3TE6A

Crystal structure of the s. cerevisiae sir3 aaa+ domain
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
316
structure length
304
Chain Sequence
PNADINLEESIRESLQKRELLKSQVEDFTRIFLPIYDSLMSSQNKLFYITNADDSTKFQLVNDVMDELITSSARKELPIFDYIHIDALELMDALYEKIWFAISKENGDISLEALNFYITNVPKAKKRKTLILIQNPENLLSEKILQYFEKWISSKNSKLSIICVGGHNVTIREQINIMPSLKAHFTEIKLNKVDKNELQQMIITRLKSLLKPFHVKVNDKKEMTIYNNIPDNVIVINHKINNKITQLIAKNVANVSGSTEKAFKICEAAVEISKKDFVRKGGLQKGKLVVSQEMVPRYFSEAIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Regulatory protein SIR3
publication title Structural basis for the role of the Sir3 AAA+ domain in silencing: interaction with Sir4 and unmethylated histone H3K79.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
total genus 88
structure length 304
sequence length 316
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17872 AAA_lid_10 AAA lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1280 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3te6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3te6A01
2WWXA 4RZ3A 2WPDA 3AGPA 4GOKA 2N1BA 1N6NA 4N3NA 3MWYW 1C9KA 2CK3D 2V7QD 1SVLA 4S2EA 5KNBA 4DCNA 1BIFA 3PEUA 4LC0A 3D31A 4P31A 2W0SA 2ZI4A 2ZREA 5CK4A 1FQJA 3KKMA 4KODA 4ZDJA 2ZS8A 1KO5A 1IN8A 1GZSA 4TT3D 1X8KA 5AJVB 2EQBA 3SS8A 1CR4A 2NO0A 1GUAA 1ZYUA 3I5YA 2FSGA 3L43A 2VYFA 1QHHB 4RD6A 2Q9BA 2NTYC 3K70D 2EU8A 1XTQA 2AD5A 1G17A 5L3QB 5FOTA 4IW3B 2C78A 2B7CA 4GP7A 3RNLA 2CLDX 2JLXA 5HZHA 1GNPA 3QKSA 4US0R 1IN5A 3HDTA 4XSHA 3PUXA 1IJEA 2IHYA 3VR1A 4U5XA 1NRJB 3CH5A 2GXQA 1ETUA 1Q21A 1X1RA 5JCZA 1N2CE 1XEWX 4A8JA 1JR6A 3SI7A 3K0AA 3AF3A 3EARA 3NXSA 1IXSB 4I1UA 3BFKA 5LPNA 3H86A 4GP6A 1TL7C 4WZBE 1N5IA 2ZROA 3MG9A 4LHXA 2J0SA 2YWHA 1XTIA 4EPWA 1XFAA 4Q9LA 3SR0A 1KMQA 2LCFA 1T3SA 2ZYVX 3EZFA 3LVQE 4HAVA 1B23P 2QROA 4MITA 4AYWA 2RGCA 4KJZA 4A15A 3GLGE 3NG1A 4G0NA 821PA 2GVZC 2XOKD 3TVTA 4KV9A 2FV8A 4Q1AA 1QRAA 5TY0A 1W36B 1KJZA 2BIFA 1S3SA 4TQUS 1WF3A 2CL0X 1OFIA 2GK6A 2VLIA 3BE4A 3CRMA 1ZC3A 4NP6A 2ZVPX 4YC7A 1HQCA 2P3SA 3IHWA 4ACBA 4P33A 1E2EA 3AGQA 1KO4A 1K8RA 3M6AA 4HUQA 1EX6A 2RAPA 1KO1A 3V4RA 4G5QA 1PVOA 2FPKA 4P3YA 4C7OB 2O0JA 4V0OA 4XH9B 3EX7C 4JBXA 3HR8A 3R9IA 1OFTA 2G3YA 3SE0A 1UBFA 2IF0A 1ZUHA 2GZDA 1Z0JA 3PV0A 1YRAA 3W6PA 4EPVA 1KDPA 3DL0A 2DWQA 1Z0AA 3FB4A 3SYKA 3KL4A 4XSGA 2Z43A 2W6JA 2VRWA 4RCZA 3K9GA 2GDJA 1US8B 1ZD1A 1XEXB 1Z0KA 5HKKA 5KOYA 4URUR 2OEPA 4V0ME 2C8VA 1P2SA 2JJ8A 2F43A 2RHMA 3AVYA 3EZ7A 3JZAA 3QI2A 4L16A 3UKDA 3X1YA 4IDPA 1P6XA 3CX7A 2VPPA 1KSHA 4D0NA 1XCGB 2XITA 1W2HA 3THXB 1M7BA 2K5UA 2GAAA 2OO7A 3I92A 3A1UA 3FPAA 2FPMA 2CJWA 3GMTA 4CW7A 4GL2A 4BLSA 4TTPA 3OAAD 1TU4A 1CJKC 1WCV1 1XXHA 3QOFA 1E32A 4Q1DA 4URWR 3T35A 3ZS8A 3ECCA 5FPYA 1E94E 4KI0A 4P4TA 1Z6YA 4ASUD 1OXSC 4PO1A 3TR0A 4C0QC 4Z1MA 3TLXA 1ZCBA 2VP2A 4MRSA 5EP2A 4M9QA 2NIPA 3LVRE 3L0IB 1FP7A 2F7SA 2ZUBA 2NPIA 1W4BA 4MDEA 3U44B 4DWJA 1TUEA 1W46A 4UNSA 1E69A 4JZKA 4LJAA 3TIFA 1G3UA 5LD2B 1XCPA 1E0KA 1WBBA 1VCOA 4A6PA 3IPXA 3B1YA 3U7FB 2J0UB 3WRYC 421PA 3ADDA 2NPFA 3X1XA 1JEEA 3B60A 4HSEA 2EFEB 2KWIA 5FL7A 4DHEA 2IS1A 1OXXK 1NN0A 1QHIA 3ADCA 1TX4B 2VEDA 4Q4JA 3WNDA 4A2PA 1J2JA 2NO6A 3GD7A 3TNFA 4F93B 1S1CA 3PJRA 5JCPA 2IYSA 1TQ2A 4AIIA 5L3SB 4WBSA 1OW3B 3BFVA 4Q4AB 3IEVA 1VCIA 4C2UA 1ZP6A 5HZKA 4JLMA 3BJIC 3J81k 1FX0B 2CE7A 2A78A 2GRJA 3B7GA 3QY0A 4V02A 1F2UA 4P4SA 3D3QA 3W3AA 1GWNA 3BC1A 1N6OA 2RHDA 3ASZA 3LW8A 4GOJA 1MO6A 2Q21A 1RFLA 2XTNA 1S0UA 2LKCA 4P32A 3ZZTA 3FFBA 4B3XA 3JZMA 1CTQA 5FL3A 4C30A 3CBQA 2VH5R 2ZSEA 2GF9A 2CL6X 4F4CA 1FPMA 5C4GB 2CLCX 3E1SA 4K81B 2W83A 1TUIA 2RCNA 2VF7A 1XCMA 3QF4B 2UZ3A 2JLVA 1Q20A 3HR7A 3G5UA 5G41A 3E70C 2PCLA 3ZGXA 1KDOA 2ZR7A 1R4AA 5A5GA 3UIEA 1LF5A 3M1IA 4BRUA 5EJEA 4M1OA 4JT4A 5IHPA 2P2LA 3MGCA 4HYYA 2NG1A 3W34A 3MWJA 4HDCA 4YXWD 4NBSA 2A3RA 4PAMA 4CIDA 1CR0A 2QGNA 4L9SA 1DVRA 4HB2A 2GVDC 4L5BA 4US2R 2EFCB 1XBTA 4C0JA 2GETA 4DZZA 1J8MF 1WRBA 4TN1A 2IEYA 5EUMA 1NL3A 1W1WA 3CR7A 2P0EA 5JWOA 3U4QB 3MD0A 3SJBA 1CP2A 3KTAB 1SULA 4UQOA 3N2EA 1E2QA 1LS1A 1RW4A 1K6MA 4UJ5A 2ORWA 4NH0A 2FNAA 1SQ5A 2SHKA 2WSSA 3THWB 4DDWA 4V03A 3QE0A 1RRGA 4M8NE 1W4CA 5TXGA 3QEJA 1P60A 1VCNA 4I1VA 5J4HA 1IBRA 1Q1EA 2C95A 2XJ9A 4HUTA 4G5OA 1RRCA 2WWHA 2VP6A 4BEBA 2LKDA 2JJ1A 4GSYA 2B21A 2O8FB 4OQMA 1R5NA 4O25A 4OQXA 5BN3A 2ZE8A 1E4VA 5L3RA 1NNEA 5SZJA 3LQQA 2UVQA 2A9KA 2FSFA 5FBRB 3GPLA 3CUEF 1TQDA 2ZJYA 1W4AA 3KTAA 1U0HC 1KMHB 1Q44A 2AK2A 5KSPA 1CR2A 1OIWA 4QXAA 4BE7B 1IN7A 3AF4A 1E1RA 4XJXA 1ZCAA 1N6KA 2YZ2A 2JIZD 8OHMA 2MSDB 1JXOA 1GL6A 1H8HD 1S1MA 3K53A 4KO8A 2R6AA 2ODNA 1L7VC 2I3BA 3TAHA 1R5BA 1T9HA 2AXPA 3K8YA 1ZW6A 2DR3A 3ND9A 4URXR 2V4ZA 3KUDA 3WYFA 5KDDA 3CF6R 3B5JA 1OH5A 3B6EA 4CVNA 4ARZB 5AJXA 3V4FA 2F1RA 4DLRA 2PT7A 3KZ1E 1CRQA 5L8VA 5F3WB 1GITA 5E7JA 4M1KA 4C9BA 1XXHE 4A82A 4DB2A 4YLGA 1AM4D 1OIVA 5KO2A 3HPRA 3WMFA 3VX4A 2QTFA 2FE4A 2GJ8A 4IJMA 3CLVA 1AS0A 1N6IA 4O0MA 4RZ2A 3PCRB 4BRWA 3MUFA 5B57C 2OXRA 2WWYA 1Y3AA 3PG5A 1AGPA 4XTRA 1G8FA 1KTVA 3OFNA 4RKFA 3O47A 4G3XA 3SQWA 1E96A 1IY1A 1E2LA 3H4MA 2V1XA 2IYQA 3LA6A 3DKPA 4JLDA 2X2EA 2ZRCA 1GRQA 2ZJ5A 3T34A 4OJKA 3MMPA 4KYIB 1NMXA 2ZU0C 1QHGA 4M4SA 1KO7A 2DWOA 3WMEA 4E09A 1R8QA 1LF0A 1MABB 4RFSB 1GP2A 5FUYA 2JJ2A 3U3OA 1G8YA 3IILA 5KYKA 2ZI3A 4NYMQ 3OHMA 4KBFA 1LFDB 2ZJ2A 2MMCA 4XWKA 2R6CA 3VU9A 5C46F 1W4RA 4NZYA 3UWKA 3A1WA 3LBHA 1P75A 1I2MA 1U8YA 1JXMA 1DEKA 1R0ZA 1HT2E 1EGAA 2D2EA 1GKIA 1Z06A 1U98A 3QSYA 3LNCA 5J4YA 4LCBA 2D7DA 3CRW1 1S4QA 3R9WA 2NZ8A 4MH0R 2QZ4A 5IDVA 3SOPA 1P3JA 3LRPA 3BB3A 1S3GA 4OI2A 4TT3A 4FMDF 4ZCLA 3ND8A 1HQYE 121PA 1SXJC 3OE7D 4F38A 1HY3A 1SVKA 3CF2A 3GJXC 4DSNA 2PBRA 4R71A 2OSBA 4GRAA 4MGZR 5KDOA 1YZTA 1F48A 2WWWA 3RS5A 4CEJB 3PUVA 4IEIA 2KSQA 4Q5IA 4JSTA 4A2QA 2OBLA 1D6JA 3EPJA 2BJVA 2W6ID 2Q3HA 2QAGA 2CCKA 4FXPA 1W0KD 1E2PA 2C9OA 4TMXA 1D9ZA 1ZU4A 5J5CA 3VKWA 2YOGA 3T5DA 1L4UA 4PHFA 1D2EA 3IGFA 1MO3A 2G83A 2GJAA 5EZ6B 3RHFA 1ANKA 2QU8A 3FKSD 1AA9A 1XD2B 5IRCD 4CEIB 3KJIA 3AVVA 2F9LA 4CYMA 4WAUA 3TJZA 4E22A 4BLOA 1LB1B 4CGZA 2PH1A 2WMNB 4LDJA 3H84A 4R2HA 3AVTA 1Q12A 2B7BA 2ZE6A 1AJEA 2ZRLA 3KQUA 2I1VB 4JBWA 4WOPA 1E2MA 4G5GA 1UF9A 3MAAC 1AN0A 1E9SA 3ZIAD 5JBQA 1KDTA 1UKYA 2QM7A 4DDTA 2QP4A 5BW8A 2FFHA 2XOKA 2IXGA 2XAUA 4C0SA 2ZPTX 1ESNA 4ERNA 5FOUA 3T12A 5KNCA 2Z4SA 1QG2A 1NG1A 4D4JA 5L3VA 1DG3A 2DY1A 3E2IA 2CMKA 3TW8B 5JFGA 5FTNA 3W3ZB 5JJLA 4LK2A 3DZ8A 4Q4LA 3NHBA 3RS2A 4TYNA 1AQYA 4G5SA 4B6FA 1KO8A 2H57A 3CIOA 4NYIR 1Z2AA 2FOLA 4Y0VA 4Q66C 2QQ0A 1OXTA 2EVWX 4EQ6A 2IWHA 1NMYA 3R7WB 3RS0A 1UKZA 2ZETA 1JJ7A 1OYWA 2D7CA 1YKSA 1SVIA 3IO5A 4IDNA 5FPKA 3T61A 3LAWA 3OEHD 1CF4A 4JLAA 1W2GA 3FVQA 4HB3A 1XPOA 1YR8A 1PZNA 1X1SA 2OFOA 2QBYB 2KBFA 1CLUA 1DOAA 1ESMA 3L8ZA 1E2JA 1Z22A 5B58C 4UNRA 3K70C 2FEMA 2IC5A 2IBMA 4O3MA 4LY6A 1M2OB 4XD7D 4PANA 3ZJYA 3OAAA 3THYB 2IL1A 3AF1A 2IUUA 1R8SA 2P6UA 1G19A 2QAGC 4LYFA 4YONB 4AG6A 2PMDA 2A5DA 4ZDIA 4XIGS 2JA1A 2QRZA 2FFAA 3FMOB 4ZIRB 4QJ3A 4WZAE 3KQHA 2CNWA 1YR9A 1YZNA 2GBLA 4KLNA 3O8BA 3KXLA 2IXEA 1QZXA 4QKQA 1Z29A 3CRRA 4MA4A 2BCJQ 4TMTA 4GDFA 1G1MA 1GVNB 4IFBA 1ZU5A 4ZCMA 3EA5A 3GEEA 3ADBA 2OAP1 1Z8FA 4PC3A 1YQTA 2HXSA 1JPNA 2I4IA 2QORA 2ZI5A 3HYRA 5DYIA 5GADl 1KIMA 2QBYA 1DAKA 4FI3C 1V43A 2VBCA 1E9CA 3EA0A 3RABA 2PLFA 2QSYA 3KB1A 4IRUB 1Q1ZA 4NYJR 5EXXA 3SDZA 1G20E 1ZINA 2GXUA 1IXZA 2G1KA 3ZDQA 2O8CA 3GEIA 3ZD7A 1P9NA 1X8JA 5JS8A 2JGNA 1KAOA 4QM6A 2BVNA 2ZR9A 1JQJC 4X8HA 4PTLA 4PZYA 4HLDA 1DE0A 1NSFA 3KUCA 4QL3A 1E9DA 1W48A 2HT6A 1KYIA 1I4LD 3C16C 4DDVA 5KUTA 4I4LA 2H1LA 5P21A 3SJAA 1KK2A 4A92A 2QUZA 1HV8A 2V55B 4A9AA 4JJKA 5G3ZA 2TMKA 1MV5A 1Q57A 2AFIE 1OKKD 4DLVA 3NH9A 1SXJD 2OXCA 4MGKR 1M7GA 1N6LA 5BYKA 1G7TA 5IK2D 2XZPA 3QENA 2EWVA 1O87A 4CZ2A 4TMZA 4TYWA 1I4TD 1W0JD 2NOAA 1ZMXA 3RS4A 1KKLA 4TYQA 4PAOA 4UNNA 2EFDB 2E9SA 4YXWA 2FDCA 5DHAA 1HH4A 1N5KA 4QNRA 2O8DA 1NBMD 3Q72A 1R10A 1N0VC 1UM8A 2F55A 4Q1EA 4BLRA 1NJFA 4IOLA 1JR3E 3CM0A 4R7ZA 4A6XA 3AUXA 3SBDA 1R0YA 4OQNA 3W8RA 1N6PA 5SZKB 1BH2A 1FOEB 3K9LA 4LBVA 3QXHA 2P6RA 4OK5A 5GJWC 3BXZA 2IYTA 2J7KA 4BUJA 4KSBA 1XF9A 1ZD9A 3E5HA 4FCVA 3WP1B 3MCAA 2CXXA 5TDHA 1P2TA 5DYGA 3RRYA 2IS2A 2QPTA 3QPWA 4TLBA 1HEIA 2DFLA 1G8GA 2BKEA 2OBNA 4DIDA 5CITA 5JI3E 2G88A 1LY1A 1N25A 1OF1A 4Q48A 4D4LA 5FUWA 1GNRA 5DE3A 4LWZA 3UMSA 4HDOB 3EW9A 1G4UR 1L4YA 3V00A 2ZAOA 3GLIA 3GLFA 1S2MA 4YMVA 2ZRNA 1G5TA 1JALA 2FX3A 4Q47A 3SHWA 2BOVA 4YMWA 5DO9A 2P6NA 3EPLA 4ZKDA 1X8LA 3WBJA 4HAWA 1VYTA 4LUCA 5JWRA 5SZIA 1FFHA 4IKEA 4B3DA 2W2VA 1LS6A 4WXRA 4WXPA 1T0JB 1RJ9A 2V6JA 5E3HA 1XMIA 1P5ZB 3W9YA 3QKSB 4OK3A 1TPZA 1ZBDA 2F3RA 1GILA 2OZEA 3EIHA 3DKVA 3QF7A 2FA9A 1H8HA 2FU5C 4DCSA 4JIMA 1FNNA 2PT5A 1JBKA 4QGAA 3TKLA 5AR1A 4A8JB 1D5CA 3K0AB 3LX5A 4HLQB 2XZLA 4Z54A 4MKIA 2GJKA 4FWTA 1G9XA 2AX4A 5AUOB 4JSYA 4IDOA 3N5CA 3P26A 1CEEA 1P2VA 2HEIA 4DIEA 2JATA 4MYHA 1CU1A 4IFEA 5JJIA 3QPUA 5GVSA 2O8EA 3AP2A 3NWJA 2IHBA 2N42A 2WAXA 3BFXA 4LX0A 2ZSDA 5DN6A 1T8TA 4JYCA 1B0UA 2XSZD 1IN4A 3NEYA 4Q1CA 3H1TA 4JVLA 4JBYA 4BQSA 4LJ9A 2AFHE 3QVUA 4C0KA 4BFWA 1CR1A 2ZRJA 1CS4C 5LB4A 4HUQB 1EXMA 3AH8A 1XTRA 5CYOA 1JB1A 5AWFC 2ZR0A 3I3SR 4M1MA 4PX9A 5CDFA 3WMGA 2PZEA 2GTPA 1G3IA 2EW1A 3BD9A 4EJSA 4DDUA 1ZM3A 2B92A 1NI3A 3MJRA 2GZAA 2EYQA 2N46A 3KXIA 2GWHA 2BM0A 4PQRA 2ZUDA 1GAJA 2JDID 1W44A 2WICA 1AS3A 5EP4A 1E2DA 4AKIA 4YDHB 2YINC 3A1VA 4D6PA 2VO1A 1E9FA 2V54A 5BWMA 3SFZA 4DT1A 3PITA 3WHLA 3AM1A 3CX6A 2F43B 3LFUA 4PPGA 2WWFA 3SJZA 2ZE7A 3EAQA 1F2TA 2YC4C 3LD9A 3ZZUA 3OIUA 3B8HA 1W5TA 2X2FA 1X86B 621PA 2YHSA 1AIPA 3FHCB 3NVAA 4R98A 1KI8A 2WOOA 3AKYA 2CJWB 2NO1A 1XXHB 2EYUA 1OXUA 2FF7A 3MFYA 3PEWA 2W6IA 4I81A 1MKYA 4GI7A 3I1FA 1W0KA 2ZAMA 3P4YA 2CVFA 5FBLB 5FTKA 1UBEA 4OBEA 2JLZA 1MT0A 1ONBA 2O0KA 3NEJA 4TMKA 3SU8A 3C41J 1GKUB 1VCMA 4ZI2A 4Q02A 3AF2A 1GL7A 3Q5DA 3QEOA 4FW9A 2R6DA 4D26A 4JL8A 1VKJA 5G3YA 1RRFA 4LJ5A 3FWYA 3P27A 4EFLA 3LV8A 1GOTA 4DCVA 1A82A 2Q3MA 4ZKEA 4MYCA 3FDIA 3QKRA 1UEIA 1J70A 4NCIA 3O8CA 2I1QA 4AYTA 3GLHA 4LV6A 2XJ4A 3PFIA 4Q4JB 1XX6A 2BC9A 4I1OA 2X19A 5G40A 3ZIAA 5CB6A 3DEFA 1L8QA 3F8TA 4BZXA 5JSZB 5JZVA 1L2TA 2YWGA 2GK7A 3ZQ6A 3RYTC 4JLKA 1EFUA 2BKUA 3DDCA 2RGXA 4Q1FA 4Z51A 1OLOA 4Q9KA 4FCTA 3NC0C 2VQSA 1J7KA 4NYIQ 3CPHA 2WJYA 3I8SA 3QJYA 2GEUA 1F2UB 2OHFA 4P4SB 3I72A 5EE0A 1U9IA 3ZVMA 4HLUA 4BECA 1A4RA 1DBSA 1LW7A 3QG5A 4IVPA 3M0EA 2IYZA 5FPSA 1COWD 5EP1A 2ONJA 1E0SA 2ZVQX 2C99A 3CPJB 4P0TA 4EJSC 2O5VA 1ZD8A 5TMPA 1EX7A 1HTWA 1IAQA 2FFQA 4W9MC 3I4LA 4V0KA 3TR5A 1D2MA 2Q9AA 4YDSA 3AV0B 1KI2A 4C2TA 4QFMA 4NONA 3VR3A 4B6EA 5JSZA 4MKFA 3FTQA 2BBWA 5FUVA 4DKXA 4RFVA 3KQLA 2AD1A 1VG1A 4QHSA 1ZIPA 3OEHA 3FKQA 1ZJ6A 3QNUA 2FWRA 4PZLA 4N1AA 2QPAA 5EQTA 1SVWA 3L8YA 4NU0A 4Q21A 1T91A 2QP3A 3RWMB 3QKTA 3T06B 4CT5A 4XWAA 1IONA 2A7QA 3RSOA 5TV2A 1NLZA 4TTQA 4XD7A 2QT0A 5KPDA 3FMFA 4M2LA 4LHZA 4TL7A 3RWOA 5LDDC 4OHZA 5SZHB 4FIDA 1TQ6A 4LHVA 1IY2A 1MRSA 2CL7X 4FMBB 3VFDA 1ZM2A 1P62B 3EZ9A 5AUQA 1SHKA 3ICQB 4OQFA 1GDDA 3SQXA 2EFGA 3DM5A 1TEXA 1G8PA 3UATA 1O3YA 4Q18A 1YR7A 2ZRBA 4DLSA 4QNMA 1NF3A 3DO6A 1S9DA 2GEVA 1TEVA 2ZSBA 1AKEA 1J99A 2OCAA 4MRPA 1CJMA 5J47A 4JLPA 3FMIA 2H8KA 4OK6A 1WA5A 3QXSA 3K09C 3G0HA 2RGBA 1QHSA 1IXRC 2DCUA 3B82A 2ODWA 3DOFA 2GXAA 1E3MA 4Q7MB 2ZRPA 2PL3A 2EWWA 2YNMA 4N0DA 1ZNWA 2DPXA 1P61B 3IEUA 4B2LA 1OJLA 4Q19A 1DPFA 1OHHD 2WMOB 4NE2A 4JT2A 3Q5EA 1VECA 3HJNA 1U9IC 4HLUC 4OHVA 1E0JA 1M7HA 2V3CC 1ZM7A 2VTKA 2ZRMA 4LI0A 3RRMA 1M6NA 1YZGA 1YRBA 2J87A 2ZUCA 4FMDB 1W5SA 2PMKA 3LX8A 1U8ZA 221PA 3KFXA 2QA5A 3NDPA 2WWIA 4RD1A 3VR5A 4E03A 4EAQA 4DSTA 4G5RA 2J45A 2E87A 3W5IA 3K0SA 4JLOA 4IOJA 4BPBA 2CLSA 4Q00A 1T4GA 2CCJA 1OKKA 3B78A 1II9A 1F5NA 2YWEA 3OIYA 1SXJA 5GJCA 2WM9B 3SEAA 1E2KA 1G6OA 4LJ7A 4MYUA 1QHYA 4DLZA 5C18A 1ZNXA 5TB5A 1JAHA 1E9EA 3IBGA 1RIFA 2XZOA 1NG9A 2R9VA 3LXXA 2J0QA 4O2RA 1OFUX 2DBYA 4IDQA 3U61B 4A36A 5KHOC 5H8WA 3WNBA 2RGEA 2XB2A 3OIWA 3WRXC 3CO5A 1IHUA 1E79D 2PJRA 1W0JA 1KSJA 3NC1C 2J9RA 3EIEA 4AWXA 2WAYA 1WDTA 4EUNA 3CNNA 4Q4HA 1U81A 4U7DA 3ADKA 1R2QA 2DWPA 1KSGA 2G9NA 1NBMA 3AVPA 4TZ0A 1NIJA 2FH5B 4B44A 3QKUA 4OHXA 3VR6A 2YV5A 1TF7A 4PO9A 2ZJAA 4Q01A 3I5XA 1KZGB 2CVHA 2B8WA 2FJUA 1YZQA 4B73A 4N0EA 4UXHA 3VAAA 1ELOA 2BMJA 2DFNA 2RGAA 3EG5A 3EZ6A 1K5GA 2WPDD 1DS6A 2NO9A 4IVQA 1G6HA 4TMVA 3OEED 4X8LA 2ERXA 5BYJA 3VR2A 4A0RA 3T1TA 1KDRA 4WA7A 2REOA 1C4OA 2HV8A 2W2TA 3RRNA 2IYLD 4PHHA 4LJ6A 4RZXA 1ODFA 4NPHA 1P73A 1G7RA 1DARA 2ZRGA 2ATVA 3NBXX 4HZUA 3VKGA 1U99A 3U3MA 4JL6A 1NN3A 1TAGA 1WE2A 1PLLA 2WJGA 2QENA 3GJ3A 4HEJA 3RDPA 1XJQA 5FFMA 3A37A 3AVUA 3K0FA 1NVWQ 4TTRA 3U60B 3LW7A 2GHIA 2DFTA 2E1RA 4RD4A 1RYHA 4ESHA 1VMAA 2YWFA 1VG9B 3K70B 1ZNYA 2J1LA 2RMKA 1IN6A 1XZQA 3CW2A 2QAGB 1I4DD 2OUKA 3CZPA 4H9GA 3V9PA 1M8PA 1E2HA 2QN6A 3A6PC 5DISB 4B3FX 4AURA 2QSZA 2CK3A 2V7QA 2OT3B 3SZRA 2VHCA 3CWQA 4K46A 4E5UA 1G3RA 2WKPA 1VG0B 4X8OA 1M1YE 2OAQ1 2NMVA 1D9XA 2IYVA 2ZTSA 1KK1A 2QMHA 5E95A 3UWOA 4KYUA 2ZJBA 2JEOA 5HE9A 1NN1A 3DOEA 2GESA 2XTZA 5FPHA 1FW6A 5HR5A 2AWNA 4ZO4A 2Z6VA 1XD8A 2GXSA 2F3TA 4GT1A 2RGNC 3I8XA 2VHTA 5KSOA 2QMUA 3LLUA 1XEWY 4LBWA 3AKEA 3BB1A 3BK7A 5CM8B 3X1WA 4V0NA 2IS4A 1XZPA 1HYQA 3LLMA 2ORVA 4B76A 4DLUA 2XSZA 2J59A 3SBEA 4F92B 4U02A 3W6NA 3B1ZA 3CKLA 1DAHA 3T1OA 4RD2A 4DSOA 4URZR 3PXGA 4ESVA 5C1BA 1DTSA 2IX3A 4B32A 1T5IA 1SVMA 4TZ6A 1YR6A 4JS0A 4XWOA 4KFRA 4PC2A 3CF0A 3TVDA 3ZYCA 2H7VA 3QXXA 2WSMA 3RSLA 3L0SA 3ZQJA 1ZUNB 4MDFA 5BN4A 1T8UA 2ZRKA 4RJLA 4AKEA 1BS1A 3S1AA 2PLRA 3BBPA 3R20A 3ZZ0A 4EQ6B 1W36D 2PX3A 3GFTA 4MRRA 3X1ZA 3M4YA 4EKDA 1KK3A 4TLDA 3GJ4A 4FMCB 4DCTA 2P5TB 3TSWA 2WJHA 1XTKA 4LHYA 4TLEA 1AZTA 4B47A 5D3QA 2ZRHA 3EWSA 4HAZA 4LV8B 2XXAA 1UKVY 5DHFA 5CM9C 3TUIC 3SC3A 1Z6AA 2FGKA 4OI1A 3TBKA 3TGPA 4G01B 1E4YA 4US1R 1RVDA 4HB4A 1DG1G 4U00A 3VHXA 5KNDA 2HYIC 4OJQA 4RD0A 4XVUA 2Z0MA 4TLCA 2C77A 2NO7A 3CRVA 2X77A 4UXIA 2CBZA 4Z1MD 4MKHA 5ELXA 4Z8XA 3SN6A 3B85A 4Q9JA 1W47A 5K8IA 3VNVA 3D7MA 4AC9A 4URVR 2WIAA 3BAFA 1RPZA 5H70A 1UFQA 3CWZA 3W5JA 3KJHA 2R62A 2IS6A 2A5FA 1CJUC 2VA8A 3C7KA 1Z0FA 4IVRA 1PLKA 4HDQB 2QT1A 1E1QD 2VHQA 3MJHA 4QC2A 1IY0A 2F6RA 3PQCA 3IIMA 4ZV4A 4PPNA 4E07A 1OH7A 4ILEA 4NHOA 1U94A 4RCYA 3VX3A 2GILA 2J41A 2WTUA 2O8CB 4Q9IA 4II7A 5DLQC 5FBQB 4ASUA 3O8RA 3B1XA 4LYAA 4R2IA 1VPLA 2F1HA 2XNSA 4LPSA 3ZVRA 4BGDA 1Z6TA 3LWNA 3CZQA 3KDSE 2AR7A 1HURA 2Q0HA 1OB2A 3K1JA 4BLTA 1AKYA 2JCSA 3LBIA 3K0EA 1COWA 5KDLA 3EC2A 3R8FA 2ZYWX 1MO4A 3CR8A 2YOFA 4PHGA 4BFXA 2ZRIA 1P4SA 3OF5A 4Q7JB 5FI1B 4M22A 3UPUA 4PPFA 3LQRA 2ZI7A 1KI7A 4QBIA 2HCJB 4R9UC 4XOIA 3CPEA 1ZM4A 3U2QA 1FQKA 2GA8A 4GOXA 5DIFA 4EPYA 3AEZA 1FP6A 4B35A 2G0TA 3HU1A 1PUJA 4J0QA 5J4VA 4FMCF 1SZPA 5JLJA 1G7SA 1VIAA 1KHTA 1EK0A 2VF8A 4B2IA 2HT1A 521PA 2O8DB 1S9HA 1Z47A 3NIBA 3JVVA 2KBEA 2IYXA 4QBGB 4I99A 1WXQA 3CRQA 2BJWA 2IYYA 4NCHA 1N5LA 1XWIA 2ZIAA 3EWAA 1NMZA 4G1UC 2GCNA 4BLQA 1PLJA 2QMOA 4KBGA 2WKRA 1Z0DA 3B2EA 3GLGA 2O52A 2R44A 3QIAA 4CEHA 3UMRA 3VQTA 5EE5B 2JLUA 4YMSA 5CYPA 1N6HA 2QMEA 3QXJA 3TQFA 3U7EB 4JKIA 2HLDD 1YU9A 4PAQA 2ZRAA 3KFVA 4WW0A 3WBKA 2IF2A 3I61A 3CNLA 4QHYA 5DGXA 1CRPA 2JJ1D 5HPYB 3UG7A 4B3CA 2YC2C 5DI3A 5ANRB 5HE8A 1KI9A 5JRZA 1F3OA 2ZU6A 4AG5A 4Q9HA 2ZRDA 4A0FA 3GLIB 4MGYR 3GLFB 1E2IA 1JQLB 1GTVA 2CHQA 4GMDA 2ZM5A 4P4UA 5KPJA 3OESA 1MR3F 3LO5A 5HCNA 1E98A 2A5YB 2LWIA 3KKNA 1NLFA 1NKSA 1Q3TA 1TADA 2ODBA 2C2HA 2VP0A 2XNDD 1RJ9B 3PENA 4EDHA 2VP5A 2XGJA 4RD3A 4V0MA 5JI2E 1P72A 1JNYA 4W5HA 3H2YA 3CNOA 1Q1QA 1MOZA 1R6BX 4YQFA 2BBSA 5KSZA 1XP8A 2OM2A 2MSEB 3UXMA 2QAJA 3F0TA 3C8UA 2YVUA 3QQ5A 4NCNA 5HCIA 4IXNA 4TLAA 5DSZA 3KB2A 3AKDA 4HI0E 2ANCA 3LY5A 1KI6A 3QBTA 2FZ4A 2XEXA 4JVMA 2CE2X 4X8MA 4DUGD 4PSKA 2GCPA 3L0OA 3I73A 1VTKA 2QQEA 5AUPB 1LV7A 1U0JA 2O8EB 4F7WA 5AK0A 3RLFA 1U2RA 1UBGA 2WIBA 4OQLA 1E79A 2V9PA 2IXFA 5EXSA 2JIZA 4PSAA 3KKQA 1TMKA 1SVOA 2WOJA 4TL8A 3D8BA 5H68A 3C4JA 4BFYA 2PCJA 4D0LB 2IYWA 2H5EA 2IA5A 3DVLA 4LHWA 2F1JA 5JHHB 3BERA 1NKTA 1XU4A 2FGJA 1N0UA 2BMEA 3AVQA 3OIVA 4QOSA 5J4KA 3NTUA 3GCGA 3CONA 2GAOA 2O8BB 1II8A 1QHXA 2IUTA 2ZRFA 2R8RA 3RS7A 4EJSB 3IQXA 4D25A 3IHLA 4D80A 2ZANA 1OIXA 2KE5A 4PXAA 5FR2A 3OEEA 4D82A 3PUZA 1FUKA 2OESA 3ZS9A 4NCKA 4F4IA 2AL7A 2J5XA 1NN5A 4IHQA 5D3MB 3K0CA 5JMTA 4L9WA 2HF9A 3EZ2A 3IIJA 4PO8A 4RKEA 4K8OA 4DLXA 4DT1B 4NYMR 5TARA 1UJ2A 3HWSA 5DNYB 1D2NA 5G53C 2OE2A 2GZHA 1KKMA 3VTKA 5CJPA 2FEOA 2YYZA 1Z28A 1F2TB 6Q21A 3A1SA 1CJVC 1EESA 3GJ8A 2D3WA 2D62A 3T1QA 2WBLC 4AD8A 3B13B 2G6BA 2GKSA 2MSCB 4M1TA 3ZVLA 1U8AA 3C5CA 3TSOA 1I2DA 1G18A 2ZI6A 3AB3A 4JL5A 4ACAA 2O8BA 1Q0UA 4RSGA 2REBA 2QTVB 5A4JA 4WIAA 2A5JA 5BXQC 3LBNA 2ZJZA 5M04A 3SYLA 1NVUQ 1KI1A 3P32A 3QBVA 3U3JA 2HCBA 2QE7D 3FYHA 5AJZA 2KJQA 4HAYA 4JVNA 5D3MA 2JASA 3FOZA 3SFVA 2QRNA 1Z08A 4IDHA 2ZYTX 3GEHA 4ZDKA 1Z07A 5LB2A 3W90A 2REXB 2WJVA 2DYKA 3AP3A 5CK5A 4PHTA 3L82B 1T3HA 3OE7A 4TQ9A 1JR3D 4A0HA 4O2LA 3QKRB 1E9RA 3BIFA 1QHHA 1XJCA 2PEYA 5AJYA 5C4MA 3GLHB 1IJFA 2Q3FA 1G41A 4MUAA 5L3QA 1OSNA 1VYUA 5FOVA 3LDAA 1P7CA 4DC9A 1EFTA 1YE8A 1GIAA 3WY9A 4JLJA 5DI9A 3T5GA 2WJJA 2GJ9A 1AK2A 2OFWA 4FINA 1NVVR 1F6BA 1WQ1R 2H16A 2G0NA 2GF0A 3RS3A 3HU3A 1E9AA 1EFHA 1DAMA 1SKYB 1GNQA 4BWYA 1KNQA 2J46A 3FKSA 5FUXA 1XB2A 2VP4A 4NL4H 5J4LA 4LYHA 3WNCA 2O0HA 3UANA 2R6GA 3IDQA 4NCJA 4OL0A 4C0BA 1G5RA 1Z6XA 3P20A 1QVRA 4LJ8A 2A2ZA 1NLYA 2ZSAA 1OT3A 4XVRA 1R0XA 3Q8XB 3PIRA 3K09A 5EXTA 3RC8A 2AKYA 3DM9B 4LBYA 3D6TB 3W8NA 4M9SA 1G291 4C3ZA 2BMDA 3K0CC 2ERYA 3VHLB 2QGZA 3KKPA 4QJ5A 1YJ5A 3HPQA 2G77B 1Z83A 4M1YA 2DHRA 4DSUA 5EE9A 3BGWA 5B64A 4BFUA 5EZ5A 4IOMA 5E4FA 4HAXA 1XMSA 1EFRD 2IEZA 3IUYA 1HUQA 2V8OA 4NDZA 4QHTA 3WYGA 4BASA 1LTQA 4B34A 4NKRA 4M9ZA 5AUNB 3I62A 3NBFA 1R0WA 3KX2A 2CHGA 4PC6A 3EXAA 4C7OA 1Z5ZA 5JEEA 4DLTA 3GLIE 3GLFE 2IK8A 5F9HA 3B1VA 4MYTA 3THOA 1BYIA 4BFZA 3NBZC 3U7HB 2IT1A 1JPJA 1TTTA 1XNJA 3PVSA 2CEAA 4BFSA 3F5FA 2AN9A 4A2WA 3RANA 2JLYA 2KI5A 2R2AA 2OILA 2CNWD 2WZQA 4DEXA 1Y63A 3B9QA 2ECKA 1US8A 1S96A 4QBFA 1XEXA 4JLBA 3FHOA 1AZSC 4L15A 4A8JC 5FH9A 1ZM9A 3TQCA 2B6HA 1R7RA 2QM8A 5EE3A 1BMFD 2IW3A 2ZJOA 4TSFD 4W7SA 4AYXA 1P9RA 2C9YA 4CRWB 4TYYA 5K8UA 1G16A 3Q3JB 1T3LA 1PUIA 2BDTA 3AP1A 3B1WA 3THXA 3IO3A 3EASA 1AS2A 1K5DA 5EP3A 3WXMA 4HZIA 2P67A 1KJWA 3AVOA 1E1QA 1NP6A 1IOZA 1TF2A 3F3YA 3PR1A 4RVCA 1QHNA 1HA3A 4GZLA 1KI4A 5FPTA 2ASEA 2L0XA 2BMFA 4LZZA 2W0MA 1AGRA 3QPVA 3KQNA 5DH9A 1H8ED 2Q6TA 4TMWA 4URYR 3DPUA 1NY5A 4LPKA 4QJ4A 3K9HA 5JWHA 4NYJQ 1A7JA 3U44A 2PEZA 2W2XA 2JLWA 3BWDD 4XVQA 4C0HA 4GFDA 3AQ4A 2XB4A 4Q7LA 1OV4A 1GFIA 3CX8A 3HP1A 2HXYA 3ASYA 1A1VA 2D74A 3TH5A 4EPRA 3VU9B 1BO6A 1FUUA 2J0UA 4EIWA 3MSXA 4A1FA 3U3KA 3ZLJA 1E2NA 4AK9A 2CHVA 1XMVA 3FGNA 5CDFE 5CLLA 2ZXUA 1W36C 4POAA 1OB5A 3UK6A 4IOKA 2BCGY 1CULC 1SXJB 5L3SA 2XX3A 2YJTD 4Q4AA 1GRNA 1JAIA 2CDNA 2FSIA 3SNHA 1E9BA 1FX0A 2GJSA 2ATXA 2GCOB 4LOAA 5H1YA 4B75A 2ZI9A 1CKEA 2Y8EA 1RZ3A 4MUBA 2RKOA 1OH6A 3EIQA 4MKGA 4GPTA 4PSVA 3UG6A 4HLCA 1KY3A 4KFUA 4FWIB 4Q4HB 5JHGB 4B2PA 1CBUA 3DZDA 2J7PD 4Q03A 4PR0A 2BM1A 4H1VA 4FN5A 4BFTA 3QF4A 1UKEA 3BH6A 1C1YA 1FTNA 3GP8A 2FMXA 1E6CA 4W5WA 2ZJ8A 1ZNZA 4KVAA 1FNMA 1MO5A 1JEDA 3C14C 2VSOA 4OKSA 3ZVNA 5UKDA 2IYUA 1T0HB 2OCPA 721PA 1XRJA 5IK2A 3K9NA 1E2FA 4EFNA 1G3QA 3HYTA 2GCOA 2BHRA 2PJZA 2HLDA 2VSFA 3GJ7A 4ZDWA 3AUYA 5K8TA 2DFKB 3NKVA 2V6IA 2RGNA 4IXMA 5EUQB 5FOWA 4B43A 1NSTA 2P65A 3RRZA 1KY2A 2WHXA 1G21E 2Z5FA 4JKYA 4HZUB 5CLQA 3WYAA 1RC8A 1IQPA 1YZLA 2FFBA 2WKQA 5FTLA 4Z8YA 2BBOA 4JMPA 4B33A 1D8TA 1HT1E 2HJVA 1II0A 1JI0A 1TF5A 2JAQA 4LJ4A 4PC1A 5AJWA 4RY2A 1BOFA 3FE2A 1XPUA 4TWZA 3K0FB 3GJ0A 3U4QA 3GLHE 5EXPA 1E99A 4CT4B 4HATA 4ZCIA 2Q9CA 4GMXA 5FTJA 3CH4B 4KAXA 4LC1A 3A4NA 4B71A 4QRHA 2JLSA 2UZIR 4CDGA 5LD2C 1T6NA 1YZKA 3THWA 2XNDA 1E0AA 4LSGA 4LGMA 1N0WA 4DB4A 4YMUA 1SKYE 3MWKA 1P9WA 1JJVA 1VDZA 3TUZC 3B9PA 4PQYA 3WHKA 2OCBA 4B3GA 1T5LA 2D4HA 2AHOA 4AI6A 4TL9A 4RZUA 5IF9A 3IPYA 3BB4A 2O8FA 2QG6A 3A58B 4KITB 3NBYC 2ZEJA 3JVUA 1EWRA 3U6BA 3P1JA 1N3BA 2RGDA 3ZH9B 1WP9A 3FFAA 1H65A 3MWLA 3PUWA 3RAPR 4C4PA 4KFSA 3TW4A 3N70A 2QI9C 1KMHA 4DUGA 2G1JA 4IEEA 1EG7A 4CF7A 5HTKA 2NZJA 5DN6D 4DLWA 2FG5A 3REGA 1XEFA 2C04A 3REFA 5K8LA 3T15A 2YKGA 1TU3A 1RRPA 1UBCA 2Z83A 1SVSA 5B30A 1UAAA 1J90A 2PX0A 1G3MA 3MLEA 1G5PA 2VIIA 3VKHA 4ARZA 2BEKA 4JLNA 2C9CA 3Q7QA 3Q7PA 4BFVA 2ANBA 4WVFA 2HF8A 2R6FA 2QEQA 2ONKA 1CXZA 1QBKC 4GZMA 5FI0B 4DRZA 4ZI3A 4PZZA 1ZUIA 5CIWA 2C03A 4AKGA 4M9XA 4OI0A 2IUSA 3S1AB 3SHFA 2C98A 2PZGA 3VNUA 1GRRA 1VHLA 3A4MA 4LBZA 2D06A 3KJGA 5KSYA 1YVDA 3T1VA 2R65A 1NVXQ 3PEVA 4BEJA 3TUJC 4A4DA 2OG2A 2ZQ5A 1ZVQA 5GVRA 3L0PA 1HE8B 1M34E 1GKYA 1R5OA 5CIQA 2OFXA 5E7IA 2J3EA 1XTSA 5FR1A 2XXAB 1KJYA 5LBIA 1MABA 4RFSA 1KZ7B 2H18A 5IT5A 3BH7A 2RGGA 4DCUA 1LNZA 4V0LA 1EFCA 4FCWA 1GL9B 1DAFA 1KOFA 1KSFX 1ZAKA 4KU4A 5BN5A 5FBVB 3NDBB 2AXNA 2ZYUX 4UNQA 3Q9LA 1JECA 3BRWD 1KNXA 4UXJA 4KVGA 4DJTA 3DMNA 1Z63A 4S35A 3FHTA 1DAEA 2W6JD 2JDIA 2ZITA 2WV9A 1J8YF 2UKDA 2QE7A 4HAUA 4MGIR 5HKKD 2BV3A 2QNRA 5GJVC 3OZXA 2WVJA 1QVAA 4BLPA 4DVGA 4ITRC 4QG7A 3H0KA 5CB8A 1NVVQ 3PEYA 2FSHA 2OV2A 1DADA 2OLJA 1DAIA 5FOSA 3SJCA 5JECA 1MRNA 2JLQA 1QDEA 4L4UA 4M0LA 2HDNB 2IYRA 3P4XA 3AKCA 3R9XA 1XMJA 4CEJA 2V1UA 1CJTC 1JR3A 3AF0A 2NGRA 5FOXA 3MRSA 1SXJE 1CIPA 4DXAA 1GM5A 1VIYA 4GNKA 3IKJA 4LYJA 3KQKA 4Y0AA 3W6OA 1A2BA 4B48A 2P5SA 4B3BA 3VMFA 3QUSA 4UKDA 1NJGA 1XD2A 2QTHA 4M53A 4B74A 4CEIA 4KHZA 2ORIA 2ZS7A 4EPTA 4F4JA 4AKHA 2ZS9A 5GJBA 4A0GA 2MMGA 4H1UA 3BH0A 4QM7A 2GEDA 1XJ0A 3GFPA 1KI3A 2AKAB 1NBME 3QG1A 1UADA 1UPTA 1DO2A 1SGWA 3AVWA 2HYDA 1KGDA 5FL7D 3IQWA 4DBLC 4F91B 4M1SA 3ETLA 3KJEA 1M74A 1OYYA 3GQBA 1DAGA 1VHTA 4FD2A 4JLVA 1VYVA 1MH1A 3GJ6A 3L2OB 4C0LA 2H92A 1UEJA 1EWQA 1XDBA 3TRFA 1OPXA 1E2GA 3BOSA 3U7GA 1QG4A 2AWOA 2ZSFA 2Z4RA 2OBMA 2AK3A 5BQ5A 3HU2A 2VHUA 5JRJA 3X2SA 1EFRA 1SKQA 2B8TA 2X8AA 1G4AE 4UJ3A 1PJRA 2VP9A 2JLRA 5C2JB 1FTSA 1TQ4A 1GG2A 4PPQA 4YMTA 3IBYA 2F1IA 1Z0IA 2WJIA 1KAGA 1DELA 4I1SA 5J40A 4BZQA 4MRVA 4LRWA 1YZUA 4GBMA 3R7WA 1BYUA 2A5GA 4ABYA 4M1WA 2BEJA 3VR4A 3GLGB 4BZPA 5KTYA 4DLYA 4CEHB 4PC7A 2W58A 3I32A 4XTCS 5FTMA 4LJYA 3AVXA 1OXVA 3U3RA 1BMFA 3U6KA 2FPLA 4TSFA 1XTJA 1Z2CA 2VHJA 2X1VA 2ZE5A 1X3SA 1FZQA 4OHYA 1UDXA 5TVKA 4MRNA 5CJ2A 1G8HA 2ODEA 4D0GA 1TNDA 1KK0A 1WBDA 2QY9A 4LV5B 5JEDA 4MQBA 2CCGA 4WZ6A 3G82C 5DI3B 3LXRA 5F2EA 2RH5A 4NTZA 3FMPB 3Q85A 4DEYA 3THYA 5A0FA 3ICEA 3TE6A 3EPKA 2WWGA 4TYPA 2D2FA 3IIKA 1Q22A 4L8GA 3BS4A 4ZIRA 4D2IA 2IWRA 4C0AC 4Q7KA 4EFMA 1H8EA 4UNPA 2XTMA 2WSSD 4EPXA 4KSCA 3A4LA 4KFTA 1F60A 1RYFA 1WMSA 2KB0A 2J0VA 1FL9A 1A2KC 5F98A 1A5TA 1G64A 4QBHA 2FN4A 1FMLA 1LVGA 3C15C 1DO0A 2QPOA 3A36A 1OH8A 1Z6GA 3TAUA 2VSXA 2GNOA 3DMDA 1Q3HA 2C96A 1AQUA 3KKOA 4HB0A 4PQFA 4TQAA 4D4MA 1NIPA 4ZPXA 4AY2A 1Z3IX 5JS7A 1QF9A 1YHNA 2QP9X 1XPRA 5JJKA 3LH5A 2DB3A 4OYHA 3WP0A 1KI6B 4D4KA 1OFHA 2A30A 4QGFA 1PV4A 1XD9A 3A8TA 5E7MA 1X6VA 3C5HA 2OLKA 3QVVA 3TMKA 1OHHA 3GJ5A 4OI4A 5B2ZA 3RC3A 1E1RD 3CB4A 1W7AA 4JVSB 1V5WA 1WB9A 2HUPA 3EC1A 1OE0A 4ON9A 2EFHB 2OCYC 1FMJA 2FZLA 3U5ZB 1W49A 1N6RA 4PFSA 5F9FA 3A1TA 1ZC4A 1NY6A 1HE1C 1ZIOA 2BBTA 3BORA 2F9MA 2BWJA 1P2UA 2H17A 2PZFA 4NMMA 3ZD6A 3X1DA 4D81A 3SYNA 2J7PA 2C5LA 2NQ2C 2RB4A 3PUYA 5FBWB 1SHZA 2GBLC 2YOHA 1II8B 3KXKA 1VG8A 3O8DA 3OFND 3ONWA 1ZRHA 3NH6A 2HJGA 1S8FA 1IM2A 1BKDR 5EE1A 4M21A 2VL7A 2QL6A 4JJZA 1RKBA 3TSZA 3NHAA 4W5JA 1G7CA 3GFOA 4TL6A 4OHWA 4QGGA 1N5JA 1UDWA 3EPHA 2W00A 4KCGA 4QGHA 3RVBA 3QXCA 1Q1BA 1U0LA 4KXFB 4JYBA 3TK1A 1RE0A 1GSIA 2JJ2D 5KU1A 3DHWC 3R8CA 1U90A 4Q1BA 4KLZA 3N2IA 3UMFA
chains in the Genus database with same CATH superfamily
4RZ3A 1WO8A 3MWGA 4P83A 5FAXA 3UW3A 4RA9B 5KQRA 1RLJA 2WI8A 3H2GA 3R40A 1ZD5A 4I1IA 3EPRA 4Y6LA 3ZHQA 1X8KA 1TCUA 2BCEA 1E89A 2FMTA 1D1TA 4DIUA 4YT4A 4DR7B 1ZGJA 3ABIA 5JUWA 2CLDX 3K1AB 4XSHA 3IFSA 3ORRA 5KVAA 5JVDA 3R1IA 5ALTA 3EARA 1IXSB 1NUSA 2CYBA 5KKCA 3DKIA 3TW0A 2ID8A 1T3SA 3R3WA 5EJIA 4EY8A 3TEFA 3TVTA 2FV8A 4Q1AA 5TY0A 1KJZA 1QIEA 4FYWA 1Q7CA 1KVQA 3FZNA 2ZVPX 1Z5NA 3AGQA 1JG6A 2IPNA 3N3AC 2VI5A 4KRGA 3KB8A 4E2YA 1XHFA 4V39A 4YNBA 3DHEA 3GA7A 4DQKA 1AB6A 3RUCA 3EZ7A 3JZAA 5A3SA 4IEFB 2DHDA 5JSKA 1LRJA 1OWOA 1TU4A 1E32A 3CUWA 4MCJA 1EIZA 3OEYA 1SUBA 1NXXA 2OCGA 4RVHA 3KAPA 1TH4A 2DAMA 3Q9SA 3ZV3A 4LOJA 3UHOA 1C0KA 4WBSA 1SCDA 2GRJA 1UJMA 4JDUA 1YJBA 3BC1A 1UC8A 4HV4A 3G8BA 3G6KA 4BE4A 2YIVX 3DOHA 4NJMA 4F4CA 2GS9A 5ITXE 4MQ5A 3LC0A 5F5XA 3HYSA 2RCNA 5JASA 1KMNA 1NKVA 3O9MA 1X1EA 2FMIA 1AHIA 2WTEA 1T2EA 5NULA 2EQAA 5EJEA 3MWJA 2WP8J 3VV3A 4E0BA 1B26A 3Q15C 3D5QA 4XPIA 3A6GA 4OQYA 3GZ4A 2GETA 4IMIB 4XIYA 3OPQA 3P9KA 5EUMA 5I9MA 3PQ4A 5IJZA 4D57A 4QYIB 1OI7A 2GF2A 3K9FC 1D4ZA 1IBRA 4J0FA 1Y6ZA 4GQIA 2DZDA 3PRJA 1O1YA 3VKUA 1KA9H 1XAIA 3CHYA 3H5AA 3MN1A 2QGFA 3GVXA 1ISMA 3L7JA 1B93A 2V4MA 1IUPA 4KO8A 5D6NA 4FYXA 1R5BA 1T9HA 5KDDA 3V4FA 1XXHE 2AJTA 3N0RA 3BRQA 3EXFB 3MUFA 4O2BB 4X6XA 4TN5A 3IE0A 2WSFF 1IC6A 1QUSA 1XQ1A 2ZRCA 3QYPA 3IE2A 4MDHA 1LPPA 2A92A 3T9FA 1EBBA 1TYEB 4X84A 1NVBA 3BWMA 1TCVA 4R7TA 1G8YA 2JP7A 4LRXA 1TC2A 1HT2E 3Q3EA 4RSHA 3SS7X 2GM3A 3M49A 4YT5A 3SOPA 4KDFA 3C4VA 4G67A 1VJCA 4HGRA 4Q5IA 2Z5GA 4JSTA 3M5WA 3U0BA 3Q8LA 2VDVE 1ECLA 3COJA 3CO0S 4FXPA 5FA8A 1E2PA 2EARA 4KXNA 3P0RA 4G84A 5EZ6B 2WJWA 4QTZA 5IRCD 4D5EA 2YJNA 4CGZA 3FA2A 2C4NA 1Q19A 4FWDA 3HG7A 2GSWA 4FHFA 3LC1O 4KRYA 1IYZA 4QO8A 4OHFA 2ZBRA 4GI5A 2ZW9A 4NXNM 4Q4CA 2HF2A 4TKMA 5LP6F 4E14A 2HQ1A 5LC1A 4O4JA 2VZ8A 4L76A 3E2IA 3S2ZA 2CJFA 4ZEXA 5AKLA 1YH3A 2GPSA 1AQYA 5CDYA 1QR6A 2EVWX 1MDFA 5JQGF 2P5TA 2LD4A 1VB3A 3FVQA 4FYJA 1UKBA 4MR9A 2IBMA 3WB2A 2GJ4A 2B1JA 2PMDA 2FFAA 3KO8A 5LQNA 1AG9A 5CDHA 3VVBA 2XYGA 3KQHA 13PKA 2APLA 1EEHA 2W71A 3FPKA 3VYWA 4Y2HA 3O1LA 3M6UA 4FFOA 2Y27A 4M1QA 3VSDA 1EYZA 4PXSA 1WGLA 1DAKA 2D0PB 3EA0A 3RABA 5JCXA 3URMA 1IOWA 1TMYA 4IIJA 2A0UA 4E46A 5ALLA 2H1LA 3FLEA 1HV8A 1P1KA 2EATA 2VDNB 3KQSA 4JJKA 1EU1A 3W8DA 2OXCA 3OPYI 3WB0A 5ABPA 3QENA 4UFOA 4HK4A 4CZ2A 4TYWA 1L5MA 3MCVA 1KHHA 4G0YA 4TYQA 2EFDB 5BNIA 4DLLA 3L9WA 2PBZA 4X92A 1Z13A 5JNSA 1PDOA 5F2OA 4NPCA 5HTOA 4KBYA 5E6JA 3AY7A 4GSKA 2WIGA 4MW4A 4FCVA 5AVTA 3ABSB 5BVHA 2YYSA 2QPTA 2DFLA 1N25A 1LK5A 1BJTA 4HDOB 3HNPA 3SBXA 1L0BA 2W2VA 5E3HA 2H52A 3GUCA 1HNZM 4OK3A 1TPZA 1ZBDA 1MC1A 5FSWA 3C3XA 4K9MA 2PIDA 3ABOB 2TSYB 1MV8A 1NPTO 2OYSA 3LX5A 2DZNB 5D84A 4P7KA 3ZE2B 2VPYA 3FB1A 4IDOA 1TZKA 3ZNPA 1P2VA 4F0JA 1HZJA 2MCFA 3HKPA 2D54A 4HTFA 1EVZA 4QQKA 4QYMA 1FBNA 2ZWOA 1QC5B 2AFHE 2GZRA 2NM0A 4C0KA 3DV9A 2VBIA 2XV1A 2GTPA 1AT1A 1BW9B 1A0OA 2HU7A 2X15A 4OYLA 1L8LA 4J3NA 1UMCA 1AD2A 4NBTA 4AZVA 2ZDHA 4JQCA 3EDYA 2NZXA 3PITA 4ALNA 3FUXA 3C39A 1TEHA 1CUKA 4PZ0A 5JO9A 3RK4A 4LCJA 3LPDA 3P2YA 4FZRA 4GMKA 1MG5A 2NO1A 4IJUA 3ZE0B 3MA0A 4K8RB 2C82A 3I9NA 2JLZA 4MW7A 4EWLA 2WT4A 2XUPA 5BW6B 4TS9A 1RRFA 5G3YA 4HDKB 1QTNA 1TM4E 4NBLA 3AK4A 3BVPA 5G40A 4JROA 4DR2B 4OUDB 5TGDA 2A9RA 1QQTA 3I05A 1XVVA 4IVPA 2IYZA 1CZUA 2ONJA 2C99A 5BSKA 4KN5A 4QFMA 3TWLA 1AUPA 1FXSA 5J9FA 3NX4A 5DMXA 4MVWA 3OQHA 5EG5A 4HN4B 1GFZA 2H31A 4PCUA 4O8CA 5EQTA 1FU8A 3RS8A 1T91A 1FRFS 4TTQA 4LHZA 2I3GA 1MRSA 4UHFA 3IBTA 1N34B 1Q74A 3SK0A 4N7RA 5K03A 2WJ6A 3SQXA 2EZ4A 4XASA 3DE5X 4M7PA 2A0XA 3DO6A 1Z59A 1PN3A 1S9DA 5DBHX 1AKEA 3L8MA 1IXRC 3B82A 5BN3B 1QFMA 1W6RA 3H1AA 3UMJA 1ZNWA 2AG6A 3LT0A 1C7ZA 4YIHA 1M7HA 4JI6B 2VTKA 2ZRMA 2Q4OA 3RKSA 1UPFA 3GDFA 4ZQFA 3K4PA 2WUEA 3AUFA 3PLAE 2VXYA 3V9AA 3W8EA 3ZV7A 3E1KA 4LJ7A 1E2KA 2HL6A 1FSZA 4HFJA 1JAHA 5DSTA 1NG9A 3AHFA 4RMHA 4X5OA 4JP3A 1KSJA 3QW2A 1R6UA 1DFHA 1A69A 3GYBA 2DH5A 1T15A 4AT1A 1FFAA 4AZTA 1G6HA 2ERXA 5A3RA 2OFPA 1B14A 1IHDA 1KDRA 1SA0B 3K2BA 3WLQA 2GM4A 2YJ5A 2GYWA 1TAGA 3NAQA 2WU8A 4MULA 3AVUA 4DCMA 5K0TA 1TM7E 1C0EA 4LSMA 3OKFA 2J1LA 2RMKA 4ZWNA 1RE1A 5G4LA 3KZXA 4GKKM 2J4CA 2DKOA 2ZAGA 5DHSA 4UFPA 1W25A 2WKPA 4X8OA 1GRCA 4S0ZA 2L17A 4K0RA 3VNSA 5ITZB 2XB6A 2EOAA 4KHPB 3OICA 5TMBA 4URZR 4Z9YA 3DBVO 4OHPA 4TZ6A 3RK1A 2VRBA 4JS0A 3UHJA 3QXGA 3CF0A 3C3DA 3FOBA 3R3ZA 5BN4A 1T8UA 3NM6B 4Z9FA 2Q49A 3S1AA 4AL4A 4EQ6B 5IZ7D 3JWHA 3EGDB 1ZMUA 4NFHA 4TLEA 3PQDA 2ZRHA 4ZOAA 4H4DA 2D1SA 5GY7A 3T0GA 4OVZB 3SHQA 3CRVA 2X77A 2XLCA 3VRHA 5H9WA 2O7NA 3B85A 4DS3A 2QUKA 2VSNA 4DQLA 3T6PA 2WIAA 3SBOA 3BAFA 2LCQA 4BU0A 5BPVA 3IA7A 1G8KA 2I6UA 3HZZA 3KVVA 5JS6A 3IURA 2X86A 4PG8A 1QZZA 2GILA 2A3NA 5BORA 5DLQC 3PSHA 4TQGA 3C3BA 1QH9A 3BMOB 4UD6A 3P45A 4F4UA 4WMLA 2IITA 2OXFA 4B35A 5JJCA 1PUJA 2BF4A 4FMCF 1G7SA 3BD7A 2PD3A 2XH8A 3JQRA 1MTZA 2IYXA 4JI2B 2ZRQA 4EO4A 2R4JA 4IBJA 1ZIYA 2QMEA 4CTOA 3NV9A 1DWQA 3U13A 3VH1A 4NCBA 1MA0A 4S1NA 3SDSA 5B7QA 3OX2A 5LNK6 3R6LA 3BCRA 4KYTA 4E11A 4MGYR 1SHJA 1TYAE 4D9HA 3OESA 1Q0HA 3CTWB 3PQ5A 4CDMA 4EX7A 5H83A 2D2VA 4R3WA 4JP5A 3RFUA 3KKLA 5BSTA 3PUHA 1C1XB 4IIJF 2QVYX 1J06A 4DMFA 4RHCA 2MSEB 2QAJA 1CVRA 4IJKA 5DSZA 1AUAA 1W87A 3K30A 4BFCA 2XUAA 3KB2A 3L84A 3O90A 1UZMA 3O38A 3C6XA 3HWX1 5D86A 1GGNA 2GHRA 4KIWA 2Y0BA 1I7PA 4YAOA 4O4LB 4JJ4A 4QU9A 3OM0A 2E4ZA 3QJGA 2NZYA 4B7CA 4TL8A 4BFYA 5FI5A 2PCJA 3LDGA 1ZAEA 4IIBA 2P3LA 1SHLA 1JSLA 2GN4A 1UT8A 1JXQA 3KUKA 1PR5A 1RAAA 4UM9D 3WK7A 5G53C 6Q21A 1R27A 3U9SA 5IP5A 2D62A 2GKSA 2FETA 4M1TA 4W5TA 4JI4B 4Z4QA 5A4JA 3HZJA 3O4JA 3MK6A 2IUYA 5FFFA 5FJJA 3PFFA 2Q3LA 3T94A 1K7EB 1FS5A 5E1DA 3TJRA 3EUEA 5LB2A 2R5NA 4UCFA 3RKRA 2B8EA 5BSGA 3QKRB 1XJCA 1KYXA 3BMQB 1UJ4A 1EFTA 1CVLA 1J8DA 5DM70 2H16A 4RE6A 1YGPA 3FZEA 4C0BA 1VE3A 2D0DA 1Z6XA 2XEPA 4E5NA 2ZSAA 4MHTA 3OEWA 4NBWA 2AKYA 5LBTA 1YJ5A 1X0VA 5EE9A 1NYQA 2I4OA 3KP0E 1U7PA 2FN9A 1RU3A 1R00A 4DLTA 2LP4Y 3NBZC 4WK6A 2ENUA 4W7HA 4NZ9A 4BJ6A 2AN9A 3RANA 2FOIC 2KI5A 5CDSA 4QBFA 4LA4A 5HMLA 4EEXA 2X4IA 1VYHA 2R7LA 4TYYA 3Q3JB 5HYVA 4YLEA 3WFIA 4GZLA 4YWJA 4C0WA 3SX0A 4DJ5X 3QPVA 5KJCA 1DUVG 4QJ4A 5MN5A 4N0MA 2PEZA 2RBEA 3ASYA 3TH5A 5GM2A 1SBQA 5JTUA 3JZDA 2VK1A 2XWSA 5AI8A 3U3KA 3VPAA 2FPUA 3ZDZB 3A3OA 4B4WA 1W36C 4POAA 4X3OA 4L6AA 2O25A 3IOEA 1WV1A 2YMPA 6LDHA 3HUDA 3KVOA 4MVCA 4LE2A 1YJAA 1Z7BA 3PCTA 4COOA 5EPUA 4R2JA 1JEDA 4N5MA 4R9VA 4KP7A 1YJXA 1GJSA 2DC1A 5IK2A 4DSZA 4XJSA 1RAGA 4RK4A 2RHJA 2Q46A 4C4ZA 1DXYA 4C7KA 2P4EA 4IXMA 2I91A 1P33A 2WHXA 1YZLA 4B33A 3R7LA 1VLVA 2UXDB 3NBQA 5MGNA 4QOHA 5KAPA 2D8MA 4FVMA 3QU7A 4QYIA 2JLSA 2OBXA 4K9DA 4AMBA 4BB6A 3D8RA 3G8AA 1T5LA 2D4HA 4BQNA 1USGA 2FSVC 2O6HA 3IBFA 5F78A 3P1JA 2QUHA 3DZBA 5KTKA 2AJCA 3RAPR 4KFSA 1N36B 2QI9C 3H4JA 1WKVA 2J5YA 1B0AA 4HHEA 2ZYIA 4D46A 5DOVA 1AGXA 1VPTA 5B4TA 3O1JC 2QD3A 4R1UA 1N9KA 2R6FA 4NRDA 3UAGA 1QBKC 5DTIA 3EXFA 4O2BA 2JK1A 1IUNA 3SHFA 3VNUA 4J1TA 5IH3A 3KU4A 1MJHA 4EHHA 2CB0A 1LJ8A 3O3OB 4W5NA 1XTSA 1TO6A 2YVQA 4GLOA 4JI5M 1GL9B 4MARA 4WY8A 3KOWE 2G09A 3RV3A 3LKBA 3NEPX 4IPTA 1UINA 2EP7A 5JZSA 3TSCA 2YFQA 3QU9A 2UKDA 2XBUA 1NXVA 5M3BA 3OZXA 4CKWB 5KWJA 4Y2GA 3ZWCA 2WRZA 5T8KC 4IBFA 1ADGA 3TINA 1PJTA 1SXJE 3IKJA 4NX2A 4ALJA 2HREA 1QDUA 2ORIA 2RAUA 2ZS9A 3A6LA 3ZHYA 4S0XA 3C5WP 4JGGA 4G81A 1VHTA 4JUCA 2Y0EA 4HXEB 5AW2A 1QU2A 4FZ5A 1OPXA 2Y6VA 4PYKA 1QG4A 1SQFA 2H1WA 2BE7A 4M6WB 5SY6A 4IIVA 5JRJA 1ZV1A 4M60A 2JLRA 4IH1A 5J2TB 2BMWA 2ZYDA 4RY8A 1MAHA 2EJBA 4IJQA 3W05A 4DC1A 1SHTX 2WTBA 2A5GA 3VJLA 1H0HA 1PWYE 4WXEA 4HR7A 2WUVA 1P0CA 5CJ2A 1R5JA 1LLDA 1WBDA 4UTXA 1QV7A 2QL9A 4WZ6A 5AW1A 2RI6A 4WFQA 4CFYA 4AZ3B 2X3FA 2WWGA 1PWXA 3IX7A 1L5FA 4KOEC 1H8EA 2WG0A 1JQKA 4WK2B 2ZIXB 3BREA 2IIPA 3K0KA 4G4RA 1LVGA 3O21A 2ZTVA 4BBPA 4IZOA 4PQFA 4E15A 3GUYA 3WIUA 2G8LA 2W6OA 5DPMA 3K5HA 1G8AA 5C5DA 3GJ5A 4JI3B 1WB9A 1XZKA 4ZV9A 2FZLA 2PYZA 3W6ZA 3HHZA 5F9FA 1ZC4A 1WIWA 4F72A 2F9MA 2FTKE 4EF6A 4XK8F 1OLXB 4BCDA 3X1DA 2FKAA 4FD3A 2RB4A 2DFVA 4GPBA 3WLNA 2LUOA 1SHZA 1O5OA 4MUHA 1BNCA 1ZRHA 4UMVA 2AX3A 5EE1A 5JIBA 2LH0A 4MWZA 2G5CA 1EHCA 1ODSA 5AO9A 5IKMA 5IREB 3BF7A 3CE6A 2ORED 2EEZA 4RWZA 1P29A 1ZRSA 2JH8A 3KEOA 3HY5A 1X94A 2F5QA 5C7OO 3JQDA 4AM8A 4PYJA 3G2JA 1L5GB 4XGQA 4MGZE 2WPDA 4UTOA 3BXXA 2V7QD 1A9ZA 3BAZA 3COWA 1Y48E 5DGDA 3I4YA 2MYUA 2I3AA 2OHOA 5CK4A 2II6A 4LVCA 3DUFB 4EP1A 2C5HA 1KIAA 2EQBA 3HY3A 3ROFA 1ZYUA 1FDUA 5CAEB 2PKYX 5EIXA 2B7CA 1KS9A 4ZYTA 2CXUA 3LY7A 4LY0A 1YE9A 4ZQIA 1RP1A 3CH5A 2DTXA 4Q3NA 1C0LA 5K45A 3A1EA 4M0FA 4H3SA 4WZBE 4RQAA 4JIGA 2J0SA 3EFHA 3L1VA 2LCFA 5T4BA 4N8EA 4A15A 1V9LA 4C07A 2GVZC 3OBBA 4MP3A 4MVJI 1I2AA 2VDMB 3J7TA 3R3VA 3I58A 3ZLVA 4NP6A 1FLNA 3SIRA 1QC5A 4FE4A 3BZBA 1R6TA 5TQ2B 2HSWA 3V2UA 2M6KA 4V0OA 4DQDA 2B4AA 1BW9A 2CNDA 4CJ6A 3E9CA 1DMRA 1ZMOA 1VA4A 5KKNB 1Z0KA 3DONA 3DB2A 4OGGA 3NCTA 1UP4A 2LTUA 2GAAA 4WE3A 4ZVTA 1XTBA 2D59A 3T35A 1TR8A 3MRXA 1BHO1 1EZ1A 1E94E 1Z6YA 3PE3A 4HDMB 1OXSC 2VP2A 1LCIA 1OBOA 4F8YA 1DOZA 1XRSB 5IWAB 2DAGA 4CLDA 3LPNA 4DIBA 4HDKA 2WSEF 3B60A 1K9SA 3IPCA 3IP7A 3GWZA 1Z0SA 4OUDA 1VCIA 2F5PA 5HZKA 5C53B 3A9CA 1YDEA 4WPGA 1U4OA 1ETHA 2CFCA 2PMBA 3S2YA 4I46A 1VL5A 3JZMA 5FL3A 1Z4PX 2CL6X 1IEWA 2E5LB 2YX1A 4FYHA 3ESBA 4G4GA 2FSVA 2B9VA 1KDOA 3AHJA 4MRAA 3ONFA 1FEZA 1XWWA 3QLVC 3RTGA 1ZK0A 4OH1A 5KCMA 2XGMA 2FCAA 4YFVA 4IIDA 3OLZA 2IE0A 3QFTA 4NBSA 2FP4B 3BL6A 3M7GA 1NL3A 2P0EA 3W5DA 2EBUA 3N2EA 3KSMA 4EABA 1KF0A 2D13A 4L5JA 2IIQA 2BEUB 4ZEWA 2PGDA 4BUZA 2JJ1A 1I94M 3LVVA 5BN3A 3OC0A 1S2NA 2GHQA 3L1HA 4I4IA 4LWQA 2FSFA 3OQOA 4F8EA 2EJVA 3H9QA 2X0RA 2DECA 1EA7A 2WVHA 4EB3A 3AUTA 4RKYA 1ORTA 4CVNA 4RLFA 3KZ1E 4U2CA 2P4QA 4UHEA 1B16A 1EX9A 1L4FA 4RVFA 1QH1A 3KOXE 4OAOA 5T8KA 3O47A 3V4ZA 3TCXB 3OETA 4HMOA 3P4UA 3K9BA 2ZJ5A 4W9RA 3UGQA 4W9NC 3WMEA 2A86A 4JYPA 1Q50A 1SM4A 1ZEMA 4PG7A 2BRUA 3NO4A 1SA0A 5KX5B 2B4RO 1DEKA 1S8AA 3UK1A 1U98A 3E84A 3LNCA 2VBGA 1I24A 5TJ9A 2C97A 1NNLA 3OE7D 5K0FA 1SVKA 3QHPA 5K3OA 4GRAA 2KSQA 2JFYA 2HBRA 3I2GA 3F67A 1IBLM 4TTJA 5IASA 5IBCA 2YOGA 4EYKA 4PHFA 1MTOA 3VR6H 1Q7RA 3RHFA 3OY2A 3IQEA 4NS4A 4CYMA 1GCAA 4R2HA 5CURA 3AVTA 1IZYA 1YAHA 3LZ6A 3WGGA 4GR5A 5DM4A 3UXYA 5ITZA 5FHRA 1HQKA 3ZWNA 5KNCA 1RXSA 5CW2A 3U19A 3KEFA 5HHTA 1U80A 3G2NA 5JJLA 2HR1A 3DZ8A 2H1SA 3NHBA 2P9QA 2H57A 4KTTE 5GONB 4BXOA 1ZD2P 4EQ6A 2IWHA 3RS0A 4J2TA 5CVJA 2IYNA 2Y4NA 4IDNA 3EGDA 5ICCA 5F2KA 3I0ZA 4TWIA 1XPOA 2GPBA 4MO9A 2KBFA 1ESMA 1ZHFA 1E2JA 4JLWA 4OVZA 3UAVA 1QYXA 3A4YA 3SXUB 4H16A 4PSUA 3DE4X 4KQ1A 1F0NA 2PSFA 4B3SB 2OAP1 5BRJA 1ZLXA 4PC3A 1STOA 4FI3C 2OV1A 4MVJE 1R16A 9LDBA 1ZVKA 5CVEA 4YRCA 3GEDA 2H5XA 1ZINA 1IXZA 3GEIA 3ZD7A 2C83A 3WHPA 5GKNA 4FQ5A 5KNDH 3ANTA 5T3YA 1G0NA 1U7ZA 2ISQA 2KDLA 2Z9DA 4ETNA 2OVBA 5ALJA 3S2SA 2YWRA 3FROA 3H16A 5K99A 2I7XA 4DLVA 3FE3A 4N9WA 2XZPA 1UZAA 4I3HA 4FEEA 3DE0X 1WU7A 2QZJA 1WEKA 4YCDA 4IJ6A 3F4KA 3UNXA 1EFLA 1DBQA 2TYSB 1FFCA 1R0YA 3W8RA 2Q07A 3WGHA 3VR2D 5B2EA 3QXHA 2P6RA 1GQQA 3GLTA 4Y2PA 4CLXA 5ULLA 5TDHA 3WAKA 2DHYA 2DLDA 1Y7PA 4K9PA 2G88A 2P77A 2FZGA 4IJEA 4D4LA 1NGSA 4KMRA 4ZCTA 1EE9A 2PMCA 2ZRNA 3LC2O 1YT5A 1GNLA 2DQZA 2DPYA 4OGLA 1ID8A 5DGIA 4C04A 1C1XA 1H8HA 2PT5A 4NBRA 3JYLA 1DHTA 2C57A 3MJTA 4UEQA 1JG4A 1AY0A 2IPLA 1XDUA 1E1LA 4O4LA 3N0VA 3AP2A 4RVOA 4GE0A 5A7GA 1NVDA 4DM4A 1TE2A 5IU6A 4P86A 1Z5VA 1CB7A 4OXKA 4DA7A 1RSZA 1SXQA 1BDHA 4HUQB 3MTBA 1Y4SA 2EW1A 4PTYA 4E2FA 3J2PB 1EP1B 3WSWA 3SEQA 2GPNA 5IFLA 2YINC 2VO1A 2V54A 3ES9A 1NF2A 2J85A 3AM1A 4TKLA 3SJZA 4DLBA 1IEXA 1JZTA 2BSQA 1VKRA 3UEOA 4CF3A 3MVEA 4BV9A 1NJ6A 1DRWA 1SZCA 1CUFA 2F1KA 2J9ZB 9GPBA 3BRWA 1KDVA 3H7IA 3L8HA 3C41J 4Q02A 4L5YA 3ZOZA 3QLVA 1VKJA 4XX0B 1VHDA 3QKRA 1Q7BA 3BMQA 4MO2A 4UVHA 1JZQA 1Q6ZA 3NV7A 3DEFA 1CUGA 4OU7A 3RO7A 1Q77A 3LDHA 4ECEA 1I6MA 2FKNA 3IXLA 5B4VA 1SCJA 4HLUA 1UANA 1D2AA 5EHQA 4ZO8A 1EZ4A 2FFQA 3HUFA 3TD2A 3TR5A 1KI2A 2B83A 2PT6A 4N5IX 4JSRA 1CUDA 3IUEA 3P2MA 4FNAA 5T4FA 4KQEA 3L8YA 1AIPC 3WRXA 4O29A 4OHCA 2QT0A 3A26A 3E6AA 4LHVA 3AKZA 3VFDA 2QVGA 3U7IA 3WDSA 4M86A 3WLFA 2V1CA 2GEVA 2OCAA 4M37A 3KJZA 4K5QA 4DA6A 3FXAA 3PGMA 4W9NA 3A32A 2W4IA 1OHHD 2NAPA 1H4SA 2IEGA 4M9UA 2XKAA 2HRZA 1ZM7A 2C5SA 1M5UA 3H5RA 3VR0A 1X7ZB 3LHFA 3BXOA 2YN4A 1T4GA 3T5PA 4A0QA 1ZGBA 1F5NA 3TDKA 1B3BA 3IBGA 4IV8A 2IUEA 3KQOA 4RTLA 4MQFB 3OF2A 1ISRA 4TMYA 3WKEA 1WUIS 1WDTA 1RKXA 1U81A 4LKRA 1KSGA 1NBMA 1DC3A 3UAZA 1QQ6A 3HGTA 2HPVA 2ZUFA 3O4RA 2CVHA 4QZVA 3VYTB 3PQ6A 4HL6A 1RM5A 3S2GA 5ELMA 2B98A 3P9YA 1E2BA 2DHQA 3V97A 3RRNA 4LJ6A 4HGOA 1CFJA 5DIZA 3U3MA 4MYDA 3RC1A 1PLLA 2WJGA 4RYDA 1R74A 1LLQA 3U60B 3AFGA 1W19A 2PKRA 4RS3A 3R4CA 1M8PA 2INGX 2CK3A 2POCA 2XGNA 4DG8A 2WFMA 1EJBA 1EUYA 1M1YE 2P0AA 1NI4B 5E95A 2DUUA 5FNVF 1A7AA 5HR5A 2XD9A 4EDFA 4V0NA 2H54A 2YWJA 1PVDA 3NBAA 3FZGA 3WLIA 4OQPA 3UOAB 2C94A 4XWOA 1MEOA 4PN7A 1DX4A 1O9BA 1FQWA 2J3MA 1XNQB 4GUAA 4LE1A 4D02A 5B7GA 3DULA 3WAGA 1ZGAA 4AVYA 4F45A 3TLZA 2JGMA 4W8OA 3U6CA 2CD9A 1GJRA 3UOGA 4CCSA 4KN6A 4Z8XA 5T6BA 4CISA 4CKWA 2RHHA 2H5LA 2EL9A 2V0GA 3L07A 2G9UA 5FXMA 4E07A 4ASUA 3D4BA 1O0SA 5HK8A 4RPGA 3LWNA 2QQ5A 4KQKA 3IE1A 1GVHA 3JQAD 1COWA 3VZSA 4KLAA 1MO4A 3G5LA 3V4OA 3MLAA 1AQ6A 4ZAWA 3IJRA 4JGIA 4OU5A 1YMVA 4XOIA 2XDYA 3U2QA 1S2DA 4EVSA 1T34A 4M6WA 2SNIE 2A0KA 3PI6A 2GN8A 5J2TA 4Z2YA 3RVLA 5IVKA 5CFLA 1XWIA 4HMPA 2FAXA 2A4MA 1F4VA 1RABA 1J0CA 1DINA 5JZMA 2HWWA 1V35A 3WLHA 2IF2A 3I61A 4QHYA 1ARZA 2Q4TA 2MGWA 7CATA 1PUXA 2ZU6A 3RUIA 3UQYS 1E2IA 4KXWA 1JQLB 4P3PA 4KXUA 2TMDA 5JI2E 4W5HA 5JXWA 2P7HA 2ZIXA 3FF4A 1Q1QA 5ENVA 2IIBA 3ROGA 3HVHA 4QSHA 3DA8A 5LR6A 3AKDA 4CLRB 3ZBQA 5BRNA 2P35A 3AUSA 4QOFA 5HM8A 5A6VA 2QQEA 3QPAA 1LC3A 2IXFA 4AO8A 2JIZA 3QNWA 4MPJA 3D3JA 5CHYA 4WT7A 4DCGA 4D0LB 1OLXA 5B7NA 3VO2A 4NI5A 3AVQA 4JA2A 1GAEO 1R1DA 3HRHA 1X0XA 4DG5A 3IHLA 2E5WA 2J5XA 1WUTA 2OBYA 3NGMA 1GPYA 4PO8A 4DT1B 4OFWA 4BX2A 2FEOA 1YFKA 3A1SA 3AI1A 5HJ2A 3J80A 3MB8A 5A3VA 1XQYA 4AD8A 4QLOA 2MU1A 2XUOA 1IBCA 3DBLB 3ZCQA 4G1CA 5KYWB 3ZGNA 4B0OA 4NHEA 4IDHA 1Q0RA 1G21B 3DUFA 4CKYA 3JVEA 3WWOA 3KOYE 3EHEA 5CAEA 2R7NA 1ZEJA 5IVHA 3PWTA 1I10A 2YW9A 4O4LF 1VL8A 4BWYA 3HACA 4QOJA 1OIZA 5EN4A 1IUKA 3PHBE 4E2WA 3KKEA 1PS0A 1RS0A 3CLSD 1U9YA 4BNUA 1R0XA 2E6KA 5GINE 4IFIA 2F59A 2QE6A 4M1YA 5LMUB 4L95C 4HAXA 4NDZA 1AOXA 2GWRA 5TQ2A 3G0OA 4HMQA 4PC6A 3Q9NA 2PNJA 1JQ5A 4KQCA 3LP8A 1EWTA 4BFSA 2WZQA 1Y63A 3OM9A 1H4TA 2OD9A 2WWTA 2O8NA 2PUHA 3AP1A 1E3LA 5DCUA 1BWQA 2JAOA 3HLTA 1DNPA 4LAFA 4HDMA 4DZRA 1A5ZA 4TMWA 1NY5A 3QX8A 4Q24A 2CNKA 2AG0A 1L4KA 1GFIA 3OCJA 5I9BA 4CM9D 3DXYA 4J2HA 3GO8A 4Z4HA 1PFWA 5CD1A 2WNIA 3OVMA 5H1YA 3G7UA 2VHVA 4DA8A 1NMSA 3EIQA 1UFZA 4MKGA 4ARCA 1M3SA 1KY3A 4FWIB 4WNAB 2VAXA 2UVPB 4C43A 1UKEA 2FMXA 3IAM6 3G0IA 5C8DA 5UKDA 5HFNA 721PA 4EFNA 4GPZA 4NU6A 1PAUA 1WZIA 4FM9A 4B84A 1GTMA 2FP4A 3FTFA 2DVMA 1TC1A 2KS6A 1XR3A 3HFSA 2DT5A 2VPTA 1TZMA 3RVKA 1JFTA 2VS1A 3KAJA 4B2YA 3CZMA 4TM8A 4Y9TA 2BEUA 5MFZA 5CT5A 1EWRA 4C2BA 3MCTA 2NT4A 3E82A 2PWAA 3D5TA 3PXUA 5HIMA 3DFIA 3Q87B 2Q7XA 1J33A 3MLEA 3PDJA 1SKAA 3M70A 4KXVA 5BWBA 4IR7A 5KOJB 2CSXA 1XTZA 3FFTA 5CIWA 3F46A 4C06A 2V7XA 3G2HA 3N86A 2QAIA 1VHLA 4AUEA 1IZ0A 5EZQA 1XPJA 4JJ8A 4RULA 4HFNA 2OFXA 4BP1A 1QBGA 2J3EA 3JTEA 2C1EA 1QM5A 4FCWA 1KOFA 3JXEA 3OCUA 4UNQA 5GV7A 4WEOA 2Z2XA 4MWCA 1Z63A 5KX5A 1IG0A 3RSCA 2QE7A 3AONB 2QXYA 2QNRA 1SUPA 2PS3A 4TRMA 1NVVQ 1DADA 2OLJA 1DAIA 1MRNA 1T4CB 4L4UA 1B15A 1A8IA 3GCDA 3HM9A 4GGMX 4CR6A 3EY9A 2CV1A 3N07A 3RHTA 4M53A 4N01A 4KHZA 3KE9A 4EPTA 3UAYA 5KKAA 2B4QA 3JAKB 4BAGA 4COKA 1UPTA 4KREA 5JG7A 3LPAA 5FL7D 4JI0M 7REQB 3P9XA 1B3RA 3PC4A 3JS5A 3GJ6A 5EPEA 2AR9A 3BTUA 4BVGA 3TRFA 1SRRA 3ELDA 1QFXA 4RTKA 1PJ3A 1EFRA 1Q95A 4MB0A 1PJRA 2PA3A 3Q0IA 3Q5GA 2NACA 3I0NA 2QZZA 5EWMB 1WBJB 1K0UA 5GONA 1Z0IA 4M8IA 1PZXA 3GLGB 4BZPA 4OX9B 4DLYA 3ZWWA 3NRCA 4E1BA 2X1VA 5FAKA 1X3SA 4LK3A 1T43A 3H97A 1T1EA 3OPXA 3QHQA 5CFPA 2QJOA 5A2QS 3SXUA 3ORHA 3OCYA 1E8DA 4H0FA 4UNPA 4KQ9A 1PV2A 2CVOA 1HT3A 5C7IO 4CMCA 5CB4B 3SF0A 3LHSA 2JHCA 2XOEA 3KSRA 2B4KA 3VJKA 1LBEA 1HNXB 1V8DA 2DLCX 2LNDA 1OE0A 1U7OA 1Z4OA 1N6RA 1PX2A 4ZREA 1XALA 2HZ7A 3VSCA 1DJPA 2V58A 1WNFA 3PXAA 1Q0TA 3GCXA 1II8B 3HY4A 3GG2A 5BSMA 3HRIA 2DT8A 4WX2B 4LXXA 1JEOA 3LA8A 3NHAA 2VZLA 4HGPA 4WY5A 1KWGA 1B00A 3FVRA 3BWEA 3JZFA 1Q1BA 1R6VA 1RE0A 2JJ2D 2WJ4A 5KU1A 1HLFA 5F33A 2E55A 3HQ4O 4ZT2A 4RDHA 2K47A 2UV8A 1TLTA 3SSNA 3OTGA 1C9KA 5ARDA 1PBNA 5HEKA 2DTDA 1FQJA 1RZUA 1O6FA 4MWGA 4LFBM 4XFKA 1RM4A 3QWFA 3HDGA 3KV3O 3RF6A 5L3QB 1B41A 4QPCA 2ZSKA 4US0R 4XB6B 2R48A 3I37X 3M4NA 3RTEA 3PFKA 2IHYA 3EVNA 1CW2B 5L4SA 1J8QA 4GL4A 4YJFB 3GPUA 3MG9A 3E27A 2RGCA 2OFFA 4B85A 3WRVA 2YW2A 5DGTA 5MN6A 1W36B 1NE7A 2R8YA 3KG2A 1XAGA 3J27B 4WACA 2ODAA 1XA3A 3L7DA 3LWDA 4HUQA 4BIIA 4NJEB 4Y9UA 5HIAA 2H4HA 4WUVA 1MVNA 1YQQA 4DIKA 2K7FA 3FUUA 2Q1YA 2GDJA 1KOGA 3DFUA 5FD8A 2E7ZA 2OEPA 1J4AA 2C8VA 4C20A 5JVDF 2GOYA 1P6XA 1QUEA 1KSHA 2XCTB 4GAEA 3FAKA 2WJ3A 2PGOA 2AF4C 1KJQA 1YLAA 4GL2A 3UMVA 1XCJA 5I47A 3ECCA 3CUVA 4P4TA 4PO1A 2JAWA 5EP2A 4MUMA 3VPGA 5KWEA 2I87A 3OKPA 2ES4A 1XCPA 5E9JA 1R8JA 1YJCA 4L50A 1QIDA 1MB4A 1GJTA 1PZGA 4XX0A 1QVWA 1NBOA 3ADCA 2EHJA 4JODA 5L3SB 4A8HA 3M6XA 4GYWA 3QY0A 4XVCA 1P7YA 4D8VA 4D4GA 5HJ7A 2GF9A 3T6KA 1J5XA 1TUIA 2PU7A 2VF7A 2YYAA 4KR6A 1POWA 3HR7A 2HW8A 3JZIA 5MGBA 2P2LA 4ZC1A 2Z1MA 2P9BA 4J43A 4PAMA 2VQ3A 4C4SA 3A6DA 3K5IA 4GEWA 2PX8A 4MQMA 4DZZA 4PLZA 1TW3A 1WRBA 3U4QB 2YIDA 2CSUA 1BCRA 4UJ5A 4OHKA 3TGLA 5JPCA 3D43A 5TXGA 3R5JA 1CC1S 2C95A 1Y8AA 2PANA 1P4RA 3AXTA 2O8FB 5CH3A 5JSUA 1E4VA 1QH1B 4D97A 1NVFA 4NSNA 1KMHB 3AF4A 1N6KA 1JXOA 3K8YA 1X7ZA 2V65A 2COEA 3LCVB 1NBAA 2Z2IA 1OIVA 1UDAA 4IJMA 1N6IA 2B0JA 2R85A 4H6WA 5K4AA 3E9QA 2CHEA 4MQFA 2ZYHA 4MA5A 2JI9A 5CLIA 1DWPA 1KO7A 4MWBA 2DWOA 5A5FA 2WMYA 2ZJ2A 1W4RA 4EHAA 1L5QA 4QPJC 3A1WA 5JXHA 4ER0A 4W1RA 1NVKA 5A4MS 2J9FB 4IIWA 3BB3A 1LBHA 1LV8A 1S3GA 3GHHA 4P4GA 3U60A 1MN6A 2Z2YA 2W7TA 1EP2B 3TIIA 3TJZA 4CKCB 3GAMA 1NI4A 1AJEA 1L3CA