLZ A;  4LAW A;  4N19 A;  4R0X A;  1NH6 A;  3RM4 A;  3FSC A;  4NNR A;  3WQW A;  5GPG A;  3IK8 A;  2PPO A;  4A0T A;  1EG4 A;  4DRK A;  1LL6 A;  4IT6 A;  2KXQ A;  1FKR A;  1ZBK A;  4ZPT R;  1U79 A;  4DRN A;  1WAW A;  2WK2 A;  3FS8 A;  2MPH A;  3AQU A;  4IQ2 A;  1SYT A;  1JND A;  1E44 A;  3KZ7 A;  3ALF A;  1JNT A;  2YBT A;  1TFV A;  3AS3 A; 
#chains in the Genus database with same CATH homology
 2XP4 A;  1E6R A;  4Q7N A;  4WK9 A;  2PPP A;  1L1P A;  3ARP A;  1M5Y A;  3NI6 A;  3CHE A;  1C9H A;  1KT0 A;  1E6N A;  3O5D A;  1NMV A;  1W9U A;  1QZ2 A;  2AWG A;  2KFW A;  1HXV A;  2DSZ A;  1F40 A;  1FKH A;  4WIW A;  3MDY B;  4DT4 A;  3WIJ A;  4REX A;  2DK7 A;  2ZQV A;  2RUR A;  4ZS6 A;  4ODK A;  2KGJ A;  3UI6 A;  4DWS A;  5HKG A;  3RFW A;  5CQ2 A;  3B9E A;  1D7I A;  2JXW A;  5AHT A;  2ZAJ A;  1ZL1 A;  1EHN A;  1FKI A;  3O5M A;  4DRM A;  2ZQU A;  3OOB A;  2PV2 A;  2O9O A;  1UR8 A;  3O5F A;  4KR0 B;  1EYM A;  4QIB A;  2DG3 A;  1FKT A;  2G41 A;  4MPK A;  5HW8 A;  1BL4 A;  4ZPV R;  4JFJ A;  2A3C A;  2OFN A;  4S3K A;  4P8W A;  5HTG A;  2WLZ A;  2A3B A;  2F2D A;  1P5Q A;  2A3A A;  3FXY A;  3WD3 A;  1J4H A;  5I98 A;  3CHC A;  1W1P A;  4AY1 A;  5J6E A;  3CHF A;  4DZ2 A;  3PR9 A;  1Q1C A;  4URI A;  1TR8 A;  1PIN A;  1ZU8 A;  3L4H A;  1D2K A;  4JFK A;  3O5G A;  2Q5A A;  4TNS A;  3TDB A;  1LQ0 A;  1ZB5 A;  1YW5 A;  2BA1 A;  1FD9 A;  1FKG A;  1FKF A;  1FKL A;  1HJW A;  5HW6 A;  2RUC A;  3O5I A;  2ZR4 A;  5HWC A;  1BKF A;  4L72 B;  4JFI A;  2XP5 A;  4DWS C;  1Q6U A;  1ZBV A;  2MDI A;  1H0G A;  1KFW A;  4MGV A;  4GIV A;  1FKJ A;  5JH8 A;  1D7J A;  2D9F A;  4XAK A;  2XP7 A;  5DF0 A;  4DRI A;  3TCZ A;  3O5L A;  1HJX A;  1J4R A;  1R9H A;  3CH9 A;  4JYS A;  2YSG A;  1TCO C;  1O6I A;  3TC5 A;  1CTN A;  2M8J A;  2ESC A;  1LG2 A;  1EG3 A;  5E66 A;  4A0U A;  2F4E A;  4QZV B;  4BF8 A;  2KO7 A;  3MCB B;  3ARW A;  2EZ5 W;  4WKH A;  1QPL A;  3RME A;  3WD0 A;  1W1V A;  2VCD A;  1SR0 A;  3O5J A;  3O5O A;  2K8I A;  1LJY A;  1F8A B;  3ARY A;  2YSH A;  4PTM A;  1WR7 A;  2VN1 A;  4WKA A;  2DT2 A;  1LG1 A;  3MCB A;  1JNE A;  1LL7 A;  2WAD A;  3QOK A;  1O6W A;  1E6P A;  2DSW A;  5DO2 A;  1ZBW A;  3FSB A;  3CGN A;  3NRK A;  2JX8 A;  4IT4 A;  1RP5 A;  1TK7 A;  4DWS B;  3IHZ A;  4MTV A;  4Z2I A;  2LPV A;  1FKS A;  3AS0 A;  3LKX A;  1H0I A;  3G6L A;  1FKD A;  4E5R A;  1FFR A;  4IQC A;  2YSI A;  1W1T A;  2Y8N B;  4HBE A;  4C02 B;  3RM8 A;  3O5P A;  4P8V A;  2DK1 A;  4ZPW R;  1UR9 A;  3CGM A;  1FKK A;  3ARQ A;  1T11 A;  1X6N A;  1W1Y A;  1N1A A;  4DRH A;  4JFL A;  2MLY A;  2WM0 A;  2PI6 A;  2M8I A;  3JYM A;  3OA5 A;  2DWV A;  5U47 A;  3B8S A;  3O5Q A;  4TX0 A;  3M7N A;  5DIT A;  4FN2 A;  2JZV A;  2LJ4 A;  1K9R A;  2KI3 A;  4GGQ A;  3KAD A;  3UQB A;  4J4N A;  4KQZ A;  4TW8 A;  3WD4 A;  2L4J A;  4W9P A;  4W9Q A;  3RM9 A;  3WKZ A;  5B8I C;  3EY6 A;  3UF8 A;  1K9Q A;  3ODK A;  2QF8 A;  1E6Z A;  1ROT A;  2F21 A;  4DH0 A;  1ROU A;  2PV3 A;  3CZ8 A;  2XP9 A;  4G2P A;  3KAB A;  4FAP A;  3B9A A;  3IKD A;  2XPA A;  1FLC A;  1NWT A;  2FDM A;  4IPX A;  2ZR5 A;  4QT2 A;  1WB0 A;  2XP8 A;  4O2T A;  2QRV A;  2KR7 A;  4WKF A;  2ZQT A;  2PV1 A;  4S3J A;  5HWB A;  2Y78 A;  3KAG A;  1ITX A;  2IUZ A;  3PRB A;  2XP3 A;  4Z2H A;  2YAJ B;  5DIU A;  4GLX A;  1EQ3 A;  4QT3 A;  3JXV A;  2MLX A;  3KCE A;  3O5K A;  1JNS A;  4U84 A;  4Z2J A;  3WL1 A;  2WAE A;  2OLH A;  1HKK A;  4WJX A;  4ODR A;  4DRP A;  4DRO A;  4MAV A;  3VAW A;  3WQV A;  3ARU A;  4Z2L A;  2RSE A;  3FAP A;  4U86 A;  1GPF A;  1KT1 A;  4L3N A;  3UI5 A;  3M85 A;  1XHG A;  2AOS A;  3GPK A;  5E65 A;  1PBK A;  2DMV A;  4P8U A;  2FKE A;  3MQH A;  2PBC A;  4U85 A;  1ZK6 A;  2ZR6 A;  3WD2 A;  3LKX B;  2YBU A;  3B7X A;  3BXW A;  1FFQ A;  1HKI A;  3LE4 A;  2DSU A;  2O92 A;  1GOI A;  2M3O W;  5DEZ A;  3O5E A;  3PQH A;  4J4O A;  4NZC A;  2LKN A;  3ALG A;  3WH0 A;  2YSB A;  3FY1 A;  1B6C A;  2DG4 A;  1OGB A;  4LAX A;  1JMQ A;  3WD1 A;  3H9R B;  1ZCN A;  3ARZ A;  4ODP A;  5GPR A;  5HUA A;  2B31 A;  2DG9 A;  1ZBC A;  4ODQ A;  1E9L A;  2KE0 A;  2MF9 A;  4JFM A;  1VF8 A;  3B9D A;  1OWQ A;  2DT0 A;  4LGX A;  2RQS A;  1Y0O A;  1LL4 A;  4NSB A;  2XP6 A;  3CHD A;  1K9T A;  4DZ3 A;  2LGO A;  2ZQS A;  1YAT A;  4MNK A;  4LAV A;  1NMW A;  2DSV A;  2M08 A;  3LUO A;  1A7X A;  1I5H W;  4MNL A;  4P8X A;  2RE3 A;  5E5W A;  3ARX A;  1J6Y A;  2XPB A;  1HKM A;  5BXJ A;  1NWS A;  2A3E A;  3WL0 A;  2M2A A;  2DT3 A;  2FAP A;  4LAY A;  4Z2G A;  5HT1 A;  4MNJ A;  3NTP A;  3UQA A;  5E62 A;  3ARS A;  3JYJ A;  1NSG A;  4Q22 A;  3CNG A;  3KAC A;  1W9V A;  3PRD A;  5HW7 A;  4ITZ A;  4G50 A;  3UI4 A;  1D7H A;  4W9O A;  4ODM A;  1J4I A;  2DT1 A;  2PPN A;  3AS1 A;  2YSF A;  1NWR A;  1X6L A;  4MNM A;  1EIB A;  4TW7 A;  2WLY A;  3MQG A;  2JV4 A;  3I6C A;  3IKG A;  1EDQ A;  2DPE A;  3ARO A;  4DIP A;  2E45 A;  3KAF A;  1HJV A;  2LAJ A;  1WMV A;  2L2S A;  2RUQ A;  1Q6I A;  4TYO A;  3PA7 A;  4DWS D;  4HBO A;  3W4R A;  2N87 A;  2G8Z A;  4HAR A;  1QPF A;  2UZ5 A;  2IF4 A;  4MSP A;  1WNO A;  5E64 A;  3ARR A;  2OWO A;  1JVW A;  3ART A;  1Q6H A;  1E15 A;  3KAI A;  1FKB A;  4Z2K A;  3UQI A;  3RGC A;  3KAH A;  1W9P A;  1W26 A;  1FJD A;  2JMF A;  1RD6 A;  4DRQ A;  3AS2 A;  3O5R A;  2ITK A;  4DRJ A;  1FAP A;  2MNT A;  1HKJ A;  2DJY A;  1OGG A;  1XRV A;  5GQB A;  3G6M A;  1GUV A;  2RUD A;  4ML4 A;  3ARV A;  5HBF A;  4ODL A;  4ODN A;  5DIV A;  3PRA A;  1IX5 A;  5D75 A;  4ODO A;  4W5U A;  1D6O A;  4R5E A;  2M1I A;  4TW6 A;  1NWU A;  2MLZ A;  4LAW A;  4N19 A;  4R0X A;  1NH6 A;  3RM4 A;  3FSC A;  4NNR A;  3WQW A;  5GPG A;  3IK8 A;  2PPO A;  4A0T A;  1EG4 A;  4DRK A;  1LL6 A;  4IT6 A;  2KXQ A;  1FKR A;  1ZBK A;  4ZPT R;  1U79 A;  4DRN A;  1WAW A;  2WK2 A;  3FS8 A;  2MPH A;  3AQU A;  4IQ2 A;  1SYT A;  1JND A;  3KZ7 A;  3ALF A;  1JNT A;  2YBT A;  1TFV A;  3AS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...