3TE6A

Crystal structure of the s. cerevisiae sir3 aaa+ domain
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
316
structure length
304
Chain Sequence
PNADINLEESIRESLQKRELLKSQVEDFTRIFLPIYDSLMSSQNKLFYITNADDSTKFQLVNDVMDELITSSARKELPIFDYIHIDALELMDALYEKIWFAISKENGDISLEALNFYITNVPKAKKRKTLILIQNPENLLSEKILQYFEKWISSKNSKLSIICVGGHNVTIREQINIMPSLKAHFTEIKLNKVDKNELQQMIITRLKSLLKPFHVKVNDKKEMTIYNNIPDNVIVINHKINNKITQLIAKNVANVSGSTEKAFKICEAAVEISKKDFVRKGGLQKGKLVVSQEMVPRYFSEAIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the role of the Sir3 AAA+ domain in silencing: interaction with Sir4 and unmethylated histone H3K79.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
molecule keywords Regulatory protein SIR3
total genus 88
structure length 304
sequence length 316
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17872 AAA_lid_10 AAA lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1280 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3te6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3te6A01
2ZYVX 2R6FA 3UMRA 4QGAA 3KB2A 2VP9A 1KO7A 4LHXA 5J40A 2ZRHA 4RD6A 2ZI3A 5BN3A 2B8WA 2ZAOA 3L82B 4G0NA 1NL3A 2WJVA 3REFA 5HCIA 3IILA 5C2JB 3EZ7A 4DWJA 3EIEA 4MH0R 3LBIA 1E2KA 4E5UA 3UPUA 3WHKA 1X3SA 4G5RA 2KBFA 3QPWA 2RGAA 2XTNA 2G1JA 1Z6YA 2VHTA 3BE4A 3BRWD 5DI3A 3VX3A 3U60B 1E4VA 1RC8A 1FP6A 3NXSA 1R8SA 5KUTA 4TQ9A 1P7CA 3K1JA 1KI6A 3PV0A 5BYJA 2W6JA 5D3MB 1W36C 4WXRA 1KSGA 4MYCA 3WMGA 1T3SA 1COWA 1U0LA 2JA1A 4PPFA 4QNMA 1HV8A 2VSXA 3EAQA 4OJKA 2BKUA 2XNDD 2ZI7A 2JGNA 2ASEA 2GCOA 4RCZA 4A15A 4PHGA 3ASYA 4DLUA 1KY2A 1NMXA 2QTVB 2XSZA 5SZIA 1FQJA 3MGCA 4A2QA 5KU1A 1SZPA 4MUBA 1S9HA 4TLAA 2G6BA 2CL7X 2IWHA 1FQKA 1QG2A 5BN5A 4A9AA 3B78A 4PHTA 3RNLA 2CCJA 3FVQA 2QT1A 3IIMA 5H70A 2YNMA 2YV5A 1YE8A 1DAGA 2WMNB 3D7MA 3GEIA 4L15A 5LBIA 2PZGA 4TZ6A 2J41A 1G291 3AF3A 3NHBA 2DFLA 1GFIA 3LD9A 5DN6A 2PX3A 1OFTA 3CKLA 1E2NA 2X8AA 3C14C 1R0XA 3G5UA 1AGRA 1ZU4A 1UKVY 2DCUA 4XIGS 1QHYA 3JZMA 4LJ8A 5FUVA 5JS7A 3BFKA 3DOFA 1HUQA 1WA5A 4WAUA 3AUYA 3WRYC 1E3MA 5J4LA 2QAJA 2CL6X 3QI2A 1GNRA 2A5YB 4Q4HA 4TL7A 1T3LA 5DH9A 4K8OA 2V9PA 2REBA 4KLZA 1XDBA 3AF0A 1TAGA 5AWFC 1WXQA 4Q4JB 1MABB 4JYCA 4PC7A 5K8TA 2IHYA 2IYVA 5EJEA 3DEFA 3T5GA 4BFTA 4Q18A 1SHKA 1XXHA 4B34A 4BLOA 3PCRB 3CF2A 2CDNA 1GKUB 3BH0A 3X1ZA 2WIBA 2GK6A 1F48A 1HY3A 2KE5A 3CRQA 1IY1A 4Q1FA 1NRJB 2NQ2C 4A0HA 3NH6A 4M9SA 1H8EA 1G3RA 3CRVA 3IIKA 2PJRA 2G9NA 2DFTA 4KU4A 4PPGA 3FHTA 3EIQA 5JJIA 3X1DA 4I1OA 2DWOA 4DLVA 4DDUA 1TX4B 4U5XA 5BXQC 2O8DB 2ZU6A 4FI3C 5CIWA 3VNUA 2F43B 1ZBDA 2D4HA 4X8HA 4Q9HA 4DJTA 2XAUA 5CB6A 4M1WA 1P60A 3I5XA 4QOSA 4HZUA 2NPIA 2BJWA 2FJUA 3W5JA 4BUJA 3V4FA 3A6PC 3K0SA 1OJLA 1R4AA 5FTKA 1YZGA 1E2EA 2XJ4A 4PPNA 1H8HA 1GKYA 2VSFA 3SFVA 2O0KA 2ZE6A 1RYFA 4HUQA 4MKGA 5H8WA 5FTJA 1XJ0A 3DHWC 2SHKA 2B7BA 1IQPA 2IEZA 5E95A 1OIXA 4QJ5A 2O0JA 1GILA 1HURA 1UDWA 3EC2A 3IIJA 1E9EA 1VDZA 3SJZA 4L4UA 2ZVPX 3D8BA 4O0MA 3C41J 1M7HA 3IUYA 3U7FB 1CU1A 1ZC4A 1KHTA 1P62B 4I1SA 1GDDA 1Z0KA 3AVQA 1U0JA 1U81A 1WMSA 2OHFA 1G21E 1Z28A 3MSXA 2ONJA 4C0HA 3ADCA 1US8A 1Q21A 5TV2A 4WOPA 2VHQA 4NCKA 1TF5A 4PANA 4DB4A 1AZSC 1MOZA 5SZKB 2KI5A 4M9QA 2J9RA 3B13B 1FX0A 3K0CC 4JMPA 4RFSA 4XVUA 1GSIA 421PA 2JLVA 2WKQA 2G0NA 2GBLC 5G53C 4MDEA 3I72A 1YZTA 5JECA 4MYHA 2ZRDA 2N1BA 4MYUA 4B35A 1JXOA 2ZRKA 1AGPA 5FPYA 1XU4A 2OFOA 1MRSA 1N6PA 2F9MA 3BH7A 2AFHE 1Q20A 1GRQA 3K0AA 4Q21A 2VP5A 5G40A 1EX6A 1E9AA 1NLFA 1PLKA 2F7SA 1E2GA 2W2VA 2WPDD 3BBPA 5P21A 1KK1A 5IT5A 3RC8A 5B58C 2ZJZA 3AVOA 2V6JA 2F43A 1D5CA 1W2GA 5EP4A 3VFDA 4O3MA 2HF9A 3RHFA 1XZPA 1TEVA 1E2JA 3O47A 1A82A 2J1LA 4HAWA 3B1YA 1ZM9A 1P2TA 4EFMA 2WM9B 3D31A 3IGFA 3I32A 1XTSA 4BFVA 4FW9A 4G1UC 1EX7A 3I92A 4Q7LA 4DEXA 1OV4A 4M1TA 3MCAA 2V3CC 4LX0A 5L3RA 4HAXA 3AF2A 1GL9B 2RHMA 4QBIA 3UWKA 1P9WA 1RYHA 2NO7A 5B30A 2XOKD 2VO1A 4KYIB 5FI0B 4HUTA 3FKSD 4B76A 5BN4A 3K0EA 1U8AA 3HPRA 4F7WA 1KI3A 2OCAA 4F92B 4MGYR 4NCHA 1BOFA 5DIFA 2J46A 4B71A 4DZZA 3BJIC 3K09A 4B2IA 1MABA 4MUAA 3IHWA 4XVQA 1K8RA 4DIEA 2RKOA 4NONA 3R20A 3X1WA 4B32A 4V0KA 4HATA 1KJZA 1E2MA 2ZIAA 5B2ZA 5JCZA 3QQ5A 4M9XA 2B7CA 3MRSA 621PA 4P3YA 1Z0DA 3UG7A 2QP9X 1IM2A 2KWIA 4M9ZA 1M34E 4B43A 1ZM2A 2H5EA 3TMKA 3LDAA 3AKYA 1M74A 1AKYA 2H1LA 1D9XA 4ARZA 2GJ8A 2AD5A 1XTKA 1E1RA 4RZ3A 3SYKA 1KNXA 1G4AE 4B3XA 5EP1A 2I1VB 2C98A 3QXJA 4US0R 1S1CA 2BM0A 4OI2A 2OO7A 2MSDB 1MH1A 2BEKA 2IYWA 2WJJA 1JALA 2ZRJA 4KO8A 4ON9A 1GUAA 3VHLB 1KZ7B 3THXB 2CL0X 4IOMA 3BFXA 3TQFA 1Z83A 4BLTA 3KQHA 3QEJA 5JEDA 1M7BA 2YHSA 4AKGA 3OE7D 4CGZA 3IO5A 2WJGA 1KDTA 2ZANA 2VTKA 3GLIE 1ZCAA 1P9RA 2ZS7A 5FOWA 1D2EA 1R0ZA 2AXPA 3EPKA 2WWXA 4UJ5A 3EXAA 2NTYC 2QE7A 4QL3A 3B9QA 4EJSB 3K53A 1N5IA 1KYIA 1UF9A 2OBMA 2JJ1D 2ZRCA 4V0LA 4MRSA 3I73A 2QROA 1SVOA 4URVR 5L8VA 2R2AA 3RS2A 3NC1C 4D0GA 1R0WA 5KDOA 3T35A 1TADA 2TMKA 3T5DA 3GLGA 5DI3B 2X1VA 5CIQA 1T3HA 2Q9AA 4B3CA 1E79D 1RRFA 1Q1EA 1KO4A 1N0VC 2ZJOA 5K8IA 3LQQA 2B8TA 4D80A 3KTAB 1J99A 3U3JA 1XRJA 5CM8B 4LV5B 4NZYA 2GXAA 1W2HA 3B1WA 4FCTA 4PC6A 5HTKA 4JYBA 4WZBE 2CK3A 4H9GA 4B6EA 1U9IA 4ZI3A 5FL7D 2ZUBA 1TUEA 4GI7A 1AQUA 3M1IA 3SC3A 5DI9A 4GL2A 5FOUA 1ONBA 2B6HA 4BECA 1QHHA 5FOVA 2W6IA 3KKMA 2HEIA 4BFUA 5AJWA 1HH4A 3PJRA 1DS6A 1NLYA 1S3SA 4A4DA 3CW2A 1NVVQ 1ZU5A 2PT5A 4IDQA 2ZSEA 2JLRA 4TTPA 1XZQA 3U4QB 1H8HD 1L4UA 1KK0A 3LVRE 3ZIAD 4GOKA 5J47A 3TH5A 1JJ7A 1VECA 3TKLA 2YOHA 2BBTA 2ZI4A 4BFZA 1SXJA 5E7JA 2ZROA 2FH5B 2XGJA 4Y0AA 3FHOA 3LW8A 3PR1A 4XTCS 1XX6A 1ZCBA 3IBYA 3FFAA 1U94A 3QPUA 1JB1A 2V7QA 4CF7A 4PO8A 1BYUA 3L8ZA 3RSLA 1FUKA 3F8TA 3UATA 3GLHA 2JJ8A 2JJ2A 2Q3MA 2JLQA 1Y63A 5E3HA 2J0UA 4NYMR 4IXNA 3VMFA 1U99A 3HU1A 3EC1A 3CZPA 4RFVA 3MD0A 2GJSA 2JASA 4I1UA 2BMJA 2PJZA 3L0PA 2FEMA 3ADKA 2W0SA 3FKQA 4P4SA 3I5YA 3AP2A 2J59A 3W90A 5AK0A 3I61A 2CK3D 3LAWA 1NY6A 2IYTA 2FPLA 4Q9IA 4EKDA 1T4GA 2OXRA 2ZRGA 4QG7A 4LBWA 3SJCA 4HB2A 2WJHA 3W8NA 5IK2D 2Z5FA 1EESA 2REXB 2HF8A 2ZSBA 2WICA 4QGFA 1KMQA 4TL8A 1TQ2A 1Q3HA 4US1R 3ZVMA 1RE0A 3RRMA 2IYUA 3BORA 1N6LA 1O3YA 5DHFA 1NN5A 3W34A 5FBVB 3CX8A 2J45A 3GLIB 3DZDA 3MLEA 3BB3A 1GNQA 1OFHA 1Z0AA 2Q21A 3A58B 4CIDA 5LB2A 5F9HA 1F2UB 3RS5A 1F6BA 2OT3B 5JJKA 3UMSA 3U3MA 4F91B 1IHUA 3DMDA 3FB4A 3LLMA 2Q9BA 3LBNA 1Q0UA 3U6KA 2EFCB 1O87A 2ZQ5A 3HR7A 2QBYB 1GRNA 2GILA 1RFLA 2GF9A 1XEWX 2H17A 3X2SA 4J0QA 4JZKA 1VG0B 2ZI9A 2QG6A 1OYYA 1G7SA 1UFQA 2ZVQX 3KJHA 3Q72A 2Z83A 3LY5A 4R9UC 3SR0A 1E2PA 1OLOA 4A36A 1FP7A 2BBSA 2NO9A 3MWLA 1Z2CA 1NVUQ 3THYA 3U5ZB 2W83A 2JIZA 2C9YA 3WNBA 5EXPA 4A8JA 5B57C 1XD9A 4IW3B 1IN8A 2A30A 3I8SA 2ZSAA 4HAZA 2QGZA 3L8YA 2CNWA 3BB4A 2FE4A 1N6NA 1PZNA 3A1SA 4Z1MA 1P6XA 1KI9A 4TL6A 4V0NA 1OXTA 5AUNB 2RH5A 5EE0A 4IHQA 3QSYA 1K5GA 3A36A 4IRUB 2BOVA 2ZS9A 1QHIA 3WMFA 4H1UA 3TVDA 1CRQA 2HJVA 2QTFA 4M1YA 1E2QA 4DSOA 2VLIA 3KKNA 1OIWA 3BERA 4C7OA 5GJWC 3AVUA 1QVAA 3P32A 2JJ2D 4OHWA 2NPFA 2WAXA 4LCBA 5DNYB 5DGXA 1N6OA 3UIEA 1HE1C 2NO6A 4ZCLA 4C0QC 1Q1ZA 1G6OA 2HV8A 1E1QD 2FMXA 1W49A 1T8UA 1TMKA 2OSBA 1UM8A 4ZIRA 3R8CA 1SVKA 4ASUA 3PVSA 1GAJA 2OV2A 1Q1BA 3AM1A 1DG1G 1NVXQ 2ZSDA 2E87A 5AUOB 3K9LA 4PSKA 3GLFB 2F6RA 4URXR 3V4RA 2CNWD 2ORWA 2QEQA 1YZUA 3CX6A 4YLGA 2BCJQ 4IDNA 1Q1QA 3B1VA 4Q7MB 3VU9A 4BZPA 2PBRA 2AL7A 1T91A 3R8FA 4UKDA 5EE9A 3MMPA 5TB5A 3EZ6A 2ZRPA 4EDHA 4HLDA 4G3XA 1W0KA 5L3VA 3L0SA 5HCNA 3G82C 3GJ7A 1G6HA 4IDPA 4WZ6A 1NMZA 2GAOA 8OHMA 4KCGA 1T5LA 1N0WA 4X8OA 4GRAA 1AS3A 4EUNA 3LWNA 1FW6A 5FPTA 4UNNA 3MWKA 2I3BA 3PG5A 2FEOA 4D0NA 2ZTSA 2IYRA 1G5PA 1ANKA 1MO3A 3T1VA 2O8EA 4N3NA 4TQUS 2I1QA 4D4LA 1QHXA 1G5RA 4GMDA 4DLYA 1Z6TA 4OK5A 5JMTA 2ZRFA 4BZXA 1WQ1R 1GWNA 2G1KA 4MQBA 2IS2A 3FMOB 3SBEA 1G9XA 5SZHB 2PZEA 3DMNA 3B60A 4TTQA 4QKQA 2GCNA 4CW7A 1E9CA 1YKSA 2GCOB 3SHWA 3RLFA 2ZM5A 3MAAC 1Z47A 4PAOA 3X1XA 3LH5A 4R7ZA 4N1AA 5F2EA 4IOJA 2DBYA 5CDFE 2R6CA 1P72A 3NBYC 4I99A 1NKTA 1X1SA 3NDPA 4JSTA 5FBQB 3ZH9B 3LQRA 3VR6A 4MYTA 1K5DA 3E5HA 3ZVLA 1DTSA 3KUCA 2BMEA 4GDFA 5IDVA 1S8FA 2OESA 3RVBA 3AP3A 2A9KA 2ZE8A 2ZRNA 1XCPA 4OI0A 3ONWA 1W44A 4JBYA 5FOXA 2Q3HA 2KSQA 1G4UR 2RGDA 1L8QA 4NHOA 4RVCA 2HT6A 4AKEA 4QJ3A 4HAUA 3AH8A 3I62A 2FN4A 2QORA 4ZCIA 1ZUNB 3FHCB 4PHHA 4NMMA 2Z43A 2EU8A 1OH5A 2BEJA 1VYTA 3ZYCA 2NIPA 1FX0B 4JLDA 1GL6A 4BLPA 4JT4A 1NP6A 3IO3A 2HLDD 4Q1EA 4ZO4A 1SXJB 3SNHA 3UXMA 1UEIA 3IEUA 2GBLA 1KIMA 4D2IA 3KQKA 3TIFA 3HU2A 2O8FB 5DHAA 1EK0A 1N5JA 4CEIB 1G41A 1KO1A 4LJYA 2ZPTX 2XZLA 2KB0A 2A2ZA 4Q1AA 4HDQB 3TE6A 4XSGA 3FWYA 3L0IB 3TW8B 2D2EA 5FL7A 2VYFA 1P2VA 1D2MA 3QKTA 2C8VA 1H65A 4KFUA 2D7DA 3ICQB 4DB2A 5KTYA 3GLFE 1G8GA 4RKFA 2AKAB 2GTPA 4MGKR 3U6BA 1V43A 2WWWA 1CJUC 1AJEA 4Q4AA 2WV9A 3OEHA 3BWDD 4A0FA 3ADDA 1AS0A 4KSBA 1KY3A 4NYMQ 4LSGA 1J7KA 3CH4B 2FV8A 2AWNA 4LJ4A 2BCGY 3EARA 1KZGB 3MWJA 3IQXA 3RAPR 4KFRA 1MO4A 3QENA 2OFWA 2O8EB 4CZ2A 4TYNA 1CJVC 1NN1A 5SZJA 2A5JA 2C95A 4GMXA 3A1UA 4TLBA 2AR7A 2P5SA 1M2OB 2F1RA 4F38A 4LK2A 2MMCA 3ETLA 1OB2A 2GJ9A 1NN3A 4TYQA 4BWYA 3AKDA 4W7SA 4M2LA 4IKEA 1Z8FA 3M0EA 4UNRA 2DPXA 1OH8A 2GVDC 1OYWA 4EJSC 4ITRC 2H18A 1G16A 2VP6A 1HT1E 2D06A 2J3EA 4CEIA 1KMHA 2FZ4A 3U3RA 3ZJYA 2CHQA 5FH9A 2EFDB 3CO5A 1KNQA 2W2TA 1YJ5A 3CB4A 2BWJA 5KPDA 1HQCA 3P20A 4ZDJA 3THXA 2PX0A 3R9WA 4M21A 2CE7A 1YZLA 3P27A 1SVIA 3GJ8A 1CR0A 2ZRMA 3B1ZA 1G18A 1IXRC 2W6JD 3VR2A 2D3WA 4PC3A 2IT1A 4GT1A 1CJTC 3QF4A 1C4OA 1TL7C 4G01B 5GVSA 1G20E 3HYRA 3GQBA 1S0UA 3MUFA 2LKDA 3T1TA 5JWOA 4LRWA 3WNCA 3KZ1E 3RDPA 1KI1A 5DE3A 2ODEA 4YONB 4B2LA 5CYOA 3QBVA 2YINC 3T61A 3BD9A 3VR5A 1FNNA 1A7JA 1W4BA 2PEZA 3CM0A 4FMBB 2CLSA 3EX7C 4URZR 1DE0A 3CRRA 4JVNA 2C03A 2X2EA 4RZ2A 4V0OA 3JZAA 2ZJ2A 3AVVA 1ZIOA 1W0KD 4Q4JA 3RANA 1G3IA 2R62A 4F93B 1ZNXA 1WF3A 2ZE7A 1A2KC 1G3UA 2NO1A 1YR9A 3BC1A 1W1WA 3GLIA 1N2CE 3EASA 1Z22A 5DYGA 3NEYA 1UBFA 5EE5B 4LPKA 1KO5A 3U7GA 3CLVA 4DSUA 2DY1A 2JLUA 4C7OB 5JI2E 5FI1B 4QGGA 4POAA 2R9VA 1NLZA 1FMLA 3U3KA 1E6CA 1S96A 1A4RA 1VG1A 4KXFB 2H8KA 2DHRA 2WPDA 1PV4A 2P6RA 1DAIA 1Y3AA 3C5HA 4US2R 2CCKA 4D4MA 2ZR7A 4QM6A 2PMKA 2AHOA 2ZSFA 3OZXA 4PSAA 1IN6A 1XMSA 4EPRA 3H2YA 4KV9A 1FOEB 4LHYA 2PLRA 5HZHA 5G41A 2G88A 4A8JB 4M4SA 4WIAA 4GZMA 3FOZA 1KTVA 4C0LA 4ZIRB 5HKKD 4P0TA 1JR3D 1ZINA 3I1FA 1LTQA 4HAYA 1PVOA 2FNAA 3QVUA 3CNNA 2XZPA 1E69A 1FMJA 3BOSA 5JLJA 4YMVA 3FDIA 2XOKA 2NMVA 2QQ0A 2BIFA 5GJVC 3NHAA 2ZRAA 3TRFA 5C4MA 4MRVA 3K09C 5DN6D 2ORVA 4Q1BA 1AK2A 2EYUA 2F1IA 4FMDB 2P6UA 1UBCA 4PC1A 1W5SA 2B21A 1JXMA 2P5TB 4HYYA 1CXZA 3UG6A 4D26A 3HR8A 2R44A 2FPMA 4IVRA 4PC2A 4BFWA 1UBEA 2GKSA 4E03A 4E09A 3B2EA 4M53A 3DPUA 1CJMA 4HSEA 4MRRA 4QFMA 4BLRA 5FTLA 1NG9A 2HT1A 3IBGA 1Z5ZA 2ATVA 3QVVA 2VHUA 3SEAA 5LDDC 5EE1A 3KXIA 3SOPA 1LFDB 3KQNA 1AKEA 1PUJA 3RS4A 1RVDA 1EFHA 1GKIA 1KI7A 2Q0HA 3QKUA 2RB4A 1G5TA 2QGNA 2IBMA 4LHZA 5TMPA 4Q19A 3A1VA 1E9RA 1GITA 2PH1A 1JR3E 4LV8B 3VHXA 3KJIA 5CK5A 2YZ2A 4CDGA 5CDFA 3E1SA 1HE8B 2AX4A 3ADBA 5TDHA 4M8NE 4BE7B 1U8ZA 3BFVA 5LD2C 1WBBA 1JI0A 2ZS8A 4LYAA 5JSZB 1OHHA 1JR3A 2GRJA 2CLCX 1TU3A 4UNQA 4GZLA 5CLQA 4LPSA 3O8CA 2ZETA 1Z3IX 1E1QA 4PTLA 1X1RA 2QI9C 2XXAB 2N42A 3PEUA 1ZYUA 4PO1A 4OYHA 4C0KA 5CK4A 1EWQA 3QBTA 4A2PA 2CJWA 3PENA 2J7PD 3AF1A 3EZ9A 2YJTD 3ICEA 4NYJR 5L3SB 1PJRA 3P4XA 521PA 4DRZA 4AG6A 3QXXA 2XTMA 4HLCA 5JHGB 2OE2A 4JLJA 1RPZA 1ZM3A 4IJMA 2AK3A 4Q7KA 2QAGA 1IAQA 3NC0C 2VRWA 3UKDA 2IS1A 3DZ8A 4EFNA 5M04A 4UJ3A 4C0AC 4LWZA 1XXHB 1XFAA 2ZI5A 4JL8A 2V7QD 3M6AA 4LJ5A 3B85A 4TSFD 3WP0A 4A0RA 5GJBA 4ZDWA 4OHXA 1E0SA 4P4UA 3RSOA 1OXVA 2EWVA 2J87A 2IL1A 3EWAA 5AUQA 4OQMA 1SULA 4TLEA 1W36D 1IN4A 5ELXA 3D6TB 1P73A 1RW4A 3AGPA 4K46A 1ZW6A 2XX3A 1SKYE 4JVMA 2PZFA 2A3RA 1JAHA 1FFHA 4B44A 3CWZA 5CJPA 4Q7JB 4TT3A 2K5UA 4EIWA 2QRZA 2PLFA 4I81A 2Z4RA 1RJ9B 2OLKA 4YDHB 2ZI6A 3NH9A 2WOOA 2ZJYA 3IEVA 1U98A 3W3AA 3B1XA 2I4IA 3Q85A 1YR6A 1P9NA 2J5XA 4B47A 1KKMA 4B48A 1R5NA 2R6DA 4LDJA 3KKOA 1I2DA 1TNDA 1MR3F 2CBZA 4TMZA 4YMUA 3AF4A 4JS0A 2DB3A 3AVXA 4LJ6A 3GLFA 4CEHA 1ELOA 3OEHD 5FR1A 2QSZA 1KI4A 2A5GA 3BXZA 2P3SA 4RD4A 5IHPA 3CBQA 3CRMA 4C0SA 3J81k 3EW9A 3OIUA 4BQSA 2DFNA 2WBLC 1ZD9A 4Q47A 2OFXA 3QF7A 1U2RA 2G77B 5DO9A 3VR1A 5AJXA 2O8CB 4QBFA 1U90A 1WP9A 2IYYA 2YWEA 1NG1A 1CLUA 3EPJA 4C9BA 2GZHA 3OEEA 2JAQA 5L3SA 5LPNA 1EFTA 5AJYA 3W9YA 5HKKA 3QUSA 1VG8A 1EG7A 2E1RA 1XP8A 2DWQA 4M1KA 4TL9A 4GNKA 5C46F 3LFUA 2CEAA 3K9NA 4DKXA 3TAHA 1E0JA 1OXSC 4AD8A 3GPLA 4XD7A 4BFYA 1II8A 3A37A 1N6RA 4UNPA 3IKJA 4C2UA 1KSHA 3HYTA 3OE7A 3MFYA 3PXGA 1W4CA 4JVSB 4Q02A 1FL9A 4HDOB 5F3WB 5TARA 2KBEA 4KJZA 4AWXA 1S2MA 4K81B 5DYIA 2GEUA 1KDRA 4HZIA 4MA4A 1G3QA 5DSZA 5LD2B 3Q9LA 3QNUA 5IRCD 1EWRA 3MJHA 4XWKA 4TTRA 2A5DA 2VA8A 3A1TA 3TJZA 1U9IC 1DAHA 4AKIA 2J0VA 1US8B 2JDID 3CNOA 1L7VC 4U00A 3QXHA 5FUWA 1E9DA 1TQDA 4Q48A 3K70C 1IJEA 3FE2A 1X86B 1YU9A 2C2HA 3VNVA 4B3BA 1EFUA 3TUIC 3PUZA 2FX3A 4HB4A 3QY0A 3VKWA 3Q7PA 1WRBA 4LY6A 4NE2A 1VYVA 3CH5A 2IK8A 4URYR 2C9OA 1E9FA 2QM7A 5JZVA 2IWRA 3QKSB 3NBXX 5LB4A 3ZLJA 1SHZA 2V54A 2ERYA 4D4JA 4ABYA 5FR2A 3TR5A 4A8JC 4D81A 4LYHA 2HYDA 2OXCA 1NI3A 1Z6GA 4AYTA 2VPPA 1LB1B 4QRHA 3PIRA 3ZDQA 2F3TA 4W5WA 2OILA 3EZFA 5DLQC 1CP2A 2QM8A 1HA3A 5BYKA 1XTRA 2OZEA 3OFND 3ZZ0A 1FNMA 2GHIA 1KI2A 3KJEA 3QG1A 4B74A 4D4KA 4TT3D 3QJYA 2ZITA 1OFIA 2J0UB 1GNPA 4WVFA 1QF9A 2XZOA 2YKGA 4IOKA 2REOA 4TMTA 1CULC 2HYIC 3AGQA 5FTMA 4FMCF 1D6JA 1OW3B 5GVRA 2F9LA 3BH6A 1W5TA 2ERXA 4KODA 4CEJB 5ANRB 3FMPB 2PT7A 5JI3E 5DISB 4RCYA 4EQ6B 3RRNA 4LYFA 4DLZA 2OLJA 1YZQA 1G8YA 1NIJA 2VSOA 4HI0E 2F3RA 2HXSA 2QN6A 1Z0FA 2GJKA 2HUPA 2VH5R 2D2FA 3QEOA 1VHLA 3KX2A 3RC3A 4WXPA 4G5GA 4HZUB 2FGKA 1DOAA 3HJNA 4DSTA 1XCGB 3D3QA 3WNDA 4JLKA 4DUGA 4D25A 1F5NA 1JQJC 1WBDA 4TMXA 3ZS9A 4LGMA 1G64A 1SKQA 1VCMA 2CHVA 2YC2C 4B33A 5FUXA 1T0JB 2UKDA 1Z0JA 1DEKA 4A2WA 2UZIR 1OHHD 2RCNA 3GFOA 4NH0A 3IQWA 1UEJA 4AYWA 4M0LA 1SGWA 3V9PA 1OFUX 1ZUIA 2BV3A 3LX8A 4GFDA 5E4FA 2DWPA 4RJLA 1W48A 1AZTA 3C7KA 1L2TA 2RGNC 3BK7A 5E7IA 3WRXC 3N2IA 1ZMXA 3T1QA 4ILEA 4QHTA 1BO6A 2YWFA 2JIZD 1ZM7A 4DCTA 1NMYA 1ZUHA 3GJ6A 3W6NA 2IUTA 1KO8A 2R6AA 3FFBA 3LNCA 2IYXA 4RSGA 4Q9KA 4FWIB 4BFXA 5KSZA 1ODFA 2GEDA 4LJAA 4II7A 4NCJA 1CR2A 4BGDA 4YMWA 2QMEA 1TF7A 1KI8A 1RJ9A 2OM2A 3FYHA 4TYPA 1EFRD 1Z0IA 2ANBA 1E9SA 3AKEA 3B9PA 3I3SR 3TSWA 3ZGXA 4EQ6A 3EA5A 1AN0A 1F2TA 1LS6A 1XPRA 4XH9B 3F5FA 4NDZA 4YQFA 4B73A 4MGIR 4XOIA 4A92A 3OHMA 1X8KA 1ETUA 1UADA 1T9HA 1HYQA 3Q5EA 2HDNB 1DG3A 2J7KA 4PQRA 3CF0A 3LA6A 1P2UA 2QZ4A 4JSYA 2IYLD 2ZR0A 1LY1A 1N25A 2CLDX 3ZQ6A 3SBDA 3MWYW 1IN7A 2UVQA 3TR0A 1XNJA 4Z1MD 1UAAA 5CITA 5FTNA 1VIYA 2PCJA 3VAAA 2OBLA 2P67A 3RRZA 3OAAA 3X1YA 4P33A 2NZ8A 2PEYA 3GJXC 1NY5A 2WJYA 1BS1A 3FTQA 1JBKA 3B7GA 4Q9LA 4E22A 3F3YA 4HUQB 5FBLB 1TQ4A 2ZJ8A 2OCYC 2O8BB 3OESA 2FPKA 1XPOA 3TLXA 1QDEA 1X8JA 2WKRA 1T5IA 4YC7A 2F55A 4NCIA 4GBMA 3BIFA 3Q3JB 3PITA 4JLNA 4DCSA 3PUVA 4LZZA 1ZVQA 1P75A 1IOZA 2BDTA 1LF0A 4JT2A 1XMVA 1NF3A 1FTSA 3T12A 3ZVRA 3DVLA 1PLLA 4PXAA 5EZ6B 5JEEA 1OSNA 3N2EA 3IPXA 1EFRA 2CVFA 4CEJA 1YR7A 3HDTA 5JFGA 3NKVA 2QNRA 3LO5A 2ZEJA 1NVVR 1DVRA 4UQOA 1TTTA 2N46A 2WHXA 4Q9JA 1GRRA 1R5OA 1Z6XA 3LXRA 3MG9A 4OK3A 3V00A 4BRWA 3H4MA 1BKDR 2XEXA 3AP1A 4O2RA 1SQ5A 1XCMA 4MKHA 4NL4H 1IN5A 1CR4A 3NIBA 4GSYA 4G5QA 3QIAA 1D9ZA 1BMFA 3RS3A 3K8YA 4NBSA 2RGEA 4JJZA 3KKPA 4C4PA 3PEVA 4KVAA 2AWOA 2V8OA 4BPBA 4MRNA 3U44A 4F4CA 1NBME 2IA5A 3U4QA 1CIPA 3GJ5A 4KI0A 3LX5A 4A6XA 4KAXA 4KBFA 5G3ZA 2A7QA 4JLOA 3U3OA 4EJSA 5FPHA 721PA 4IEIA 3K70B 2QMOA 4TMKA 1Q57A 1LW7A 4LBYA 3PFIA 2JLXA 1UBGA 2ZAMA 2FGJA 3P26A 4W5HA 2P2LA 1Q12A 2F1HA 4JLVA 4XSHA 3PUXA 4V0ME 4HAVA 4JLAA 3VU9B 3DM5A 1W47A 2X77A 4ZKEA 1KK2A 1TUIA 3O8DA 4XD7D 1GM5A 1LV7A 5KDDA 2H16A 4LI0A 2GXUA 2EFEB 1GVNB 3JVVA 1E0KA 3IDQA 4BASA 2D7CA 1F2TB 2X19A 4FMCB 4Q4AB 1E2IA 1NBMD 3CR7A 3R9IA 5JS8A 1B23P 3AVTA 3GLGE 4DCVA 5KPJA 4KLNA 1U0HC 1ZD8A 2R8RA 3DL0A 2GF0A 3RS0A 5TY0A 2WSSD 4DUGD 4IXMA 4DIDA 1M8PA 4BZQA 4Q03A 3SN6A 1MO5A 2OUKA 2IW3A 3OFNA 1N6IA 4O2LA 1XD2B 4AY2A 2QAGC 1E1RD 1KOFA 1VPLA 4LOAA 4URUR 1I4LD 5HE8A 3SDZA 2O8DA 1RRGA 2O52A 2O0HA 3NDBB 1QVRA 2R65A 1E79A 2V55B 2C77A 4ESVA 4ZCMA 1F2UA 3RYTC 3WXMA 5EP2A 1XPUA 1NSFA 3R7WB 1VCIA 3CF6R 3VQTA 4TYWA 1DELA 1NVWQ 2WIAA 1ZAKA 2H7VA 4DT1A 3CNLA 4JBWA 3H0KA 4QC2A 4AC9A 2FDCA 2Z4SA 2BHRA 2QENA 3WYAA 1IXZA 4PFSA 3TSZA 1ESNA 1JPNA 2VF8A 2AKYA 3QPVA 4UXHA 2A5FA 2WOJA 5C4GB 4D6PA 4DVGA 2QU8A 3H84A 3U2QA 3WYFA 2XXAA 5A4JA 1AQYA 2WMOB 4PQFA 1NSTA 4OK6A 1A1VA 1J90A 1P4SA 4DLSA 2ZREA 3GP8A 4KITB 2B92A 5EQTA 1XEXA 4TSFA 2HJGA 4G5SA 4NYIQ 1SVLA 3TBKA 4ARZB 2VEDA 3SQXA 3GEEA 2IXFA 2FSFA 4B6FA 3VKGA 1AS2A 3SI7A 2YWHA 3CWQA 3N5CA 3RRYA 3ZS8A 4EFLA 1KI6B 2Q3FA 4ESHA 1A2BA 3TAUA 2H92A 1F3OA 1YQTA 2GVZC 4AI6A 3KDSE 4F4IA 4UXJA 3T06B 5L3QB 1DPFA 3O8RA 2CHGA 3CRW1 2EFHB 5E7MA 3CZQA 1J8YF 1Z6AA 5UKDA 2JLZA 5CM9C 5KOYA 4YXWD 3TGPA 1T6NA 3WBJA 2C5LA 1C1YA 1QBKC 3L43A 1GTVA 5A0FA 2WSMA 2OAP1 1Z07A 1YVDA 4OQXA 3B6EA 5K8LA 4HLUA 1Q22A 3T34A 4AG5A 2D74A 2XITA 2W6ID 2CXXA 1LF5A 1NJGA 2QA5A 5FUYA 3SE0A 2RGGA 4L16A 1YRAA 1KAOA 4HB3A 4W5JA 3AVYA 1FTNA 2IEYA 1NKSA 4D0LB 5AJVB 4L9WA 4M1SA 4XWOA 1CF4A 1LVGA 2QSYA 2QBYA 1KK3A 2RAPA 3THOA 1ZIPA 2AN9A 3C8UA 5KNCA 4W9MC 2DR3A 3KQLA 4LJ7A 2ATXA 5J4HA 1II8B 2PMDA 4MKFA 3UK6A 4OJQA 1G7CA 4OQLA 1CKEA 1KGDA 3LRPA 2FA9A 1Z29A 2VP4A 3I8XA 2GESA 3NG1A 4RZXA 2OEPA 4C30A 2Q6TA 2NGRA 1QHHB 2JJ1A 3OIYA 2ODWA 4PSVA 4DHEA 3HPQA 1HT2E 5D3MA 4GP6A 1NIPA 1Z06A 4PZLA 1MT0A 5EZ5A 4DCNA 4YMTA 5TVKA 3QOFA 3M4YA 1ZNYA 4XTRA 3GD7A 1SVWA 1XB2A 4JKIA 4S2EA 2V1XA 2C99A 1Q3TA 2FU5C 4DT1B 4DXAA 4PO9A 2FFAA 3ZD7A 4RD3A 3K9GA 2BM1A 1E9BA 1B0UA 1SKYB 1OXUA 3GJ3A 1N0UA 4H1VA 1ZD1A 1OPXA 3A4MA 5J4KA 1DAKA 1EFCA 5FOTA 3LBHA 5GADl 3AUXA 1M1YE 5IK2A 1OXXK 1GL7A 4P31A 4XWAA 1N5LA 1E4YA 4MGZR 3UANA 1II9A 2J0SA 4KFSA 1R7RA 4FMDF 2LCFA 2NZJA 3GLHB 1S3GA 1SVSA 1E32A 5HZKA 3QE0A 1H8ED 1OKKA 2ORIA 1XWIA 3TQCA 5CYPA 3FMFA 1QHNA 1S4QA 3AVPA 2ZU0C 1CRPA 4LV6A 4JKYA 2E9SA 3WHLA 3KUDA 1NN0A 5EP3A 2HCBA 4L8GA 4EPTA 1RRCA 3K0FA 1DADA 1P2SA 2P65A 2GJAA 1Z08A 1AM4D 3KL4A 3CUEF 3TUJC 1S9DA 4IOLA 4BFSA 3Q7QA 5A5GA 4M22A 4C0JA 2O5VA 3QF4B 4QM7A 2YOGA 4GOJA 1YZKA 1EGAA 4UNSA 3T1OA 3TUZC 3H86A 2FG5A 3CPEA 1G7RA 2BC9A 1ZM4A 1CEEA 4B75A 3QG5A 4Z51A 3SS8A 1VG9B 4NP6A 1XXHE 1KMHB 2C9CA 1W7AA 2FFBA 4TQAA 3A4NA 3K0CA 5G3YA 1TQ6A 4LJ9A 3U7HB 2CMKA 3NTUA 2ZRLA 3GEHA 4IVPA 4X8MA 4XJXA 3BS4A 2VP2A 5H1YA 4JL6A 1R8QA 4WZAE 1I4TD 3R9XA 1G8HA 3EPHA 821PA 2GNOA 1R0YA 4JLPA 4CEHB 2ZUDA 2CJWB 1XF9A 4Y0VA 4B2PA 2ECKA 3AKCA 5F98A 3QKSA 3FGNA 1G1MA 1M6NA 3U44B 1HQYE 5KSYA 2PL3A 2IX3A 1E96A 4DLWA 4FN5A 4YDSA 4DLXA 1HTWA 3NVAA 3ZZUA 1TU4A 1U8YA 1WCV1 2QMUA 2QY9A 4QJ4A 4A82A 4DDWA 2QL6A 2WTUA 1OT3A 3JVUA 3OAAD 3WP1B 1GOTA 4BRUA 1QRAA 3SQWA 1ZJ6A 4BLSA 5EE3A 4PZYA 4L9SA 4Q66C 4DDVA 2WSSA 4TLDA 3KFVA 3F0TA 3DO6A 2G83A 1JEEA 5KSPA 2G3YA 1R6BX 2MMGA 4Q00A 1CTQA 4L5BA 3TVTA 4CVNA 4LYJA 4KFTA 4IDHA 2EWWA 2WVJA 4R98A 1S1MA 3L2OB 3ECCA 4R71A 3S1AB 2BVNA 1UKYA 3RWOA 3SJAA 3DOEA 3GMTA 3H1TA 2V4ZA 3HP1A 2XB2A 3A4LA 1L4YA 1YRBA 2QE7D 3SHFA 4YXWA 1D8TA 1FZQA 2ZJ5A 4ACAA 3CONA 4Z54A 4OQFA 1XTJA 3FMIA 4JVLA 5EUQB 3VX4A 2OCPA 3AV0B 5D3QA 3RABA 3W8RA 5BWMA 2VF7A 3OF5A 3QXCA 1X8LA 2ZXUA 4OHZA 1SXJD 2FZLA 5HPYB 3W6OA 1W46A 121PA 5BQ5A 5FFMA 2ZRBA 3NBZC 4RFSB 3VTKA 1W0JA 1YZNA 4DEYA 1RRPA 4V0MA 4JL5A 5K8UA 2W0MA 1DAEA 2BMFA 2RGXA 1G17A 3K9HA 4IVQA 2YYZA 4O25A 2BMDA 4TMVA 1COWD 3ZVNA 1OH6A 2YVUA 4X8LA 4Q01A 4PX9A 4AKHA 1DARA 2IUSA 5BW8A 4JBXA 2GEVA 221PA 2DFKB 3KXLA 2QPTA 3OIWA 1IBRA 1VKJA 1AA9A 1QHSA 2FF7A 1CBUA 1MRNA 5EUMA 4HEJA 1BYIA 2J7PA 3NBFA 2NG1A 1C9KA 3UWOA 3ZD6A 3ZQJA 1KJYA 1A5TA 5KHOC 2VQSA 1XMIA 3C16C 4DC9A 3WYGA 2PCLA 4EPVA 2ZR9A 4B3DA 3KXKA 5L3QA 1N6HA 1NNEA 1BIFA 1SVMA 2OCBA 3B5JA 2ZE5A 3QKRA 2O8BA 4PPQA 2VIIA 3C15C 2F1JA 2JLSA 1EXMA 3ND8A 4TN1A 2HCJB 3PUYA 1R10A 1N5KA 2CVHA 1F60A 4F4JA 1VMAA 1UJ2A 3FKSA 4QHSA 2FSIA 2IF0A 2QTHA 4DDTA 4Q1CA 4C2TA 1JPJA 1WE2A 2QPOA 2GAAA 4URWR 5B64A 2G0TA 2EYQA 2QUZA 2WWFA 4FXPA 2LWIA 3FPAA 5EXXA 3AEZA 1E2HA 3L0OA 5FBWB 1X6VA 4OL0A 3CPJB 2EFGA 3REGA 4QXAA 2WJIA 4N0EA 4OI4A 4AURA 5JJLA 2J0QA 5EXTA 1NBMA 2QAGB 2QP3A 2ZYWX 2OAQ1 4NCNA 2ANCA 4NYIR 3PEWA 3NEJA 1OIVA 5KNBA 1JQLB 2IF2A 2QT0A 2GA8A 1OB5A 4JLBA 4U7DA 1G8PA 2EW1A 2X2FA 3P1JA 5FOSA 4JLMA 1P3JA 2L0XA 4N0DA 3W5IA 2GXQA 4JJKA 4TWZA 5AJZA 2WWYA 3THWA 4IFEA 1G3MA 4NKRA 2RGNA 3GFTA 4LBVA 1KDOA 3AQ4A 5JWRA 1E2DA 2RGCA 3W3ZB 5J5CA 4EAQA 2LKCA 2V6IA 1UPTA 4HDCA 4M1OA 1UKZA 1UKEA 4DSNA 3B8HA 4OKSA 1SXJC 4FD2A 5KYKA 4MITA 4CYMA 3CPHA 3ND9A 2XSZD 4ZDKA 2MSCB 2CE2X 2ZJAA 3AB3A 1YHNA 3T15A 5GJCA 1M7GA 2IS6A 4AYXA 3KKQA 3VR4A 1WDTA 2W00A 3K0FB 4PQYA 4UXIA 4WW0A 5CLLA 3TK1A 2KJQA 5HE9A 2FFHA 3PQCA 5TXGA 1D2NA 4V02A 2P0EA 2BBWA 5AR1A 1KKLA 3N70A 4PZZA 1VTKA 4QBGB 5KO2A 3C5CA 1K6MA 2BKEA 2XNSA 3SFZA 4ZI2A 1ZC3A 3KTAA 2JEOA 2XTZA 4Z8YA 2GDJA 1BMFD 1VHTA 1MV5A 5KSOA 2RHDA 2ZUCA 4LHVA 2Y8EA 2EQBA 4LHWA 4B3GA 4BLQA 1XD2A 4A6PA 2WAYA 2HLDA 4LUCA 1N3BA 3LVQE 1W0JD 1OF1A 2VHJA 1E2FA 2GCPA 3LXXA 1IY2A 1SXJE 4QGHA 1T0HB 4NTZA 4P32A 1ESMA 4ERNA 1VIAA 4ZKDA 1ZP6A 1VCNA 1VYUA 4FIDA 2Z0MA 4QHYA 2BJVA 2CCGA 4ASUD 3GJ0A 4U02A 2IXGA 3SZRA 2GXSA 1ZNZA 2DYKA 4LC1A 2MSEB 3NWJA 1JAIA 1E98A 1JJVA 1WB9A 2C96A 2C04A 4TZ0A 4M1MA 1BH2A 2R6GA 1LS1A 1G8FA 1YR8A 2Z6VA 5H68A 2GWHA 1R5BA 4Q4LA 3DM9B 2JLYA 4ACBA 1TPZA 3E2IA 3CR8A 1MKYA 2ZYUX 2ZJBA 2AXNA 4Q4HB 1CS4C 4RKEA 3OEED 3KQUA 3EZ2A 1E94E 2VP0A 2QRNA 1J2JA 4HLQB 4TMWA 1RIFA 3LV8A 1OKKD 5JWHA 1W36B 1IONA 4CRWB 1DO0A 3PEYA 2IHBA 4FCWA 4KHZA 2RGBA 3HWSA 1JR6A 2EVWX 1HEIA 1N6KA 5FL3A 1XJQA 2NO0A 2BBOA 3TSOA 1GP2A 3GCGA 1GG2A 2YOFA 4NPHA 2W2XA 2ODNA 4PHFA 1IY0A 5J4YA 2ODBA 3RS7A 2OG2A 1W4AA 4HB0A 1XEXB 4E07A 4P4TA 4MKIA 1QG4A 4TLCA 5F9FA 4GP7A 5CJ2A 3ZZTA 3C4JA 4LBZA 3K0AB 5JHHB 1KSFX 4MRPA 1TF2A 3GFPA 3U7EB 3EWSA 4LC0A 3G0HA 4AIIA 5KNDA 3B82A 1GIAA 1P61B 4FINA 2AD1A 5JBQA 1GZSA 4RD1A 4PR0A 5HR5A 4GPTA 1KDPA 4R2HA 1XTQA 4Q5IA 5EXSA 2GETA 3KFXA 3SYLA 1ZRHA 1I4DD 3EPLA 1NJFA 2NOAA 2YWGA 1J70A 3I4LA 3Q8XB 1J8MF 3QXSA 1KSJA 1T8TA 2XNDA 4GOXA 2FSHA 1XEFA 2GZAA 2P6NA 2H57A 5CB8A 2GZDA 3IPYA 4WBSA 4OI1A 1FUUA 2FWRA 4NYJQ 1RKBA 4IEEA 4C3ZA 2IXEA 2WZQA 3EG5A 4IDOA 3GLGB 2JLWA 5J4VA 4KYUA 3EA0A 3OIVA 3KB1A 5C1BA 4XVRA 4QBHA 5FPKA 1FPMA 2JDIA 1E2LA 3SYNA 3W6PA 2QPAA 1R2QA 3S1AA 1PLJA 2A78A 3UMFA 3THYB 1E0AA 1TEXA 1VCOA 3RWMB 4JIMA 1CR1A 1LNZA 4KVGA 6Q21A 4FWTA 4A0GA 4MDFA 4G5OA 2WWIA 4CT5A 3BGWA 1Z63A 2C78A 4V03A 3CX7A 1XMJA 4ZPXA 4RZUA 1IJFA 2ZYTX 1JNYA 1Z2AA 2IC5A 1CJKC 3MJRA 3WY9A 4DBLC 1DAMA 1XD8A 2FFQA 4BEJA 4EPYA 2FOLA 4S35A 1DO2A 3ZIAA 1E99A 4DLRA 3TW4A 5AUPB 2OBNA 2WWGA 4ZV4A 2O8CA 2XJ9A 2IS4A 4R2IA 3SJBA 2ONKA 1PUIA 3THWB 4B3FX 5JRJA 4C0BA 4KBGA 2JCSA 3R7WA 3TNFA 4I4LA 3PUWA 3BAFA 4EPWA 2RMKA 4D82A 4A1FA 3EIHA 3LW7A 1OE0A 2AK2A 3A1WA 4AK9A 5JRZA 3GLHE 3K70D 2VBCA 4OQNA 2FSGA 2QQEA 4NU0A 1JEDA 2JATA 4TYYA 1DBSA 1QZXA 2QMHA 4RY2A 1QHGA 3VR3A 4KSCA 4EPXA 4Q1DA 1W4RA 5C18A 1XBTA 1DAFA 4OHVA 1G19A 3ASZA 3WMEA 2IYSA 2HXYA 2IYQA 2D62A 2IYZA 1V5WA 3WBKA 4DLTA 1XEWY 3A8TA 1G7TA 1KAGA 3KJGA 4QNRA 2WKPA 5IF9A 1XJCA 1ZNWA 3DKVA 5JCPA 2VHCA 4RD0A 2GK7A 3IHLA 3O8BA 2IUUA 1JECA 1II0A 1RZ3A 3DDCA 3E70C 4BEBA 2WWHA 1IXSB 2ZRIA 1KJWA 1Q44A 2UZ3A 2XB4A 2VL7A 5KDLA 2AFIE 3SU8A 1MO6A 4CT4B 3DKPA 3P4YA 4DCUA 2W58A 3CIOA 3Q5DA 2YC4C 3QKRB 4Z8XA 3GJ4A 4HLUC 4YMSA 3AVWA 1XTIA 3LLUA 4OHYA 2Q9CA 4ZDIA 3HU3A 4RD2A 4P4SB 4PAQA 2V1UA 1UDXA 3U61B 4OBEA 3BB1A 4PAMA 5FBRB 1P5ZB 2O8FA 1AIPA 1I2MA 5FPSA 4WA7A 5JSZA 4I1VA 4IFBA 1OH7A 4FCVA 3VKHA 2QP4A
chains in the Genus database with same CATH superfamily
4RA6B 1SRQA 2WJ3A 4QGAA 5KWIA 1AXRA 2VP9A 1DJOA 3H8WA 3EIWA 4P7JA 4LHXA 1SXGA 3BZUA 4RD6A 1L7XA 4XRGA 4ZZ3A 1YR2A 2ZAOA 1NFRA 2NUAB 5CTAA 3FSGA 4G0NA 1L5YA 1PL8A 1ZMOA 4M55A 3IILA 5GMOA 2A58A 3L4JA 1T36A 2ZT8A 4E5MA 2CW5A 3EIEA 4MH0R 5JDIC 3LHKA 2PUJA 1B76A 4EM6A 2RFLA 1BROA 3G17A 3PFHA 4CIWA 4YRCA 4E33A 3FBTA 3QPWA 1QP8A 2XA1A 1Z15A 2B25A 2E4ZA 2RGAA 5DI3A 2SCUB 1KL7A 3RBZA 3SATA 1BHJA 1U4SA 1FP6A 1M6VA 4K1LA 2BE9A 4PYLA 4X1IA 4RM3A 4ML3A 3K1JA 2K47A 1EFKA 1TU0A 2WYHA 3A1NA 3NBKA 4FSHA 4GHLA 1J4AA 2VSQA 3NM6B 4J75A 3EEIA 4WXRA 2ZYGA 1J8QA 1CPYA 4WWHA 5K3BA 2QMQA 2JA1A 1HLDA 3TCXB 3EAQA 4GI2A 2BKUA 4E2YA 1A9OA 2ZI7A 4MS4B 4PYRA 4A15A 3WO1A 1HLPA 4YQEA 1DKNA 1QV7A 4YCAA 1ZO8A 3W67A 1FQJA 1NJSA 3M82A 1S2OA 5ALYA 1ICEA 4M54A 3M4JA 1H0SA 4MUBA 2A59A 1AHHA 4X71A 2G6BA 1V41E 2CL7X 1B3RA 4OXXA 1EUYA 2XH8A 4C0XA 5BN5A 1VJTA 1PT8A 1H85A 2C57A 4GMFA 4LFBM 3FVQA 2QT1A 3H42B 4RBNA 2YV5A 3MCTA 1YE8A 3ZQUA 3ETGA 4PDGA 1L8XA 1LGYA 3BMCB 4L15A 5DV9A 4FFDA 2WSIA 4OVKA 3GUVA 4TZ6A 4JR1A 1N2OA 3W1VA 4FNAA 3E0QA 3IP9A 2NNLD 2NUBA 2B1GA 1EJ2A 4NRVA 3M8KA 3VDRA 3ZWDA 4DF3A 1BMQA 1DL5A 4FSXA 3WYEA 1FFYA 2F3QA 2DCUA 3AI1A 2UZAA 1C2TA 1STOA 2G1AA 4UCXA 1TAQA 3JZMA 3G5TA 4GR5A 4CMIB 3DOFA 1SURA 1RXIA 3AUYA 5CVCA 2JFQA 4DA0A 1RYEA 1ZH4A 4HFNA 1NF8A 2QAJA 2P9HA 1QAOA 1AHNA 3C5WP 3NDJA 4HYQA 5EUCA 3H13A 4BZWA 2XH9A 5KYNA 4Q4HA 2PL9A 1LPNA 4E5NA 4F04A 3OC0A 4BLWA 5A4AA 2XNKA 1T3LA 2IDZA 2ACKA 4K8OA 4BVAA 3QLEA 1EFPB 1PNTA 1J5PA 2W4IA 3CZRA 3ITNA 3DHNA 3HL0A 4B84A 5AWFC 1WXQA 1SBTA 2AQIA 5K8TA 3IRUA 1C30A 4ZO7A 4ZOCA 1FLVA 3IUJA 2UYGA 1SIBE 1SK8A 5DNWA 4JP3A 3CF2A 1GR0A 2KZSA 1GKUB 1VE6A 3Q7SA 4YAGA 1UFVA 3SX4A 2EHDA 2YTZA 1F48A 1HY3A 3O82A 3NPAA 3CRQA 3R6DA 4MQEA 2FEWB 4Q1FA 5TT0A 3D6MA 1H8EA 4LRSB 1DAOA 1ODCA 3B6JA 4M36A 1A69A 5EIBD 2G9NA 4CMEA 4RF4A 4LFAB 1O95C 4MB2A 1T26A 3EIQA 3KLPX 3B20A 3MN1A 3JD2A 4D99A 4YV0A 3I04A 3SVTA 1J8DA 4TMYA 5C8VA 5B7GA 2CHFA 2JAWA 1WDMA 3ICOA 4ZVPA 1Q84A 5BXQC 5BWCA 3CXRA 1UMKA 2ZU6A 4FI3C 4PQEA 4LWQA 5CP8A 1AKTA 4EP1A 8AT1A 3DDHA 3GH3A 3W9UA 1ZLXA 3PVCA 3K2LA 4K9LA 2PK3A 1ZBDA 4NV3A 3S0JA 3IB3A 4K86A 4MA0A 5ELLA 2EL9A 5ESWA 4R1QA 2IRWA 1SKMA 1RAAA 4HZUA 2ZWAA 4CR8A 1VGVA 1QYIA 2YBEA 4M8KA 2EX0A 5G0UA 1H6CA 2GKOA 2JPDA 3BWBA 5JAHA 2BZGA 2OGZA 4O4IB 3A6PC 3GUCA 5KTTA 5B6PA 1NW7A 3EQ9A 3ICVA 3B38A 4PAWA 1GTMA 1BE8A 2YHIA 5FEMA 4U7JA 2ZE6A 1X1DA 3GO4A 4K26A 1U31A 5H81A 2GR9A 2LBPA 3IJ5A 5ENDA 1Z36A 3W05A 1IYZA 1MAUA 1WZCA 3TLCA 1M2OA 3BM5A 4UBLA 3DB1A 4ED9A 2SHKA 1RHJA 3QMWA 3AERA 1ONNA 4UZFA 2FRDC 1C1DB 1WY5A 1W25A 3MPOA 3OKPA 5KC9A 1GG5A 4QJ5A 3UHJA 2O0JA 2YFQA 1HURA 3TFQA 3H19A 4R1PA 1U5CA 3NCTA 3SJZA 1T9ZA 2PVSA 2YHUA 3VH2A 5FX2A 1AZWA 1UC9A 3HFJA 1UCFA 4BGIA 1M7HA 3U7FB 1Y3FE 4ZI7F 3D6HA 5DM4A 1U5BA 3OD1A 4FGKA 1JN0A 2J5QA 1XTTA 2EJWA 3DQQA 4B80A 5GIPE 5J2UF 2PFGA 1U7UA 5C3UA 1P3QQ 1U81A 3ADCA 3MSXA 1G21E 5E0OA 2ONJA 3N8IA 3G2PA 3RSZA 4MWSA 5ITQA 1B8OA 3UFXA 2VHQA 4NCKA 4W8GA 5DYYA 1XALA 2NZYA 1AZSC 2MYNA 1R88A 2V74B 3AHJA 5SZKB 4ZHQB 1WAMA 1WWKA 3V97A 3K0CC 1FX0A 2C9MA 1ZMWA 5KTSA 2CGEA 3TSAA 2BSAA 3MC1A 1J1UA 1B4DA 3NAZA 4G81A 5B55A 4LRUA 3D7RA 2OVBA 5G53C 4HRVA 4MDEA 1DDIA 2VJPA 3EZXA 4R41A 5FCDA 3M4NA 4IIJF 4A3VB 2N1BA 1KH2A 4B35A 4ZK6A 3RTDA 4EG6A 1BU8A 3KT6A 2ZRKA 3JARA 1N6PA 1C0KA 3BH7A 3C7DB 2C1XA 1Q20A 3C6XA 4NNOA 4IGIA 3K0AA 3M6UA 5JMTA 2VP5A 4P5EA 5DTRA 1PLKA 1NLFA 4H08A 4BVBA 1HT3A 1WW2A 2W2VA 2WPDD 4QYTA 3ZC3A 1KK1A 4BNMA 3A11A 3RC8A 3AVOA 4P3XA 5LUBA 3VH3A 2BF4A 2VHXA 3X2FA 4KMMA 5EZYA 5I9MA 2B1QA 1TZKA 4XPIB 3ABSB 1XZPA 1E2JA 4Z0HO 1A82A 5LJIA 3B1YA 2FMIA 3DA1A 1V39A 2QU7A 1T1JA 4NDAA 3IGFA 4YT8A 1KRWA 2DAMA 1PGJA 4L78A 1Y33E 2QVYX 2VHYA 2WINI 4NSNA 4CKCB 2X0RA 3D7SA 4Q7LA 5IAJA 2V3CC 1DWPA 5L3RA 4LRSA 2RHMA 4I4CA 4QBIA 3UWKA 5DLDA 4F3YA 2WSFF 2NO7A 2VO1A 3L07A 2WIDA 4RACA 1FPQA 1T2CA 2YVAA 4HUTA 1FLDA 2NU6B 4IIJA 3D4BA 3CHYA 1KI3A 1XKXA 1CNMA 1PQPA 2GZ3A 2I4NA 2OCAA 3M4XA 1P19A 5A03A 4NCHA 1X3LA 2Y71A 5FKJA 4F92B 1RMYA 3TOCA 1U5BB 4TQGA 1HNXB 1BOOA 3E8SA 4C6TB 1MABA 4RKQA 4LECA 1N2GA 1WVMA 2RKOA 4GC9A 1BEUB 3B6MA 4PCLA 4F21A 1FEZA 5FULA 3IB6A 2KMLA 2OD2A 2X9LA 4X85A 3AJEA 5JY6A 4IJQA 4FDUA 1WIWA 2V7EA 3FZGA 5JCZA 3LQ2A 5LYJF 4LF8B 1C2YA 2QCUA 4WCFA 4EI8A 4JMLA 2QP9X 4FM9A 1PG5A 1M34E 1OT5A 4OGWA 5ITUA 1QGDA 1V9LA 2H5EA 3TMKA 1IEQA 1TM7E 2QLFA 5G1OA 2GPJA 1QMPA 2AHRA 3A6HA 1Z16A 4GHWA 2I33A 3Q6IA 3CCFA 2ZWPA 4QOFA 4ARZA 4KR7A 2G09A 1RM0A 2H7CA 2Q4EA 2AD5A 3BFPA 1H9BA 1J8VA 1VE9A 5DU2A 1KNXA 1L4KA 1FFGA 1ZH6A 1UKCA 1KMNA 3JTMA 5EP1A 2Q28A 4IZIA 4QBTA 4DNOA 4IHJB 3DEKA 4R84A 1U8CB 3BX1A 4ON9A 2E82A 2A14A 2Q8PA 2WJJA 3VHLB 4KO8A 5JROA 2WD7A 4TTTS 3THXB 2CL0X 4DR2B 2Q8NA 4B7CA 2ZIUB 1G9SA 5HQTA 1KYQA 1NNLA 3G8YA 5IM4F 4GXTA 3TQFA 5IVKA 1NQVA 1Z83A 3BSSA 1J5EM 3FROA 3HB7A 4X3CA 5CH8A 4AKGA 3FTFA 5EXEA 4W5RA 2YYSA 4CGZA 2WF8A 3GFQA 1QIGA 5HTOA 2Q7XA 4XWTA 1P9RA 1ZK2A 2ZS7A 4NARA 4B7HA 1D2EA 2HL7A 1T8RA 3HVUA 3VGJA 3MERA 2WWXA 4UJ5A 1X77A 3V2UA 3B9QA 4O29A 4LRQA 3K53A 2JAPA 4RTRA 4FIZA 1KYIA 3KT0A 1HNZM 4UBMA 4D3FA 2FSPA 2ZRCA 3BMOA 2FCAA 2PH5A 2WSCF 2VF4X 1VIDA 2QROA 1SVOA 2M5ZA 3I73A 3U48A 4URVR 4DCJA 4XQCA 2L19A 4EZIA 2R2AA 3UOWA 4HDAA 1R0WA 1CDDA 2JGLA 4D0GA 3KOZA 5KDOA 3GLGA 2SECE 1YZHA 1YJCA 3CZCA 2O8NA 3EVBA 4YQZA 5DI3B 1I32A 2Q9AA 1J0DA 4JB2A 3HN2A 1RRFA 3CB2A 1QP0A 3QYJA 4QPZA 1LPAB 4W1PA 5CR9A 2GPAA 4OATA 1F7UA 4ENRA 4QEDA 5B7QA 3MGAA 3FUCA 3HXOA 4DIEA 1KC3A 3KTAB 1V5GA 1Z2DA 4P9NA 1XRJA 1YFKA 2QTZA 2VPQA 4RDCA 3HB9A 4FDTA 5CM8B 4F8EA 2A67A 3B1WA 4FCTA 5ICCA 5HTKA 5JMWA 4EA8A 3ZGVA 2V0CA 4H9GA 3LGSA 4U7GA 2VAXA 1XLVA 4MS4A 5FL7D 2X3YA 1VL2A 2ZUBA 1AQUA 3M1IA 3PTZA 1Y8AA 1WCYA 5FOUA 3D3KA 5JC1A 1IBMB 4GL2A 1VPTA 1NUQA 2BI8A 5FOVA 4JHXA 1R0SA 4BFUA 3CR3C 3ISVA 5AJWA 1HH4A 1RI1A 3VM6A 1QO9A 2BD0A 2EO2A 1B74A 3GEPA 3RBVA 1X1QA 1B6SA 3UJ6A 3X44A 4KN9S 4ES6A 1QPZA 5D1NA 3ZJTA 1XZQA 2VK2A 1J49A 1H8HD 1WEHA 2BP7A 5EPEA 3TDNA 4GWLA 2W82A 4GOKA 3TW0A 3GZTB 5ARBA 2HY7A 1GPAA 3ODPA 1P5FA 1GT91 1JJ7A 4TVBA 1U0FA 3EYAA 3OUZA 4UUQA 2NYVA 1MOSA 4OHBA 2BBTA 2BEWA 3U37A 3USZA 4P0PB 4PQGA 1ZKMA 4EZBA 1ZY2A 1EPUA 3KOOA 3FHOA 5LMNM 3LW8A 3QGMA 2Q2EB 5HJ5A 1L7OA 1PZEA 4KHPM 1LBTA 1U94A 1AKQA 1ZK1A 1JB1A 3PNLA 4X64M 3RTCA 3II6X 4CF7A 2XD4A 2Q49A 3IP5A 1WHSA 4G5HA 3QY9A 1DI0A 2RH8A 4JX8A 4WLEA 5AK5A 2JJ2A 2OD7A 4O6VA 1KDYA 1RWWA 1Z35A 4NYMR 4KPUB 2LDBA 4IDEA 4IIDA 3VMFA 1U99A 5I4BA 4D3SA 4EI7A 1OGIA 2OQRA 1DIOB 5AJTA 1GZ4A 4MIOA 4AQYM 4HJRA 3RSFA 3TG2A 2BEUB 4YAJA 3U09A 1KJ9A 2PJZA 5TPZD 1X7GA 2FEMA 2Q5CA 1SELA 2FQYA 2PWPA 2W0SA 4IXDA 1QCZA 4RPKA 5AHKA 3WGVA 5CA0B 3I5YA 4DZRA 1UPFA 5CURA 4EKDA 2ZRGA 3FNHA 3SJCA 3ZE1B 1M8FA 3WIUA 3K16A 4HB2A 1J9EA 1H5NA 1ITZA 4J90A 5IK2D 2UUAM 1QMGA 1NWCA 2HR1A 1TAUA 3R23A 1EESA 3RRBA 4NU8X 2ZSBA 2J33A 1KMQA 2JKZA 4OAPA 4MCIA 2H9AA 1GYRA 1MQ8B 2VJYA 3VRHA 4AXXA 2IYUA 2PZMA 1NN5A 3ROZA 3OIFA 4REQA 4YJ2A 5BR1A 3EB9A 3GLIB 3HCAA 5I7SA 4WADA 3T7RA 3L28A 4KWCA 1GNQA 2BKXA 4GC5A 3A58B 5F9HA 1IK4A 5EC8A 2AIRA 4F06A 1PYOA 3RS5A 4BTEA 4EATA 2MSKA 2A1TR 4ID3A 3UMSA 2VUUA 3CUKA 2AQ8A 2JI7A 2RHBA 1GD1O 4P2GA 3DMDA 5F3DA 3U3MA 3U7QA 3UK2A 5J4LA 2VPYA 2Y1GA 4ISBA 4RTKA 5TLSA 1PR9A 1VMDA 2CNLA 2ZG6A 5IBPA 2ZQ5A 2QBYB 3P9XA 2X8JB 3NWEA 1Q6ZA 1BU5A 4EFKA 2POQX 2AJ8A 4UHKA 2GF9A 2H17A 1JLMA 4BFCA 3IXLA 2H8GA 2XCIA 1P4HA 2ZI9A 3L04A 5JNRA 5AM1A 1T3TA 4A36A 4R9UC 3SR0A 2QRQA 3DL4A 1TIBA 2E48A 1OBOA 2BBSA 3I6MA 4BNDB 1P2BA 2QKYA 5EUBA 3U5ZB 3PRYA 4ZD6A 4JUFA 3RHTA 3VKUA 4B8WA 5HQ3B 4GPZA 2OAEA 4R0NA 4IW3B 4KQXA 1P6QA 2XNCA 1SZDA 1W94A 4Q3EA 3K1ZA 3L8YA 2CNWA 4FE7A 1P8AA 2FE4A 3SZOA 1ENOA 1VXOA 1XQYA 1QZTA 2J6HA 2FZEA 1A5ZA 2P68A 2YFKA 1MB0A 3A31A 2PDAA 1KBQA 2RRUA 1WZIA 2QD3A 1GGJA 1X7HA 2GB4A 4W9RA 3UB2A 4RAQA 3RAJA 2HHHM 4NOLA 4U5QA 4XUEA 5BVHA 2QI9F 1EZ1A 1R6VA 3K4PA 4XQ0A 4DDHA 1CRQA 5FLXS 1UDBA 2HJVA 3WB2A 3HUUA 1E2QA 3FUUA 4PLFA 3KKNA 4C7OA 3TL4X 1KTIA 2NTNA 4O2BA 5AW2A 3OTOM 2Q1XA 4LCBA 4MGZE 2WAXA 3H83A 1N6OA 1EDOA 4WNCA 4C0QC 1Q1ZA 5KQSA 1CUDA 1DQPA 1KYZA 1KVQA 1ZISA 2Y1KA 3HWRA 3JQPA 4G4NA 1TMKA 1RQLA 2JAOA 1UM8A 5FNVB 5CX1B 4BGEA 4ZIRA 5J1SB 3M5PA 5A3JA 3PVSA 4C20A 4CM4A 1YJBA 1YQEA 3DL7A 4Q93A 5BUQA 1ZCJA 4YWHA 1BRMA 2O6HA 3B48A 3B53X 4LOKA 1ZGBA 1EM6A 2E87A 5GOZA 3FCAA 4LC9A 1QWSA 5AUOB 2EDAA 3K9LA 3MOGA 3G02A 1T15A 2YS7A 2F6RA 3G0DA 3CLSD 4FVTA 4YLGA 1Z0UA 1M1NB 2FFJA 2BCJQ 4LTNA 3H2SA 3VV3A 2F4NA 4RIEA 4C4SA 1V3QE 1KYTA 1UOEA 3DAGA 4LOIA 4BZPA 2WM8A 4EGQA 1FJHA 1T91A 2J8ZA 2CMHA 1TVCA 2NTEA 3IQEA 3OJWA 3MMPA 2CXQA 4I6JA 3RGPA 3EZ6A 4J0EA 4UKDA 5EE9A 3VBEA 3WB1A 2QIPA 3QE2A 3D2LA 4HLDA 3HCDA 4G3XA 4PS1A 4QG3A 3IBFA 2CXPA 3BICA 9GPBA 1Y82A 2ZJ3A 4LZLA 3HVIA 3G82C 5EMNA 2G71A 4Q7JA 4OBWA 5HQ3A 2G5TA 1T5LA 3U5TA 1DQNA 2O2EA 1N0WA 2D0IA 1F12A 1AS3A 2P62A 4GRAA 4X8OA 1FW6A 1T1SA 2KA6B 4RKRA 3B36A 4QYSA 3PG5A 1H66A 1UANA 3FHLA 1NW3A 3T1VA 4YPOA 1MO3A 2HA5A 1NVTA 1UZMA 1EXWA 1N5MA 3HMQA 4N3NA 1UMBA 2LE0A 2VWGA 4WNAA 2QSUA 3ZZ1A 4D4LA 3RFWA 1UBMS 4GMDA 4OLBA 1DG9A 1JYEA 1U2PA 1WQ1R 3ER8A 1GWNA 4HX2A 1YHYA 2EARA 1GSOA 2BUAA 2WUEA 3SBEA 4ETMA 1G9XA 4RH0A 4H3KB 5AVJA 3A7DA 1QZZA 3DMNA 3TDKA 4QKQA 5JQWA 2QOEA 2RGRA 1BVYF 1XEAA 2CXNA 3CNEA 2GCOB 3C6BA 4JELA 4L51A 4WKCA 1V5FA 4N39A 3E4CA 3W4KA 5JNTA 2H5LA 4HX5A 1Z8HA 5EESA 1I5EA 2WEKA 2EP8A 1Y5NA 2WP0A 4CHTB 2VYNA 1OA0A 2OCLA 2QL7A 2EJTA 4CCYA 4YJHB 1D09A 1XN4A 2OZVA 5EXDA 5ALVA 3OY7A 5ICEA 3NBYC 5FBQB 4B83A 3AHFA 3WYNA 1B0AA 5H82A 2W5UA 4MYTA 4D9NA 1K5DA 3E5HA 4PLPA 2CNNA 3SZ3A 2HCFA 4GDFA 5IDVA 1NXXA 1V16B 1BVHA 2B34A 1WUHS 2EGGA 3C3DA 2NV2B 2A9KA 3AT1A 4J76A 2Y1EA 3UFBA 1CQXA 3VSBA 1TKRA 3BGDA 4ZN6A 1ULTA 3AESB 4ZT4A 1JTFA 2A86A 2P2GA 3C7TA 1JAYA 1YI8A 2B9EA 3M6MD 4I50B 4WCFC 4JBYA 4Z4CA 5JBNA 2KSQA 5LOVA 5BMVA 1G4UR 1NBIA 4ANRA 1L8QA 2QRMA 3D1LA 4NHOA 4PLZA 4HAUA 2X4GA 3I62A 5AO9A 4C7BA 1FFXB 4OQ4A 2O7NA 4RIFA 2B1IA 4NCAA 3UMCA 5ENZA 4BO9A 3MTEA 4BMSA 5IASA 5LMZA 1DAPA 1IHOA 1OH5A 1VYTA 4IH1A 5TX7A 2PN1A 3BWVA 4C4XA 2W37A 3I6ZA 4RY8A 3W04A 1S01A 1PM5A 3D6AA 3T3GA 3V1KA 4YRKA 5JCJA 4KWHA 1LNSA 4R3NA 4G97A 4MKRA 5K51A 2OBBA 3UXMA 3IEUA 2GPBA 2O4CA 1FJGM 1PWHA 3S3TA 1VKRA 3D3WB 3VDQA 3KQKA 1RU3A 2ORYA 4F4FA 3TIFA 1VSTA 3DMFA 4UPVA 5EHXA 3HBMA 2B4QA 3AR7A 2J6BA 2ZPTX 2HNAA 2A3NA 3DFZA 2I2XB 4G23A 1USVA 1TLFA 1ZESA 5IAKA 1MX3A 1A8PA 2B4YA 4R0MA 4ZOQI 5A4MS 2D7HA 3AG5A 3BWEA 2V7TA 1ZHHA 2OP1A 3E27A 1E3WA 3H18A 3U26A 3L41A 3GLFE 3JPWA 2AKAB 2G9UA 4DYDA 1FRVA 1U11A 2IGTA 1CJUC 1LNQA 2H11A 3FCUB 4XWGA 1KBZA 2CB0A 5BNZA 1ZUD1 2LUOA 4KSYA 2CF5A 1AS0A 3ZCPA 4G8JA 2VZ9A 1P7WA 3L4KA 2IW1A 4NYMQ 4LSGA 1J7KA 3CH4B 4LXIA 3C3EA 4OHKA 5F51A 1TT5B 3V8EA 4BDTA 5LP6F 3AETB 4OLJA 5EKTA 4YHHB 5A06A 4UDNA 3DF7A 4CZ2A 4MPPA 4LY9A 4YQYA 5HIJA 3T3DA 2XMDA 1YFZA 3BL6A 4JIGA 5HDQA 1RXWA 4TKVB 1U1FA 1VKNA 4G0VA 2YXNA 4L4XA 2FJ0A 3A1UA 4GMXA 1H1TA 4B9AA 4E1AA 4ALIA 2Q2OA 4DEVA 1G2QA 4MH0E 1YOVB 1N36M 2MMCA 1NRWA 4GNRA 4JY7A 4TROA 5EWLB 2WYIA 4ER3A 4FFVA 4I3FA 4GO1A 1NN3A 1K66A 1RHMA 5ALFA 3RS9A 4BB0A 3OCWA 1L5MA 2VJOA 4BWYA 2WIFA 4EJ6A 4M2LA 4IKEA 1YUBA 3GL9A 4JLSA 1Y1LA 3ZLVA 3FTDA 2EZ9A 5JOQA 1JV2B 3BQMB 3DCNA 3P9ZA 1L3BA 3EAGA 2H18A 3HBJA 2XCLA 4AMUA 5IJ9A 2GHQA 1WCIA 2DQ4A 2H6EA 4MUNA 4RULA 1P6UA 2D06A 1K27A 1SG9A 3NGLA 4DG5A 5L45A 5ADWA 2PUBA 3X2EA 2FZ4A 4IDFA 3IAHA 3EUWA 4X20A 2AZTA 1XQ9A 3DGEC 4B45A 1E1DA 4H35A 2R1ZA 2BGLA 3R9WA 3WWZA 1WBDA 2PX0A 2PGOA 3P27A 4TUYB 3B1ZA 1OXMA 3KU4A 3SHTA 4PC3A 3GCXA 4R3DA 2IT1A 3H2ZA 3GCDA 2C84A 3MPUA 3PNPA 4BX2A 5CDUA 1NYLA 1TL7C 5JNLA 5GVSA 2PRZA 8ADHA 1YF3A 4B08A 4QDOA 1VMEA 1ZLYA 3GQBA 2Q3DA 3Q8WA 4JD5A 4JI5M 5ED0A 5F1YA 1SZCA 3E3OA 3SMVA 2DR2A 4C89A 4LY3A 3GVPA 3LCUA 4WERA 4CMIA 1KI1A 1RKQA 2DQSA 3R5XA 1O7JA 5DKFA 5B53A 4AZTA 3RVLA 3ZD8A 3JD4A 1ZJWA 4FUTA 3LT1A 1EEXB 1FNNA 1W4BA 3DSRA 2PEZA 2XMCA 3NOVA 2CLSA 2R8YA 4UMVA 4D9IA 1NHWC 4FUQA 4QPPA 2PL5A 1SXHA 1Y1QA 4YLYA 2X8JA 3PQ6A 1GADO 2H0QA 2QT9A 4HNSA 1JIXA 2A84A 3WA6A 1M1XB 1YAJA 1ZIOA 1W0KD 1EE8A 4FHEA 2WTMA 2NT4A 4PFJA 3RANA 1FDUA 2V98A 3KLMX 4C04A 5GZ1A 1SQFA 2B9VA 5FV7A 5DIZA 4KIWA 3USES 1N2CE 3A1CA 3Q11A 4INJA 3BTOA 5AIAA 3ESAA 3NEYA 1V5EA 3SFTA 5EE5B 4F3NA 1OZ0A 2IEGA 4DJEC 5COBA 4RLFA 4HPJB 1T4BA 2F5PA 4DSUA 2ES4A 2JLUA 4C7OB 5JI2E 1TEHA 1SD2A 2J9XB 3D4OA 5FI1B 4HL4A 1BX3A 3D59A 4DM3A 2RJ3A 4E2WA 1NLZA 1FMLA 1U0OC 1MAWA 4K9NA 5DLYA 1PR5A 4E1BA 1CZUA 2DHRA 1PV4A 2FOIA 4EW2A 1OI2A 5CVTA 1JQAA 1OD6A 2P6RA 2ETVA 2LWXA 1MUUA 2RSLA 2CCKA 4QM6A 5DB4A 3VR4D 3WJ2A 5BW4A 2ZSFA 3CJQA 3OZXA 1XMSA 2WSYB 4JQCA 1AMOA 2UUAB 2WM2A 1FOEB 3LOUA 2PLRA 3KZNA 3Q0IA 3E9SA 4BB5A 2ZT7A 4A1OA 1NJ6A 2G7MC 4ZEOA 1QYXA 4ZIRB 5HKKD 1ZINA 4JXZA 1S7GA 1Y5MA 1JIKA 1PTJA 2QW0X 4B6OA 1RZRD 1PVOA 2QVXX 5SYNA 3F9IA 3I09A 3JQBA 3BOSA 5I9LA 5JLJA 1K4MA 3V1UA 4YMVA 1RRKA 1YMQA 3LX6A 4OU7A 1U0RA 3R5SA 4U6NA 2VT7A 4ZOEA 3NHAA 1CUYA 1YA6A 1QIKA 3TRFA 3OQHA 5GONA 2HJHA 4L6V6 1NA5A 3IJEB 1CQIB 3OWOA 3BCUA 3PSHA 1V8ZA 3U1TA 1X7XB 1RXSA 1E9VA 4YJGB 2P6UA 1W5SA 1I2CA 1JT2A 2D5LA 2P5TB 4UHBA 1X7ZA 4RJKA 4XRRA 1I5RA 3CUSA 2R44A 4ZVLA 2JVJA 3PI7A 4PC2A 3U31A 3PRHA 4BFWA 3N58A 2NYRA 3O4IA 3WGLA 4YUAA 4D9JA 3F7OA 2MOKA 1CJMA 4YRAA 4MRRA 4QFMA 1UP4A 2WUVA 5GM2A 4BLRA 5MN4A 3IBGA 3IHTA 1X92A 1OAKA 2ATVA 4QYIB 4ONEA 3L5KA 4BV8A 3KXIA 2OSVA 2Q5FA 1AKEA 1E7QA 4Q0MA 1RVDA 4TV8B 5F2NA 1EFHA 3BT7A 2FR1A 1D0LA 4C5CA 1M1YA 2DFPA 3OJLA 2B94A 3UWSA 4TSRA 3NBIA 2HMVA 2IVZA 1E63A 1E9RA 10MHA 1H42A 4PX3A 4LV8B 3RH0A 4MARA 3A3KA 3MRVA 2UDPA 3TZKA 3NC4A 2WG1A 3OSZA 1HE8B 1N2IA 2HMAA 3C3JA 5LZ5A 5JZOA 3FKJA 4M8NE 2ALJA 3AHHA 3VXKA 3FXAA 2WVAA 4CJXA 1PL0A 1EGMB 3DDSA 2UV8A 3C45A 3S29A 3ZLBA 5JSZB 3FWKA 1JR3A 3AFGA 1JNXX 3MJDA 3QUTA 1F0KA 3R1IA 5E1MA 4GZLA 3RWBA 1ORDA 1ZVKA 2ZETA 1XTPA 3DAFA 3EIFA 5MFZA 1E1QA 3JR4A 1Y6QA 1EGQA 2A57A 3KHTA 3N59A 3OJCA 4G2TA 3H9GA 1XG5A 1ZYUA 3FVVA 3PEUA 2QJOA 3S70A 4NOOB 3AIKA 4KE7A 1TO1E 2KNVA 3ZWVA 1A9RA 2LCIA 1BVSA 1A27A 3BWYA 3G9ZA 3JQ9A 4HWPA 5DMXA 2Q3LA 1BVUA 3LRTA 2QN9A 3QBTA 1EWQA 4BO6A 3NVDA 3I76A 5U4QA 5CG2A 2GFQA 2J7PD 4PYMA 2XXAB 3DPSA 3B1KA 4G84A 3KR9A 2YJTD 1KE2A 4DQ0A 1Y6GA 4NYJR 3NJ8A 1MORA 2JIQA 4DRZA 2B6NA 2KNAA 4AG6A 1RQ2A 4YTEA 3M2TA 4HLCA 4QU5A 5JHGB 4JLJA 5HKAA 4BVKA 2AKEA 3I05A 3D2CA 2V59A 4K40A 3RV3A 1IAQA 4C4RA 1LQ2A 3GUUA 4PYKA 1J0EA 2H2GA 1H2XA 1V25A 3C3AA 3F5SA 4KMOA 3HM2A 3MWDB 1TTEA 4AMVA 3FW1A 4I4NA 1GKLA 1CRWG 3WOHA 2PH7A 1ZRMA 4X6YA 1GTSA 4M0PA 1AQNA 2HMUA 4LZJA 3B85A 3E4DA 5GJBA 1E0SA 1U7WA 1KDZA 3RSOA 4A7PA 3LHDA 2UUBB 1BEZA 1C9MA 4GGPA 4TXLA 1YS4A 5FYQA 4W5OA 3WMRA 4AY3A 4MAMA 2XEDA 1IN4A 1QGZA 4JEIA 4C0WA 3AGPA 1RW4A 3GR6A 1GPKA 4K46A 4QWMA 1Q5PA 5J43A 4YO7A 4RF1A 1RMTA 2J31A 2NSLA 9MHTA 4UM8B 4I5EA 1SHTX 4L0CA 2AYXA 3LPAA 3Q8LA 4BX9A 1AV6A 3Q7RA 5BQOA 3OPYA 1S2DA 1E6KA 1ADJA 2HK7A 4I81A 2Z4RA 1J8FA 3GRKA 2H2WA 2OLKA 5BSFA 2V7XA 3AEYA 4MUHA 2H00A 1KOLA 3V2IA 3A4VA 3U0BA 1JBQA 1ZFNA 1CT9A 3B1XA 2EF0A 5DFAA 3TKYA 1SM4A 2I4IA 2OV1A 4ZDWA 4CI0B 4LF9M 1JKJA 3C4VA 4YJ3B 3VLFB 4ADSG 3HSYA 1TNDA 2Y0DA 3JATB 4I9HA 2JA2A 3SSAA 2DB3A 1O4WA 4AS2A 1UMCB 3AVXA 3ANXA 1W5AA 4HN2A 4YAEA 4CL8A 1G5FA 4O33A 5CT5A 4LOLA 4E15A 1ELOA 3I58A 4P7GA 2C7BA 5IVIA 1J0XO 3GD5A 5EGSA 5IHPA 4OB7A 2DZNB 2B35A 3CBQA 3EW9A 1JA1A 1B8PA 3KTDA 2PLWA 2VRCD 4BQSA 4Q47A 2BFBA 5ESDA 3VR1A 1U2RA 3GYGA 5DO9A 3S2FA 3E5RA 3RF7A 4QBFA 4EJ2A 4Y3UA 3OPMA 2Q45A 4CF3A 3F6BX 3IULA 4H7KA 4QXRA 4Z49A 4FC6A 7ABPA 1JG4A 4EHIA 2DCMA 5HKKA 1Q3CA 4CFYA 1EG7A 1IDOA 1XP8A 4F9GA 1TKBA 4N7MA 2AC2A 2P1DA 5CUQA 3UWMA 3Q4GA 3ZHZA 2HWYA 5EJFA 3K9NA 3TQSA 2XUHA 5D5QA 2MSWA 4NI5A 1WPXA 3M4ZA 3TM5A 1OXSC 4M49A 4UD2A 3BK1A 4GMGA 1H3NA 3I1JA 4XD7A 4C06A 2C4UA 4YRRA 4UNIA 3ILSA 3NVMB 1NXPA 1TCUA 3L5OA 3WIBA 3NIWA 2QQ8A 2IIVA 1KSHA 3HYTA 3R5FA 2NACA 1AKUA 4HDOB 1PE0A 3GFVA 3IQZA 4GI1A 4U9HS 3SSOA 4LXGA 3O8OB 4AWXA 4M88A 2I34A 3T4UA 2TRSB 2H4JA 2XMGA 3JWPA 1XZKA 4HZIA 4LJLA 4PFQA 4QPNA 1XZEA 2B99A 4AJLA 1LSUA 4X54A 3FY4A 5BP7A 4TTRA 1ISPA 4G8BA 3A1TA 1CEQA 1IC6A 2E4WA 2IU4A 5DCWA 3V8RA 2J0VA 2JDID 2XDWA 1L7VC 3SC4A 4U00A 1TKAA 2XYRA 2QTAA 1H22A 5K03A 1JQ3A 5A5DA 3MMZA 1X86B 3BKXA 2QZ9A 2YMPA 1ZMTA 2BGTA 2FX3A 5D84A 3IKTA 4G1FA 3QY0A 4WESB 3VKWA 4DXHA 1WRBA 4LY6A 3QMPA 3KZOA 3ONFA 3DD5A 3KJZA 1FZTA 5K0GA 3X3HA 1OXBB 1FU7A 2CXSA 1AUAA 4CBVA 2C9OA 1UODA 2BWEA 2QM7A 1N0HA 3A9CA 4IGFA 1Y42X 3QKSB 4PN7A 5JZVA 2C1ZA 1L2DA 1L7PA 2UU9M 2Y68A 4L02A 4N5IX 2ZSUA 1SHZA 5DHUA 3WZLA 3AERB 4RPLA 1T5TA 5DSTA 5JS1A 1L9KA 3EC7A 3TNJA 1KZ9A 4P3NA 2ATIA 4ABYA 2B4RO 4LRYA 5FR2A 1YL5A 3N8DA 4J29A 5DM1A 4N5NA 5FNVF 2RCYA 4EL0A 1IQRA 5IH3A 4UTVA 1TMGE 3IP3A 5JCOC 1LB1B 4QRHA 1C41A 3ZDQA 4W5WA 2F3TA 4AWBA 3EE6A 2O2XA 2R47A 5FAXA 4ER0A 1SB8A 3AESA 3PX7A 1HA3A 3G5AA 3HA7A 2JI4A 1SG6A 2CFTA 3LWDA 4CT0A 1XTRA 3L6DA 1R1DA 4FJ0A 2Z8YM 5HVNA 1QGED 1ORTA 3RO7A 4HYTA 2XUGA 3ZZ0A 1BS2A 2GHIA 3QG1A 4B74A 5JISA 1IOVA 4PONA 4TT3D 5ARCA 1HYGA 3DAHA 4MEAA 1SUDA 3FTNA 4RQBA 1OFIA 4XI9A 1LZKA 1PIWA 2G72A 3T0IA 4XQGA 2XZOA 4GM4A 2YKGA 4MM3B 3PJFA 4HVTA 1DINA 5TV2A 1CR6A 2V58A 3QPBA 4ENPA 5CBPB 2OHJA 1B8VA 1NM5C 4ZP1A 4IBBA 2I6FA 1D6JA 4RPHA 4ZREA 4ZT3A 2N0SA 4LZNA 2PBFA 3MLAA 2ZB8A 3GN1A 4H4DA 1PFVA 2LIPA 4LCJA 2BZ0A 1C8LA 5ANRB 3NUQA 4QJIA 4ENUA 5HXAA 2JY8A 1Z7EA 4B7ZA 4EQ6B 5LJLA 5IT9A 1NHWA 4LYFA 2QDXA 1S02A 4KUGA 3AIMA 1DUSA 3BF8A 4ZQGA 1ILEA 3BGSA 1G8YA 4UMFA 4EY8A 3KJQA 2QN6A 3RS8A 1XCJA 1Y9EA 2HDWA 3LFTA 1DWUA 2VH5R 5DNCA 1HKHA 1QJ4A 4A3SA 5CDTA 1P2FA 1VHLA 3KX2A 4BP3A 2EFJA 3FCXA 4QELA 4WXPA 2XE4A 3LP8A 3QH4A 1GQOA 4NF2A 1SFRA 4QTYA 3ZE6A 1I3MA 3G2MA 2H5IA 3SASA 3Q7IA 1MQSA 4E11A 2EP7A 4PEVA 1XCGB 3D3QA 2G07A 4JLKA 3ZXUB 3G8BA 4G5YA 3T1NA 3LQKA 1DKOA 2WG2A 4ME6A 4DZTA 1HR0M 2PNFA 4Q16A 2EZ4A 2P0YA 1CUEA 1SKQA 3QYEA 2O3QA 5NLLA 3BD6A 5IVDA 2CHVA 4MCAA 4XVCA 1KAEA 2VTBB 4B33A 1X39A 5FUXA 1T0JB 2C59A 2UZIR 5FWNA 3LE8A 3PXUA 3RBAA 5JO9A 1OHHD 1UPUA