3TE6A

Crystal structure of the s. cerevisiae sir3 aaa+ domain
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
316
structure length
304
Chain Sequence
PNADINLEESIRESLQKRELLKSQVEDFTRIFLPIYDSLMSSQNKLFYITNADDSTKFQLVNDVMDELITSSARKELPIFDYIHIDALELMDALYEKIWFAISKENGDISLEALNFYITNVPKAKKRKTLILIQNPENLLSEKILQYFEKWISSKNSKLSIICVGGHNVTIREQINIMPSLKAHFTEIKLNKVDKNELQQMIITRLKSLLKPFHVKVNDKKEMTIYNNIPDNVIVINHKINNKITQLIAKNVANVSGSTEKAFKICEAAVEISKKDFVRKGGLQKGKLVVSQEMVPRYFSEAIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the role of the Sir3 AAA+ domain in silencing: interaction with Sir4 and unmethylated histone H3K79.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
molecule keywords Regulatory protein SIR3
total genus 88
structure length 304
sequence length 316
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17872 AAA_lid_10 AAA lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1280 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3te6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3te6A01
5TARA 1KNQA 3OESA 2WKRA 1SVLA 1SULA 2QQEA 5FBRB 3A36A 1A5TA 4Q5IA 1A2BA 2IS6A 4UJ5A 4IXNA 1Z06A 3AF4A 4W5JA 2IEZA 3B1WA 2MSDB 1LVGA 5CYOA 1Q44A 4HEJA 3ZVMA 4NYMR 2FZ4A 6Q21A 5JZVA 3U4QA 2DWOA 4JMPA 4LYJA 4TZ0A 1VKJA 2JLZA 3PCRB 3IGFA 4LWZA 3U3OA 2HXYA 2OFWA 5AUPB 2O8FB 1HQYE 2GXAA 2GJAA 3H4MA 3I92A 1YRAA 4LJ6A 1LF0A 2WICA 1OW3B 2O0KA 1KI9A 2CVFA 1J7KA 2G1JA 3T12A 5FTMA 3CX8A 5HKKD 4BGDA 5IK2D 2BBOA 1TF7A 1XXHE 1E0JA 1YJ5A 1QHSA 5KSPA 1KI3A 4D80A 4FWIB 5IHPA 3QSYA 4XWKA 1WBBA 2VSFA 3BWDD 4PR0A 5JRJA 3WNBA 4O2LA 4F4IA 3B5JA 3FFBA 3TMKA 4GOJA 5BW8A 1DAIA 1NN1A 3UKDA 1XMSA 3NBYC 4PZYA 3CPEA 4IOKA 4JBYA 4M1OA 1FTSA 4GP7A 2D7DA 2JLWA 2WWXA 1N5JA 4LRWA 3TJZA 2UVQA 1WP9A 221PA 2R6AA 4QL3A 3VR3A 1U94A 3LX8A 1KY3A 1SXJB 1E0KA 2RB4A 1FNMA 2O5VA 3D8BA 4LJAA 5FOUA 5JWRA 4AI6A 2WJIA 2P67A 1XNJA 4ZV4A 1AZTA 1XPUA 4TLDA 1TX4B 1VG8A 2BM0A 2GEUA 1DELA 2C96A 5CJPA 1M8PA 2QM7A 2ZS9A 4GMXA 4E5UA 2C9OA 5FFMA 2ZXUA 2XZOA 3GLHE 3W8NA 2JLUA 4GOXA 4II7A 2ZUBA 1L7VC 4G3XA 4P32A 2C9CA 3KTAB 3QG1A 2VTKA 2ZE7A 3CUEF 1P2SA 3FGNA 1SQ5A 2G0NA 4H1UA 4KFRA 3LQRA 3CW2A 1SVOA 1T4GA 3A1TA 3OIYA 4KCGA 3TBKA 5J5CA 3C5CA 2Z4SA 621PA 4NCKA 5EE9A 1E69A 1MOZA 3EIQA 2WOJA 3VR2A 3PUXA 4JT4A 1YE8A 3LVRE 4UNQA 1Z6AA 2QTVB 4YQFA 4YMUA 4I81A 4EDHA 3SOPA 2FA9A 2ZANA 4DDWA 4ZKDA 1G18A 5JSZB 1P9NA 2CK3A 1HT1E 1KMHB 2HLDD 1WBDA 1TL7C 3ND9A 4D4JA 5CJ2A 5CYPA 2IXEA 2ZSAA 5SZHB 3VMFA 3EWAA 1G1MA 1II9A 2WIBA 4MYCA 4KJZA 1VCMA 4B75A 3ZGXA 1WE2A 3K0AA 4LHWA 3ZVNA 2A30A 1FMJA 5FI1B 2AWNA 1HY3A 2F3RA 1NLFA 2MMGA 2JLXA 3T35A 3QKRA 3E5HA 5FTNA 3T1TA 2O8EA 4QKQA 2Z4RA 1AJEA 4ACAA 2PX3A 5FL7D 3ZDQA 4DXAA 2E1RA 3NDPA 1HYQA 3REGA 3PENA 2V1UA 3AP3A 3GLHB 2FE4A 2Z83A 5TVKA 3TE6A 1UBCA 4BFWA 3I1FA 5JBQA 2ECKA 1IOZA 1CR1A 4YDSA 4Q9KA 1E2JA 2HYIC 4BUJA 4E09A 4Z1MD 3BXZA 3CBQA 1Q3HA 4GOKA 4E22A 1N0WA 4HUQA 2V55B 4NPHA 1DADA 1E96A 4V0OA 2IYUA 3RANA 2F1HA 1E2MA 2F9LA 4JLAA 3FKSD 1ESNA 3FYHA 3GFOA 2EW1A 3BOSA 4HDCA 5E95A 5KSYA 3WYFA 1ZCBA 1GL6A 2NMVA 1B0UA 4FWTA 2O8BA 4M8NE 3T1OA 4RKFA 3PUWA 1BMFA 5EE0A 2WPDD 2WIAA 3SNHA 1R2QA 1W5TA 1VG9B 4A2WA 2Z6VA 5K8UA 2ZQ5A 1R6BX 4Q18A 1P4SA 3QE0A 1SVWA 1LB1B 4MQBA 5KPDA 2PLRA 2VA8A 3X1YA 4V0NA 4HB2A 2CL0X 3VU9B 2XTZA 4AWXA 1XEFA 1IJFA 1Q3TA 1U8YA 4B35A 3ZS8A 1G17A 3GLIB 1VMAA 4CEHB 3NG1A 5L3RA 3SR0A 1BKDR 4Q1AA 3TUZC 3C7KA 3UXMA 1O87A 3SE0A 1G7TA 1JPNA 5H70A 4C3ZA 2XSZA 4LPKA 1QDEA 1HA3A 4R9UC 3PEYA 1ELOA 2WPDA 4Q4AB 4C2UA 2BEJA 4MYHA 5HCNA 4ZI2A 521PA 3ADDA 1O3YA 3T1VA 3K0AB 4M22A 3CRQA 421PA 5IT5A 3VR4A 4CGZA 3UPUA 4LX0A 4Q1EA 4YLGA 1K5GA 4TZ6A 1ZNZA 2GCOB 2LKDA 1P73A 5KNBA 3B1YA 1N6KA 4JLOA 5J4KA 2R65A 1UKEA 2BMDA 2XXAB 1C4OA 1P61B 4LJYA 1ZBDA 2PEYA 2H8KA 5M04A 1TNDA 2ZU6A 4TT3A 2LKCA 4PC3A 2G1KA 4QJ5A 1JECA 3NTUA 1L4UA 2KE5A 3AUXA 2XAUA 3AP2A 4DUGD 4ZDKA 1SHZA 4TQUS 2QTFA 3MMPA 1N5LA 1QZXA 3KZ1E 3QQ5A 2YINC 3K9NA 3QPVA 4TLEA 1G21E 2J9RA 2CCJA 5FR2A 2GF0A 1RZ3A 3LBNA 3V4RA 2RH5A 3DO6A 3LW8A 3MJHA 3X1WA 3ZD6A 2NO7A 5DI3B 5FBLB 2F1JA 3B9QA 5DGXA 3CRMA 4DEYA 3EARA 3PVSA 1WDTA 1UDWA 4YXWD 3CWZA 2BKEA 2OBMA 4DT1B 3NHAA 4CYMA 2R44A 4BLRA 3THYB 2F43B 1RRCA 5JWHA 3N2IA 2I1QA 4UNSA 3UG6A 3QBTA 2ODWA 2IK8A 2ZI6A 2WSMA 1G5TA 1IN8A 1YHNA 4DB2A 2HXSA 2CJWB 3H86A 4LJ5A 4XH9B 3UWKA 4PO8A 5DYIA 3DMDA 1U9IC 4QJ4A 1A4RA 3TQCA 1FQKA 4A4DA 3B60A 1M6NA 1MABB 1G8GA 2VHQA 1AIPA 4LJ4A 2PBRA 1UKZA 2QMUA 2YOHA 3VAAA 3FMPB 5JCPA 3M0EA 2VP0A 4C0LA 2BBWA 2H92A 1SXJA 4NCIA 5EJEA 2CNWD 1E2KA 4URZR 2WWHA 2C9YA 2KI5A 3NH6A 4QBGB 1U2RA 3DOEA 4QHTA 3WRXC 3KQLA 1OLOA 3A4MA 3D6TB 3P20A 4TMZA 5L3QB 1R0YA 4G5SA 4GZMA 2C2HA 2ZJYA 4KHZA 4JL8A 4CEIB 2CBZA 2IEYA 2CXXA 4ILEA 1CU1A 4M1KA 1J8YF 2F9MA 4GRAA 3DKPA 4MGYR 4Q47A 1KGDA 3IPYA 3RS2A 4BLOA 1S9DA 3E1SA 4PSAA 4Q4JA 3KJHA 2K5UA 3K0FA 1XU4A 3QXJA 1KYIA 3ZZTA 2D2FA 4Q7MB 1NIPA 1II8A 4C0QC 1FFHA 4Q9JA 2H18A 4QBFA 1OT3A 3W3ZB 1E6CA 2ASEA 4CVNA 3FDIA 2PEZA 2GESA 1BYUA 4JIMA 3AVQA 3FB4A 4EPTA 1HE8B 1NL3A 2ZVQX 4MKHA 1MRNA 4RSGA 2JDIA 3RHFA 2A9KA 4TQ9A 5JJLA 2J45A 3O8BA 2ZRPA 2D7CA 2AXPA 2W0SA 2OHFA 4AG5A 4C7OA 2XZPA 3V4FA 2FGKA 1OIXA 5AWFC 2FPKA 2ZIAA 1JEDA 5BQ5A 3EPHA 4OBEA 2PJRA 3EX7C 2JATA 4TYPA 3QOFA 1X86B 2G6BA 4AD8A 1CF4A 4D81A 4CEHA 4MH0R 2ZE5A 3N70A 1XJQA 2EQBA 3AF1A 3SFVA 3FMIA 4B2LA 2BV3A 4Q48A 3M6AA 1F48A 2GA8A 5DSZA 5FBVB 2O8BB 2WAXA 3MFYA 1K8RA 1TU4A 2GXSA 1WMSA 1ZUHA 3F3YA 1IXSB 1E98A 3NC0C 3W3AA 5EZ6B 5HTKA 4P31A 3IIMA 4A0RA 4OK6A 3CPHA 1GKUB 4EKDA 1E2PA 4BRWA 3UANA 3RRZA 3LV8A 1MO6A 1CJVC 2ZJOA 1R8QA 3P4XA 2BCGY 2CHVA 2ZJBA 4L9SA 1TUIA 2OUKA 4DJTA 1JJVA 2YOGA 4EPVA 1NNEA 5FUVA 2HDNB 2ORWA 3IDQA 3LVQE 1X1SA 2VQSA 4GSYA 4W5WA 1VTKA 2IA5A 1T9HA 1Z0AA 3B8HA 4FCTA 1ZU5A 1E2DA 3I8SA 3VR6A 5BN5A 1G8PA 4IJMA 5E7IA 5G40A 3W6OA 2RHDA 2HT1A 2FJUA 1KO1A 2VP4A 4K8OA 5BYJA 2CLDX 1XX6A 2JJ2D 2JIZD 3LO5A 2XSZD 1YZQA 2N46A 1U99A 4DSTA 1RYFA 4B33A 1W4BA 2AL7A 1NG1A 4KITB 1M7HA 2IYQA 1G7RA 4WZ6A 4BFUA 2H17A 4PANA 1Q57A 3U61B 4TMKA 4GNKA 3BE4A 1SKQA 2QUZA 1WXQA 5LBIA 1UBGA 3WYGA 1E99A 3AF0A 3L0IB 3EZ2A 3KQUA 4HSEA 3A1SA 1JQLB 4PQFA 3RS7A 1RC8A 2VP2A 1YZKA 1ZC4A 2NQ2C 5AR1A 4PTLA 4QHYA 2QPOA 2EYQA 1VIAA 2GVDC 4UNRA 1ZD1A 3ASYA 2VHCA 2IYYA 2IHBA 3I3SR 1CR4A 4JLJA 1FZQA 1ESMA 4DSOA 5DNYB 5L3SB 3NIBA 4BLSA 2X1VA 4AC9A 2KBEA 1NVXQ 4ZDWA 1G3RA 3FOZA 2GJKA 5EE3A 2GKSA 2J0VA 4IDNA 5FTJA 2IS2A 2CHQA 3K09A 1E2QA 1SZPA 1BS1A 1IXRC 5FOXA 2TMKA 2EVWX 2ZUDA 5D3MA 1Z63A 4URVR 1N6RA 3LBHA 1Z28A 2PLFA 2VBCA 1W46A 3S1AB 4Q03A 2A5FA 2B92A 1SHKA 2F1IA 1DARA 2GZAA 2JEOA 1YR9A 2FV8A 4KYUA 3TSZA 4B48A 1GFIA 1Q0UA 2ERXA 3BRWD 4YMTA 3FKSA 4ABYA 4WW0A 2B6HA 2ZJ2A 4LOAA 4BFZA 3NHBA 2GAOA 4PSVA 3VTKA 2A2ZA 3CX6A 3LX5A 2P65A 4ESHA 4EAQA 4EQ6A 2QPAA 1N6OA 1ZIPA 2CMKA 2DFKB 2P6RA 3Q7QA 4UXJA 3FMFA 1YR8A 3TW8B 1P2UA 3O8RA 1KKLA 1NN3A 4PC1A 2W58A 1EWRA 4WOPA 1TAGA 2ZRKA 4Q1CA 3PJRA 1VYTA 3WYAA 4OQLA 1NKTA 1YZLA 4XIGS 2O8FA 1KZGB 1KI8A 3GLFB 4BZXA 1NMYA 2R6GA 2RCNA 3THXA 1W48A 3BC1A 3SHFA 3UK6A 3G5UA 3LH5A 3UIEA 3DVLA 3TKLA 2PT7A 1T3HA 1FTNA 3QF7A 2HYDA 2PMKA 2UZIR 3IILA 4TYQA 5JJIA 3TLXA 3FPAA 4RZUA 2A5JA 3ONWA 3ZJYA 3OIWA 3H1TA 2O8CB 4JL6A 2ZYTX 2E9SA 3B7GA 1JI0A 4WAUA 5KTYA 2ZSEA 4MRPA 2Y8EA 4Q02A 5KU1A 4PFSA 5JECA 1RRFA 3K0EA 1IN4A 4LC1A 4U02A 4BEJA 4ZDIA 4FIDA 1G6OA 2OLJA 1LFDB 4KSCA 4JBXA 3PG5A 5HZKA 3QF4A 2ZYVX 2ZRIA 4XVUA 1H8EA 5BYKA 1G20E 3RRMA 3U7FB 1P6XA 5FOSA 2O52A 2ZR9A 2J41A 5H1YA 3A4LA 4BFVA 2XNDD 1HURA 3U3JA 3DZDA 3B2EA 3AQ4A 3RWMB 3QNUA 4JT2A 4PPGA 3THXB 2ATXA 1XJ0A 4TL8A 1XMJA 1F5NA 5KSOA 4NZYA 2FEOA 2ZRAA 2GCOA 2JA1A 3QUSA 1OFIA 1IONA 1MO3A 4TYWA 1E94E 1T91A 1U81A 4V0MA 3SYLA 2X77A 4C0JA 1L2TA 1KI6A 3EWSA 2YZ2A 2PCJA 4M1MA 2JLYA 3TAHA 1VYVA 2ZPTX 3KXKA 3FTQA 4PC7A 1UJ2A 3VX3A 2GJ8A 4B71A 1R5BA 5GJWC 5SZKB 1NJGA 4RFSA 3ZQJA 4C30A 2FFBA 1KDTA 5CLLA 4BZPA 4DRZA 5GVSA 1PUIA 3A37A 4NYJR 2ZI5A 5FOTA 2ZRHA 1OPXA 1X8KA 2H7VA 1KMHA 2GRJA 4JLPA 1R0XA 4MA4A 3SHWA 4JL5A 2JLVA 1U9IA 4CW7A 4JVLA 4IOMA 3IQXA 3L82B 4XD7A 1RVDA 1NP6A 3MGCA 4P0TA 3O47A 4AKIA 2GBLC 2NZ8A 1VYUA 4A8JB 2C77A 1TADA 5EE5B 2HV8A 2IYVA 5FOWA 5GJBA 4DIEA 1RFLA 4B3XA 3G0HA 3CO5A 5CITA 2BOVA 2CJWA 2A3RA 1IN7A 2NG1A 2YWFA 3OAAD 1G4AE 2O0HA 3N2EA 2C03A 2PX0A 3UWOA 2GXUA 4HI0E 3O8CA 5CM9C 1X3SA 3MWLA 5LB2A 4EFLA 1EX6A 2OZEA 3CZQA 3DOFA 4TSFD 3SBEA 1BIFA 2RHMA 3LWNA 1E2FA 4ARZB 4D82A 2YC2C 3AEZA 4NCJA 4US0R 2OCBA 4TT3D 4EJSC 3WMGA 2XX3A 3OEHD 3GCGA 1QHYA 4KFTA 2ORVA 1XWIA 1R0WA 4Q4JB 1SXJD 1WCV1 5B57C 3WP1B 1FP7A 4QOSA 1LS6A 3GLGA 1IN5A 1KK0A 3EXAA 4A92A 4HAVA 3VQTA 4HAUA 3WNDA 2VSOA 2AK2A 2VP5A 3K0CC 4ON9A 3S1AA 1I4LD 1OHHA 4I4LA 1ZYUA 3AKDA 2RGNC 4N0DA 1AGRA 1ZRHA 4LHXA 1G8FA 1R5NA 3EA5A 4QG7A 2QPTA 4RFSB 3ECCA 5EQTA 4QGFA 4M1TA 5DYGA 1XBTA 1MO5A 3GJ8A 3OHMA 4M4SA 2HUPA 3OZXA 2ZREA 1KO5A 3B9PA 1U0LA 3T1QA 2CK3D 2HLDA 3U5ZB 2PT5A 2JLRA 5JJKA 1D2MA 3EAQA 4HB3A 4YC7A 2XTNA 5DH9A 4I1SA 3V9PA 2CEAA 3KKQA 1CJKC 2P6UA 2XOKD 3D31A 3K0CA 4Q21A 3K70B 1KJWA 3FHOA 4A0GA 4NYIR 4DC9A 4HDQB 2OAQ1 2FGJA 1OYYA 2FPLA 1RRGA 4DT1A 1SVKA 2GJ9A 2W0MA 2QG6A 5JI2E 1T0HB 2ZRCA 4R7ZA 3W6NA 2XITA 1OXXK 4LY6A 5AUOB 5KDOA 2PH1A 3MRSA 1OH8A 5DHFA 2QRZA 3VHXA 1N2CE 2V6IA 5LB4A 1NLZA 1VPLA 2ZE6A 3THWB 1UAAA 1UADA 4QGAA 5EXPA 4RVCA 1JEEA 3KB1A 4DLXA 1E9CA 4LBVA 5AK0A 1R10A 2C99A 4YDHB 4JYBA 4RD2A 2VHTA 1H65A 1KI1A 1XTIA 3AVWA 1FPMA 2WKPA 2RGEA 4TLBA 5F9HA 4OI1A 3SS8A 3A1UA 5DISB 5JS7A 2XXAA 1M2OB 1QG4A 3T61A 1Z6XA 2XNSA 1XDBA 3C41J 2ZS7A 4J0QA 5AUNB 2NGRA 3NC1C 3IEUA 3I8XA 4TLAA 1AN0A 1E1QD 5JEDA 5FBQB 4BFSA 2NIPA 1WA5A 4JVSB 2FSGA 2GBLA 3Q5DA 3SDZA 1Z3IX 3CX7A 4Q9IA 2B8TA 2QAGA 4US1R 1G7SA 2BKUA 4DLYA 1S1MA 4MITA 721PA 4PZLA 1EFHA 2EFEB 4XVQA 3KKNA 4WA7A 1BMFD 1HH4A 1PZNA 2OCYC 3BIFA 1AK2A 1D2EA 1CTQA 1EFUA 1KO4A 3DEFA 4DLWA 4C4PA 1S2MA 3GLGE 3O8DA 1E9RA 2ZRGA 2GHIA 2XB2A 2XOKA 5AUQA 1CJMA 1QHHA 1AS3A 1FX0B 4GFDA 1UM8A 2R6FA 3VNUA 1SVMA 2QRNA 3H0KA 2JAQA 3I32A 1N6HA 1NSTA 1YR6A 1TEXA 3GJ5A 1TQDA 4D4KA 4EPXA 4A8JA 1T3LA 2GZHA 2OFXA 3E2IA 2Q3HA 1QBKC 3QKTA 3TW4A 121PA 4JLBA 2REBA 3D3QA 1DAKA 4PAQA 4QRHA 5G53C 1EK0A 2DHRA 3AVOA 3KUDA 4HLCA 4LK2A 1S1CA 3A4NA 3UMRA 3SEAA 3L0PA 3QXSA 4Z8YA 3VX4A 2VRWA 4NMMA 2ZI4A 2H16A 2D06A 2JASA 4L15A 2UZ3A 5B30A 4DCTA 3TVDA 4I1VA 4Q1DA 2YHSA 4CRWB 4JJZA 3CNNA 5GVRA 1FOEB 3OAAA 1ZVQA 1KO8A 4AYTA 1Q21A 3RSLA 2W83A 3AKEA 3KFXA 3R7WB 4RJLA 3CLVA 1NVVQ 2QI9C 4OK5A 4GMDA 2D62A 1KAOA 1G291 5JS8A 3GLFA 1TU3A 3U6BA 4EQ6B 4MYUA 2V1XA 3ZQ6A 3X1XA 1GM5A 5KDLA 1JBKA 4ACBA 5EP4A 2IYRA 2NZJA 3Q8XB 4IHQA 4HAZA 3R9IA 1CULC 1F60A 5KO2A 4AYWA 1S96A 5JLJA 5F9FA 4MKFA 1W7AA 4XD7D 2QT0A 1GNPA 4PHFA 3ZVRA 3BD9A 4HLUC 2WSSA 1WF3A 4CEJA 4GT1A 4JJKA 1ZMXA 2IF2A 5EP3A 3KJIA 4ZCIA 2F55A 1G16A 1TPZA 4F38A 1ODFA 3AP1A 4IKEA 3KX2A 1AA9A 2W2VA 4GDFA 2FWRA 2BC9A 5H68A 5JSZA 4TYYA 4OJQA 1XD2A 4PO1A 4DSUA 1JXOA 2NO1A 3U3RA 1KIMA 4KXFB 3B6EA 4ZDJA 4LHVA 5FPTA 4GI7A 4NP6A 1F2TA 5EP1A 5C18A 1T5LA 1N0VC 2RAPA 3Q7PA 1ZNYA 5FBWB 1TF2A 1XXHB 1R7RA 1L4YA 1ETUA 3AVYA 1ZM2A 1G8YA 2HCJB 1Q12A 4I1OA 1PJRA 3RRYA 2JJ8A 2QY9A 1NJFA 1COWD 2RGNA 2I4IA 1N6IA 2Z5FA 3L8ZA 4QGGA 5JI3E 3DM9B 4Y0VA 5EZ5A 4IRUB 2N42A 3WNCA 4BECA 2YKGA 2JJ2A 2JIZA 5HCIA 3REFA 3K53A 3EPKA 4BEBA 4ZIRA 1DOAA 1NVUQ 3CR7A 1GKYA 2R2AA 1Z2CA 2WSSD 3U3MA 1UEJA 4K81B 4TMWA 1W0JA 3KQNA 5DI3A 3BJIC 2QMEA 1NMZA 3TGPA 2VH5R 1KSHA 1FX0A 2NO9A 5C4GB 4LSGA 1NBME 3LXRA 1DAFA 1R0ZA 4TYNA 1SVSA 3A1WA 4AG6A 3HR8A 1E1RA 4XTCS 3ZIAD 1CP2A 2W2TA 3ZH9B 5E3HA 1EG7A 1WRBA 3ASZA 3IQWA 2P3SA 1VIYA 2V6JA 4B34A 5JCZA 2BCJQ 3MAAC 1NG9A 2AD5A 1C1YA 2GK7A 4LI0A 5C2JB 3DL0A 5FL7A 4W7SA 1GL7A 3K70D 3A6PC 1ZW6A 3MD0A 1QG2A 4F7WA 4OHXA 4S35A 4A15A 2O8DB 2FN4A 2OEPA 5HE9A 3U6KA 4R2HA 1MO4A 2KSQA 1P9RA 3MCAA 1D9XA 1GUAA 4D4MA 5B2ZA 3I61A 3AF2A 4IVRA 1ZIOA 4HATA 4DB4A 3QVVA 2Q3MA 1MV5A 1Z0JA 1Z47A 3PUZA 4MRSA 4V0KA 4KVGA 3Q72A 3RRNA 4DUGA 2CCGA 2QAGC 1OYWA 4OI0A 1KDRA 1AKYA 4ITRC 4WZAE 3GEEA 2C8VA 3Q9LA 1LNZA 4M9QA 1AM4D 1U98A 4AKGA 2O0JA 4KU4A 3WHLA 4QNRA 3KXIA 1W4CA 1DEKA 2FF7A 1U8ZA 1F2UA 5L3QA 1E1QA 1LF5A 2QP3A 2G83A 4JKYA 4F92B 1PUJA 1P7CA 3B1XA 4DDUA 2YVUA 2HF8A 4P4SA 3GLIE 1J90A 2HF9A 1EWQA 2BDTA 4PX9A 5JWOA 5LPNA 2OXCA 4JLVA 3CRVA 1F6BA 3KJEA 4Z54A 5IRCD 4R98A 2I1VB 1C9KA 1OXUA 4HB4A 5CLQA 2P0EA 1M74A 4MGIR 4IFEA 4NHOA 5JHGB 2ZRBA 1YRBA 4LHZA 1U90A 4LC0A 1D6JA 2OXRA 2ZAOA 3FHCB 3NBFA 3DZ8A 1J70A 2ZS8A 3SC3A 4C9BA 1CBUA 2FU5C 1CXZA 2IUUA 3T06B 1E9SA 5E4FA 4OQMA 1CR2A 1TF5A 1ZC3A 3LA6A 4M9ZA 1ZUNB 2Q9CA 4JLDA 4DEXA 4FMDB 4CT4B 2BJWA 2ODNA 3AGQA 1Y63A 1RPZA 3KDSE 1HT2E 4BLQA 3CF2A 2ZJ8A 2L0XA 1E2IA 1P72A 3KKOA 3B1VA 1GNQA 1M7GA 1Z6TA 2LCFA 2VO1A 1GOTA 3I62A 1K5DA 2J7PD 1KK1A 1DO2A 3K8YA 4GPTA 4QGHA 4A0FA 1UDXA 4V0ME 2V9PA 1HE1C 3KXLA 4LUCA 3TSWA 1B23P 5FUWA 4BLPA 3VFDA 1NY5A 1TQ4A 1U0HC 4JZKA 4CEIA 2BHRA 3NH9A 5AJWA 1E2EA 2NO6A 2VF8A 3QIAA 4RD1A 3TR0A 1JB1A 1W2GA 2IYXA 3NVAA 5K8TA 1J8MF 1NF3A 1E3MA 3QF4B 2OFOA 1XPRA 2ZTSA 2ANCA 3DPUA 2DWQA 2FNAA 3F8TA 3X2SA 4TTPA 4KFSA 3C4JA 1G5PA 4L9WA 2VLIA 1JJ7A 3AH8A 5KOYA 2G77B 3SJZA 1Z2AA 1Z6GA 1N6PA 1GP2A 2XJ9A 2ZROA 4C7OB 5B64A 3UMSA 2X2EA 2W6JA 4FD2A 4LJ9A 2QQ0A 3OIUA 3CKLA 1SGWA 3L0OA 2HT6A 2WWYA 1XXHA 1OH5A 4KLZA 4OL0A 1TMKA 2F7SA 2ONKA 1JPJA 1UEIA 3W8RA 4DLTA 3MJRA 1E9EA 2AFHE 2ZRMA 3C8UA 4O25A 2XTMA 1G4UR 3BFKA 2J7KA 4KSBA 2WTUA 4Q4HA 1D5CA 1Q1BA 3WBKA 2ORIA 4NYJQ 2QGNA 3AKCA 3EZ6A 3ZYCA 1G41A 3PEWA 3JZAA 3VKGA 1YVDA 1UPTA 1YZGA 3MWJA 5AJYA 3ETLA 1OIVA 4PAOA 4H1VA 4OI4A 1YZNA 2AKAB 1RRPA 3W5JA 2FEMA 3TK1A 1XD2B 3BH0A 5JFGA 3LLUA 1G3QA 1UKVY 1ZNWA 3PEUA 3BB3A 2CE2X 2ZJAA 2WAYA 4GL2A 3ZIAA 2YNMA 1OB5A 1NY6A 2F1RA 5EXTA 3HP1A 1XTKA 2QENA 4DDTA 4LBWA 2OCAA 4ZO4A 2P5TB 3FMOB 3OF5A 5C46F 2RGCA 4HDOB 2OAP1 3QEOA 3U7EB 3U4QB 2PMDA 2IS1A 1XJCA 4Y0AA 1H8HD 2G3YA 1IM2A 1XEWY 3WRYC 3A8TA 5CB6A 3U7GA 4XJXA 2QA5A 3FE2A 4EFNA 1KOFA 4G5OA 2PCLA 4B76A 4JS0A 3EZ9A 4ARZA 3QXHA 1W0KD 4DKXA 5J4HA 2VL7A 2UKDA 4EIWA 4HAXA 2YV5A 2GF9A 1XCPA 4UNPA 1QVAA 2BEKA 4IDOA 3R7WA 2QE7D 1X1RA 3AF3A 4UKDA 3LFUA 2R6DA 2FDCA 1IY1A 1R5OA 2FOLA 4KBFA 4GP6A 4PSKA 1CS4C 2WMNB 2C98A 1WQ1R 3EG5A 3KKPA 3ZS9A 1M1YE 4P4TA 4NBSA 2GCPA 1Y3AA 1OKKD 5TDHA 3K9GA 2FFHA 3K70C 2ZAMA 2IT1A 2ZSDA 1MRSA 1FQJA 1A7JA 4DHEA 5TB5A 3UMFA 1W0KA 2WHXA 5FPHA 4LPSA 1E32A 2JJ1A 4UXIA 2Q6TA 2AFIE 4HZUA 1T8UA 3MUFA 4A0HA 4D4LA 1DAGA 1FL9A 2C95A 2A7QA 1H8HA 2VHJA 3QI2A 4B74A 1CKEA 2N1BA 2GTPA 4JLMA 4BZQA 1COWA 5K8IA 4M21A 1QHHB 3RS0A 3AVUA 2RGAA 3LDAA 4RD6A 1Q20A 3BAFA 3B1ZA 4TMVA 3DM5A 4HZIA 3R8CA 4ASUA 2J0SA 2ZI3A 1HQCA 1FP6A 3LRPA 3W6PA 5KYKA 4BASA 1AZSC 2WVJA 3RABA 4TQAA 2V3CC 4DLRA 2IF0A 3GJ0A 1KDOA 3IHLA 1XEWX 3CPJB 3A1VA 3QY0A 1T3SA 5A0FA 1OFHA 2ZITA 4V0LA 5CK5A 2B21A 2HJGA 2VP9A 3IPXA 4FMCF 1IY2A 4Q4AA 4RZ3A 1QHXA 2IX3A 4NKRA 4FI3C 2FFQA 4YONB 2OM2A 1PLLA 2J59A 1Q1EA 5P21A 4PHTA 1OKKA 4OI2A 2OO7A 5FTKA 2Z43A 3K09C 2W6ID 3JVVA 4JVMA 2ATVA 1SXJE 3G82C 1Z0DA 4PQYA 3I5YA 1QHIA 1S8FA 4EPRA 2A5YB 2B7CA 4N0EA 2XZLA 5AJVB 2EWVA 3GEHA 4H9GA 4RZXA 1CJUC 3RS3A 1E79A 1R4AA 2RGDA 2OLKA 1JALA 1A82A 2QBYB 1KK2A 1G6HA 4IOJA 4OYHA 3LBIA 1NSFA 1XZPA 5E7JA 1CLUA 3CM0A 1S0UA 3C16C 2RMKA 1N0UA 4BRUA 4FMBB 3T15A 5EUQB 2QSZA 1U0JA 2GNOA 1MABA 1YU9A 4KAXA 4X8MA 4O2RA 4M2LA 2C04A 1XB2A 4HB0A 4I99A 2IYSA 4GZLA 1E2NA 3JZMA 1XP8A 3CZPA 4MUAA 4O0MA 2J46A 3LNCA 4JKIA 3WHKA 2QT1A 1SKYE 3R9XA 1Q22A 1E1RD 1AKEA 1W4AA 1KI2A 4YMWA 1U8AA 3W34A 4QBIA 4QJ3A 2ZETA 3VHLB 5CDFA 3RC3A 1US8A 1S3GA 1Z8FA 3U44B 1KDPA 2WM9B 5H8WA 3MWKA 4RCZA 5EUMA 5DN6D 4HAWA 1JXMA 1RIFA 4DLSA 4BFTA 3RS5A 1W36C 2MSEB 3ADCA 1M7BA 1IJEA 1PLJA 3SU8A 2WOOA 2CLCX 1VHTA 2IXGA 3WXMA 1XZQA 1XEXB 4XVRA 3EPJA 1KJZA 4KODA 2GXQA 1KHTA 2V7QD 4M1SA 2YWEA 2GEVA 2VP6A 4OHVA 2C78A 4G5RA 2MSCB 4LV6A 3J81k 4DIDA 2PZGA 2YWGA 5D3QA 2A5DA 1KZ7B 4G5GA 4B3DA 3T5GA 1YQTA 3BGWA 1W5SA 4AK9A 4DCUA 3QENA 4IDHA 1ZINA 2G0TA 4U00A 1HTWA 1Z0FA 3R8FA 1QF9A 2OBLA 4HLDA 4NYIQ 2GAAA 2J5XA 1ZU4A 1VG0B 2IBMA 3ADBA 2B8WA 4DCNA 4DSNA 4FN5A 1VDZA 1L8QA 2VYFA 4ZI3A 1GRRA 2XB4A 3MSXA 4G0NA 2JJ1D 4M1YA 4PPQA 4A6PA 4ZPXA 2IXFA 3IO5A 4MUBA 2KB0A 3K0SA 1CRQA 5DN6A 3SQWA 5HZHA 4MGKR 4NE2A 1F3OA 2YWHA 3MLEA 3WP0A 2HJVA 4FCVA 4F4CA 3I5XA 2FH5B 5C4MA 4NH0A 3IBGA 1JQJC 4M53A 2GJSA 3Q85A 2WWFA 1LY1A 1AGPA 2J0UB 3FVQA 4OJKA 5J4VA 2W00A 3CNOA 3OIVA 4BFYA 2HEIA 2FFAA 1FNNA 4LZZA 1Q1QA 4LV5B 1JAIA 5GJVC 4X8OA 5BXQC 3SZRA 1LW7A 4JVNA 1OSNA 2QP9X 3QVUA 2X8AA 3BH7A 2GEDA 3NBZC 4IW3B 3NEYA 2QBYA 1TQ2A 2QEQA 1RE0A 2O8CA 5BN4A 2BWJA 1G5RA 1X8LA 3M4YA 4PPNA 4X8HA 4LYAA 4OQFA 3C5HA 1S3SA 5LD2B 3ICQB 4HLUA 1YKSA 4URYR 4D6PA 2FG5A 1V5WA 2J1LA 5ELXA 3SJBA 3GFPA 3E70C 3BORA 4HUQB 2A78A 3FKQA 2ZRJA 2GCNA 4QHSA 4URWR 5EP2A 4OHYA 4TN1A 2WBLC 1OB2A 2AXNA 2MMCA 1EFTA 1GRQA 2PZFA 4TSFA 2EFDB 1N6NA 2A5GA 2QMHA 3DDCA 3NEJA 2ONJA 1KI4A 2C5LA 5G3ZA 5GADl 4D25A 4IDPA 3HU2A 3RYTC 2XJ4A 4A9AA 4B6FA 4EUNA 2DFNA 4C2TA 2QZ4A 3CH5A 2D74A 4LYHA 5CIWA 1ZNXA 2AK3A 3KJGA 5DHAA 2IW3A 2ZI7A 4OKSA 4D0NA 2JGNA 2BBTA 2IYLD 1IY0A 4JLNA 4LBYA 4DBLC 5J4LA 1E9DA 4R71A 1CRPA 2ZRLA 3HJNA 4M1WA 1KMQA 2BIFA 2R6CA 4NYMQ 1ZD9A 1E79D 3Q5EA 3IUYA 2NO0A 3BFVA 3RS4A 2JLSA 3AKYA 1P9WA 1VG1A 1RYHA 3IIJA 5HKKA 2DY1A 2JDID 4TMXA 1P2TA 3WBJA 1NBMD 2VIIA 2W6IA 3THWA 2J7PA 5DLQC 4NTZA 4A8JC 1G7CA 5AJZA 1E9BA 1NN5A 2FSIA 1EFRD 1KO7A 2AWOA 2R62A 3ZVLA 3PQCA 1EXMA 2DR3A 2OCPA 3CRRA 4Q00A 1LS1A 1EX7A 4MRNA 1UBEA 2X2FA 3KQKA 5TY0A 1EESA 4OHWA 3GLFE 1CR0A 1WB9A 2DFLA 1OIWA 5C1BA 3KTAA 1J2JA 2H5EA 1VHLA 4IEIA 1ZM4A 1N6LA 2DWPA 1TEVA 5LD2C 1E9AA 4TL6A 4M0LA 4F91B 2HCBA 4TLCA 2ZU0C 4L16A 4PZZA 3B85A 4WZBE 1W36B 2BVNA 2DBYA 4NCHA 3BS4A 3GFTA 2CNWA 4QBHA 1JR3A 3K9LA 4C0SA 1DPFA 1NN0A 1Z07A 1OE0A 1JR3E 4V02A 3CR8A 4UJ3A 1E0SA 2DPXA 3ZLJA 4I1UA 4B73A 1OFUX 4PQRA 3AV0B 2ZSFA 2DYKA 1VCOA 3NBXX 3LXXA 1JAHA 2REOA 1N5IA 3RWOA 1X6VA 2V54A 4L5BA 4PXAA 1NVVR 4KVAA 4TL9A 1YZUA 3L0SA 5KUTA 1E4VA 3PR1A 2Q21A 1TQ6A 2OBNA 1W1WA 1AS0A 3F0TA 1Z08A 3ADKA 2Q9AA 4MRVA 1XRJA 2BM1A 2CL6X 1OV4A 2ZJZA 4G5QA 1J99A 3KUCA 2IWRA 3R9WA 3AVPA 4C0HA 5FL3A 4YMSA 3IBYA 1XCGB 1OXSC 1ZD8A 2CDNA 1Z83A 3CF0A 4RFVA 3EC1A 3THOA 1ZAKA 3P4YA 4Q4HB 2Z0MA 3LW7A 1EFRA 2OSBA 1AQYA 2GK6A 3V00A 2XGJA 1XTSA 1G64A 1I2MA 1D9ZA 4X8LA 3BB4A 5CB8A 4F93B 1PVOA 1Z0KA 3C15C 4KI0A 3LLMA 5CIQA 1E0AA 1LV7A 1DAMA 2YJTD 1K6MA 1GDDA 4EPYA 2VF7A 2VEDA 2ZRDA 4M9SA 2IYTA 4POAA 4UXHA 4OK3A 3TR5A 1GSIA 3RSOA 2WJYA 3F5FA 4W5HA 2X19A 1T5IA 4IDQA 1UBFA 3CWQA 4V03A 3P27A 3VU9A 5IDVA 1R8SA 4AYXA 4FINA 1RW4A 2BMEA 2H57A 3HR7A 3CF6R 1W2HA 4FW9A 5J40A 4LBZA 3LY5A 4A1FA 5FH9A 3UATA 1DBSA 1IAQA 1VCNA 4HZUB 1OH6A 3HPRA 1GZSA 1N5KA 1KK3A 1SVIA 4N1AA 2ERYA 3ZZUA 1KKMA 3A58B 4TMTA 4RD0A 4A2PA 4B3CA 2QU8A 1OH7A 3TUJC 1G8HA 1W36D 4DVGA 3CH4B 4AIIA 1W4RA 2KJQA 4Q4LA 1BO6A 3OEHA 4TTRA 1KJYA 2CHGA 4U5XA 2H1LA 1Z5ZA 4JSTA 5L3VA 3FFAA 4Q7JB 2AKYA 3BH6A 4MKIA 1KTVA 4MRRA 4Q9HA 1KI6B 4LV8B 4MKGA 1PV4A 3T34A 1GAJA 2QN6A 2QL6A 2WMOB 4PC6A 3EZFA 3TUIC 2VSXA 5J47A 1NVWQ 1NMXA 1AQUA 1MR3F 2DFTA 3IIKA 1XFAA 3UG7A 1DO0A 1IBRA 2ZE8A 1RKBA 3GJ4A 5IF9A 1GRNA 2J3EA 3LD9A 2WWWA 4TTQA 3B82A 2YC4C 1NIJA 2O8DA 4D0LB 4XWAA 3OE7A 2YOFA 4B2PA 2R8RA 5FR1A 2AR7A 2KWIA 2ZJ5A 3VNVA 4FXPA 2VHUA 1XMVA 4ZKEA 3WMFA 3W90A 3VR5A 2ZRNA 4PO9A 2WJGA 1ZM9A 1XTQA 1NI3A 4XOIA 3HYTA 821PA 3PUYA 3QG5A 1T8TA 2GILA 3QBVA 4KFUA 2FPMA 3NDBB 1GILA 1US8B 2V7QA 2FZLA 2IHYA 1IQPA 2EYUA 4JLKA 1E4YA 1YR7A 4P33A 1GL9B 4KLNA 1SXJC 5FUXA 3AVXA 3PV0A 4B3FX 5JMTA 3X1ZA 3TAUA 2OT3B 2ZVPX 1QHGA 1F2UB 4B3GA 1OHHD 3CB4A 2WKQA 3THYA 3QPWA 4D0GA 4W9MC 4ZIRB 1H8ED 4LYFA 4URXR 2VPPA 5KSZA 2DCUA 4PPFA 3I72A 4C0AC 1GWNA 5AJXA 4B44A 1XF9A 3AVTA 4AKHA 3GLHA 4IVPA 1SKYB 3LQQA 4Q66C 1VCIA 4HAYA 2QE7A 5CM8B 1IXZA 4XWOA 4DLZA 3K0FB 1E2GA 3PEVA 3K9HA 4WXPA 3CIOA 3QKUA 5FI0B 2GVZC 4OQNA 5HE8A 5ANRB 3PXGA 4XSGA 1GITA 3TVTA 1CEEA 4URUR 5F2EA 2ZRFA 2P6NA 4WXRA 4A36A 2REXB 1A1VA 3JVUA 3IHWA 3GQBA 3GPLA 1G9XA 3I4LA 3SYKA 4Q7KA 4D2IA 2EWWA 3NXSA 3AB3A 3P26A 3TH5A 2AD1A 2GZDA 1S4QA 4S2EA 5DO9A 3EPLA 2NTYC 5EE1A 4L4UA 4YMVA 3VR1A 1QVRA 3M1IA 3MG9A 2IYWA 1FUKA 2F43A 1HV8A 4YXWA 2E87A 1EGAA 4B43A 1RJ9B 3AVVA 1T0JB 3QKSB 5FTLA 1M34E 1E2LA 4Q7LA 1ZUIA 3BBPA 1KSGA 2DB3A 2IC5A 2IWHA 2JLQA 3RAPR 5TMPA 4IEEA 4A6XA 4AKEA 1A2KC 2AN9A 5BN3A 3BFXA 5KNCA 1JR3D 4DCSA 5KHOC 1P3JA 2EFHB 4ZCMA 2RGXA 3GJXC 3FWYA 2WV9A 3NWJA 3KKMA 2PZEA 4Q9LA 2PJZA 2ZR0A 8OHMA 2CLSA 1XPOA 5FOVA 4ASUD 2ZUCA 4U7DA 4QM6A 2EU8A 5E7MA 2OG2A 4B32A 5CDFE 3RC8A 1NKSA 1N25A 2WWGA 3GJ3A 1GNRA 2BMJA 3TIFA 1Z22A 4NU0A 4EJSA 4IOLA 4DZZA 2EFCB 1FMLA 4AY2A 4MGZR 3CNLA 3EW9A 4G01B 1DS6A 4Q1BA 3TQFA 4MDEA 3PFIA 1FUUA 3SI7A 4A2QA 4US2R 2CVHA 4BE7B 4KYIB 3ND8A 4FMDF 1KAGA 4P4SB 2Q9BA 4TL7A 4RY2A 2IUSA 2F3TA 2QORA 2QP4A 4KV9A 5CK4A 4D26A 4CDGA 4L8GA 3KL4A 3BERA 1II8B 2ZYWX 4OHZA 3B78A 4NL4H 1IN6A 2GDJA 1W44A 3IO3A 2WJJA 2FX3A 4DWJA 4PC2A 3VKWA 2J0QA 3AM1A 4MYTA 1XMIA 1IHUA 4QXAA 1W49A 3AUYA 2IYZA 1MKYA 3GMTA 1G3UA 2R9VA 3QEJA 2V8OA 1EFCA 1E9FA 3Q3JB 3RNLA 5B58C 4NDZA 2LWIA 4LCBA 4WBSA 3RVBA 1QHNA 3OFND 4NCNA 3SBDA 1OF1A 1BH2A 4JYCA 1GVNB 3RDPA 4B47A 1ZP6A 1P2VA 2CE7A 1KSJA 2D3WA 2QMOA 5G3YA 3CRW1 4AURA 1TUEA 4Q01A 4PHHA 4PAMA 2IL1A 4QM7A 4MDFA 3WMEA 1D2NA 2BBSA 4E07A 2YYZA 4TWZA 1V43A 4HYYA 4WIAA 4WVFA 5KDDA 3DKVA 4LDJA 2Q0HA 3SQXA 4QFMA 5HPYB 1VECA 3U44A 1UKYA 2P2LA 3I73A 3FHTA 5HR5A 4CF7A 1ANKA 3D7MA 3B13B 3H2YA 2I3BA 3QKSA 2J0UA 1FW6A 3EASA 1JR6A 1KNXA 4EFMA 1P5ZB 1PLKA 2FSHA 3OEEA 4FCWA 4Q19A 1Q1ZA 1XTRA 1RJ9A 3HPQA 3HU3A 5UKDA 1CIPA 2WWIA 3WY9A 2B7BA 5DI9A 1MT0A 3OFNA 5FPSA 3VKHA 1NLYA 1GIAA 4G1UC 3GJ7A 3HDTA 4DLUA 4RD4A 1YZTA 4BWYA 1ZCAA 2KBFA 2NPIA 4BLTA 3KFVA 4DDVA 4N3NA 4RCYA 2V4ZA 1Z6YA 2BMFA 4XTRA 4R2IA 3RLFA 1P75A 1F2TB 2W6JD 3W9YA 1QRAA 1DG3A 3U2QA 2QM8A 3HWSA 3N5CA 4PHGA 5JEEA 3R20A 5SZJA 2QAJA 3X1DA 2Q3FA 4DCVA 3IKJA 4EPWA 3EZ7A 4P3YA 1E2HA 3GEIA 3QXXA 3TSOA 5A5GA 4CEJB 2IUTA 4FMCB 1S9HA 3C14C 1ZJ6A 1JNYA 5GJCA 3GLGB 3U3KA 1OFTA 2BJVA 1G3MA 3PUVA 1MH1A 4KO8A 5EXSA 3LAWA 2J87A 1Z29A 1NBMA 3P32A 4O3MA 2QTHA 1AS2A 3PIRA 4LGMA 4RKEA 1XD9A 2RKOA 3QXCA 3GP8A 5D3MB 5JHHB 5IK2A 4ESVA 5JRZA 3SN6A 2ZYUX 4Z1MA 4A82A 2WJVA 3T5DA 1KSFX 2AHOA 2CL7X 3HYRA 1ONBA 3OE7D 3IEVA 2IS4A 1NRJB 4KBGA 1ZM7A 1N3BA 4B6EA 4QC2A 3EA0A 2XNDA 5KPJA 1G19A 4Z51A 3L2OB 2QGZA 3TRFA 2GWHA 3GD7A 1Z0IA 5TXGA 1XD8A 2ODBA 5BWMA 2ZM5A 5J4YA 3EIHA 5LDDC 1OXTA 1DVRA 2ODEA 1HEIA 5DIFA 2OESA 1GTVA 2NPFA 1LTQA 1II0A 3GJ6A 1P60A 2D2EA 1P62B 2FSFA 2G9NA 5A4JA 4CIDA 4ZCLA 2ZR7A 2RGBA 3U60B 3SFZA 4HUTA 4QNMA 3MWYW 3BK7A 5EXXA 5F98A 1W47A 4RZ2A 1DAHA 1UFQA 1I4TD 3P1JA 4XSHA 5KNDA 1BYIA 4OQXA 4C0KA 3SJAA 2QNRA 1TTTA 3ZD7A 4Q1FA 1XTJA 2D4HA 1DAEA 5K8LA 2QAGB 5G41A 4ERNA 3QJYA 4CT5A 1I2DA 2FMXA 3DMNA 3SJCA 4B2IA 1BOFA 2OE2A 5FPYA 2XEXA 4K46A 5SZIA 4C0BA 1DG1G 1G3IA 3EIEA 4LHYA 3KQHA 4BPBA 2ZI9A 4JBWA 4UNNA 4IFBA 4M9XA 4RD3A 3QKRB 5FUYA 2O8EB 3QPUA 4LJ7A 1D8TA 2WJHA 2RGGA 4F4JA 4IXMA 4HLQB 5TV2A 4DLVA 1DTSA 4B3BA 1DE0A 2CCKA 4BQSA 3EC2A 5L3SA 4CZ2A 3CONA 4NONA 3W5IA 3NKVA 2OV2A 3TNFA 3AGPA 3K1JA 2W2XA 2ZEJA 2GETA 3GLIA 1T6NA 2JCSA 3SYNA 1HUQA 1W0JD 4EJSB 3U7HB 1CJTC 1GG2A 2ZSBA 4IVQA 2AX4A 1I4DD 3L43A 2ANBA 2F6RA 1ZM3A 2SHKA 2NOAA 1XEXA 2QROA 3OEED 3BB1A 4Z8XA 5L8VA 3DHWC 4BFXA 2QSYA 4P4UA 5DE3A 2G88A 4E03A 2WZQA 1XCMA 3HU1A 1X8JA 2OILA 4JSYA 3ZZ0A 3KB2A 2P5SA 5FPKA 1KI7A 3PITA 1KY2A 3H84A 3ICEA 2PL3A 1OXVA 2EFGA 4UQOA 5F3WB 1UF9A 1OJLA 1GKIA 3L8YA 4LJ8A 4GBMA
chains in the Genus database with same CATH superfamily
1MEEA 4LFCM 4UUAA 3G9ZA 1OWOA 4MICA 5E4YA 4BUCA 2AKEA 3LDHA 3T4XA 4EBFA 2P5YA 1A2BA 5HF8A 1UJBA 1Z06A 4DCMA 3AF4A 4W5JA 4CM5A 2A7XA 2WFAA 2CWBA 5KJ6A 2H4HA 4J3NA 1I2ZA 1MW9X 2XI4A 4X3CA 2EP8A 5D5PA 2IZ1A 1Q44A 4IGFA 1OAOC 3IMFA 3RQIA 1MEJA 1IUNA 2I1LA 1WNFA 2GUWA 1K2VN 3A2LA 4U2FA 4WDRA 3PCRB 1ZCZA 4WFIA 3IGFA 4LWZA 3WR5A 5BUSA 2Q6LA 1TH3A 3G2HA 3DDNA 1YB5A 2HHLA 1VE5A 1X14A 3CW9A 4FS3A 2F5OA 4ZU1X 2GXAA 5A1TA 4N5HX 5CEFA 1YRAA 2W8BA 5CW2A 1AO0A 3JZIA 5HKKD 3FBTA 2V7BA 3CLRD 4JN6A 2UAGA 3SC4A 1YJ5A 1E0JA 2JFPA 3HBNA 1QHSA 2ZTVA 5KSPA 2P9CA 5IHPA 1QUFA 1X70A 4CM1A 1KRHA 5GP1A 1I80A 2NYUA 3O7WA 3N0TA 1NN1A 2FB9A 1XMSA 3G89A 3NBYC 3M5CA 4PWZA 4PZYA 4JI3B 5IVPA 4IOKA 4M1OA 1VRCA 1AQIA 1H0KA 1HNWM 4NBRA 3EEFA 1X38A 3UGKA 3GDGA 5T4HA 3FTCA 4DGSA 3NVKI 3RSSA 1UM9A 3OG9A 1E92A 3HKDA 1W93A 2BEVB 4JX9A 1KY3A 2CJFA 2HHCA 2Z8ZA 4ND8B 5LYJB 1E3DA 3R5XA 1KYVA 4LJAA 2O5VA 1QKIA 2WD8A 4L6CA 4LZNA 4RWZA 3SS9X 2P67A 4E5VA 5E9QA 1I5OA 4BMSA 4XVCA 5BUCA 2QY6A 1AZTA 1QYIA 3EVNA 4J1QA 4DE5A 4G41A 2AW3A 3KWMA 1VG8A 1Z75A 2BM0A 4GMGA 2H85A 2WD7A 1OAAA 2OD9A 4I3GA 1EUZA 5CJPA 3ROQA 3TQHA 1XMQB 2VUSA 2QM7A 2O9JA 1ACLA 3M49A 4AJNA 2B36A 2Q1YA 3B2QA 4EKYA 3QX8A 3GAAA 2XUHA 6REQB 1XAHA 5FFMA 5CG2A 1KEVA 1KZ1A 4NWIA 5LUBA 1EWKA 3RU3A 1CEYA 3KOZA 3K6JA 3F3KA 4L73A 1L7VC 4PFJA 4RGVA 5TEWA 3MJFA 2V6GA 5TF0A 3KTAB 3MCWA 3AETA 2D5LA 3BWXA 4E11A 2PDAA 1ZSNA 1OQYA 3AM4A 5A4IS 2GRAA 2EKDA 3M7GA 3Q5GA 5F2OA 1SQ5A 5DCUA 2C8KA 5ICSA 4HNAA 4YAIA 2Y1FA 2Y21A 2D8MA 4JQCA 4M88A 4AU1A 3QLUA 1IMOA 3ABZA 4EYQA 1DDOA 1E69A 3K05A 4KGXA 1LA2A 4ND4A 2B4AA 1MC8A 3A6ZA 3ASUA 3LRTA 3PUXA 4PZDA 2DQYA 3JVDA 3LVRE 1AUOA 1PYDA 1IY8A 2YV4A 3DGFC 4UNQA 3WFZA 3TWKA 4YMUA 5JADA 3R7NA 4H35A 2ZANA 2FA9A 2A35A 3EXFB 3WL6A 1KMHB 5LIPA 1BXZA 2PMFA 1K82A 2JB9A 2X8WA 3GA5A 3ND9A 5IBQA 3WMWA 3P9CA 3RE1A 4D4JA 1CYEA 1VXRA 1RCUA 3T9CA 4DSAA 5SZHB 4F3RA 5H3LA 5LJIA 3KOZE 1O95A 1II9A 1U3UA 3PD0A 2WIBA 4KMRA 3K92A 2E5LM 5T5QA 3FCYA 4MYCA 1I3LA 3KYCA 4KJZA 4B75A 1WE2A 10MHA 3QUTA 2XD9A 2AWNA 4C5BA 1KEZA 1HYGA 2HPVA 4FM9A 1IEVA 3NVDA 1TZCA 1EBUA 4CMEC 4BB5A 3CXRA 1E59A 4QKQA 2Z4RA 2PX3A 3ZDQA 1Z7YA 3M3PA 1IZYA 2E1RA 1U0TA 3NDPA 3REGA 2YQ5A 1U31A 4P4LA 4UBOA 3OLQA 3UJCA 4F12A 3TE6A 3MTDA 3PUHA 5JBQA 2EZ8A 3I1FA 1CR1A 2XV1A 2NU8B 1DRKA 1JAZA 3TQRA 2Y05A 5BV2P 3T3OA 2HYIC 1W581 3A27A 3L4JA 1NW5A 1X7DA 4C7XA 5DTJA 4Z1MD 4RTLA 3BXZA 3P96A 4MMZB 4C4AA 2IE0A 4GOKA 1XTUA 5HHTA 1AD2A 1YCFA 3RF6A 2VDNB 2V55B 4N12A 1I32A 3AJRA 3V34A 5IJ0A 3S5UA 5CCBA 1ADBA 3VGJA 3X1KA 3RANA 2VBIA 2NVWA 3FKSD 2X58A 3FYHA 2EW1A 1THTA 3BCRA 5KSYA 1ESEA 1ZCBA 4GZ5A 1JFRA 4OJYA 3M2TA 4II3A 1NTOA 3GPPA 1K7SN 2M2IA 4L2IB 4P58A 5DJ5A 2HQSA 3CE6A 3EGXB 4B6OA 4E08A 2O8BA 4M8NE 2C2YA 1ZX1A 3CSSA 1V7ZA 2WUGA 1BMFA 1IZZA 3G2IA 2WPDD 1SCQA 4Y9SA 2JKVA 1N1MA 5DX1A 3W68A 3MIZA 1R2QA 1W4LA 4ID3A 3V32A 1O8CA 3BREA 4WLFA 1EPUA 2ZQ5A 3C3JA 1P4SA 2WAMA 3H5LA 4PLFA 4B3RB 2FPOA 1FSSA 3WB1A 5KPDA 1WUKS 3X1YA 5CLJA 4HB2A 2CL0X 2YRFA 4JSRA 4X20A 4DLLA 1S3IA 2HK9A 4B35A 1G17A 3GLIB 4LFCB 1YZVA 1VSQA 5L3RA 4JI0M 1EA5A 3N58A 3SR0A 2JP7A 2C3YA 2I99A 2JKYA 4Q1AA 5IMSA 3TUZC 3GX1A 4P98A 3SE0A 1G7TA 1JPNA 1J39A 4UEQA 4JI0B 4LPKA 4B7GA 3IV9A 5KOJA 3PEYA 1CUWA 5IASA 1W75A 3N05A 5BOSB 3RHZA 2V7XA 4YPFA 1N1DA 3C3MA 3CX3A 2O0LA 3L0DA 1BSVA 5EEGA 5HCNA 3TZHA 4E6PA 2AGVA 1LDEA 2EKFA 2EBHX 4CIBA 421PA 5IT5A 4CGZA 3K1ZA 1ORHA 3GVCA 1CQJB 4LX0A 2LBCA 4NK4A 1ZNZA 2JY6B 3E46A 1DCFA 1J8FA 1VJGA 2NWQA 2PUTA 2QL5A 4M0EA 4PRZA 1H3EA 4LDQA 3B1YA 3VVMA 3ZX4A 3RAEC 3TMYA 4G23A 4D9FA 1OLUA 3DZKA 4OXQA 2AX3A 3G8AA 4MYSA 4XWGA 5C9ZA 2DMRA 5J5VA 4BIMA 3D6JA 3T1YB 1K7XB 1P61B 2GQFA 3NW9A 2PH3A 2PEYA 1SURA 4PCLA 4RHCA 5EL0A 5G0UA 5LMZA 2J31A 1QU3A 4G36A 1SQSA 1ZGCA 4TT3A 1VE6A 2LKCA 4PU0A 3E22B 4WK0B 2MR6A 3QKIA 4FFBA 4KREA 5CTAA 4YPVA 1ZXBA 1M8GA 3SZOA 3IP5A 1LK5A 2QX6A 2XAUA 4DUGD 4N48A 1SHZA 4BO4A 1NQWA 2IRWA 3B48A 4ZHQF 4QNNA 1Y8RA 3BTOA 4CKZA 1Y8AA 2EIHA 3GP5A 4WCVA 1HZJA 1NQUA 2GF0A 3OQNA 3BMQA 3AJAA 3RAFC 2RH5A 1KMCA 2IHZA 1V26A 4E88A 1B16A 3GRUA 2ICAA 3ZD6A 3DXFA 1RXUA 5DI3B 4UUPA 3B9QA 1MCZA 1WCIB 5I7HA 5JJ5A 3PVSA 2OHVA 3HB5X 3ITEA 1ZKDA 3LQ2A 5T3YA 3IJPA 4WDQA 4BV9A 1L2BA 3FNGA 3HX3A 3HZJA 1XA4A 2LVQD 3QVGB 1BWRA 3VSBA 4UN2B 3THYB 2QRMA 4PQEA 4BLRA 1RRCA 3O1LA 5JWHA 3N2IA 2ISCA 4UNSA 2XECA 3QBTA 1UPXA 1VJ5A 1ZMVA 2ODWA 3VDPA 2X13A 2ZI6A 4BKMA 5CAEA 1IN8A 1UT5A 3NBIA 2CJWB 2PG3A 3H86A 4XH9B 5J63A 3UWKA 2AJBA 3OCUA 3D5QA 4PO8A 1PK9A 4BV2A 5A4KA 5HA5A 5DF1A 4KIWA 1KQFA 1FNBA 3GEBA 3KQTA 4LXYA 1JE1A 2W6QA 4QPCA 5AKJA 4Q3EA 4KRFA 2BEVA 3STUA 2LTUA 4A4DA 1RQ7A 5AHWA 5HIJA 3WZLA 2PSJA 4YRNA 2JBHA 1M6NA 3I2YX 3O4IA 2VJYA 1H1TA 3PTZA 2BEWB 1RTTA 3EOAI 3WB2A 1G8GA 1X7YA 4EGSA 5LQCA 1AIPA 4Z2AA 4GXRA 1GJSA 1TC2A 1STOA 4OBBA 1A2QA 1FYWA 3EVCA 3M0EA 1VIMA 2VP0A 3FMPB 4QYIA 4NXMM 3ECSA 2H92A 1SXJA 2V6BA 3JQ6A 5CT5A 4YX9A 5EJEA 1SUAA 1G5HA 3TX2A 4URZR 1JFFA 1DV1A 1ZI9A 2C9YA 2P7IA 1H6AA 5H3HA 2WY2D 5GGYA 3DDOA 1J07A 1KAMA 3D6TB 3H3XA 3G2KA 2HNBA 4G5SA 2B8EA 5HKBA 2X0DA 1AQNA 2A58A 4Q1VA 4RYDA 3BYZA 4J0DA 2CBZA 4I2VA 3CN9A 2HJWA 1CDOA 1QKKA 4UU1A 5DTIA 4ZVPA 4ONEA 4R9SA 1NVMB 4GLBA 2JFNA 4M1KA 5KAMA 2G40A 2LIVA 2PS9A 1WP4A 3IPYA 2XCUA 2VHVA 3IECA 4O29A 3PIIA 4DAOA 2WV7A 3ABOB 5DDIP 2E89A 4GWKA 4BP9A 1AIPC 3W2GA 1KYIA 1PNQA 2D2FA 2X2PA 5I4BA 5JALA 3SY8A 4QUBA 1ZHOA 3H05A 1II8A 3CY6A 1R2ZA 1JZTA 1KGSA 1KZ4A 3N9IA 4KYVA 4QOGA 1MAUA 3GOHA 3EXG2 1OT3A 5K0GA 3BAZA 4JQOA 2ASEA 2K7ZA 3DD5A 1BYUA 3D54D 5AM5A 3FB4A 5FNVB 4YRLA 1Z68A 1HE8B 1NL3A 2P90A 4LRXA 5H0IA 1JYSA 2XXJA 2XA2A 4EPTA 5CXQA 3J81S 4DG8A 4JBHA 4X1YA 1HE5A 1MRNA 1TVMA 2JDIA 1I51A 4IINA 4LMAA 4KR9A 4D4IA 3JQRA 2DBRA 4QOEA 3GFRA 6ABPA 4X66B 2FE1A 4GITA 2K6BA 1USIA 3LT2A 2FZGA 4GPAA 3HKCB 4I55B 3V4FA 4CV1A 5C8XA 2B83A 3A9CA 1EG2A 2ZIAA 1JW9B 3A1NA 3IB3A 1RMQA 5SY9A 4FN4A 3A70A 4EB6B 3ESBA 3HACA 4KQXA 2UXCM 4TYPA 1CEQA 1IMJA 1E5QA 1C7FA 2B1QA 1BS9A 2G6BA 4XFDA 4DSZA 1CF4A 2OG1A 3EPRA 2ZE5A 3ZBPA 3N70A 1UPCA 1XJQA 2EQBA 4QDUA 3PICA 3SFVA 4B2LA 1Y3FE 4HVLA 1CERA 4DBZA 3BMNB 3DXXA 4NU6A 1H2EA 3HO6A 5KTNA 4K6OA 2GLTA 1MTZA 1ZVKA 3EGXA 1EMDA 3HHWA 4N6OA 4P81A 4U7TB 3RUFA 2O8BB 4YQZA 1FP4B 3ETJA 4P17A 1MT3A 1Z5UA 4CG2A 3L4EA 4CMHA 1ZUHA 2EW2A 2P11A 3F3YA 1IXSB 1A98A 1TUBA 2Z9CA 3L6CA 1A8QA 3NC0C 4NEHB 4E15A 5C1OA 5HQ3B 2EDCA 3IIMA 5AK4A 4OK6A 3UA3A 4ZYYA 4EKDA 3FVWA 1ZOIA 2G9VA 4FHGA 4U7WA 2AE1A 2OA0A 4F6RA 4ARBA 2EOAA 1MO6A 2C00A 2CN1A 1CJVC 3LKBA 5BNIA 5EYPA 4H0FA 4OJNA 2CHVA 4HCJA 1ZA2A 1AKMA 2EA0A 5KQPA 2QUAA 2YOGA 4UHJA 2C3UA 4K6GA 5C5EA 3IDQA 1X1SA 1NVMA 4A03A 1QB7A 3GPIA 2H1FA 1VTKA 2P69A 2IA5A 4YACA 1Z0AA 3IT0A 5DIZA 2D2VA 3HVUA 4HDAA 1ZU5A 5E1BA 1GAQA 2FN7A 5G40A 3Q8MA 1WW2A 4QYWA 3W6OA 1AUVA 3MBOA 2RHDA 4V0SA 3VDNB 2FJUA 2H5LA 2CXNA 2CLDX 4MIOA 1SCIA 2JFUA 4XDZA 2XSZD 1LRKA 1WETA 5IJ9A 2I2AA 3CHYA 2D2IA 1U99A 2N46A 1Q11A 3HDHA 5U4XA 5CFZA 2AS0A 2AL7A 3KJFA 1TAUA 5K0SA 1NG1A 3NEAA 4KITB 4RTPA 1P29A 1M7HA 3L8CA 4GOMD 4R1QA 1T2UA 1G7RA 2H17A 2PAFA 3LWDA 4CKEB 1WY5A 1U28A 2W2KB 2ZYSA 3TZKA 2E55A 1RHQA 1FF9A 1PEDA 1VBNA 2C83A 2I4LA 3MTJA 4GNKA 5JAUA 1SKQA 2QUZA 1WXQA 4OHFA 5LBIA 1WB4A 1E99A 3L0IB 1VM6A 1BVUA 2FEKA 2PVCA 5AKGA 4PQFA 3RS7A 1H9CA 1EZ1A 1T0BA 1WLYA 2P9BA 2VP2A 3OTGA 4MVJG 1C8LA 4J0KA 5AW4A 1HE4A 5AR1A 2NQ2C 1F9EA 1WGLA 4KDCA 3M1YA 2LHCA 2GSDA 4YRTA 3FHLA 1RI1A 1QYXA 1Z7WA 1JQKA 3FOFC 3AHIA 1YSYA 1MB0A 4JLJA 2O1WA 1BC5A 4DSOA 2GPBA 1GGEA 2IYFA 5DNYB 1IK4A 2OQRA 4RL6A 2W93A 4W8OA 5LLSA 3ZBUA 1UH5A 5I51A 1RFGE 2KBEA 2QYTA 4TVKA 3ADPA 3L40A 1PJSA 4ZDWA 1H2XA 5JDIA 4RA9B 3M6UA 4FYVA 2C4KA 2J0VA 5DCYA 4ALKA 2W98A 5FAXA 5GQSA 3V1MA 4K3VA 3VR6H 2WF8A 5DHRA 1E2QA 1SZPA 2PV0A 3BE5A 2NUTA 1A96A 5FOXA 1PCXA 2YZKA 3E2MA 1CUBA 4C6TA 2B0JA 1UP6A 4G1VA 4BO3A 2RB5A 1VE1A 2VBCA 3S1AB 4OAQA 3SOZA 4S1PA 1EUQA 2A5FA 3KPVA 4BN4A 1DARA 1NWHA 4J91A 2DAGA 2EG5A 1XHFA 4C0XA 1A2OA 3DAFA 4KYUA 2Q8QA 2I2DA 1GFIA 4F4HA 1XLTA 2AT1A 1C4WA 1NJSA 4A23A 4ABYA 4ZTZB 4GQAA 3OTIA 3SNKA 4HV4A 3BVPA 5F21A 4LMPA 2BDEA 3RPEA 2NSHA 2GAOA 4N4AA 3VTKA 7REQA 1CQWA 2A2ZA 3OWXA 1MB2A 3LX5A 4QU5A 3GWZA 4EAQA 3ZX5A 1ZICA 1ZFNA 1W96A 4EQ6A 2QPAA 4MW1A 2BEUA 4EG5A 2P6RA 1WMAA 3EUAA 1OZ0A 1SUDA 3LT1A 5LMUB 3Q7QA 2JNWA 4UXJA 1L4NA 1ODJA 3Q3HA 4UE3S 3TW8B 3A2KA 5JD5A 3C9PA 4QA9A 4QPPA 1QJCA 4XE5A 2FQXA 1WUHS 1XOIA 1ZGBA 3SYMA 1QRDA 1B00A 2W58A 5AI6A 2ZJ4A 2ZRKA 4WOPA 2WYUA 2FEXA 4JWKA 4EG0A 5JBNA 3PJRA 1QCZA 3KP1A 4M0KA 3WYAA 4BWFB 2NZ2A 2O8FA 3VSDA 4OAOA 3WI7A 1E5TA 4NSNA 1ZWLA 1T1EA 2RK3A 4MPJA 3S27A 2H9IA 3T94A 3U1VA 3T6KA 3SHFA 2W6OA 1F8UA 3T7IA 4CKWB 1TH2A 4L3OA 1YWGO 3DV2A 4P0QB 1UL1X 1FTNA 1I36A 5B6IA 3OQPA 6REQA 3IILA 4FC6A 4ZANA 2FW8A 5JXGA 5JJIA 1GFSA 1RNLA 1MBZA 2NXEA 1ULTA 4YIKA 2X1HA 2G04A 3TPFA 2R1VA 2E9SA 1VHDA 2X8JA 1FQWA 1M6VB 2Y8EA 1AXGA 4GGPA 5TS2A 3DL4A 5FORA 3TECE 3CB2A 3ZU6A 3PEFA 4CMCA 1YOVA 4RDXA 1QNLA 4F5WA 1ISPA 2BGJA 4J0HA 4KSCA 2F00A 3VHXB 4DXHA 1LDNA 4XR9A 5HZKA 1WEKA 3AEUB 1Y6FA 2YL2A 3F2IA 1R27A 1MQ8B 1J56A 2W2KA 2ZRIA 2W2LA 4HN9A 4JJAA 4EEKA 3K6SA 4AS2A 3PIDA 4PYOA 2JAHA 3EZYA 3TX6A 1DFGA 1G20E 3UOAB 2VDJA 4V3BA 3U7FB 4X93A 3KWJA 3HHEA 2ZATA 1P1IA 3CUWA 4IJQA 3T7SA 3ZLUA 2O52A 4Z3DA 1ENYA 3B7QA 2ZR9A 2J41A 3P8ZA 4COKA 1C8VB 1MV8A 3A4LA 3U3JA 2E5WA 3DYIA 2FETA 4ZQIA 2AHRA 2OFPA 4R16A 3QNUA 3ELYA 1L5KA 2DHDA 3THXB 2BTEA 1B6RA 1XJ0A 3M9XA 4TL8A 3P2YA 5KSOA 3C74A 4RULA 1TCCA 2GM5A 2HPZA 2GCOA 2JA1A 4ZFNA 2ZIXA 3QUSA 4PZ0A 3OUUA 2H2WA 4CNBA 4RQTA 4YRRA 4EB0A 4DR7B 1TA9A 4KQMA 4Z5XA 4TYWA 3M82A 2CEKA 4DV0B 1UAGA 2QVZX 2JC3A 1DMRA 2H8GA 2PCJA 3DOOA 4MVJF 1VYVA 1W2WB 4G5YA 4WFQA 1B41A 1HZZA 2ATIA 6PFKA 4KDRA 1UJ2A 3VX3A 1G8SA 4RA6B 2GJ8A 2ZLBA 4K6MA 5GJWC 1NJGA 4FGLA 1CR6A 1C1XB 3PR3A 2FUNB 3OCWA 4XQ0A 2D5AA 2FFBA 5TSDA 4YT2A 4HNUA 4MQMA 1TCAA 3PKJA 3EUFA 2PFSA 4NYJR 1JB9A 1GPYA 1X80A 2B0CA 5HQ3A 1MTOA 5DNDA 4JFRA 1KMHA 3WXBA 4JLPA 4KXVA 1R0XA 2XYQA 3FXAA 1R0CA 3KKLA 1FNDA 2Y1GA 3DUFA 2QLFA 3LLSA 4IXTA 4BBJA 1GO2A 5CXSA 5JJCA 4RTJA 2JGRA 4IOMA 1JLHA 3PKIA 3L82B 3JYPA 4IF4A 3DVSX 4Q3CA 1RQXA 2NV6A 5BT8A 2PT9A 4C1BA 4Z0NA 1FE8A 3EMDA 3IC5A 3RVSA 6LDHA 3IAXA 2GT1A 3WIOA 3SDBA 1TA0A 1T36B 2YHAA 3EMKA 3HNPA 3SAWA 2VNKA 2ZXEA 3SGLA 3CO5A 4EG3A 2FXVA 2CNKA 4PNHA 3UTDA 1H4VB 2HCFA 1PEAA 4YR7A 2PU5A 1IN7A 5KIAA 2YYAA 4WBNB 4WQMA 3TDNA 4NXNB 3V2GA 3E9ZA 1YR3A 2YWFA 3GNTA 4CMJA 4E5YA 1C3XA 2DAIA 4AJ4A 5K3BA 2O0HA 3L26A 3N2EA 3ZWQA 4HLQA 4I4TF 2ZBVA 4PIPA 3TZLA 3UWOA 3OF3A 5CM9C 1IE3A 1NHWA 3MWLA 1P7PA 2ZSKA 4N7JA 5LB2A 4EFLA 1EX6A 3DOFA 4C76A 1UWCA 5JY6A 1I0ZA 3LWNA 3LE8A 4ARZB 1K66A 3WDLA 2XYVA 5EWMA 4JJGA 5T8KC 5CB0A 3V33A 1M0WA 2HGSA 4TT3D 1VEJA 2PBFA 5AQ1A 4UOZA 1IBKM 1FCJA 3GCGA 4Y2TA 2Z3WA 4KFTA 4OY3A 3VZRA 4DYVA 1PYGA 2O6HA 2I7VA 2F8LA 4UASA 1FP7A 5T4EA 1IUKA 1JYFA 1Q14A 2OMKA 2ZIUB 4JR1A 1ABBA 3GLGA 1KK0A 1FRQA 1T2EA 2HA7A 2ZYHA 3IQDB 4AKSA 4W5QA 4HAUA 2VSOA 1LK7A 2VP5A 4RZSA 4N3AA 1I4LD 4RKRA 5EHGA 1R64A 4KR2A 4I4LA 4IO0A 3AKDA 2P2SA 2RGNC 4K03A 1AGRA 4R1UA 1ZRHA 4BGVA 3AKZA 4BO9A 1R5NA 3EA5A 3ELWA 4DR2B 2C7PA 4U4AA 3U60A 4FE7A 3AONB 3GFGA 3OZXA 3B3GA 4MWZA 3BWMA 5JU6A 1KO5A 1UBNA 3MAGA 5G4KA 2PJDA 2G1PA 1XRLA 4HDNA 2R1UA 2CUKA 4ZXPA 4QLOA 2CJPA 3B9PA 2PGOA 3W5DA 1UZNA 4JUDX 3U5ZB 3DL7A 3WGGA 2WTMA 4Z4CA 3KLOA 3R3ZA 1SU8A 3V97A 2AVDA 2IIQA 3A4YA 3G23A 3VJLA 3BBLA 4OQZA 2Y4OA 3T0IA 4I55F 5A3VA 3TFWA 2X40A 2EV9A 3A04A 4YC7A 2QVCA 5DH9A 3WLSA 2P6UA 3K0CA 4CV2A 2ZKIA 3V6MA 4BMCA 3WSVA 4D3DA 1KJWA 4EKIA 2RIPA 5CT9A 2C29D 2FRDA 2IP1A 1L5RA 1OYYA 5LXTB 4DT1A 2AFIA 3IA2A 4M0PA 5F1KA 2GYUA 5C8DA 2VT6A 2QG6A 2F5NA 3N8IA 4CM4A 4ZV9A 1U5AA 2CFRA 3PDIA 4AUKA 1PFGA 2EXXA 3JYNA 3W6NA 3QEBZ 2C4NA 1OXXK 3L7OA 3GLQA 2OTCA 1W94A 1XVVA 1Z17A 5KDOA 4QXPA 2GBGA 2H65A 3GOQA 4DUYM 1OH8A 1U0SY 1N2CE 1VL0A 1CS0B 5SY4A 4Z7NB 5KTPA 1VPLA 4F0JA 4PCVA 3F47A 4GC9A 5JROA 5EXPA 2NACA 4RVCA 3E6AA 3GRFA 1JEEA 2NN3C 2O2JA 1L4BA 2WINI 2YS7A 3KOUA 4LBVA 4LZAA 5GIOE 4YDHB 5JVDF 5L53A 4IMPA 2VHTA 1KI1A 2WKPA 4D5GA 4CF5A 2PGIA 3I45A 1QYCA 1UCFA 1VCHA 5K1ZA 5CLIA 5F9HA 2R1ZA 5CG1A 1M34A 1SUBA 4UMFA 5HCUA 3WIBA 2IZ5A 1Y48E 2D5IA 2H4YA 3GLRA 3MWDA 3BWBA 1XLUA 5CH3A 1AKRA 4ZOQI 2XNSA 3N6XA 4KPUB 1ZGHA 3E61A 3HUDA 4G0VA 1XDBA 2BFBB 2C97A 2H7XA 4NPAA 4RCVA 2D1RA 3D0QA 3IEUA 3LC2O 4UM9B 3O3CA 3FWZA 1O4VA 4IGKA 4X95A 4C78A 5BV8A 5B2FA 4LY9A 3NDRA 1ZNQO 3GUYA 4FBGA 4JVSB 1C9JA 5AVJA 4MZXA 2WM2A 4J0CA 2EKLA 4BQNA 1Z3IX 3H16A 4H6WA 2ECPA 3LPCA 1DIRA 4US1R 5EZSA 1CVIA 1G7SA 3QK7A 4JDUA 3VNRA 3DVAB 1V5EA 3K7EA 1KEPA 1L6IA 3N3AC 2BR3A 1YQDA 2P91A 2WD9A 4U3JB 3SEZA 1C5KA 3CZCA 1MOSA 2PMEA 4QASA 1IJKA 1EFHA 5FLXA 4XVQA 4AMVA 5E26A 3KKNA 4QXMA 1D2EA 3LK7A 3TQIA 5LA6A 5F2NA 1PR5A 5H81A 4DLWA 3O8DA 2ZRGA 2J6CA 4X65B 3TKYA 3B7ZA 1Q2XA 2XOKA 2X0EA 3V6LA 3WLRA 3OLZA 3BMCB 4TUWA 4OIFA 3VNUA 1UM8A 4MRAA 3H0KA 2QRNA 4KN6A 2JAQA 1N6HA 4PGMA 4WINA 1TEXA 4ZVLA 3SAJA 4R0NA 4QYMA 1PE0A 2XOXA 1NF8A 4A8JA 1IBKB 5DLDA 2GZHA 4Y2UA 1QBKC 1TTHA 4IZOA 3ER8A 3KK0A 1B8PA 5H7XA 5G53C 2GCIA 3F7MA 3KUDA 3LUBA 1M2EA 4S2UA 2QLMA 2C2GA 3A4NA 1H3NA 3L0PA 4KV7A 5EZYF 3SEAA 4JMLA 3JALA 3KQSA 2VRWA 1LBQA 3A32A 1DJQA 3H2ZA 2D06A 4G4SP 4L15A 1KXJA 5FB3A 4CLOB 1T5BA 3VO2A 1C7IA 1MX9A 3NS7A 4DQKA 3KYJB 5JZBA 1AOXA 1YB2A 2RK6A 2YHSA 1NX9A 3QFSA 4Q16A 2V7UA 5CX4A 4ANRA 5GVRA 1JFLA 1FOEB 4D41A 3F71A 3R3YA 4K9MA 3WAGA 4RM3A 1EVZA 1Q21A 2NU7B 3OKCA 2W83A 3AKEA 3KFXA 5DHQA 1RXVA 1NTRA 2YMLA 1QLHA 3RYIA 1KAOA 4BXOB 3GEPA 1G291 1KMNA 1NP3A 3GLFA 2HA6A 2XUZA 5AT1A 3IOEA 1PZXA 4LDNA 2HZBA 4ZOEA 2JBWA 1NI4B 2OL4A 5KDLA 3A98B 1JBKA 4BKPA 5A0TA 3NJ8A 5EP4A 1K0UA 3MRVA 3Q8XB 1CY0A 4IHQA 1L1QA 3HL4A 2XADA 1MAAA 3GARA 3VJMA 1CULC 3KOXA 4GPIB 2UUAM 3HKEB 5KO2A 5AI8A 3JWHA 3CBGA 3AG5A 4MKFA 3JVEA 1W7AA 5TNXA 1PTJC 4N82A 3VLFB 1E5DA 2BWEA 3KTDA 3BD9A 2Q3JA 1VMEA 4HLUC 1AMNA 1CNEA 2GZRA 3PWKA 2WSSA 1XAJA 1ISIA 1WF3A 4ZU3A 4U0JA 2F2TA 4CEJA 5EP3A 4JJKA 1ZMXA 2IF2A 2DVWB 3UGJA 4Q39A 1R15A 2VT7A 2DH6A 1BFKA 1EM8B 3KS8A 1GY8A 1EVIA 2W2VA 4GDFA 4JB0A 2YFYA 5JSZA 4OJQA 2ID7A 4DSUA 1OIZA 2ZR8A 3N8KA 4EF4A 2NO1A 4N6GA 3ZWCA 1GA4A 1LSUA 5FPTA 1XC8A 1MXFA 1F2TA 2DZNB 1JHDA 3H9CA 1WAMA 1T5LA 1N0VC 1E7WA 2P2NA 5ABPA 2RAPA 3PDIB 1ZNYA 4K9OA 5CDUA 1TF2A 2A8YA 4NBNA 3DMGA 3EZNA 4TTSA 1LH0A 1IRIA 3TOXA 1RAHA 2HU5A 1ZM2A 2NUTB 3IHTA 1G8YA 4LXUA 2N35A 2HCJB 4OHUA 1L5OA 4RJ2A 4YROA 5D7BA 4ZP1A 2X8BA 3KOXE 1COWD 1RXCA 2I4IA 3L2AA 2Z5FA 4RA9A 3DM9B 4QJIA 3ZE7A 1T9GS 2E4XA 2N42A 1DWQA 2JIZA 4NDNE 5F4BA 2WJ3A 4W5RA 2X0IA 3VNSA 1NWCA 4F3TA 3UJ6A 4J0EA 4D98A 1DRWA 3K8QA 4DLKA 1DOAA 3UW3A 5H59A 3KBBA 3CR7A 1XB2B 1NXXA 3HA7A 5CHEA 3KE8A 1SHUX 2X5OA 2Y4NA 3DOCA 1Z2CA 3GZ4A 3NLLA 4NLLA 3O9VA 4K81B 5ADWA 4TMWA 4EY6A 1W0JA 4IGEA 2ACKA 1JWAB 5G0WA 3JQAA 4M8SA 2QLNA 4RHEA 5EHXA 2DUJA 2I33A 4AW9A 2VSYA 2NO9A 1LTMA 3LHDA 4KR0A 4LSGA 1NBME 3RT9A 3SBOA 1DAFA 1JVSA 3MPUA 3U26A 1SVSA 1W5EA 2UVPA 4DC0A 4UBNA 1JXQA 4O4IA 2E5LB 3SHTA 1CP2A 4FR0A 5ITZA 3A45A 5E3HA 3WKAA 1WRBA 3ASZA 4JI6M 3IQWA 4C3UA 4CDRA 1Q17A 1Z4OA 2OM6A 2V6JA 3DBIA 3KPWA 3PFHA 4B34A 1CDEA 1KA9H 3MAAC 2WZJA 2Y1LA 5L6LB 3NTQA 3VOSA 1JLLB 1CDDA 3BMOB 3R9WA 5FL7A 1OAOA 1R6AA 3LZDA 3QE4A 2W48A 3K4PA 1GL7A 3CUUA 1YDWA 3QEMB 1QMPA 2J08A 4CJ6A 2QWXA 5D84A 1M0TA 1SKAA 4C6HA 4A15A 1JEYA 1LPOA 3ZI4A 2DBQA 3FTNA 2AN5A 4AUEA 3U6KA 4R2HA 2KSQA 1KZ6A 4ILKA 4WOJA 1OBVA 2BGTA 3E8XA 4B3TM 1BHJA 1FDTA 1JLKA 5B2ZA 5AESA 1Y6QA 2TMGA 1NSYA 2A88A 2J4DA 3AF2A 3MIIA 3INTA 3NBUA 3T7DA 5HFAA 3QVVA 1NQAO 3TL6A 5E3IA 4V0KA 4MRSA 1Z47A 4AB1A 2C7OA 2BGMA 3OU6A 2AYZA 4MIEA 4DCGA 1QX3A 1AKYA 1IFXA 3GEEA 1X1AA 1UQRA 1LNZA 1THGA 2C8VA 1FDIA 2G25A 1K9SA 1J0AA 1E3TA 2O0JA 2R8OA 4QNRA 1XVUA 2B3DA 2FTKE 3KXIA 4DIFA 4EVSA 1W4CA 1DEKA 1TYCA 2BM8A 2FI1A 2WFZA 1E1QA 1LF5A 2BELA 1JJIA 4JKYA 4WNCA 4CEHA 2P3QA 2C2KA 1D7OA 1P7CA 3R6GA 4E4RA 4IIWA 4HRAA 3BIWA 3MWDB 4ENSA 4IJFA 2HF8A 3GUZA 4GECA 2BI4A 2EF0A 1WDLA 4PX9A 3ZU2A 5C8YF 5K9ZA 2FWBA 1W88B 4JLVA 1YZYA 3OH8A 2I0FA 1G98A 3KJEA 4MV0A 4R98A 4AZTA 3ZWKA 2CNOA 3UJ9A 3KELA 3N53A 4MVJE 2WIFA 2WA2A 2ZSJA 3U61A 1WXIA 4PDIA 3RVJA 4N39A 2C82A 2ZK7A 3FPCA 1VMIA 2ZRBA 5IDQA 4EATA 2VN8A 1M2FA 5KO3A 1PJ8A 5JSFA 1Y37A 4KRYA 1QFXA 4X63A 2W2NA 2NUPB 3U17A 5J2UF 4EG6A 3DZ8A 2ZS8A 3A3PA 4C9BA 1Y4UA 1LNSA 5FV4A 3CLRC 1CXZA 2IUUA 1EFUB 4Y2GA 5LQRA 3DOIA 1CR2A 1TF5A 2M6RA 4M9ZA 4BQEA 3HBLA 1PDOA 2G72A 3NV7A 3TIIA 3BQ9A 3JASB 3V8VA 2P77A 1ST3A 1XL1A 5JAMA 3AGQA 1Y63A 4BVEA 1RPZA 4YO7A 4JVOA 1RQPA 2YHBA 3R0VA 1VOTA 2CNLA 2Q62A 1PJQA 1GA6A 1UMBB 1JZSA 2CW5A 3K72B 4CF6A 5K0CA 3FSRA 2FX2A 1GNQA 3GIDA 1V16B 2DVMA 2M60A 5IVDA 3QEKA 5EXEA 4C7MA 3H0CA 3NT4A 1N7HA 1K2WA 3KLBA 3RFWA 1XQ9A 3K8YA 4GPTA 4A0FA 2GN4A 2X14A 3M3DA 3A9WA 4FEAA 4V0ME 3MS2A 2JH9A 4B8ZA 4DV4M 3DOUA 4CWAA 2ZB7A 3FYDA 1E3WA 2J3IA 2OO5C 1GKKA 2UZ0A 3HCCA 1D0LA 4YJ2A 3K20A 2Q1WA 4P8RA 2PUFA 1YFKA 2DSNA 3ZDEA 3A6FA 4JZKA 2QZPA 5BQFA 1M0SA 3WLOA 1OFVA 1ZAYA 5AJWA 1GGVA 3NHWA 3NETA 2NO6A 3A7EA 2X0JA 1KFKB 2M1ZA 3QIAA 3PUJA 4Y3UA 5AM1A 4CR7A 3BXWA 5JSUA 1FFSA 1J8MF 3KCQA 3O8OA 1PR6A 3GAFA 1WW8A 2OFOA 5K0TA 1Z2OX 1BQEA 5B7PA 2PSEA 3DPUA 4JD5A 4RK5A 3E9QA 2WJ4A 5CJJA 3VHRA 3IR6A 1FSPA 1O94D 3ND6A 4KFSA 2XODA 1FVOA 3KVOA 2CZGA 4J2HA 5BO5A 5A71A 1CC1S 4L9WA 4DCPA 3U7IA 2I9KA 1JJ7A 2DTEA 2VQ6A 1A69A 2UYYA 2VQEM 1CT9A 1ZD4A 1D7AA 1N6PA 2XJ9A 2ZROA 4LE0A 4YAFA 2EZTA 3INRA 3O8NA 1CDZA 4X45A 1A7AA 5IABA 1F6DA 1V7PC 4YECA 4Z7QB 2QHOB 1EDZA 4IIJB 2LV8A 2WVAA 3ZTWA 4OCZA 3RJMA 1JBEA 1Q6YA 3L0OA 3TJRA 5BQOA 4OL0A 5LYJF 2F7SA 4H4EA 2DECA 1YDFA 4DLTA 1MW8X 3ZY4A 3GBVA 1XRMA 3JQCA 1BAPA 3C8UA 4ARVA 2H2FA 2HJ9A 1G4UR 2VAPA 2J7KA 1VJCA 2XTMA 3BFKA 1Q1BA 2OWEA 4KSBA 5KWSA 4NYJQ 2QGNA 4WT7A 2HKJA 5H80A 1U02A 4ML3A 3EZ6A 4UUMA 3ZYCA 5IPFA 5BW4A 1XDZA 3PEWA 1YVPA 3ZR4B 3JZAA 4XWTA 3IEPA 1MVNA 1YVDA 4FOLA 4H7DA 4JODA 2GK4A 3EGOA 2ZQYA 4ZMBA 3ETLA 4INPA 1H1LA 4WY8A 4B79A