3TE6A

Crystal structure of the s. cerevisiae sir3 aaa+ domain
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
316
structure length
304
Chain Sequence
PNADINLEESIRESLQKRELLKSQVEDFTRIFLPIYDSLMSSQNKLFYITNADDSTKFQLVNDVMDELITSSARKELPIFDYIHIDALELMDALYEKIWFAISKENGDISLEALNFYITNVPKAKKRKTLILIQNPENLLSEKILQYFEKWISSKNSKLSIICVGGHNVTIREQINIMPSLKAHFTEIKLNKVDKNELQQMIITRLKSLLKPFHVKVNDKKEMTIYNNIPDNVIVINHKINNKITQLIAKNVANVSGSTEKAFKICEAAVEISKKDFVRKGGLQKGKLVVSQEMVPRYFSEAIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for the role of the Sir3 AAA+ domain in silencing: interaction with Sir4 and unmethylated histone H3K79.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
molecule keywords Regulatory protein SIR3
total genus 88
structure length 304
sequence length 316
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17872 AAA_lid_10 AAA lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1280 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3te6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3te6A01
1G7TA 4DCVA 2GK6A 4BFUA 4DDUA 4JBXA 1ZBDA 2GNOA 1SVMA 5B2ZA 3AVXA 2BM1A 1ZINA 1T4GA 2Z6VA 3EAQA 3KZ1E 3P20A 5JBQA 2J0UB 1DAMA 4B34A 3BJIC 2QGNA 2VEDA 4BWYA 5AJWA 2XB2A 2OLKA 5J5CA 2BBTA 2V7QD 4DDWA 3DVLA 3KKQA 4B71A 2TMKA 3IPXA 2LKCA 3VR6A 4TZ6A 3L8ZA 2VP2A 2RB4A 3VX4A 1VG1A 3A58B 1TADA 2QNRA 2BJVA 3THYA 1JR6A 1SVIA 3LBHA 3HU2A 2VTKA 1F6BA 2QTFA 1U0LA 3EARA 1VIYA 1TMKA 2RKOA 3O8CA 3TUIC 5FOTA 5L3SA 4WZBE 4BGDA 1XJQA 3KTAA 1OKKD 3U6KA 3VKWA 3NBZC 1OH5A 1NVWQ 1EFRA 1JAHA 4EPRA 5KSZA 1TPZA 1SXJE 1Z0AA 4L15A 4LV5B 4Q1EA 4RD1A 4GZLA 1GM5A 1L4YA 3W3ZB 3W8RA 1N6PA 2CMKA 5AUOB 3RDPA 3EIHA 4JL8A 1FP7A 4OHZA 4BUJA 3BXZA 2AXPA 5BN5A 1XPOA 1UKYA 2ASEA 3CR8A 3I8SA 4OJKA 1QHSA 3BWDD 5DH9A 4DCUA 1N5IA 5JJLA 5GVRA 4YMWA 2JCSA 4UJ5A 3R9IA 3FVQA 3PEWA 4A2QA 2XNSA 4JLVA 4B44A 3OIYA 1E9FA 2CL0X 3CRW1 4KBFA 1KSHA 1S1MA 3GJXC 5JWRA 2HDNB 2Q21A 2WSSA 3VR1A 3TW4A 1A1VA 3CKLA 3LH5A 5EE0A 1P5ZB 5F9HA 1OIXA 2GKSA 3A1TA 1T3LA 2QN6A 4EJSC 5EJEA 1XB2A 5JJKA 4DUGD 3TMKA 4MUAA 4DEXA 1ETUA 2ZJ8A 3PEVA 3LBNA 3P26A 3LXRA 2VO1A 2O0HA 3VHXA 4LOAA 2ZM5A 3PR1A 3CF0A 4QC2A 4ARZA 2QG6A 4AYXA 2JLZA 3OEHD 4WVFA 1M6NA 3NC1C 2IWHA 3UANA 5TDHA 4XWKA 4O2LA 2J7PD 2XXAB 4Z1MD 1OLOA 1E79D 2ZROA 1OT3A 3FMPB 4E07A 1N6KA 4HB3A 5TVKA 4US2R 3PENA 4E09A 1L2TA 1EG7A 4LHXA 4B3FX 3TKLA 4FWIB 4U02A 1CXZA 1T8UA 2EYQA 2W6IA 1TU4A 4WZAE 5FTNA 1Z8FA 3X1YA 4G01B 5JWOA 4OHVA 3M0EA 2J41A 2RGXA 1CBUA 2Q3FA 2ZAOA 4H1UA 1XEWY 3REGA 1G5PA 4PSKA 2JLQA 4M9QA 3IEUA 2G3YA 4HZIA 1WP9A 4AK9A 1GP2A 4KI0A 4HAUA 4BZQA 1E0AA 2QTVB 1I4LD 2O0JA 2WPDA 1OFIA 3E70C 3MMPA 4KITB 3T06B 4NP6A 2OFXA 4JJKA 4EPVA 5TB5A 3DEFA 3AGQA 4F91B 2N1BA 4LYHA 3SBDA 2IBMA 4Q9KA 1OXXK 4D4LA 3GLIB 2DB3A 2BMFA 3MAAC 3QF4A 2OUKA 3B1ZA 1OHHA 4QGHA 2W0MA 3K0FA 4QM7A 4NYIQ 1QVRA 1YR9A 2QSYA 2VLIA 3VMFA 4POAA 1OFUX 3WNCA 1FP6A 4Q7LA 1J8YF 4Y0AA 4WA7A 1KIMA 3U44B 1HV8A 3OFND 1KHTA 4LUCA 3AH8A 4UXIA 1E94E 5EUQB 1ZD8A 5FR1A 5JHGB 1LS6A 4BZPA 4DT1B 1PVOA 2GCPA 2BEJA 3A4LA 3U4QB 1KI9A 4LZZA 1E1QA 2QPOA 2QRNA 1P7CA 1BYIA 1IONA 3EXAA 3B13B 1QRAA 3CIOA 3QIAA 4P31A 4YXWD 1Q12A 3U3JA 2DWQA 2VF8A 1C1YA 2WMOB 4JKYA 5HR5A 4JLJA 3NDBB 2R9VA 4IRUB 5DLQC 1II8B 2ODNA 4Q7MB 4ASUA 3AP2A 3MWKA 3LVQE 5IK2D 3I4LA 3P32A 2CJWA 5EE9A 5L3RA 1NF3A 2ZRKA 1UBCA 2G1KA 3VR4A 3UK6A 5GVSA 5AUNB 3D3QA 1BS1A 3TUZC 2C96A 3Q7PA 5EXXA 5FTLA 1G18A 4Q1DA 5JECA 5F98A 1L7VC 4GP6A 1XFAA 2AR7A 1OIVA 2DR3A 3SJCA 4QG7A 3ICQB 1PV4A 3WYAA 2ZRLA 5JS7A 4QJ3A 2GF9A 4WW0A 3VU9A 3P1JA 5J4LA 3R8CA 1N0WA 4MQBA 3GLFA 5JLJA 3MJHA 1KK3A 3PITA 4FMBB 1UF9A 3AB3A 3RAPR 3B1VA 4NYIR 5FOSA 4HLUC 4C4PA 2R6FA 2ZE8A 3LNCA 1JR3E 4Q9JA 4LPSA 4URXR 1RJ9A 1NBMA 3AEZA 4NBSA 2ZRGA 5H70A 1N6HA 5L3VA 1FZQA 2GAOA 2HT6A 1NL3A 4HAZA 5HKKD 4ZI2A 4TLCA 1E2JA 3T1TA 1RZ3A 4D2IA 4MKHA 1HE1C 4QNRA 1W36C 1MT0A 1F2UB 1SGWA 4LC0A 4X8OA 1Q1ZA 5KDLA 3ZVMA 3PIRA 1EFHA 1WBBA 5EXSA 4JIMA 2WJGA 1RFLA 2ZAMA 2ZR0A 4D6PA 4KFUA 2IS1A 3I5YA 2REOA 2XZOA 3WNBA 5CITA 1AQYA 3KJIA 4OYHA 3T12A 1K8RA 4F93B 4CEHA 1QHHA 1IOZA 3CUEF 4B3DA 3I8XA 1CIPA 2RAPA 4ILEA 2VP4A 4JLNA 4P0TA 4UNRA 1E9AA 1OXUA 2ZANA 1T91A 3LQRA 4CDGA 3E2IA 3WHKA 2F1IA 1OPXA 1GWNA 4OK3A 2QY9A 4WXRA 3TRFA 2QAJA 2ZUCA 4NYMQ 1I2DA 2AWOA 3BIFA 1D9XA 2F55A 2WWIA 3I72A 2ZQ5A 1R0WA 5TY0A 3SYLA 3R7WB 5H8WA 1UAAA 5DHFA 4RFSB 1GZSA 1KAOA 3RWOA 4B73A 4EUNA 5F9FA 3WNDA 3U60B 4OI0A 1ZIOA 4LYFA 3W90A 3BD9A 4OBEA 2QA5A 1P9NA 2VPPA 1AS2A 1WA5A 3KXLA 3EZFA 3LV8A 1I4DD 2ZEJA 4DUGA 5L3QB 1HURA 2WAYA 4EPWA 4P4UA 4G5GA 1GILA 1FNNA 5HE9A 2VF7A 1Q20A 2AK3A 3T1QA 4NU0A 3IHWA 3LLUA 3OIWA 4IDPA 2V9PA 4FCWA 3K0SA 4XH9B 2AL7A 4W7SA 4NCHA 4DEYA 1OXTA 2VSFA 1VECA 4QOSA 1ZU5A 2ZRJA 3GLGB 1VHLA 4MYHA 4RD6A 2SHKA 3EC2A 4FCTA 3B60A 2V6JA 4M1YA 3AVOA 2A30A 2QMEA 4O0MA 4Q1AA 3BH6A 2IYWA 4KO8A 721PA 1S9DA 2GJKA 3CB4A 3CX8A 4TQUS 2O8FA 2JA1A 1QHXA 1SXJB 5C4MA 5KOYA 4GT1A 2HT1A 2QQ0A 2ZVPX 2NOAA 1W4AA 5G3YA 4OHXA 2ZYVX 3H2YA 4GOJA 2MSEB 2CE7A 3LVRE 3DOFA 1EXMA 3IHLA 1EFTA 4P4TA 2ORVA 5K8IA 3MWJA 2XB4A 2C9YA 4DT1A 1ODFA 1G8YA 1W49A 3TJZA 5J4HA 4K81B 2GEVA 3BH0A 4I1VA 2GZAA 3RRMA 1XMSA 2J9RA 2ZYWX 5HTKA 4PC3A 1BMFD 5L8VA 4LSGA 1TEVA 3SOPA 4MYCA 3CWQA 2PBRA 4XWOA 5CK4A 1ZNXA 121PA 1E3MA 2BC9A 1VTKA 1ZD9A 1PUIA 1KSFX 3U3MA 1T0HB 3P4XA 5AK0A 4URVR 4WBSA 3H1TA 1KDPA 2OHFA 3T1VA 4XOIA 1KNXA 3CZPA 2RCNA 2QT0A 4LYAA 2CK3A 4A92A 2GBLC 3B2EA 2QMUA 5L3SB 1M7BA 4JT4A 3BGWA 3VKHA 1YZKA 3KXKA 4GMDA 2NO1A 3ZGXA 1F2TB 4Q03A 1KMHB 1EESA 1J7KA 1HT1E 5IDVA 2P0EA 4PHTA 4G5QA 3UIEA 4A2PA 2OLJA 3K9LA 2GZHA 4NCJA 3PXGA 5TARA 5CYPA 2XGJA 2ZSAA 4YONB 1E2EA 4TMWA 2GESA 3EIQA 3TNFA 3GFTA 4PSAA 1C4OA 1X8LA 1TQDA 3X1ZA 2JJ2D 1M34E 2JJ8A 1AZTA 4JLMA 1P2UA 1F5NA 1DTSA 1KO5A 4K46A 3ZZUA 4TTRA 1CEEA 2JAQA 2CEAA 1G5RA 3IKJA 3FWYA 4MUBA 2I1VB 4QM6A 3VKGA 2YWEA 2Z0MA 1P2VA 4IFEA 3K0CC 2NIPA 2V54A 4A0HA 1XP8A 2WTUA 3B78A 1RC8A 4GDFA 3HU1A 2GILA 2OCYC 2J0VA 1G6HA 2VP0A 4HAWA 4MGYR 1ZNWA 1T6NA 3AKCA 3CW2A 3RWMB 3ZJYA 3EWAA 3QG1A 2KB0A 4KSCA 4US0R 3QVVA 3RS7A 3ZD7A 1XRJA 1QHNA 3EC1A 3GEIA 4OI1A 4A8JB 2FH5B 4L16A 4DLXA 3KKMA 4AG5A 1UDXA 3QBTA 2YKGA 3RS2A 2BIFA 4TLAA 3W6OA 1N6OA 2ZJ5A 2O0KA 1YR6A 3HYTA 1FMJA 1MABA 4EQ6A 3SFVA 3T15A 5BXQC 1TQ2A 4BEJA 3SJBA 2PMDA 2WJHA 3WXMA 4ZDIA 3FYHA 1WCV1 4OI4A 1DVRA 1U0JA 4U7DA 5EZ6B 4B3XA 4DKXA 2QROA 2IYYA 3PFIA 2P6UA 3TR5A 2NZ8A 3E5HA 4ZI3A 4R7ZA 2GBLA 5JWHA 1FFHA 2CJWB 2QM7A 3B85A 4OJQA 4DCNA 1KK2A 4MKFA 3CWZA 3MD0A 2VHUA 1DAEA 1NN5A 4U5XA 3WMEA 2HCBA 4DLTA 2R6AA 2OG2A 3NEYA 4CEJB 2ANCA 1AS3A 1ZNYA 4CW7A 3FMOB 3TE6A 1KJWA 2A7QA 2WKRA 2CL6X 2OCAA 1S9HA 3K53A 4XTCS 1FUUA 1BMFA 4LBZA 4DCTA 3MJRA 4N0DA 2WICA 3Q72A 2ODBA 3LFUA 2YV5A 2L0XA 3IUYA 2C95A 4NYJQ 1JALA 1Q1EA 4RD3A 2IXFA 4Q9HA 1A82A 1FX0B 1JAIA 1L4UA 5KPDA 4QGGA 5C46F 1OYYA 3GCGA 4HZUA 1R0ZA 3OIVA 4MRVA 3AF1A 4JSYA 4MGKR 1Z28A 1D2MA 2F43A 1NSFA 2WZQA 2XJ9A 4TTQA 5FTKA 2P2LA 3CX6A 3UWKA 2PMKA 4DIEA 5DO9A 2QGZA 1KSJA 1D9ZA 4IW3B 3ZYCA 3KXIA 5KU1A 4BLQA 3DL0A 4XTRA 2ZS9A 5DGXA 4F4JA 2PCLA 1G8GA 2BMEA 3TLXA 4BFTA 1ZM4A 4V03A 3AKDA 2HUPA 3RC3A 2ZRAA 1D5CA 1WRBA 4V0KA 1NMXA 4M1OA 4DJTA 2W6ID 2O8DA 3OAAD 4RFSA 1KY2A 3K0AB 3BERA 5CLQA 3SU8A 4TT3A 4D80A 4ESVA 5DSZA 1XTJA 2OFOA 2IYLD 4LJ8A 1W4CA 3CONA 3X1WA 1IHUA 4DLUA 2YHSA 1ZAKA 2FF7A 1XD9A 4Q19A 1IN6A 4RFVA 4RZUA 3SS8A 4EFNA 2YWHA 2B7CA 3VQTA 2V1XA 1Q44A 3H4MA 1SVLA 1J2JA 4JVNA 4V0NA 2UZIR 2CL7X 3THWA 3NG1A 3PUWA 1AS0A 2BM0A 1XD2A 4QHTA 1E9RA 2OEPA 4FINA 4M1KA 1S1CA 4NCKA 2J5XA 2NZJA 1XU4A 3QXSA 4I81A 3RS4A 4TYNA 1EX6A 4HDQB 2XTNA 3UG6A 4Q4JA 3TSZA 1XPRA 3GFOA 2OILA 2AD5A 2R2AA 4RZXA 1U98A 1SXJA 3C14C 4QNMA 1G8HA 3ZS8A 2KBFA 3BBPA 2XNDA 1KNQA 5JEEA 1I2MA 3AVYA 3SFZA 4Q4HA 5C18A 2FFBA 1FPMA 1RVDA 3AF4A 3MUFA 2K5UA 4B6EA 1IN5A 2IUUA 2H8KA 3AF0A 1CJMA 2ZVQX 5D3MA 1OFTA 1YU9A 421PA 2CVHA 5KDDA 5CM9C 5FBWB 4OK6A 4BFYA 1Z22A 3IBGA 5LD2B 4BFVA 1W44A 3K0FB 1RPZA 2ERYA 1HUQA 3P4YA 4HDCA 2C77A 4ITRC 3LWNA 4YDSA 5EE5B 4R71A 4BPBA 2ZRCA 2V4ZA 1A2KC 2QP3A 3WP1B 1QDEA 4JMPA 4F4CA 3BK7A 3TGPA 4RCZA 4TYWA 3MCAA 4BLTA 2W2XA 1TQ6A 2OCPA 4IXNA 2W2VA 1NLFA 5TXGA 3HP1A 2NQ2C 2CNWA 2NO0A 2ZUBA 4M22A 1FW6A 4ZPXA 3QKSA 3BC1A 4PPQA 1Z06A 1ZP6A 1NN3A 1CR2A 4MGIR 1XEFA 3WRYC 1C9KA 4V0OA 2WWGA 1GUAA 1FOEB 5FUVA 2KSQA 3QUSA 4PHFA 4LPKA 1G5TA 2LKDA 3REFA 3KX2A 2R62A 1YZUA 3LA6A 2NO7A 3MSXA 3GLFE 3KB1A 3SYNA 1DG3A 1OJLA 3U44A 4M1TA 1KZGB 1ZU4A 2WBLC 4Q7JB 3F3YA 2ZRHA 1GG2A 1LY1A 1NN0A 4WZ6A 3RANA 2QT1A 3RS5A 3DKPA 4LGMA 2WWXA 1G291 1HTWA 1K5DA 3S1AB 4AC9A 1WE2A 2GCOB 3B82A 2Q9AA 2FPKA 1X8JA 1D2NA 2ZE7A 4M1WA 3EW9A 3G82C 4L4UA 3FMIA 4EKDA 1P72A 2GJSA 4C0BA 4B3BA 4Q18A 1RJ9B 3B5JA 2HYDA 3BH7A 3K70D 1II0A 4OHYA 2MSCB 2ONKA 4DLWA 3GLFB 3GJ7A 2QZ4A 2V6IA 3SDZA 3RSLA 2KI5A 2ATXA 3NH9A 3NHAA 3EX7C 1E2PA 5FPSA 3AVVA 3VR3A 3CRRA 4JVSB 1SVKA 2H16A 2YVUA 3CRVA 3J81k 4Q1BA 3CM0A 2BKUA 1N6NA 3M4YA 4JS0A 4L9SA 3QI2A 3CZQA 1M7HA 4MA4A 2QENA 2IYVA 4ZIRA 4GBMA 2C5LA 2OAP1 5TV2A 2QPAA 3MG9A 1W47A 2WOOA 4A1FA 3UATA 4JBYA 1MOZA 1E1QD 1MRSA 1NBME 2E1RA 3U2QA 4BECA 1Z0JA 1KJYA 3A1WA 1ZM9A 3GJ0A 3HWSA 3VX3A 3X1DA 3RVBA 1COWD 3QEJA 1E2MA 3NWJA 4JL5A 4Q4JB 1Z83A 4C0AC 2P6RA 1H65A 4IOKA 1UM8A 1YRAA 1GRQA 4RD2A 4E22A 3THWB 5FPYA 3BRWD 1KO7A 1ZMXA 3I62A 4Q4HB 4MRSA 2EFGA 4LY6A 1U9IA 3HJNA 3CNLA 4V0ME 1VCMA 1RYFA 5K8UA 2ZJYA 3WBKA 1KDTA 3R20A 3ASZA 5A4JA 3O47A 3RABA 5BN4A 2IS2A 1I4TD 4UKDA 1JPNA 5IHPA 1GL6A 1Y3AA 1YHNA 2HLDD 5A5GA 4IOJA 1Z0IA 4LJ7A 2CCGA 2NO9A 1LV7A 3GLIE 1Z29A 4O25A 2A9KA 3AP1A 2GTPA 3UG7A 3V00A 3WY9A 4KVAA 3ZQJA 2OXCA 1KI6A 5JS8A 3QE0A 2IWRA 4KODA 1KZ7B 2AX4A 2D2EA 2JLYA 1XX6A 2FSIA 3HYRA 2ZIAA 4IEIA 1MO6A 2J0QA 3QXXA 2D7DA 2ZI6A 1XXHB 3PCRB 4RD4A 3PUVA 3QF7A 3LY5A 2GXAA 3CO5A 2BBOA 4Q00A 3AV0B 4GRAA 1G4UR 2RGCA 1G19A 2C04A 2NPFA 1GRNA 1FNMA 2NMVA 1G3MA 2O5VA 4M9XA 2BKEA 2VP9A 2ORWA 1E0SA 3UMSA 4ZKDA 4AURA 2BDTA 2JJ1D 2PZEA 2HYIC 4XD7A 2ZPTX 2RGDA 4AD8A 1AA9A 4NTZA 1XZPA 2F7SA 2OZEA 5C1BA 1EWQA 5C4GB 1KO8A 3R9XA 4BFSA 3LX5A 2B21A 4PHGA 3F5FA 1W2HA 2I4IA 2QP9X 3JZAA 2CCJA 3FPAA 1L8QA 2EVWX 2PZFA 2C9CA 1ONBA 1XCPA 5FTJA 5BW8A 3IIJA 4PZLA 3V4FA 1QHYA 4IVPA 4QJ5A 4B2PA 1TUIA 3U7FB 4Y0VA 2FFAA 4IDNA 4YQFA 1XEXA 4I99A 2O8FB 2ZJBA 1OXVA 3BORA 1MH1A 4MDFA 4AKGA 2FPMA 5DI3A 3G0HA 4GL2A 3CLVA 1W46A 2YJTD 1F3OA 2GCNA 3ND9A 2IXGA 3K9HA 1R0YA 4A9AA 2VP6A 2QPTA 1OIWA 2JLVA 5DN6A 3AUYA 1NLYA 2DBYA 2I3BA 2VH5R 4KV9A 2BMJA 3IPYA 1R8QA 1VYUA 2ZJ2A 5KNDA 1V43A 1TTTA 3BB3A 3FTQA 2Z5FA 3FHCB 2WJYA 1N0UA 1EFCA 4C9BA 3W8NA 4E5UA 5FUWA 1M7GA 3TBKA 4KFTA 1FQJA 3CBQA 2X19A 3LLMA 3W9YA 1RW4A 2MSDB 2W00A 3FB4A 4Z8YA 4PO1A 2F43B 2GWHA 5D3MB 3DDCA 1OXSC 3PQCA 1XNJA 1KKMA 4UNNA 2UVQA 3ZDQA 1CU1A 5TMPA 3TR0A 4ZDKA 2ZI4A 3NH6A 1MO3A 1NMYA 3KUDA 4G3XA 4LC1A 2G0NA 1II8A 3CNOA 2OSBA 3GJ5A 4JLKA 1DEKA 1TX4B 2X8AA 1IQPA 3K8YA 3N2EA 1VHTA 2AFIE 4A6XA 2QMHA 3AF2A 4TL6A 1TQ4A 1J70A 1XEXB 4JVLA 4FMCB 2XXAA 2PLRA 2C9OA 4Z8XA 2J59A 3U61B 1QF9A 1F60A 3QOFA 1Q22A 1SHZA 2J0UA 1NRJB 4PC6A 5BYKA 4URWR 1CLUA 3Q7QA 4FN5A 1G4AE 4YXWA 1H8HD 1MKYA 4GZMA 1AKYA 3QPWA 1CF4A 5EQTA 1DE0A 5GJWC 2ZXUA 1IBRA 3MGCA 4D82A 2VSXA 2ZR9A 4MKIA 4B32A 5AUPB 4AKEA 3O8BA 5FOUA 2CHQA 2OFWA 3C16C 3KB2A 4FWTA 3EZ6A 3IQXA 1QBKC 5KHOC 3K09C 3OIUA 4OQNA 4Q21A 4TSFD 3TIFA 3VHLB 3FDIA 3X1XA 4Q02A 4BQSA 3T61A 3RS0A 3TSOA 5KSYA 3DO6A 4X8LA 4DVGA 3O8RA 2GXQA 2GDJA 3A4NA 1QHIA 5EP2A 1KMHA 1E2GA 2GK7A 4HSEA 3Q5EA 5JSZB 2J87A 4Q4LA 5CIQA 521PA 2OBNA 2QORA 2QUZA 4Z1MA 4DSNA 3QENA 3RNLA 4KSBA 4TLEA 1G3IA 1N3BA 1XPUA 2BVNA 2YZ2A 4ZCIA 4TMXA 2Q3HA 4FD2A 3DZ8A 4LRWA 4Q48A 5H68A 2F3TA 3K9GA 5E7MA 3RHFA 1DAIA 4Q4AB 3EPHA 1NKSA 4BE7B 4EIWA 2XX3A 2OCBA 3QJYA 2OAQ1 5IT5A 3I3SR 4PPFA 2IEZA 3UXMA 3NBXX 1N6RA 2FFQA 3PJRA 1E9BA 2WJIA 3NBYC 1Z6AA 2N42A 3LBIA 2QQEA 3A8TA 2V1UA 2X2EA 1IN8A 4CEJA 5HCIA 1VCNA 1EWRA 2FX3A 3EG5A 1HEIA 3IQWA 5KSPA 4A0GA 4CRWB 4CT5A 3WYFA 4DLYA 5FUYA 2OESA 1KTVA 4EPXA 5EE1A 2ONJA 5JMTA 4EPYA 3EA0A 4S2EA 3UWOA 5JSZA 5HZHA 4HLCA 1IY0A 4D0NA 1SKYB 1NI3A 1ESMA 2VHQA 5FBLB 1S96A 1HQCA 1E32A 2JLUA 5F3WB 3AF3A 4HI0E 1DARA 3ASYA 621PA 1NBMD 1E0JA 4PQFA 2W6JA 4DLSA 1Y63A 2HXSA 1XF9A 2C03A 4Q1FA 5E7IA 4ZKEA 1DO2A 1KMQA 4QBGB 4MYUA 4BLSA 4A6PA 2ZSFA 3GMTA 4XVQA 2IYTA 3IIKA 4C30A 3SHWA 3THOA 2EFEB 1EGAA 4LWZA 5SZHB 4KFSA 1NLZA 1U8YA 1UPTA 4HAVA 2PX3A 2HV8A 4KLNA 2JATA 4F7WA 2RGAA 3Q85A 1RRCA 3LD9A 1A7JA 3NBFA 1T3HA 2ZRPA 4D0GA 1G16A 1GAJA 2WOJA 4DBLC 1H8ED 1H8EA 1Z6YA 2FFHA 3IO3A 3BS4A 3FFBA 2O8BB 5EP3A 3LRPA 3CRQA 2CHGA 4W9MC 3K0EA 1W0JD 2PH1A 2AXNA 2FEOA 4AY2A 5J4KA 3IDQA 4DRZA 2H57A 2R6GA 4BLRA 1X1SA 2RHDA 3DOEA 3ND8A 3M1IA 4BLPA 2FMXA 1Z63A 1S0UA 3NKVA 4RSGA 4C0HA 3LXXA 1N5JA 1EFUA 5A0FA 3HPRA 3N2IA 1B0UA 1R8SA 1FL9A 2KBEA 2W6JD 4X8HA 2GXUA 3U3OA 2XTZA 4RY2A 1WQ1R 5B30A 4GOXA 3D8BA 2J0SA 3AM1A 2C8VA 2IYSA 1KDOA 1TU3A 2ZREA 3AVPA 4G0NA 1T5IA 4QBHA 5EP1A 3X2SA 1RRPA 1ZM3A 4NONA 4IDOA 1CRQA 3QEOA 4AKHA 3L0OA 3I92A 4A36A 5KNCA 3N5CA 1KJZA 4LBWA 4TLDA 5G53C 2QL6A 4GFDA 2FE4A 5FBRB 4OKSA 1LTQA 5FUXA 1CJUC 1YR8A 1W4RA 4PSVA 1JJVA 1ZIPA 2JJ1A 3SQWA 3CPHA 4MDEA 2A5FA 2O8EA 4B35A 4ZDJA 1IXRC 2IK8A 4IVQA 4AIIA 3L8YA 2G1JA 2P5SA 1Z47A 5AJXA 2IC5A 1N5LA 4G5OA 4N0EA 2QAGA 4BZXA 4JSTA 3U7HB 1PJRA 4YC7A 5AUQA 2PJZA 2IHYA 4XVUA 4M9ZA 1QVAA 2A5GA 4CZ2A 2N46A 1VCIA 3KFVA 3JVVA 2PX0A 2NPIA 1LF0A 2GCOA 4GP7A 4AG6A 3C15C 1TAGA 1R2QA 4M9SA 4IDQA 5LPNA 4GNKA 1W5TA 4HEJA 5ELXA 4QL3A 4U00A 1T5LA 2DPXA 1JBKA 4YLGA 4A0RA 4XVRA 3EWSA 3AKYA 1NG1A 4PQRA 3SZRA 3C7KA 4UNQA 4NMMA 1PUJA 1O87A 1ELOA 1MR3F 1ZYUA 3BB1A 2JLXA 2Z4SA 3OEEA 2DFTA 4ABYA 4LHYA 3GPLA 2IYRA 4WXPA 1KKLA 5DIFA 5DYIA 2ATVA 1DS6A 1S2MA 2D74A 4URYR 2CDNA 5HCNA 2V7QA 3Q9LA 2FA9A 1UBEA 2DFNA 1LS1A 1QHGA 2W2TA 2HF9A 2QAGB 3TQFA 4HLDA 1W7AA 4JLAA 1NKTA 1Z2AA 5L3QA 4UJ3A 4IEEA 1YZQA 2GZDA 2GHIA 3SR0A 4K8OA 1RE0A 5UKDA 2J1LA 2O8EB 1R7RA 2ZETA 2VYFA 2FGJA 3L43A 2JASA 3CF6R 4MKGA 4TL9A 2P65A 4HAYA 3GLGA 1K5GA 4YMVA 5EP4A 5D3QA 2FWRA 4RKEA 1Z5ZA 3GD7A 1G9XA 4PFSA 3VTKA 2X1VA 1U81A 1WMSA 2VP5A 2P6NA 5BN3A 3MFYA 1HY3A 4ESHA 2VHJA 2NGRA 4RD0A 3U6BA 1ESNA 1OF1A 1NVXQ 3FKSA 3F8TA 1DELA 1N2CE 1R5OA 4HZUB 1WDTA 4ON9A 1Z07A 4Q66C 1EFRD 2AHOA 2WJJA 4NZYA 1NJGA 4RZ2A 5JCPA 4GSYA 2PT7A 4D4KA 1DPFA 3GJ3A 1W2GA 1Z0DA 4JLPA 1P2TA 4O2RA 2ODWA 1R5BA 2OM2A 3D6TB 1VYVA 3HPQA 4LX0A 4WIAA 2ZI3A 1CR1A 1TL7C 3THYB 4DC9A 4UQOA 3THXA 2GJ9A 3V4RA 4YMSA 1RRFA 2E9SA 1LFDB 2XZLA 1OSNA 2PEYA 4FIDA 4Q01A 1P60A 3TAUA 3UPUA 2P3SA 4TQAA 1LW7A 2Y8EA 2DCUA 3G5UA 5KYKA 2Z43A 2V8OA 3LO5A 1N0VC 3D7MA 3K0CA 2WVJA 3OZXA 2EYUA 1KI1A 4TQ9A 2RGNC 4B74A 1SVOA 1ZJ6A 1D6JA 4B6FA 3AVUA 5JCZA 5SZJA 5BWMA 2HF8A 2EW1A 1X3SA 3QF4B 2ZS8A 1W36D 4NCIA 4G5SA 4OK5A 1E9DA 5CB8A 2KJQA 1XTQA 3I1FA 4HDOB 3I32A 1E96A 1OYWA 3MLEA 4JT2A 3PEYA 4XSGA 3QNUA 4O3MA 1E2NA 4PR0A 1G8PA 2X77A 4KAXA 1W1WA 4HB2A 2D4HA 4MYTA 4PC1A 4DZZA 1AN0A 1P73A 1N6IA 2ZI7A 1AIPA 3DKVA 2QU8A 3ZS9A 1ZC3A 1E4YA 2ZSEA 4TN1A 4B47A 2JLWA 2R65A 1HYQA 1KSGA 4A8JC 1NN1A 3B8HA 1VKJA 1HQYE 3B9QA 3LAWA 4N1AA 3EZ9A 1NVVR 1Z6XA 3Q8XB 4NYMR 1ZW6A 4PZYA 4A0FA 4B33A 3BOSA 1R4AA 3B6EA 4CF7A 1P4SA 4D0LB 1N6LA 3RRNA 3IIMA 1E98A 5DI3B 2H92A 2ZJZA 3GJ8A 4TL8A 4C2TA 1UKZA 4RJLA 5FTMA 2IYUA 2HJVA 4XSHA 4TMVA 3FHOA 4Q4AA 3KQKA 3IGFA 1SVWA 1VG8A 1ZRHA 821PA 2ANBA 2AK2A 1P62B 1YJ5A 4EFMA 3ADKA 4CVNA 5CM8B 3KJEA 3TVDA 5GJVC 2WWHA 2XOKA 3RSOA 5AJZA 5E7JA 3C5CA 3I61A 1JNYA 2XEXA 1XMJA 4NYJR 2NG1A 3RS3A 4TL7A 3CF2A 3NHBA 2ZSBA 2KWIA 5CB6A 3B7GA 3WMGA 1GITA 1T8TA 4F4IA 1JXMA 1S3SA 2GXSA 5ANRB 4C0QC 3K0AA 2IS6A 1OH7A 2OE2A 2VL7A 4OQFA 5GJBA 4Q47A 5AJVB 2FU5C 2BBSA 2J46A 4PQYA 4EJSA 1M74A 5HZKA 4PTLA 1FTNA 4TT3D 1VPLA 3CPEA 4ACBA 1PLLA 1G64A 2B8TA 2GVZC 1DAKA 2V55B 2D2FA 4IXMA 3JVUA 3GP8A 3W6PA 2QAGC 2E87A 2QSZA 3BE4A 1KI8A 4RKFA 2NTYC 4LJYA 4C0SA 4CYMA 5FH9A 3A36A 5EZ5A 2LWIA 1H8HA 2CK3D 1D2EA 3KQHA 1UEIA 4LV6A 4R98A 2A2ZA 2FZ4A 4NPHA 4HYYA 3K09A 1Z2CA 5G41A 2OBLA 4ASUD 2Q9CA 4QHYA 3TW8B 3T5GA 1AZSC 1M1YE 4CEHB 3IEVA 2B8WA 3SJZA 5DN6D 2P67A 4TYYA 3ZIAD 2X2FA 4PC7A 1GKUB 1KK1A 2UKDA 2YWFA 2REBA 1KI2A 1MRNA 2H18A 1KGDA 2ORIA 3Q5DA 1ZUNB 2PT5A 4B75A 5KO2A 3ECCA 1GNRA 1IXSB 1GTVA 1SVSA 2WHXA 2CNWD 1LB1B 4DSUA 2ZRMA 4C0JA 3U4QA 2QE7D 4P33A 4QKQA 3ZQ6A 2JIZD 4I1SA 4ZIRB 3NDPA 2H5EA 2Z4RA 2IT1A 2CE2X 3QKUA 1PZNA 3UKDA 2YNMA 4ARZB 2IS4A 5JHHB 3KQLA 1OB2A 4B3CA 2JJ2A 4FCVA 1IY2A 4M4SA 3MWLA 1JR3D 3ICEA 2CLDX 1XTKA 5KDOA 4DDTA 2QI9C 2JLSA 1DAHA 3FMFA 1UDWA 3AUXA 1U0HC 4NDZA 4OQLA 1G7CA 1X8KA 3AGPA 3ZZTA 1GVNB 3U7GA 1GOTA 1XJ0A 1P2SA 1YQTA 4HAXA 4GPTA 1DBSA 1Z6GA 2CBZA 2YINC 4MGZR 4IKEA 3NVAA 3T5DA 4I4LA 5EXPA 1K6MA 4GI7A 5J4YA 2CLSA 3VNUA 1OE0A 5E4FA 4UNSA 1E2IA 3EPKA 2VHTA 1UKVY 1XDBA 4DXAA 1F48A 4P32A 4YMTA 2R8RA 3FFAA 2FEMA 3KQUA 1U8ZA 1IN4A 4GOKA 2HJGA 2ZTSA 2AWNA 2R44A 3HR7A 2BMDA 2J7PA 1US8A 2ERXA 4RVCA 1XCMA 2HEIA 1JR3A 3BFXA 1R0XA 4QGFA 2XJ4A 2J7KA 2YWGA 5KSOA 5JFGA 3ADDA 2WWFA 4A4DA 1QHHB 2FSFA 1Q21A 2HLDA 3A1UA 3GJ4A 4MRNA 1DO0A 5FBVB 1ANKA 4LJ5A 5B58C 2QP4A 1X86B 3S1AA 2PEZA 1BH2A 4NKRA 2GJAA 1WXQA 1NIPA 3SN6A 2IYXA 1A4RA 3QBVA 1GNPA 1P3JA 1KO4A 4B2LA 1U99A 1IXZA 2VHCA 4IOLA 5DYGA 1U90A 2WSSD 4KYUA 1N5KA 1UEJA 3L0SA 3NXSA 5DI9A 4BRWA 2VBCA 2GAAA 1A5TA 3K1JA 4AI6A 3TK1A 3VR2A 3GEEA 4GMXA 4HUTA 5KTYA 1FUKA 2ZJAA 2CCKA 2XITA 3R9WA 4TZ0A 1SULA 2C78A 1BIFA 3KKPA 3QVUA 5EUMA 1NSTA 1KAGA 3WHLA 4KLZA 1JI0A 3QKSB 3C8UA 3L0IB 4LYJA 2A5DA 3QKRB 3N70A 4M53A 3DMNA 1RIFA 4TTPA 4WOPA 221PA 2G77B 1GL7A 4DIDA 1YE8A 3B1XA 4KFRA 4AYWA 1W0KA 3OE7A 2ZU0C 3W5IA 2WKQA 1DADA 5DE3A 2VA8A 5CLLA 5G40A 4AWXA 3ZD6A 5DHAA 3WBJA 3CX7A 4AKIA 1M8PA 2F1RA 2RH5A 1T0JB 4ERNA 2BWJA 2KE5A 2BCJQ 3E1SA 1AJEA 1M2OB 1OV4A 2IA5A 2YC4C 3KKOA 2XOKD 3AVQA 2IF0A 1Q1QA 2JIZA 1U94A 4JKIA 2JGNA 5FOVA 3AVTA 4OHWA 2O8CB 3TUJC 4DLZA 4N3NA 2PL3A 2AKYA 4TMKA 3EASA 5CJ2A 5JJIA 3C4JA 3A4MA 1MO5A 1X6VA 2FSHA 1E9CA 3B1YA 2AD1A 5CIWA 3NC0C 5AJYA 4LI0A 1G20E 1G7SA 2WPDD 3B9PA 2QM8A 2GETA 4YMUA 4TYQA 2EU8A 1KY3A 5LBIA 1BOFA 1G3UA 2DHRA 3KQNA 4D26A 5FPTA 2ODEA 1IJEA 3QPVA 2NO6A 4XIGS 1OW3B 2GA8A 2G0TA 2GJ8A 2RGEA 2V3CC 1ZUHA 1J8MF 2IX3A 4KBGA 4Q9IA 2ZE6A 2C98A 5EXTA 1FQKA 4ACAA 3IO5A 1HH4A 4PHHA 2FZLA 4V0MA 5J4VA 1GL9B 2A78A 5KUTA 1JXOA 2DWOA 1G3RA 5CJPA 5J47A 3A1VA 8OHMA 3PVSA 3W3AA 1AM4D 3EZ7A 1JQJC 4EPTA 2F9MA 4FMDF 3TQCA 1FTSA 2WAXA 1XBTA 1UJ2A 2D7CA 1U9IC 1G17A 1G3QA 2ZI9A 3BB4A 4MH0R 4TMZA 5AWFC 3CR7A 5IRCD 3MWYW 1VYTA 1XTSA 3ZVLA 4LBVA 1WBDA 3VFDA 1Q3HA 4M0LA 2YOHA 5B64A 4IFBA 5FR2A 4FW9A 1OH6A 4M8NE 1G41A 4Z51A 2O8CA 4P4SA 1UFQA 1S8FA 1W0KD 4LHZA 3C5HA 1KDRA 1FX0A 2O8BA 5BQ5A 4CIDA 3SEAA 3KKNA 4DSOA 4W5HA 1G7RA 4JZKA 1ZNZA 5H1YA 4LJ4A 3LDAA 3GLHE 2VRWA 2G9NA 1GNQA 1AK2A 4KXFB 3BFVA 4BRUA 2DFLA 2IYZA 4Q1CA 2ZSDA 2IL1A 3KDSE 3U7EB 4G5RA 2CHVA 4BFZA 3LX8A 2XZPA 1PLKA 1DG1G 2GEDA 3QQ5A 2P5TB 3OHMA 2ZYUX 4KU4A 5FFMA 3T34A 3A1SA 2JDIA 3V9PA 3U3KA 1JQLB 1GRRA 3TH5A 4EAQA 3EPJA 5FOXA 4HATA 3HR8A 1CJTC 1MABB 3FKSD 4KCGA 3GLHB 4EQ6B 1VDZA 5HKKA 3PEUA 3OE7D 3GEHA 4UXHA 1LNZA 4I1OA 4D25A 3L82B 2ZYTX 2OBMA 4HB0A 2J45A 2CLCX 4TSFA 5FPHA 4RZ3A 1RKBA 1YKSA 3QSYA 1JECA 4TWZA 3HU3A 4HLUA 2IEYA 1Z3IX 5JI2E 1YVDA 4Q9LA 3R7WA 4XJXA 2VQSA 4JYCA 4M1SA 2XAUA 4UXJA 4YDHB 3O8DA 1KI7A 1UBFA 2VIIA 3W5JA 2XSZD 2OXRA 5CK5A 2QBYA 2G83A 2RGBA 2JDID 4C7OA 3ZZ0A 3KUCA 1WF3A 4X8MA 3K70C 1W0JA 2ZITA 4B43A 1G21E 1KOFA 1RYHA 4OQMA 3RLFA 4CT4B 1NP6A 1Z0FA 1IY1A 1XD8A 5DNYB 1AKEA 1P61B 3FOZA 1IAQA 1E2DA 1OFHA 2PJRA 2BJWA 3GLGE 1VG0B 2IHBA 2AFHE 1JB1A 4DWJA 2MMGA 2GRJA 4QHSA 4QXAA 3WMFA 1XJCA 3ZLJA 4Q5IA 2Q6TA 3A6PC 5LD2C 2H7VA 5K8TA 4NE2A 3CPJB 1BKDR 2WIBA 1ZCAA 5FI1B 1OH8A 3RRZA 4C0LA 3RC8A 3AP3A 2XTMA 1QZXA 4IHQA 2FOLA 2YC2C 3DZDA 4BFWA 1XWIA 4XWAA 2BCGY 3GLHA 3OFNA 1JJ7A 2FJUA 4PX9A 2WJVA 3FKQA 5E3HA 2DWPA 5JRZA 4V0LA 1ZM2A 4NH0A 1ZVQA 1CKEA 1HA3A 4M2LA 4F38A 4WAUA 1FMLA 1DAGA 2W83A 3ADCA 4IDHA 1HT2E 2BBWA 2F1HA 1BYUA 1W36B 2RGNA 2ZUDA 3P27A 1KO1A 1DAFA 4ZCLA 1YZGA 3CNNA 5JEDA 1VG9B 4FMCF 2RHMA 3F0TA 4JLDA 4QJ4A 2ZE5A 4JVMA 5K8LA 4CEIA 2RMKA 2ZRDA 4PO8A 3VU9B 1XEWX 1SKYE 4BASA 2H1LA 3K70B 1SKQA 2CVFA 1E9SA 3QXJA 1TEXA 3TAHA 4LK2A 2FPLA 2C2HA 4URUR 4TMTA 5JI3E 5FL3A 1VIAA 3QY0A 2Q9BA 1IM2A 4ZO4A 1WB9A 2FG5A 2FNAA 1B23P 3M6AA 1NJFA 3BAFA 5FOWA 1VMAA 1T3SA 2IW3A 3THXB 2ZJOA 2ZR7A 1E2QA 5SZIA 3EZ2A 2B7BA 5M04A 4C2UA 1MO4A 4JBWA 4MRPA 5KNBA 2VSOA 1E0KA 2ZI5A 1F2UA 2MMCA 4PAOA 3T35A 3I73A 1XD2B 2EWVA 3EPLA 3GLIA 3MRSA 5B57C 4DCSA 2OO7A 1XMVA 2B6HA 2WIAA 3SJAA 5CDFE 4TYPA 4EFLA 1E79A 2BOVA 4QBIA 4ZCMA 2IUTA 3PUXA 4XD7D 1ZUIA 1E2LA 3OESA 4OQXA 4E03A 1GDDA 2G6BA 2HXYA 1X1RA 2JLRA 5FPKA 1QG2A 1R6BX 3FE2A 3IILA 3OEHA 3T1OA 4CEIB 4OL0A 1P9WA 1TUEA 3C41J 4I1UA 2WWYA 2O52A 2ZS7A 1CS4C 2ZRNA 3LW8A 2YYZA 3UMFA 2A3RA 3L0PA 4JLBA 4J0QA 4LJ6A 1E9EA 3DHWC 1EK0A 1E2HA 4HLQB 2BHRA 1OB5A 2ZRIA 3FGNA 3KL4A 5FL7D 1CRPA 3RYTC 2DYKA 1S4QA 2XNDD 1YZTA 3WRXC 4LJ9A 4CGZA 4DB2A 4LV8B 1E6CA 5GJCA 5C2JB 1SXJC 1CJVC 4PZZA 6Q21A 1Q57A 2AN9A 2ZRFA 4JJZA 4BFXA 5LDDC 1KI6B 2WKPA 3KFXA 5HPYB 1GKYA 4EJSB 2FGKA 4D81A 2ZRBA 1CR4A 2D3WA 3GQBA 4M21A 2IUSA 3SE0A 4Z54A 3ETLA 3GFPA 4HUQB 1XXHE 1LF5A 1QG4A 3KTAB 4ZDWA 3U3RA 4B2IA 1ZD1A 2AKAB 2IYQA 2JEOA 4KYIB 4PPGA 4UNPA 3DMDA 4H1VA 1KI3A 3ONWA 3VR5A 1NY6A 2ZU6A 1SHKA 3ADBA 1IN7A 2EFDB 2F9LA 2QEQA 4DB4A 1UKEA 3I5XA 1E2FA 3PUZA 1Z6TA 4JYBA 5CYOA 1KI4A 2WWWA 2RGGA 3W6NA 2YOGA 3D31A 1LVGA 2R6DA 3LQQA 5DISB 4P4SB 4AYTA 2ECKA 4HUQA 3PV0A 4C0KA 2GEUA 4TLBA 3QKRA 4B76A 1KK0A 2OV2A 2QMOA 3CH4B 4G1UC 3ZIAA 4DLVA 5FI0B 4PANA 1F2TA 4R2HA 1COWA 3B1WA 5FL7A 1R5NA 3KJGA 4V02A 5AR1A 2BEKA 3H86A 4URZR 1G1MA 3NTUA 3SHFA 1CTQA 1UADA 5HE8A 3OF5A 2FN4A 4FXPA 1HE8B 4F92B 2GF0A 2HCJB 5IK2A 4L5BA 2Q3MA 1RRGA 3RRYA 3ZVNA 3JZMA 1ZC4A 3FHTA 3ZVRA 2DFKB 1AGPA 3DPUA 1D8TA 4B3GA 1XTRA 3CRMA 2EWWA 3DM9B 2D06A 2PLFA 1P75A 1ZCBA 4LDJA 4R9UC 1KYIA 4FI3C 1Z08A 1GFIA 4LBYA 1E1RD 2UZ3A 1XCGB 4LJAA 1TF7A 1Q1BA 5P21A 4JLOA 2F3RA 4KJZA 3VAAA 2H17A 3QXCA 1NVUQ 3W34A 3PUYA 1Q3TA 1S3GA 4A2WA 2QE7A 1OHHD 1IJFA 4S35A 3Q3JB 2QTHA 1N25A 5F2EA 4DDVA 3SI7A 3QPUA 5J40A 1US8B 1XZQA 3QKTA 4PAMA 3TSWA 4JL6A 4A8JA 4NHOA 1GSIA 5JZVA 1GKIA 1II9A 4KHZA 5KPJA 3LW7A 1E2KA 1JEDA 3UMRA 4DSTA 1TF5A 2W58A 4US1R 1EX7A 4Q7KA 1U8AA 3IBYA 2A5YB 2YOFA 3NEJA 1NY5A 3HDTA 3SQXA 4MITA 1W5SA 4II7A 1NVVQ 3EIEA 2XSZA 4QFMA 2G88A 2D62A 1R10A 2W0SA 4PO9A 5LB2A 5LB4A 1NIJA 2OT3B 4BEBA 1W4BA 5CDFA 2QRZA 2WV9A 1AQUA 1JPJA 4FMDB 4L8GA 4LHWA 4M1MA 5G3ZA 4B48A 1YZNA 4IVRA 5E95A 2EFCB 1TNDA 2FSGA 1OKKA 4PXAA 3NIBA 2FDCA 4NCNA 2WM9B 1JEEA 2Q0HA 2EFHB 3H0KA 4KVGA 4W5JA 3U5ZB 4DHEA 4QBFA 4MRRA 5EE3A 1CULC 2B92A 2IF2A 2IXEA 1G8FA 3K9NA 3R8FA 2PCJA 2R6CA 1E4VA 3L2OB 1A2BA 5BYJA 4PC2A 2CXXA 1ZM7A 2Z83A 2FV8A 4NL4H 1XTIA 4DLRA 1NNEA 1TF2A 3QXHA 2WSMA 3VNVA 3BFKA 4HB4A 4OI2A 5GADl 1BO6A 4RCYA 2DY1A 2WMNB 3TVTA 1UBGA 3AQ4A 2C99A 4D4JA 3AKEA 1SZPA 1SXJD 2LCFA 4PAQA 4QRHA 3OEED 4LCBA 2F6RA 1NMZA 3QG5A 2REXB 4C7OB 2J3EA 2O8DB 3CH5A 1E99A 1W48A 4IOMA 3SYKA 1U2RA 2QBYB 1YRBA 4H9GA 4A15A 1O3YA 4BLOA 4IJMA 4P3YA 4PPNA 3SNHA 1YR7A 4C3ZA 1AGRA 1J90A 1GIAA 1G6OA 1CJKC 5IF9A 2BV3A 3WYGA 1J99A 1P6XA 2I1QA 1NG9A 3H84A 4R2IA 1P9RA 1Z0KA 3KJHA 5FBQB 3PG5A 3SBEA 1CP2A 3DM5A 3WP0A 4A82A 1CR0A 1E1RA 3EA5A 4EDHA 1V5WA 2PZGA 1DOAA 3SC3A 1PLJA 2F1JA 3OAAA 1VCOA 1MV5A 5SZKB 4W5WA 4ZV4A 2A5JA 2GVDC 4QGAA 1SQ5A 1Q0UA 1XXHA 4L9WA 3ZH9B 3AVWA 5JRJA 1XMIA 1YZLA 1T9HA 2EQBA 4D4MA 3A37A 1E69A 3GJ6A 4LHVA
chains in the Genus database with same CATH superfamily
3HGMA 4YP1A 2P4QA 4JOBA 4NV3A 1ZJ4A 1WXDA 5JJ5A 1SVMA 5B2ZA 3AVXA 2BM1A 3KZ1E 4YQYA 5A9TA 2B30A 3BXHA 4OU5A 5BSGA 1X7HA 1BKSB 1S8NA 4BLVA 3A46A 3MGAA 3VU1A 2MSLA 4GM1A 3IPXA 1QIJA 3LYUA 3ZX4A 4MR7A 3IP5A 4LF9M 1WD5A 4TZ6A 2GVNA 4MUNA 3A58B 4WI1A 4BO4A 1TADA 1FFWA 2QNRA 3THYA 1I1HA 3LBHA 3GGCA 2Q46A 1MTZA 2VTKA 3BD8A 1F6BA 2VBIA 2OGTA 4BNMA 1RLMA 2RKOA 1B93A 2JB9A 2XVMA 5CYFA 3TUIC 3I12A 2NZVG 4BGDA 4LRTB 3KTAA 4B6RA 1ISHA 1POXA 5LJLA 1AKWA 4HNTA 3LC2O 4B08A 1CP3A 1TPZA 3KOYE 1Z0AA 4LV5B 4Q1EA 3RYFB 1FVHA 1L4YA 2JFQA 3Q40A 4ZCTA 5F5NA 1L9XA 3R0IA 1N9GA 2VDRB 1HRDA 2VVTA 3L28A 4RC9A 5T41A 4BUJA 2PZJA 4C78A 4UFPA 2IYNA 3FCYA 3CR8A 3SLGA 5KWIA 1DBIA 3E22B 2XZOA 5DH9A 5GVRA 4NRVA 4YMWA 3JQRA 2WYIA 4UHFA 2HQRA 4Z4IA 3OTOM 2Z9CA 2JLAA 4JLVA 5E3IA 3HMKA 4A2QA 2FX5A 3OIYA 3T5PA 4OO3A 3CBGA 5F3DA 1MAWA 1E9FA 2I5PO 4IIJB 5K3OA 3WJ2A 5A0TA 3CRW1 1L3BA 1Z4NA 1BDBA 3CKKA 4GUAA 3L46A 5AK3A 3X2EA 3IMKA 3PKIA 2Q21A 3JQ7A 3TW4A 1A1VA 1P5ZB 5F9HA 2I78A 3AHCA 3IUNA 4I14A 3QE3A 4TTVA 4OLAA 1T3LA 3QFFA 1PGOA 1A3CA 2PKCA 5JJKA 2RAFA 4KIUA 4DUGD 4DEXA 4M0DA 1ETUA 3PEVA 3VHXB 1PYGA 5K2MA 5LMUB 4BEWA 1N8SA 3EIOA 4CNBA 1WABA 2YTZA 3CF0A 1L5FA 1XZEA 3HJSA 4PD2A 2QG6A 3COVA 1A4XA 3DE2X 3DFKA 1ZVJA 2IWHA 5CAEA 5ISMA 3KTFA 2Q5OA 3CURA 3F6SA 5TDHA 4L5IA 3U13A 1NXTA 5A71A 2ZSKA 1QFZA 1EGVB 2HD4A 4Z1MD 2XXAB 1P31A 4XQCA 4J76A 5JQGF 5HIJA 4EUEA 2ZROA 1X9IA 2QVXX 1N6KA 4HB3A 1MVOA 5TVKA 5K0LA 3D02A 1DKQA 3PENA 4BVGA 4BP9A 4DBLE 4E09A 3OSUA 1DINA 3TLBA 3DJFA 4LHXA 3MOSA 2YYSA 3N8NA 4OHBA 5BMVF 1QZZA 5KWVA 3H5NA 5IT9A 5K45A 1T8UA 3O84A 1GXSB 2FY8A 2ZJ3A 5JO9A 3X1YA 4DY4A 5A1JA 2ID9A 4FX5A 5FDFA 2GYVA 3ZCPA 1KERA 1M2JA 1CF2O 2J41A 1UJ5A 4JGIA 5GOZA 4BVHA 2Q3FA 2ZAOA 1DGHB 1HDYA 2WB4A 5IZ7D 4LY9A 5KNDD 1ZA1A 1OLXA 3JYQA 1RBYA 2QE6A 4GOLD 4MROA 4XDYA 1FSZA 3R3JA 4DOMA 4HZIA 1WP9A 1ORIA 4BRZA 1JFRA 2CGEA 3CG4A 4KI0A 2JC3A 4BZQA 2JA2A 4ZRMA 3VU3A 1R1DA 3HN2A 4TN5A 5EZQA 2NXEA 2O0JA 4R51A 3O3CA 3MMPA 1NASA 4G3OA 1Y7TA 3Q0IA 4ND8B 5H0IA 3T06B 2C61A 1K63A 4EPVA 5B3LA 2BMWA 1A8QA 2XNKA 3FLBA 3R7LA 1CIVA 1YJ8A 2WZBA 2O14A 2PL1A 1TH4A 1P44A 4R9SA 4L0MA 1H2XA 3UYLA 3ZDYB 3SBDA 1U9YA 4FBMA 2IBMA 4CG2A 4CIBA 1QFYA 3M34A 1OXXK 3GEDA 1N4DA 3NTQA 2E6UX 3GEMA 4Q3NA 3V7FA 3B1ZA 2BDUA 3OPQA 2D1SA 1N92A 3VMFA 4HFNA 5ALLA 4WK4B 1NW5A 2D8AA 1QPGA 2GEFA 3RUDA 3LPNA 3VR6D 3T6PA 3KTOA 3VU0A 3U44B 1KHTA 1U3FA 1CC1S 1RWMA 4LUCA 1E94E 1JQEA 5ALGA 4KR9A 3TJMA 5JHGB 1Z17A 4IINA 3HKCA 2AB0A 2GCPA 5EYPB 2ZUEA 2XUOA 1O95A 2BEJA 1GO2A 3PEFA 1CDDA 1OVGA 2CRUA 4RJJA 3SF8A 3U4QB 1RM0A 1CUWA 1E1QA 2VJMA 1S8OA 4HCJA 5BR4A 3Q6MA 5REQA 1AF7A 4OIMA 3EXAA 4E3WA 2IZ1A 2OFFA 4P31A 5U4XA 1MD9A 5HR5A 3LOQA 4JLJA 3L49A 1PF7E 2Q5HA 4CU2A 1FRNA 2IZOA 4IQ4A 3ITEA 4Q7MB 4LJLA 3AP2A 3MWKA 4WINA 3I4LA 4B31A 3VPGA 3AHJA 1NF3A 1XLTA 1FS5A 2QN9A 2ZRKA 3FPJA 1GZ5A 3HY5A 1I5OA 1ZUWA 1U3TA 3DNMA 1ZHHA 5K3BA 3SBXA 1TB4A 3H2BA 1JU3A 2C96A 3UUGA 3TUZC 3BXWA 2GKOA 3QVOA 5CDGA 5JECA 5J1SB 5LP6A 2GPSA 2VQDA 5TPWA 1JU4A 3UQYS 3ICQB 3SJCA 2WJ4A 3HCFA 4UD6A 2ZRLA 3N05A 4UHEA 2PTHA 1U9ZA 4WW0A 2D2VA 4IHJF 2Y20A 4P92A 4DMUB 4F2PA 3A05A 5C9ZA 4RXMA 5A4MS 5I45A 1PNQA 4CDNA 3GLFA 1DRVA 2I7CA 4IPTA 4CISA 4AZ3B 4PX5A 1RJGA 3PX7A 1UEXC 5U9CA 4B3RB 1OOEA 3Q15C 5FOSA 1HLPA 3H5TA 4EYGA 1KQOA 2R8XA 4O8CA 3FZNA 1JR3E 3BXXA 3V4LA 4URXR 1RJ9A 3TGWA 3UUFA 4MVXA 4Q3KA 2E37A 2AOUB 5J3JA 4X61A 1WXHA 2XB9A 4AJOA 1J2YA 4QDKA 3TO5A 1RZ3A 1HE1C 4QNRA 2FN7A 2GPTA 1SUAA 1LKZA 1W1UA 2I4RA 1XQVA 3U4DA 3B6KA 4Z4HA 2F8TA 4OMFG 3IQHX 4X8OA 3ZVMA 1EFHA 3RUPA 3O8OA 3KUXA 4K9QA 2F3PA 5EXSA 4JIMA 2HAEA 3DE7X 2ZAMA 1RFLA 1DBQA 3MJ5A 4X90A 4D6PA 2BP7B 4QRIA 2IS1A 1R12A 2REOA 1LX6A 1DWQA 2VDMB 3WNBA 4HQOA 1ZN7A 2B94A 1K8RA 4PVDA 4F93B 2Y6VA 2G80A 2QKYA 3KAQA 3SYRA 3WK9A 3CUEF 4BX2A 3I8XA 1SQFA 5A9SA 4MH0E 1P81A 2CXQA 2VP4A 4JLNA 3VTFA 3WQBA 1Z68A 1Z5BA 1ZGZA 5SYNA 3U56A 2ZWIA 2EAUA 3GUCA 3LQRA 4Z9AA 2M6RA 1IUNA 1ECJA 1ECFA 3WHKA 3UHOA 1O03A 1L5LA 3KVNA 3C5EA 5I4CA 1XRQA 1C9JA 2WJZB 4CIZA 1NPDA 2PUHA 4X20B 4Q34A 2P2ZA 4U7HA 3BL6A 4NYMQ 3FNBA 3GV0A 3IURA 3SSNA 4AJKA 2AWOA 2I4OA 1ORVA 4CCAA 2K2WA 3T99A 2F8MA 1V45E 3BTVA 3SYLA 5K8VA 5I3ZA 3UF0A 3RWOA 4K6KA 4B73A 4C6SA 1PBTA 1X7YA 3WNDA 6CHYA 5A3QA 1ZIOA 1ZY2A 4PT5A 2LXNA 3RVQA 3OA2A 3BN3A 2QA5A 4OBEA 2WQZA 1P9NA 2VPPA 1TEHA 3EZFA 5E26A 3IVMA 5EIHA 4K88A 2ZEJA 4BJ6A 2DFVA 2FRXA 4EPWA 5KKNB 3B52X 4P4UA 1KFEB 4YRIA 5JZSA 5HE9A 5BORA 2JIRA 3P9XA 1EE2A 3IP9A 3JYOA 1FY2A 4EP1A 1XKXA 3OIWA 5BRNA 3JD1A 4X6XA 4FCWA 1Z6ZA 3K0SA 2AL7A 2FRDA 5KCMA 4QOSA 2NADA 3BRWA 2A0KA 4QAJA 1NYLA 2Y93A 3AEXA 2W6CX 3ORYA 2IEDA 2RBEA 5FYQA 4P83A 4ZHSA 3E18A 1UAYA 2H29A 1AZLA 2A30A 2QMEA 2CWDA 1OX4A 4JJ8A 3SIWA 2DJ5A 2WJAA 4MCJA 1E4OA 1U3WA 2Z7JA 4KX3A 4KO8A 1PE0A 1BQ3A 1KY4A 3MWDB 3K5WA 1TGYA 4ENTA 2WDZA 3DE3X 2G8NA 4YR7A 1PYDA 1QHXA 5IMSA 5C4MA 4ZAGA 4YRFA 1NJ2A 2HXGA 4CLHA 4M0EA 2X8JA 3RADC 1YJAA 1EVZA 3JQ9A 1RXWA 1CQWA 5GGYA 4GOJA 3ULKA 5DEIA 1KEVA 3LVRE 4RMIA 2JH3A 2ZTVA 1EFTA 1VEGA 1JKMA 1YBFA 2QRVA 2ORVA 1XC7A 5K8IA 3MWJA 2NP7A 2XB4A 3FKEA 1ODFA 5CLHA 1XDZA 2IU4A 4XUGB 3R09A 1SA0B 3UMCA 2ZIXA 3ODPA 3IAS6 4CI9A 1CZOA 4P7FA 2XMSA 4BQRA 2DWCA 2J9RA 2HA3A 1JB9A 2I67A 4WECA 3QP9A 5HTKA 4WBNF 5L8VA 4J2TA 4NCBA 5HK9A 3A32A 3SOPA 3EDCA 4MYCA 2PBRA 5CK4A 1N0IA 1ZNXA 2JHGA 3PEEA 1JDPA 2BC9A 1VTKA 2YRXA 4QPJC 1ZD9A 1PUIA 1Y9AA 3LKZA 3UKOA 2I3DA 1YBMA 1SWWA 3HQ4O 4L02A 2QW8A 4YX9A 4LF9B 1LWOA 4URVR 4V0QA 1MA0A 1QS0B 3H1TA 1AURA 4XOIA 3AUJB 2PVPA 4LYAA 3TS1A 3A45A 3TZBA 1IBKB 1P5HA 3IERA 4DJAA 3B2EA 2QMUA 3DW1X 3C5WP 3E2PA 3IUEA 3F6CA 1VG5A 1ZN9A 3IOEA 1WTCA 2NO1A 2X0EA 4D56A 3ZGXA 5LQUA 3T1YM 3KRTA 4Q03A 1KMHB 1Y5NA 2NVBA 2QVLA 1P3Y1 2H5LA 1GADO 6ADHA 4G5QA 3UIEA 3QU5A 1NXWA 1YHYA 1LX7A 2OLJA 3PC2A 3K9LA 4WXEA 1QGAA 1WW2A 3KU4A 4NCJA 5CYPA 5HRAA 3OC0A 3X43A 5CEJA 1VJTA 2ZSAA 2XZFA 1N2SA 1VPTA 5BN4B 2BFFB 4HNGA 2GESA 1Z18A 1SM4A 3GFTA 2DETA 1YFKA 2O3UA 2ZT6A 1RHJA 1X9GA 8MHTA 2I71A 1M34E 2JJ2D 2VJDA 4JVOA 1P2UA 1C8KA 1DTSA 1KO5A 3I6BA 3TNLA 2XA2A 3IKJA 1IM5A 3PQFA 5CB0A 3MWGA 4QXMA 4QM6A 2XF2A 1XHFA 1EYZA 2Z0MA 4GXQA 2NIPA 1H5QA 1G42A 3B78A 3BGIA 3CHYA 4GDFA 1M5RA 3LCRA 3ILHA 1TCVA 4Z4CA 2AR0A 2GSDA 3S99A 3ZJYA 4MW6A 1OQAA 3RWMB 5TIIA 3WKAA 4ALNA 2KB0A 4D92A 3J7BA 3QVVA 5JAHA 5LM3A 1G20A 4A8JB 1QHNA 4X84A 4LTDA 3OEYA 2FH5B 5G0TA 5TJ9A 4L16A 2O3TA 3L6DA 1F6DA 4R31A 2D3TA 1B0AA 2J09A 4GC5A 3AHEA 1NNI1 3VSEA 3W6OA 3KB8A 4TLAA 5FHRA 3SEZA 3TQOA 1N6OA 4NC6A 1SBYA 2O0KA 1RMQA 2V9ZA 3GLRA 5AJUA 5IUJC 5JFTA 3GFBA 4G0QA 5DW3A 2VXOA 3SFVA 1TQ2A 1IRXA 1YQEA 4N65A 5HM8A 2IX3A 4ZDIA 4OBBA 1WVGA 4HGNA 2PH7A 3L26A 3JCZA 1P5JA 1MFZA 1U0JA 2UYQA 2OBYA 3NUQA 3MT9A 4DKXA 3F8WA 3H18A 3BFJA 2QROA 1CQIA 2GT1A 3M89A 1XN4A 1HI9A 1LPMA 4GUDA 4QYIA 4YP6A 2P6UA 3DKIA 3TR5A 4Z99A 1R9NA 2QTZA 2NTJA 2J9FA 3FTCA 2DR2A 2HL7A 1EP2B 1U2DA 1WUKS 2CJWB 1RQNA 3DP7A 3DXZA 3EBPA 3M6LA 4HEA1 4RCVA 1G60A 4JBLA 3QYJA 2PLAA 1R9MA 3CWZA 3FPBA 3P9PA 5HQJA 4C14A 1V25A 2ZBQA 4JUIA 4WNIA 1Y82A 3TCNA 2B4QA 3PLRA 1UKAA 3L7JA 4LKRA 3FUWA 4U5XA 3E0XA 3M2PA 3PXBA 3PE3A 3PFNA 5ECYA 2R6AA 2OG2A 3O31A 3DHYA 2A8YA 4NRWA 2NU8B 4CEJB 3ZBUA 3OOJA 1AS3A 3SBOA 1T4CA 4PG7A 2DR0A 1G2QA 1KJWA 1NW3A 2BFAA 4MVJF 4PONA 5C8YF 4CETA 5CCBA 1WB5A 1U7HA 4XTCS 3LUDA 2CYAA 4LBZA 1CIJA 1XVTA 2V4MA 3BMQA 4IJQA 4CM1A 4DCTA 1KOLA 2BEWA 3BRSA 3H5VA 2GNPA 3AEKA 2VDQB 3IUYA 4Q9HA 4RD3A 1JALA 5CPBA 4EAAA 2IXFA 3GLVA 1OFGA 1ZSVA 2AQ8A 4IZ6A 5LQRA 2FQYA 1JAIA 4C1NA 1Z7YA 1EDEA 1AE1A 2NXNA 4D1YA 4GW3A 4N9QA 4R1UA 3KZMA 3GCGA 3VYWA 2C9ZA 2WYUA 4PYQA 2X4IA 4MRVA 3T41A 3T94A 1SEPA 2X0NA 3L0YA 3OZGA 3THRA 1W75A 2RI1A 4HYQA 1R4GA 1Z59A 3FD8A 2WZQA 1D6NA 4TTQA 3UWKA 3S2GA 2GFQA 2EGUA 2B69A 2VBFA 4LK3A 5C31A 1GQSA 1IH8A 1MC8A 1DBVO 2WSFF 2A33A 3KXIA 1HDEA 4A8PA 3VYVA 4XTRA 2ZS9A 2XHZA 4NULA 1AA6A 3CT6A 2FPPB 3P0RA 3TLXA 2BMEA 2HCFA 2NSYA 5JISA 3FCXA 5M34A 2I6UA 2HUPA 3RC3A 3H8JA 4E21A 4H08A 5K05A 2ZRAA 3BM5A 1KDYA 3ZLUA 1NMXA 4H7PA 5D5QA 2VJNA 3NYRA 4X7BA 1U1CA 1BC5A 3OAAD 1I94B 1GPDG 2ZM6M 3BERA 4RKRA 2NV0A 4ZREA 3D2CA 1QH1A 3SU8A 5SYMA 5DSZA 4QICA 5GMOA 1GVNA 3MVEA 3X1WA 1IHUA 2I6SA 3TVYA 2ZULA 4IFTA 1LCIA 1IN6A 1A7AA 1Q7BA 2HCTA 3NHMA 5BWCA 2RBKA 3VO1A 3B3FA 3FOCA 3RAGA 1H0SA 3SHGB 3GXOA 1FMTA 3BIXA 1Z45A 3FG9A 4JU8A 4M86A 3USES 1RWOA 4UBLA 2YVAA 1OPRA 3HACA 4V0NA 3HG7A 3HUDA 2CL7X 4C4SA 4OHFA 2VDWA 4ZQBA 2OGZA 1AS0A 3PUWA 3EQZA 4LE2A 1ISIA 3HX3A 1E9RA 2VDJA 4M1KA 3WLHA 1S1CA 1XU4A 3IRVA 3DF9A 4IG4A 4IILA 4F60A 4XEHA 3MIIA 3RS4A 1IUPA 1T35A 4HDQB 1MPTA 4Q4JA 1MHTA 4KR0A 2R751 3G6KA 2PZBA 3PD1A 4UBKA 3IBCA 4G0UA 4KXVA 1SXJA 2RHCA 4C88A 3Q7IA 2IZ0A 1T2DA 2FVXA 4UUPA 1DTWA 1KVRA 1OBFO 1MFPA 1WF6A 2FUG1 2WWRA 4M8IA 4NFYA 3CSUA 2BFBB 2XNDA 3G2HA 1N7JA 1JRLA 5JEEA 1I2MA 3ZHBA 1HZJA 5CLJA 4JI1M 1QYCA 1ODJA 2YASA 2J5RA 3BJEA 3N3AC 3AF4A 4KE9A 3DONA 3MUFA 4Q9AA 5KAPA 4BE4A 4B6EA 4ETMA 4F9EA 1ID1A 3SHQA 1D8AA 1SHJA 2VJYA 1OD6A 4FQ8A 3HL4A 4KAJA 5D3MA 5C5IA 5C52B 3DBVO 1YU9A 4JGBA 1QF6A 2AG0A 5I8ZA 4OK6A 1EJ2A 2PJUA 4R7GA 2WABA 3AT1A 1PYOA 2K7FA 4DBGB 3BDAA 2I2CA 5JD6A 3K0FB 1U8FO 4F2HA 5A04A 4QVIA 3QYFA 5FV4A 4ITRC 2C77A 1PJAA 4RV4A 1RACA 4B3TB 1K5HA 1K92A 1QX3A 2EZ4A 3SX0A 3ZWOA 4BPBA 5H5JA 1C7IA 1UFKA 3EDYA 4F4CA 1M1UA 2DFDA 3QK7A 3NBKA 4TYWA 3HYLA 3TOZA 4G41A 1LPPA 1TQ6A 3VKUA 1NDUA 2JD2A 2PMFA 1YE5A 4IXNA 1A9PA 3HP1A 1BQEA 4CHGA 2NO0A 4IR7A 2ID7A 4ZEVA 4S1NA 1W76A 3QKSA 4EHBA 3BC1A 4BWFB 5TF0A 5GM1A 3F46A 4XCQA 5HF9A 3WGYA 5LKAA 2I55A 4NAHA 3HV0A 3GGPA 4M7RA 3DOHA 2VPQA 1CR2A 4WT7A 5FO1A 1TKAA 1SXGA 4MGIR 1ORWA 1XEFA 3ET5A 3Q9NA 5DGDA 1A72A 4BQFA 1RXIA 4NBTA 4ER6A 1S01A 5K3FA 5L6MB 1BCRA 5FUVA 3B1JA 2GHQA 3SHTA 3OX2A 5DBIA 5TS3A 5ALSA 4MM3B 3K5PA 4X41A 2LKDA 4XKJA 3V48A 5EERA 1AO3A 4JI0B 4XGKA 3H3JA 4OU7A 3G5LA 4H3SA 4XJTA 1C14A 3ZWCA 2R62A 2VAWA 3H9QA 2NO7A 4D45A 1OJLA 1DG3A 1MN6A 1UBSB 1X80A 2NSJA 2WM3A 1MGPA 3KHUA 3QMPA 4JI6B 4E12A 2FWMX 2FRDC 3T5TA 1T9GR 4WZ6A 1GG2A 1EVIA 1LY1A 4ILKA 4RPKA 1IZ0A 1JVNA 1UC5B 3E8XA 1G291 1SC3A 3PC8C 3PT9A 4LNUB 3HCNA 4KGDA 2ZE7A 1X8JA 4CTJA 4FN4A 4OJYA 3G82C 1YIDA 4EKDA 4CLOA 2NUTB 5L45A 1Q74A 4TROA 3GEPA 5G4LA 4HL4A 1T2EA 1E1LA 3MRVA 4ID3A 2YQ5A 4OQZA 4OSOA 4R8KA 1I80A 2KLBA 2HYDA 3BH7A 3ROKA 5FPPA 4BCDA 3HUTA 3N59A 3O1LA 3ANLA 4Y3UA 4P3PA 4BP3A 1M8JA 3M1LA 2HV9A 2NW6A 4YVFA 2FPIA 2KI5A 1OASA 3NH9A 3NHAA 1E2PA 5ALXA 1KYXA 3UAYA 1H6AA 4B1FA 4EA9A 3UWSA 3G0DA 3TQHA 4KDCA 2X5XA 1U7ZA 3JR3A 2H16A 4JVSB 5CLGA 3W8DA 4D5GA 3CRVA 3T5BA 4DUZM 4EF5A 1P8AA 1RI5A 3J81k 1QFXA 2PSHA 3DZKA 2CFCA 1CUXA 3SARA 1DC6A 1QCYA 4D8XA 1QQ7A 1QAQA 1TC2A 3PC8A 5J63A 1QP4A 1YUMA 1VMKA 2O2GA 4MA4A 5I3CA 2IYVA 2ZAIA 2PH3A 3SMSA 1EVEA 2CZGA 2OAP1 1ZZGA 5KTMA 2XCLA 5LQCA 1H0KA 2QPAA 1IHPA 3KOXA 3MG9A 1W47A 4URFA 1WSBA 3OHPA 1RRKA 1XQ6A 3AU9A 3WHPA 1QIEA 2GSWA 1C7ZA 1NBME 3IR6A 3NNDA 3ZTWA 2GEKA 3CNEA 1KJYA 1MB9A 4PCZA 1YC5A 3G17A 1VE1A 5ECGC 4KHPM 3HVUA 2JCBA 3R74A 1BU5A 1RQLA 2QR2A 4GXRA 1E2MA 4LOIA 5FNZA 1QR2A 5CDTA 1FFGA 1RLOA 2O25A 4HNQA 4JL5A 3EXEA 2C2KA 2EZTA 4FS8A 1O1YA 3PRKE 4C0AC 4DANA 1MTOA 2P6RA 4HN2A 1QLWA 5JALA 1NTOA 1T24A 1O94C 2P7HA 1AXEA 3FETA 3BK1A 3IJPA 4WKCA 1L5NA 1K6JA 2JF0A 1E8MA 4Q7QA 1FZTA 1NF8A 1F9EA 2PX4A 5TT0A 3W1VA 4B7FA 5BP7A 1NAIA 1V2HE 3K71B 1EP1B 3HJNA 2XUHA 4RAOA 5HUQA 4Z7NB 3JAWA 4ZAXA 4E13A 3KVWA 3DD1A 4PBSA 4LTNA 4KTTE 1ZHOA 2P9TA 4MI6A 3K9BA 3O2NA 1KDTA 1Z7WA 4KWTA 4Y0NA 3TZ6A 4D57A 1EJ6A 3ASZA 4EI8A 5A4JA 4RTNA 1NVGA 4B6PA 4TKVA 1KIFA 2LW7A 1ZSYA 1BNCA 2PV7A 1YAJA 1YB2A 1GL6A 1JKXA 1E2UA 3RROA 4BLUA 4ZCPA 3V6LA 3AM5A 3KQPA 3O90A 4ZT7A 1VL2A 2CCGA 2NO9A 1BX0A 4TTAA 5TE9A 4RTPA 3I42A 5IT0A 3DGEC 3PHGA 3WY9A 2RARA 3ZQJA 4IBCA 1UMKA 1KI6A 5JDIC 1EX9A 3QE0A 4EVIA 5DVZA 2C7QA 1QYXA 2HSJA 3NONA 5DGHA 1KORA 1RLTA 2D2EA 2BRUA 4PGGA 1ULBA 2FSIA 3FPHA 4YQEA 3RS8A 2D6FA 4FOPA 1ZK0A 1V8BA 3PUVA 2BFWA 2WILA 4E33A 4NMHA 2BBOA 4L0QA 3QHQA 1GNSA 2V6MA 1F0PA 3AF5A 3AV0B 5KPTA 3BA1A 2VSQA 3IOBA 5ITXE 1G19A 1GPNA 3INTA 2VDKB 4UD2A 1CJSA 2NMVA 4GI1A 1B4DA 2H2HA 2O5VA 2QX7A 1NLUA 4B8WA 4BEVA 1EPUA 5FAKA 1GXSA 4HBGA 4HBZA 3RSZA 4D9NA 6AT1A 5DM2A 4LF4B 5D51S 5CA0F 2P2SA 4BWGA 4MV0A 3UMSA 3VJMA 4ZKDA 4B9AA 1BWRA 2BDTA 2HYIC 1A8SA 1OKSA 3R6TA 4XD7A 3ZNNA 2RGDA 1EM8A 1AA9A 5F52A 4AD8A 1XZPA 2CW5A 2JLZA 1CVRA 3HA5A 2OZEA 5C1BA 1D7OA 1EWQA 1VBKA 3DEIA 4C6TB 3LX5A 4OGFA 5BWBA 4IS3A 3N74A 3C6XA 2WAOA 2W6PA 2C2BA 2VT6A 1V3UA 2FPGB 3JZAA 3FPAA 1WQ4A 1L8QA 2CHUA 3DDSA 3KSDO 2BZGA 3OU2A 3RHZA 3G5AA 4LF8B 5IKPA 5BNTA 1F3LA 2C9CA 1ONBA 1WHTA 5FTJA 3LT5A 5CX4A 5AI9A 2RJNA 3V4FA 4XFJA 1QHYA 4QJ5A 1NYTA 4B82A 2LCIA 4V0SA 1YS1X 1I01A 2Z09A 3OY2A 4QPCA 4Y0VA 2NU9B 2FFAA 3ZLVA 2QWXA 5KOIA 5LUAA 1OTYA 2UXCB 3G8CA 4ZYYA 1APBA 2OZPA 2WQ6A 4MDFA 1MH1A 5JD3A 1QE0A 4YJGA 3G0HA 1VP3A 2A9QA 2HMSA 1XZFA 1F3OA 1FYWA 2R1ZA 1UKCA 2IXGA 1T4CB 1R0YA 2EW8A 4KSYA 3EAGA 4ARUA 1X87A 3OIFA 2ADMA 4I3HA 2XGNA 3L1UA 3HDJA 3ASVA 5GONB 1VL0A 2J3QA 5HOQA 4KV9A 2EKFA 1P2GA 2BMJA 1JLSA 4DC0A 1X7GA 5EXEA 1USGA 3ZC7B 4WWHA 3HZZA 1FFYA 5A2QS 2CFOA 5C35A 1VYUA 3AIKA 3CF4G 4XRGA 4DR5B 1IZ7A 2QHOB 1N2CB 1UCFA 1JE0A 1V43A 4ZVNA 3QA3E 5KNDA 2IZZA 4PYRA 4OGKA 3EFHA 3CLUD 5AKZA 4E5UA 1N0UA 2XZTA 1MJGM 4WA8A 1FTYA 3W8NA 2FR1A 3ZGLA 5JCJA 2X41A 1XCJA 2DLCX 4BMPB 1GN9A 1M7GA 1QFJA 3O1JC 2AXQA 1W52X 2A1UB 5B58T 3O4JA 2L7HA 2Z98A 2BTOA 1RW4A 3AEYA 5EHXA 2FQXA 4R41A 2FEXA 1V5IA 4PO1A 4IWXA 1CNFA 4BMSA 4ZYXA 2IOFA 5B6JA 1E5DA 3DDCA 3PTZA 1OXSC 3R5FA 4RPGA 3MCTA 4DM4A 3SM3A 1VLZA 2XB8A 2FG7C 2CDRA 2QJTA 2UVQA 1CU1A 3T3DA 3OY7A 3V3KA 2ZI4A 3NH6A 1MO3A 3PFCA 3WSTA 2I34A 5AI8A 2YY6A 5EGSA 2DM6A 2HMVA 3L2AA 1PI3A 1VIVA 3G8DA 3OJCA 2G0NA 4GI5A 1RKQA 3GJ5A 4L4SA 3TQIA 1DEKA 1B16A 1ADBA 1RM5A 3ELYA 4IBBA 4LAFA 5KO3A 4Y2GA 1QTQA 1UPXA 3D5EA 3EQ6A 3KUUA 4I6JA 3TKAA 3GRFA 3AF2A 5DK4A 1OYOA 4TL6A 3WGGA 4ZAWA 5CDYA 3M7GA 2JXNA 1YJBA 4YHHM 3V9AA 1VJCA 1VRVA 5CPFA 2IU0A 2OP1A 3UJ9A 4DEVA 2J59A 1C9YA 3S70A 3QOFA 1F60A 1XU7A 1CR6A 4QX6A 2QIPA 1VJGA 1NRJB 2ZAGA 2P4SA 2EGHA 2VNSA 5DCLA 2JH8A 5E1BA 2VNJA 4GZMA 2W48A 3TWOA 3ZKWB 3QPWA 3IB3A 5EQTA 5I7OA 3CE6A 2CV1A 1CHDA 1WCXA 2PSJA 5AOCA 5GJWC 4QUBA 4DSZA 1NW7A 2YFKA 4D82A 3EGCA 1JDNA 3FVVA 4B32A 3E9YA 1RP7A 4AKEA 4C2BA 2VYCA 3V8PA 5FOUA 3C16C 4ZK2A 1Y6FA 4OMUA 5M7EA 1PK8A 3T1HM 4PLCA 3OF2A 3IQXA 2JKZA 4H0NA 5JY1A 5KHOC 3K09C 3ZHYA 2C88A 2OHXA 4TSFD 1LDBA 3D8NA 3LI2A 3NHZA 4L27A 4Q02A 2X5OA 3T61A 3ZGZA 3TSOA 5KSYA 4DVGA 4CIWA 1UQRA 2J3DA 3L29A 5DNWA 3FZYA 4TVSA 3O8RA 4X85A 2GDJA 3WGMA 1M1YA 4AQDA 5BN3B 1AUPA 3I9LA 1F4PA 1YMQA 2PGNA 4OXXA 3SLKA 1M3SA 4NDAA 3VZQA 4D9HA 1XCOA 2ASVA 2GK7A 3IMCA 4HSEA 4PFJA 3WTCA 4D96A 5EHZA 4Q4LA 1WGLA 3LK6A 1XQ1A 4RXUA 4V38A 5CIQA 2QX8A 5A4IS 4IXDA 4Z6YA 2VNIA 2XUQA 1JW9B 2QUZA 2VUHB 4EELA 1XZJA 2QYOA 3O21A 5K03A 5IAJA 5ALUA 3I4CA 4E1BA 4DA4A 1WX1A 3WWZA 3N0VA 1G4HA 3KE8A 1R00A 2YZ2A 3MTBA 4LJKA 4C5AA 2Q3HA 4FD2A 4LRWA 4OKIA 1K68A 2ZSJA 1CE8A 2WUGA 1M66A 1BXRA 5E7MA 5EWMB 3BCSA 3CPSA 1SQ6A 4QOEA 2Y0QA 2XUKA 1IMOA 3EPHA 1SBIA 3DVSX 3F8SA 3IIIA 3T3OA 4EIWA 2DZLA 4E1VA 3INYA 2PWYA 1ZXBA 4K1LA 5K0EA 3WLLA 3V1NA 5KINB 1XZ8A 3BWXA 1WZUA 2OAQ1 5DJ5A 5IT5A 5HRUA 4TUWA 2TMDA 2D5AA 4V2UA 2I4TA 3NBYC 1WXIA 1U2PA 1Z6AA 2N42A 4RLSA 2A35A 2FW1A 3NYIA 4M88A 4ZFNA 3OQPA 1XDWA 2V1UA 3A8TA 1O5IA 2J3KA 5HCIA 1DFHA 4MVJE 1VEKA 1VCNA 1A2QA 3BXOA 1QC5A 3G5MA 5CD9A 2FX3A 5KSPA 2ZSIA 1Z4PX 4CRWB 4IGIA 2Z5VA 2Q3CA 5T8KA 1TM5E 4MS3A 1KTVA 4XGQA 5AW1A 1G2OA 4EPXA 4R83A 4N6GA 4MLZA 4YGYA 4KDRA 3KJNA 3AI2A 5HZHA 1BCSB 3BKXA 4HLCA 5CR9A 2GHTA 3HP4A 2IOYA 1NI3A 1ESMA 2VC2B 2DKLA 3AL0C 1S96A 1HQCA 4I0WB 3I2FA 5F3WB 4GBGA 5ADVA 2AMVA 3AF3A 2B1GA 2GK3A 2X0DA 3KSXA 2UUOA 1LC0A 2C0QA 3ASYA 2OHVA 3GA0A 4QOJA 3M4XA 3T7EA 4DLSA 1N1EA 2W6JA 5IM4A 1GTRA 1Y63A 4QOZC 3AO0B 5LVAA 1QYWA 2HXSA 4Q1FA 1EBUA 4X54A 5E7IA 2FSVA 3F5DA 4ZKEA 5BQFA 1WCWA 3EFOA 1DO2A 3SHVA 5G0WA 2R45A 2GZRA 3B7WA 2MR5A 4HNRA 2ISCA 2V6BA 4GPZA 2E82A 3CSDA 4LDQA 3KS4A 4MR9A 4YT4A 3JX9A 4QU8A 3QFCA 1PX2A 4C30A 1RWQA 4GMGA 3GU3A 2XMPA 4I66A 3VHRA 4Q9NA 1OREA 1XWWA 1YB4A 4LI3X 3WLJA 1MVLA 1NLZA 1U8YA 2XMGA 3TMAA 2V65A 5MF6A 4NJMA 5CEEA 4R0NA 3QVWA 2UZ1A 1QQ6A 3HRHA 1S5PA 2GPAA 4C4ZA 3LQFA 3G0BA 1QTIA 1R9JA 4ZGWA 2ZRPA 4BNUA 1IWBB 1H85A 4RIHA 5FBZA 2WOJA 4OJNA 4CLXA 3K1AB 2FFHA 4DYDA 4PG4A 2IXAA 3HJGA 3JQAB 4W9MC 2P5TA 3K0EA 1NURA 1Z38A 3FFWA 2HJ9A 2AFVA 1W0JD 3JD0A 3SZUA 2PH1A 4AZVA 3WWYA 3CINA 4KVFA 4XQ0A 3TB6A 4G9GA 3RBXA 3QH4A 4AY2A 3IDQA 2PU7A 1NVFA 3L6UA 4JSRA 5KVAA 2JLBA 1HGXA 1TLTA 5HS4A 4BLPA 2FMXA 2WW8A 3KQSA 5EJ4A 3RV4A 5SICE 4RSGA 4C0HA 3I8OA 3P5SA 3DWIA 5KOHB 1EFUA 1MBZA 4I2NA 3N2IA 4IH4A 4MINA 4BB6A 2FQWA 4JENA 2Z58A 1QO7A 1U7PA 3OPMA 3SK0A 3U3OA 2XTZA 3BF7A 3UEOA 5BO5A 4G5HA 2C9DA 3KPUA 1MOSA 4E5VA 1RXCA 2IYSA 2RGHA 2O3RA 2ZREA 4G0NA 3R3ZA 1T5IA 3ZCVA 1KOJA 4GVPA 3X2SA 4DIKA 2IOQA 3AY0A 2CLHB 1J8FA 4UTRA 3GT7A 2HHHM 3TIGA 1L5WA 1ZZEA 3I92A 3L0OA 5KNCA 4A36A 3X44A 4LBWA 5G53C 3S1LA 2QL6A 3SIRA 4JHLA 3IG5A 2FE4A 1B8NA 4DR5M 1JEOA 1U6JA 1GUFA 2ONZA 1LTQA 3ECAA 5FUXA 5H4HA 3WK4A 3EY4A 4BS9A 4MDEA 3PWKA 3SAJA 1EVYA 1IMJA 1BX1A 2P5SA 2FG6C 1F2DA 4OYRA 4G5OA 5DNAA 3HP7A 2QAGA 2RAVA 2GD0A 2UUPA 4OATA 4OUKX 4BZXA 2NACA 5F3RA 4N48A 1PT8A 3AUFA 1BQ4A 2PJZA 3E3MA 5LFAA 2W8BA 1U8XX 2O20A 3W68A 3K32A 3U39A 2JK0A 1VCIA 5KYYB 3JVVA 3M70A 2C00A 5IKXA 1HR0B 2X5NA 1WCIB 3JZDA 3ZY5A 3C15C 1UZAA 3ND6A 1L3CA 3BX1A 1TAGA 2QR3A 2VOJA 1R2QA 3EGOA 5LPNA 2G28A 2QL5A 3KETA 2DUJA 4GNKA 2XCSB 2WIGA 4WASA 2WFMA 1W5TA 2RDMA 5MGNA 4KI7A 3QEAZ 1OJ7A 4NAVA 4WSOA 1VA4A 3CZ5A 3IHPA 5T3UA 1PJTA 4DV6M 2G5CA 2V5VA 1N2IA 2H1IA 2IYPA 3LY7A 1GQOA 1QU2A 2Q41A 1NRIA 1YRHA 2FOXA 1LI4A 3C7KA 2C7GA 4NMMA 1XK6A 3ITKA 4JV5M 4EX6A 3FNGA 1RDFA 1PO7A 1EAMA 1EINA 3W04A 4L08A 1C2YA 1DU4A 1S89A 1AUVA 1NR1A 4JEIA 1WGNA 1QAMA 3LY9A 2UUBM 1GTZA 3WYCA 4URYR 4NATA 2CDNA 2YRFA 3BK2A 5F5LA 1IE3A 4KXUA