3TE6A

Crystal structure of the s. cerevisiae sir3 aaa+ domain
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
316
structure length
304
Chain Sequence
b'PNADINLEESIRESLQKRELLKSQVEDFTRIFLPIYDSLMSSQNKLFYITNADDSTKFQLVNDVMDELITSSARKELPIFDYIHIDALELMDALYEKIWFAISKENGDISLEALNFYITNVPKAKKRKTLILIQNPENLLSEKILQYFEKWISSKNSKLSIICVGGHNVTIREQINIMPSLKAHFTEIKLNKVDKNELQQMIITRLKSLLKPFHVKVNDKKEMTIYNNIPDNVIVINHKINNKITQLIAKNVANVSGSTEKAFKICEAAVEISKKDFVRKGGLQKGKLVVSQEMVPRYFSEAIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Regulatory protein SIR3
publication title Structural basis for the role of the Sir3 AAA+ domain in silencing: interaction with Sir4 and unmethylated histone H3K79.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Gene regulation
total genus 88
structure length 304
sequence length 316
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17872 AAA_lid_10 AAA lid domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1280 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3te6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3te6A01
3BS4A 2QROA 2VSOA 1XCPA 2Z4SA 2A7QA 2ZI6A 4JLAA 2HYDA 4BASA 5TMPA 2DFTA 4FI3C 3W8NA 3MJRA 3GJ0A 4A82A 1KJYA 4FMDB 3B2EA 4ZKDA 4F93B 2QY9A 1XMJA 1XTSA 3X1XA 1QHYA 3U7FB 3E1SA 4UXHA 4TYWA 1JBKA 1ZD1A 3QE0A 2ORIA 4RD3A 5AUOB 3QVUA 1F3OA 3LBHA 4POAA 4HB2A 3I72A 3FMPB 4Q1CA 5J4LA 1CEEA 4Q4JA 2VL7A 4TZ0A 3DZDA 4ZDWA 1HEIA 4B44A 1U9IC 1ZM9A 2XZOA 1OYYA 1V43A 4Q03A 4TMKA 4YC7A 4DLXA 3AEZA 4ARZA 4P32A 4DSTA 3EZ7A 1HQYE 2ZRAA 3ICQB 1DAMA 2HV8A 1PLKA 3LBNA 2ZJYA 2GK7A 4DSOA 3HDTA 4AIIA 3PXGA 1NRJB 2YYZA 2W2XA 1E1QA 621PA 3QKUA 2QBYA 1G7TA 3SFVA 3RHFA 5EE9A 1JPJA 1TX4B 2A3RA 2GTPA 3A1VA 3GLIB 1NJGA 2X19A 3KKNA 3NDBB 1BOFA 1Z0DA 3WNDA 4C0QC 4DCTA 3QOFA 3AUYA 4MRSA 4WOPA 3WHLA 2HDNB 1GWNA 2OCYC 5K8IA 1XD9A 2EFCB 2WPDA 1RIFA 4QHTA 2ORVA 4N3NA 4A0RA 4AYXA 4NDZA 1NI3A 5GADl 5C4MA 2X2FA 2ZJ2A 3GEEA 4TL7A 4BGDA 1UADA 2WZQA 3BH7A 4V02A 1E4YA 1U8AA 1CRQA 4D4JA 6Q21A 3BC1A 2WAYA 4WA7A 1XPRA 2VHTA 5G40A 2B92A 4PSAA 3RAPR 2QA5A 4TLEA 1NN1A 3GEHA 3FVQA 1QF9A 2XTZA 2QN6A 2MSDB 3P32A 3AF0A 4BZXA 2BMJA 2G0TA 4Q4HB 2ZROA 3E70C 2C77A 4G3XA 1W4AA 3Q7QA 1DELA 1E99A 1Q1EA 1TUIA 2Z83A 4R98A 3EASA 2HUPA 4RFSA 3GLFA 1XEXB 2YKGA 5DLQC 3EXAA 3ND9A 3SEAA 4DBLC 3KFXA 2O8CA 3CBQA 4KFRA 3K0FA 2OFOA 3PVSA 5DI3A 4NYMR 4KXFB 3TR5A 4QG7A 1M1YE 2PZEA 3HU2A 3EIHA 2P6UA 4RD6A 4YMWA 3C5CA 2D2FA 1GRRA 2QSYA 1JJ7A 2ZAMA 3KQKA 2VHUA 1Z06A 4TWZA 4WIAA 5LB2A 3A4NA 2AXNA 2WIAA 2VF8A 3W3AA 1FNNA 1MT0A 1FX0A 3B1XA 1CF4A 4UJ3A 2YWFA 2IYVA 3OZXA 4UQOA 1E2EA 5BN4A 4UNPA 2A5GA 2RGCA 4KLNA 3BXZA 3WHKA 4URVR 5H1YA 1IBRA 3CWZA 2JJ1A 2FDCA 2IF0A 1XCGB 4B74A 1RRGA 1Z6TA 3W6OA 4CW7A 4EFLA 5F3WB 2BMFA 1XB2A 3DDCA 1GOTA 3B8HA 3H4MA 3PUVA 3CZPA 1ZD9A 2H18A 3I3SR 4LJYA 4LHXA 1EESA 1Z8FA 4NP6A 4B73A 3O8RA 3KB2A 2DFKB 3GJ6A 3FYHA 3AKCA 2WPDD 4KCGA 3P20A 1YVDA 4G5GA 2ODWA 4IDQA 2BWJA 4PTLA 4WBSA 1GTVA 1FPMA 4TMZA 4BFXA 3RRMA 4BRWA 3CH4B 1M7HA 4JVSB 4DIDA 3R8CA 2GJ9A 3OIWA 5EP4A 4Q9KA 4XWOA 3B5JA 3W6PA 4QBHA 2XITA 3UMFA 4EJSC 2OSBA 3AF1A 4B3BA 4YMUA 2AN9A 1CTQA 1KI7A 2D74A 3KUCA 3LQQA 3AVXA 2ZRNA 1IJEA 3QI2A 3THXA 4KFSA 2J41A 4H9GA 1G3IA 4QOSA 3DEFA 3KQNA 4QNRA 1GDDA 3PJRA 3TK1A 1Z6YA 3KUDA 4C0LA 4LWZA 3ZS9A 3AQ4A 5J4YA 5LDDC 1VHTA 4LBYA 3MWLA 1Z0IA 5FTNA 3N2EA 1F2TB 4XSGA 1IY0A 1VCNA 2FSHA 4M53A 1KSGA 5L3QB 3U3OA 5BYJA 1VHLA 2A5FA 2RGAA 4IOJA 1ZNXA 4NCHA 3B82A 3OIUA 4QRHA 5FPTA 3Q5DA 3WNCA 4C0AC 5M04A 1YKSA 2C98A 1KI8A 4P4SB 2ZUCA 2BM0A 1K8RA 5A5GA 3KXLA 5FOWA 3EC1A 3LW7A 4B32A 4BFSA 2NO9A 3SQXA 1E79D 1JXMA 2DY1A 2BMEA 4PO9A 2H92A 2N42A 2G9NA 2WVJA 2WOJA 2EVWX 2YJTD 4WW0A 3QUSA 5AR1A 3FHTA 1E0JA 1S2MA 2ZVPX 1XTIA 5AJZA 2V3CC 2ZJAA 3N5CA 4B43A 5FL3A 1NN0A 4OQXA 3TR0A 2A9KA 2BJVA 4G0NA 2OBNA 4HDQB 4AY2A 3LH5A 1AGRA 1S9DA 4BZPA 1SHKA 4R2IA 3GEIA 4WVFA 4Q1EA 5GJWC 2ZITA 1E2KA 4OHWA 2ZJ5A 2XTNA 1IY1A 1F2UA 1RZ3A 4DEYA 3L8YA 4TL8A 3ZS8A 2GDJA 1EXMA 4FW9A 1L2TA 4QC2A 3IBYA 5DH9A 2RH5A 2ZI5A 4WXRA 3T1OA 3ND8A 3THWA 1W36B 3ASYA 3WYFA 1OFHA 3IBGA 3KTAA 3TW4A 5FFMA 3GFTA 1P61B 3ADDA 2ZJZA 2ZI7A 5CIWA 1WB9A 1DTSA 4LC0A 3VNUA 1A2BA 4OJQA 5GVRA 2O8EA 5JHGB 4LCBA 2ZYUX 1RYFA 3KKOA 1CBUA 2J1LA 3A1TA 3GLHB 4KAXA 1XXHA 2V54A 1DVRA 1U9IA 1NVWQ 4NBSA 3K70B 3L0IB 4JSYA 5SZKB 2IYZA 1ZM2A 4E03A 1IAQA 1LY1A 4A0HA 2DR3A 3PENA 3CZQA 4QM7A 4XVRA 2PEZA 4C9BA 2PLFA 2CK3A 4X8OA 3LW8A 4A36A 1NIPA 1G7RA 1KTVA 1L8QA 2LKCA 3B9QA 3LVRE 4MKFA 4Q9JA 1KIMA 2J0UB 2OFXA 4XOIA 4ACBA 5GJBA 3NH6A 4PAMA 2ODNA 1UBGA 5KU1A 2JIZA 2YHSA 4L8GA 4Q7JB 5ELXA 3I8XA 4C2TA 3QXCA 3R9XA 2O8BB 1Z22A 3ZGXA 5KSZA 2I1VB 1P75A 3VTKA 3AKYA 4DT1B 1S1CA 2YWHA 1BIFA 1IN8A 2CL0X 2GEVA 1Z07A 1EWQA 3Q9LA 2D06A 3AP2A 3WRXC 1MH1A 1GILA 2JLRA 2ZYVX 4I81A 3CRW1 5A4JA 2Q0HA 1W4BA 1Z2CA 1CRPA 1SKYE 3TQCA 1Z28A 3K0CA 4PC3A 3QF4B 4URWR 1N6KA 4OBEA 5EUMA 4E09A 2G1JA 5KSOA 4GNKA 1FNMA 2DHRA 2HLDD 1XD2A 2BIFA 2H1LA 1JR3D 4CEIA 2OILA 3HYRA 1SZPA 5EE1A 1G5RA 1ZU5A 1KO5A 4DDWA 2KB0A 3ZIAD 1KO4A 1MRNA 4V0NA 1RW4A 4PX9A 1E2IA 1IOZA 4Q1FA 1NLFA 5GVSA 1FP6A 4EPVA 4Q9HA 2CDNA 2O5VA 2ECKA 4MKHA 4PR0A 4ASUA 4MGKR 1KK1A 2G6BA 4OJKA 3GLGA 3B7GA 1VCIA 2ZJOA 1GUAA 3LX8A 4O2LA 5BQ5A 3OEEA 4ZKEA 2JAQA 3EZFA 5E7IA 5B57C 1U2RA 5E7MA 4MA4A 4I1UA 1KMHB 3BBPA 5EXTA 4JVLA 2ORWA 1GG2A 1E98A 1D9XA 1UKZA 3K53A 1ESMA 1GM5A 4HI0E 5KDLA 1OFTA 4IVRA 1JB1A 2IK8A 5FPKA 4DDVA 1OH7A 4JVMA 1GNPA 3EG5A 3IQWA 1ZRHA 3K0AB 2R2AA 1DPFA 3CRVA 1LNZA 3TUJC 1G8HA 3BK7A 5FTKA 1OXSC 2CK3D 3LXRA 2IS6A 3EWSA 3HP1A 5KHOC 1T4GA 1Q22A 2YC2C 2FU5C 2ZRDA 5CLQA 2QL6A 1JNYA 2X8AA 3DPUA 4GFDA 2H8KA 2JIZD 4BFYA 2P6NA 3QEOA 5JJKA 2V6JA 4D0NA 1GRQA 1AQUA 1T0JB 2OAP1 3IHLA 5CJ2A 3IKJA 2QM8A 1SXJE 4AURA 1FP7A 4M9XA 2PLRA 3FKQA 5J4KA 1NSFA 1W0JD 3LFUA 4JLOA 1U0LA 3RS5A 5KTYA 3OEHA 3RSLA 3CPHA 2CCKA 2ZM5A 1GZSA 4QJ3A 4LBZA 2QPTA 2VHQA 2REXB 1YZQA 2QBYB 4E07A 5KPJA 1WE2A 4LJ9A 2IC5A 2RHDA 1L7VC 1XRJA 2ZU0C 1BYIA 2MSEB 4TLCA 4BFTA 3GQBA 4EJSA 3CONA 2JLVA 2HJVA 4HB4A 1J90A 4N0EA 1TMKA 1UM8A 1YR9A 3REFA 1KNQA 1VIAA 2R6GA 4L9SA 5L8VA 4A2QA 4IVQA 3T5GA 3FKSD 3QY0A 1FUKA 2W00A 1CJKC 2JASA 5FTJA 2F6RA 1P2SA 2EU8A 3R7WB 4JYCA 4QGFA 3V4RA 4R7ZA 4OI2A 3AVYA 2FFAA 4ASUD 2GCNA 1RRCA 2FWRA 1T9HA 4W5HA 1UEIA 2JLXA 4KVGA 5HZHA 1CLUA 3Q7PA 4US1R 2CVHA 2VF7A 2OV2A 4D4LA 3CWQA 4GI7A 2GCPA 3GJ8A 3ASZA 3NEYA 1GKYA 1ZBDA 1QHGA 3X1DA 4DCVA 5F2EA 3M0EA 2WAXA 4HSEA 4DHEA 4D0LB 5EP1A 2LWIA 3W5JA 4JYBA 4BWYA 3PEVA 2BKEA 2H5EA 4GZLA 4JLDA 3LWNA 2O8FA 1CR1A 5LD2B 1N6IA 3A1WA 3SBEA 1RKBA 2JLWA 2WMNB 1Q3HA 4EPYA 1SVMA 1E1RD 1XMIA 2IYTA 1ZINA 3KKPA 2IUUA 2Q3MA 3GJXC 4TL9A 3T12A 4B3DA 2C9OA 3K0FB 4NCNA 4ZIRA 4JL8A 2CJWA 3WP1B 3QKSB 1DO0A 4EAQA 5B58C 5EXSA 4UNQA 5EP3A 5IT5A 4LBVA 1X1RA 3NBFA 3PCRB 3IO3A 4CEHA 1G8GA 1DADA 3RSOA 1RRPA 2YWEA 3RNLA 4A8JB 1M2OB 1W46A 1XZPA 1LTQA 2GHIA 4DVGA 2B6HA 2WWYA 1JALA 2FSIA 4M22A 1MOZA 1MABB 2ZRFA 3CNOA 3GLIE 2VHJA 3AM1A 3PEYA 1X8KA 2NPIA 4TQUS 1TPZA 1Z83A 3WXMA 4MYUA 2YOFA 4S35A 1D5CA 5JEDA 1YHNA 3OEHD 2JJ2D 1GKIA 1TL7C 2VQSA 1X86B 2QI9C 2PMKA 5FPYA 2QTHA 1N2CE 1Q44A 5KO2A 4FD2A 4HZUB 1IY2A 4KODA 1KDRA 1KJWA 1NSTA 2PBRA 4TLAA 1FMJA 5AUQA 2R6AA 3AF3A 5J4HA 1JI0A 3A6PC 3IUYA 2ZSAA 1NBMD 1G3UA 1VECA 1S3SA 3OFNA 3T1QA 4B76A 2WWXA 4HATA 3R8FA 2GILA 5EP2A 4MDFA 4ON9A 1ZUHA 2O0JA 1CXZA 2ONKA 2RAPA 4JLBA 4JZKA 2ZRGA 2QSZA 1NVVR 1RVDA 2GA8A 1U8YA 3QPWA 5CM8B 5L3RA 4D80A 4JLNA 2H57A 4QKQA 3REGA 4KBGA 2HT1A 2I4IA 3V9PA 4FINA 3UKDA 2GJAA 2CMKA 1TQ4A 1P62B 4Q4AA 5E3HA 1NVUQ 3FTQA 5FI1B 3UANA 5AJWA 1NKTA 2UZ3A 1OFIA 3T5DA 1P2TA 2HXYA 1QHHA 2J5XA 4JBYA 1VG1A 4IXMA 3ZVNA 2XB2A 4LJ8A 3QXSA 2ZQ5A 5JLJA 3FB4A 1F48A 2VP9A 4A2PA 2GKSA 4DEXA 3BRWD 2IS1A 3KQUA 2OM2A 2WBLC 3C7KA 3QSYA 2ZE5A 1FFHA 4PO1A 4TMTA 3SJZA 2AFIE 2CL7X 3VU9B 1EFUA 2GXAA 4NE2A 4LC1A 3U3MA 5BYKA 3X1ZA 3X1WA 3U6BA 1MO5A 3I1FA 3JVUA 3TIFA 1KK3A 2WOOA 2YC4C 2CHGA 2WJGA 3PR1A 4DIEA 1MV5A 4HAWA 1ZNYA 4M9ZA 5AJYA 3KXIA 1VMAA 4D4KA 4B48A 3U4QB 1ZC4A 1UJ2A 1E0KA 1KMQA 3LAWA 3U7EB 4AG6A 5JI2E 2G0NA 1OXUA 4D6PA 3AVVA 4LYFA 1J70A 3KXKA 3RDPA 4PC7A 2NO6A 2YZ2A 2YVUA 3E2IA 4WZBE 1A4RA 1OF1A 1TADA 5BW8A 4F4JA 4OK3A 4PPFA 5FOUA 2O8DB 4EKDA 2IXEA 4YONB 1DE0A 4MRPA 3B9PA 1SGWA 3I62A 2XB4A 4D25A 2IYXA 4CVNA 4G1UC 1E9CA 4JL6A 3WNBA 2LCFA 1CJTC 2RCNA 4PAQA 4LOAA 1JXOA 4DDTA 3L2OB 3QJYA 1KI6A 4C0KA 1I2DA 2QU8A 4TLDA 1XJQA 1FOEB 2N46A 3THWB 2OFWA 3OFND 2AWNA 4PAOA 3SJBA 1Z6XA 4LHVA 1DO2A 1WQ1R 2QNRA 4DZZA 1AKEA 2Y8EA 3K09C 5CK5A 4OHVA 2PJRA 2CLSA 4RSGA 5DNYB 1YR7A 3CF2A 1YRBA 3SYNA 1LFDB 4CYMA 1YE8A 2D7CA 3A1SA 4W7SA 3ADKA 3NC0C 1SULA 2K5UA 2QAGA 3THYB 1OB2A 2DWQA 3NBZC 2F9LA 2QRZA 3H2YA 1UF9A 4HYYA 5EE3A 4ZCLA 3RS7A 3DZ8A 4ESVA 4HUQB 2IS2A 1RJ9A 4ZPXA 1Q12A 5TARA 3ZZ0A 3FFBA 5KDDA 2NIPA 2J9RA 4KSCA 3QKRA 3UG6A 4QBIA 2ZI9A 1XPUA 1KAGA 3K70D 2CLDX 1G18A 3HU3A 2H7VA 1E2HA 3CNNA 1BKDR 1H8ED 3G5UA 3K9GA 4NMMA 2G3YA 1E32A 4Q4LA 1ZM3A 5DI9A 2PH1A 2XJ4A 821PA 2IYQA 1II8A 5CDFA 3TBKA 1XJCA 2FMXA 1Q20A 5FR2A 1WDTA 4O2RA 1G8FA 1N6LA 4DCSA 3TSZA 1YZNA 2DB3A 5DN6D 4ZI2A 3ICEA 4QJ4A 5HR5A 5TDHA 2VTKA 1CR2A 1T3LA 2QPOA 4S2EA 1G6OA 2KBEA 2R6FA 1G20E 4HDCA 5CITA 5FBRB 3UATA 3TE6A 4L5BA 2XXAA 1W7AA 4EPWA 1UKYA 2A5DA 2NQ2C 4M4SA 2KE5A 2BEJA 4P4UA 3CRRA 4DCUA 2CE2X 2FFQA 2RGBA 3U44A 3C8UA 5GJCA 3T61A 4EPXA 1U94A 2YOHA 4G01B 1T91A 4G5SA 4DRZA 4PC1A 3K0CC 3U3JA 1JEDA 1UDWA 1ZNZA 3KX2A 3CIOA 1IN4A 1IHUA 4V0LA 2ZSDA 2GCOA 4K81B 1ESNA 1Z29A 3GLHE 3HR7A 1R8SA 2DBYA 5D3MB 5E95A 1NG9A 5G53C 1P60A 1QHXA 5HE9A 1E6CA 1MO4A 3QBTA 4B3CA 1UBFA 1CP2A 3B6EA 3MRSA 2QMHA 2G77B 2WSMA 1N0UA 3RS0A 2FJUA 3M6AA 4DDUA 2P6RA 1YZGA 3E5HA 3SE0A 2F1JA 3WBKA 4JJKA 2OLJA 2D2EA 3RRNA 2Q21A 4GP7A 1XTKA 2IYSA 2ZTSA 3GJ7A 4TMWA 3IO5A 1G3MA 5CK4A 1E0AA 3SYLA 1U81A 1OH5A 2WWFA 3VFDA 2AD1A 2VP0A 4OQFA 1U0JA 1E79A 3A4LA 8OHMA 2ZRPA 3CX7A 2EFHB 5SZHB 1EGAA 5HCNA 3ZD7A 2GESA 2GAOA 4M1SA 2B8WA 4KI0A 1JPNA 1W5TA 4URUR 1A1VA 4I1VA 2W83A 4Z51A 3QIAA 4RKFA 2PZFA 4UXIA 5JWRA 3FHOA 3NKVA 1CS4C 1AIPA 5DYIA 1IJFA 5JI3E 3MMPA 3P1JA 3KKMA 3SNHA 1OSNA 3THOA 2FNAA 3ZVRA 4BFZA 2XZLA 2NO7A 3VX4A 4NCIA 3CUEF 4FMCF 2BV3A 2W2VA 4AWXA 4JSTA 5K8LA 4QBGB 4TMVA 4M1YA 2MMCA 1EFHA 1I4DD 1U99A 4CEJA 5DE3A 3OESA 1E2QA 1NIJA 3UWOA 1E9BA 1IONA 2XSZA 2CHVA 1G5PA 2R6DA 4HAVA 1CJVC 4LJ5A 5DIFA 1US8B 4F92B 4AYWA 3U7GA 5SZIA 4UKDA 4MH0R 4UJ5A 3X2SA 1LVGA 4QBFA 3MD0A 4PXAA 4A92A 2AD5A 2GXUA 4GP6A 1N6HA 3I4LA 3LV8A 1OB5A 2VBCA 2F1RA 2NPFA 3HU1A 5JWOA 1F6BA 3S1AB 3MLEA 3SYKA 2Z0MA 2FSFA 4V0OA 4PHHA 3SR0A 1ZM7A 4OHYA 1G21E 2GVZC 3RC3A 1AS0A 5ANRB 5F9HA 3C5HA 1XU4A 1OXVA 121PA 2F9MA 1WXQA 5TB5A 3QF7A 3O8CA 2ZANA 4W5WA 2YV5A 3SC3A 4OK6A 2BCGY 1YR8A 5BN5A 1TQDA 5FUWA 4GBMA 5KDOA 4C7OB 5E4FA 5HTKA 4B6FA 1E3MA 2ERXA 3AVQA 2YWGA 3P4XA 4M8NE 4OK5A 2V6IA 3MUFA 4FIDA 1HE1C 5JWHA 4B2IA 3HJNA 1ZW6A 5EE0A 2RGNA 4Q1DA 4X8LA 3GP8A 4MQBA 3C16C 2OT3B 5KNCA 4IXNA 2OE2A 3PEUA 2Q9AA 1NL3A 4MRNA 3W90A 1AGPA 1H8HD 4MKGA 2HLDA 1GSIA 4U00A 2CJWB 5JBQA 1JR3A 4RZ2A 1U8ZA 3PQCA 4EPTA 4FCWA 3BAFA 5TXGA 1R0WA 3O8BA 4LJ6A 1G3RA 3W3ZB 4O3MA 3ZIAA 1FW6A 1K5GA 4JBWA 1F5NA 1R0XA 1G4AE 4LJ4A 2CBZA 3CKLA 4IEEA 3SZRA 1Z08A 2CL6X 2F3TA 3JVVA 1FUUA 2W6ID 4M2LA 1E69A 3QG1A 1CKEA 1HT1E 4BEJA 5L3SA 2GEDA 4B3FX 3LY5A 3K09A 2IF2A 2RKOA 4IVPA 2I3BA 221PA 2WKPA 5FOVA 4HLDA 3HWSA 3AP1A 1XD8A 3CR7A 4M1MA 3C4JA 4C3ZA 1M6NA 3IIMA 2IXGA 1P2VA 3WMGA 2XSZD 2WJHA 3U61B 5J47A 4BLSA 2BDTA 4MUAA 5G3YA 4BFUA 3J81k 4L16A 1NP6A 3B1WA 3PEWA 2GAAA 1TF2A 1NLZA 4I1OA 5JJLA 5JECA 2ODEA 1KO8A 4KYIB 3EA5A 3EAQA 3TQFA 2N1BA 4D4MA 1G4UR 1SVOA 2FH5B 3CB4A 2BJWA 3P4YA 1ZJ6A 2NO1A 3KJHA 4NYIQ 4LSGA 4AKIA 1EFTA 3I32A 1E2PA 2P65A 3NHBA 5AUPB 1N6PA 1TEXA 3I5XA 5C1BA 2AHOA 3F3YA 3UXMA 5CJPA 3U2QA 3OF5A 4ESHA 5DISB 1XTQA 4TYQA 2C96A 1YU9A 5CB8A 4TQAA 3TRFA 1XX6A 2GETA 2GF9A 3CX8A 4YMTA 3K0EA 2MMGA 1IN7A 1D9ZA 2W58A 1AN0A 1W0JA 2WJVA 5C46F 4IFEA 4ZV4A 4PSKA 1PLJA 2H16A 2V7QD 2QGNA 2WWHA 5FH9A 2F43B 1KSHA 4QGHA 4KLZA 3FWYA 4IW3B 3U7HB 2REBA 2LKDA 3K70C 3BH6A 1Q0UA 4C0BA 3GJ4A 1R7RA 4G5QA 3SJAA 5CIQA 1EWRA 1MRSA 3EZ6A 3EPKA 2OG2A 4OQLA 5IK2A 2QUZA 1CIPA 2ZU6A 4LRWA 5FPHA 2ZE6A 3LA6A 4C0JA 4V03A 2CCGA 2GJ8A 3FKSA 1MR3F 3TNFA 5JFGA 4QHSA 2P0EA 2R62A 3ZZTA 4P0TA 3GLIA 1SXJD 5HE8A 2Z43A 3LBIA 1KOFA 1YZKA 2SHKA 4D81A 1HUQA 2D62A 3JZAA 4ILEA 1IXRC 1VYTA 1Z6AA 2FGKA 2RHMA 4LK2A 4MYTA 3VR2A 2O52A 2JLQA 4U5XA 5JHHB 2DWOA 2KBFA 3TKLA 4LI0A 1TTTA 2IS4A 4DLWA 1HV8A 3UG7A 2J7PA 4BLRA 3ZJYA 3LNCA 3EC2A 1DEKA 4G5OA 3V00A 5B30A 2OCAA 3KFVA 1OPXA 1SVLA 2W0SA 1NMXA 1UPTA 4LV8B 3AF2A 5JSZB 4ERNA 4W9MC 1OT3A 3UMSA 1ETUA 1OYWA 1S0UA 2ZETA 1D6JA 2F1HA 2OEPA 2QM7A 5J40A 1NF3A 3P26A 3QQ5A 2OBLA 721PA 3QNUA 3B85A 1E1RA 2FGJA 2QTFA 1W0KD 2QAJA 4Q4HA 2QMUA 1V5WA 3WYAA 2FX3A 1LF5A 1KZ7B 5JRJA 3CF6R 3PITA 5H8WA 1YR6A 2ZYWX 1XEXA 2FG5A 1P5ZB 2VP6A 3GCGA 4A6XA 2VA8A 2WJYA 1GNQA 3WMFA 1IXSB 4DC9A 1DARA 2KI5A 2XNDD 4Q4JB 1C4OA 3LLUA 1A2KC 1SVKA 4D0GA 1YZLA 1NN3A 3ZDQA 3K9LA 4M9SA 1XTRA 3EZ2A 4AK9A 4AKEA 2YOGA 2ZIAA 2QAGC 1ZUNB 4KHZA 3TSWA 3AVUA 3MGCA 1KZGB 5DGXA 3FPAA 1E2DA 4ARZB 4OL0A 2V9PA 2IHBA 1TF7A 1W4CA 2NOAA 1P6XA 3IHWA 2JJ2A 3QXHA 1N5KA 3ZVMA 1Q1ZA 3WP0A 3BB3A 1G41A 1M74A 1P9RA 4Z1MD 1KI3A 2CXXA 4PQYA 2IEZA 5C18A 2KWIA 1BMFA 3AVWA 1NBMA 2VP4A 4TTPA 5B64A 3WRYC 3VQTA 2AL7A 3AH8A 3MWKA 1S4QA 5IK2D 1VG9B 3EPHA 2IXFA 1D8TA 1KI4A 4DSNA 1MO6A 1SQ5A 3TVTA 1W5SA 3WMEA 2QE7A 5KUTA 3IEVA 3B1VA 2IEYA 4NYJQ 1DAEA 4QHYA 3AVTA 1UFQA 1S96A 2P67A 3B13B 1HT2E 3FMFA 2J3EA 1ZCBA 4IOKA 4GOKA 1J2JA 1D2MA 2DPXA 2F55A 1HYQA 1XEWX 1Y3AA 4OI0A 4KYUA 5KSPA 4R2HA 2GK6A 3VKWA 4BECA 1TAGA 2J7PD 2R65A 2PT7A 5HKKA 1K5DA 1XMSA 3FGNA 1RRFA 1XXHE 4GOXA 2C9YA 1N3BA 2IBMA 2JGNA 4G5RA 1Q1BA 3IILA 1XMVA 2ZRIA 2HT6A 1R10A 3GLFB 4RFSB 2KJQA 1PJRA 5FOXA 4KSBA 4TYYA 2FA9A 2CNWD 2EQBA 2P3SA 5FOTA 5KPDA 4C30A 4LYAA 1A5TA 1P4SA 2DCUA 4FWIB 2O8CB 1NMZA 4UNSA 5JMTA 2GZHA 3LD9A 3IQXA 4Q00A 2P5TB 2V1XA 4K46A 4JKIA 2BKUA 4V0ME 3F5FA 5DI3B 2EWWA 2QPAA 4I99A 4D82A 3HYTA 5LBIA 3BOSA 3U5ZB 3DOFA 1JR6A 5L3QA 4RD0A 1OXTA 1RYHA 3Q3JB 2GXSA 3SN6A 1S1MA 3K9HA 3BFVA 3KQHA 3UPUA 4TMXA 3TAHA 2I1QA 2ZREA 4DKXA 4PC6A 5FPSA 2OAQ1 1NNEA 3LXXA 4P4SA 1IQPA 1FX0B 4XVQA 3MWYW 1W2GA 5FBVB 4LGMA 4GRAA 1E4VA 3AVPA 1BYUA 4LYHA 1VPLA 1WP9A 1QVAA 2XOKD 1KYIA 3N70A 1FTSA 4LBWA 3W5IA 5LD2C 4US0R 2IWRA 2YINC 1A82A 3BH0A 1Z63A 4EFMA 3LQRA 2WWWA 2ATXA 4ZDIA 3SQWA 1BMFD 1T5IA 2FZ4A 2QTVB 1I4LD 2V1UA 5DHAA 2PZGA 4PHTA 2JLZA 1XNJA 1IM2A 2QORA 4Y0VA 5DO9A 3FFAA 2J46A 1DG3A 1EFRA 3QPVA 1XFAA 3QXXA 3U60B 2B21A 4Q1AA 3RRYA 4JKYA 3KKQA 1YZTA 2QE7D 3GLGE 5CB6A 1TF5A 1XCMA 1GL9B 1AZSC 1MO3A 3AVOA 1OIXA 4NHOA 4QXAA 2J0SA 2C95A 1TEVA 3RS3A 1SKQA 1WF3A 4RZUA 2VYFA 1N5IA 1E9FA 3OAAA 1S9HA 2B7CA 2OLKA 3EW9A 4IDHA 1NY5A 5F9FA 4HB0A 3V4FA 3BWDD 1TU3A 3GLHA 3NG1A 5CM9C 3THXB 2ZSEA 3ECCA 2VPPA 2QQEA 1ZD8A 3L82B 1GL6A 5HKKD 3SHFA 1QZXA 2OO7A 4RD4A 4R71A 3FOZA 2AXPA 2ZRBA 1P9WA 1R0ZA 2HCBA 2OZEA 3PUZA 3Q5EA 5KYKA 1H8EA 1Q1QA 3NEJA 4LHYA 4FCTA 5JJIA 1VCMA 1M7GA 1E2MA 1BH2A 3Q8XB 2BEKA 3BGWA 1ZU4A 1DAGA 2WM9B 4D2IA 1T5LA 2VIIA 2J0UA 3DOEA 4X8MA 1VYVA 1ZCAA 2EFDB 5DN6A 1AJEA 1G291 1W49A 1KDOA 1N25A 4R9UC 1HH4A 4JLJA 4NPHA 2O8BA 4Q1BA 3W34A 4DLVA 4XD7D 3T1TA 3TVDA 2CHQA 4KJZA 1TNDA 1XF9A 4OHZA 3GJ3A 4DT1A 1G5TA 1QHSA 5FUYA 2XEXA 2QP4A 2W6JD 4DLSA 4FMCB 1IN5A 1ZP6A 1PZNA 3DL0A 4OYHA 5AUNB 2HCJB 3GJ5A 2OHFA 2RGNC 2O0HA 4JVNA 1EFCA 2ZRHA 1KAOA 3QF4A 4M1TA 1P9NA 1PLLA 4HAYA 1KY2A 3I92A 3BE4A 2C03A 3G82C 1OJLA 4U7DA 2FF7A 1ZMXA 2A5JA 3HR8A 2QEQA 4XWKA 4OQNA 3CO5A 1HURA 1A7JA 3OIYA 1CJMA 1KKMA 4CGZA 1F2UB 4WZ6A 2PX0A 4L15A 4WZAE 1OH8A 3ZD6A 4H1UA 2AKAB 2KSQA 1Z5ZA 1O3YA 1I2MA 3L8ZA 1ZC3A 1JAHA 4O0MA 5EZ5A 2J59A 1SXJC 1W2HA 2UVQA 4ITRC 1SVWA 2FE4A 3HPQA 3KTAB 4B35A 4D26A 5FR1A 2JLSA 1RC8A 3PUYA 1YZUA 2FPMA 3LLMA 1LB1B 2ZR7A 1E2GA 2ZI4A 4GZMA 1ZVQA 3MAAC 1EFRD 2O8EB 5IDVA 2ZUBA 5GJVC 3O8DA 4I1SA 1W36D 1VKJA 1XXHB 4Q02A 1T0HB 1KMHA 1ANKA 2HF9A 3R9IA 3VKGA 3NWJA 3K9NA 4LV6A 2IX3A 4B34A 5FI0B 2HXSA 2OXCA 4RD2A 4DB2A 4BE7B 5FL7A 5JCZA 1LW7A 3SOPA 1P2UA 3OAAD 4LJ7A 2E87A 5AWFC 4PPQA 1OV4A 2JEOA 2IL1A 1SHZA 4PANA 3EPLA 2IUSA 4A9AA 2F3RA 1T6NA 4IOLA 3T35A 3K0AA 1F60A 2XX3A 4DJTA 5SZJA 4QGGA 2O0KA 3D6TB 2C5LA 5EE5B 5KNBA 1J99A 1XZQA 2HJGA 2QT0A 4HLUC 3TUIC 3F8TA 4QM6A 2IA5A 3WY9A 2X1VA 1PUIA 4HLQB 4QL3A 1LS6A 3GFPA 2XAUA 3IIJA 4EIWA 3L0SA 5G41A 4Q01A 1W47A 1K6MA 2F7SA 2NGRA 1KDTA 4URZR 1N6OA 2DWPA 2JJ8A 5BXQC 1SVIA 2ZJ8A 1KO1A 1N6RA 2ODBA 2PL3A 1P7CA 4TN1A 2JA1A 1WMSA 2A2ZA 4MGYR 3MFYA 1XD2B 5K8UA 4XJXA 3TLXA 1S8FA 2Q9BA 3GFOA 1W44A 4BQSA 5JCPA 4CEIB 2YNMA 4BUJA 1YQTA 1VG0B 4IDNA 4DLRA 2J45A 1N6NA 2B8TA 2VP5A 1X8LA 4TSFD 1KJZA 4KV9A 3TJZA 4AG5A 4NL4H 5KOYA 4JT4A 2IYLD 1OKKD 1RE0A 1Z3IX 4GSYA 2RGGA 4Q48A 2WIBA 2FV8A 2JCSA 2WWIA 3ZYCA 1KO7A 2GNOA 3ADCA 2PX3A 1G8PA 4AD8A 3GLGB 1QVRA 2QT1A 2EWVA 2GRJA 1U98A 1VTKA 2GF0A 1UEJA 5HPYB 2ONJA 2ZE8A 4RCZA 4TTQA 2UKDA 5G3ZA 3VNVA 4Q21A 1ZUIA 4L9WA 5AK0A 1TU4A 4HEJA 4FWTA 1KKLA 2NG1A 1BS1A 4DSUA 3R7WA 1NN5A 2CCJA 4RKEA 3I73A 1NLYA 4F91B 2AK3A 2ZS8A 4CT4B 4TTRA 2WKRA 4IDOA 5BN3A 3PG5A 4NYMQ 1XTJA 2ZPTX 2A30A 3I5YA 2ZRJA 3IGFA 2WJIA 1M7BA 3LVQE 1II9A 5H70A 4B75A 2GJSA 5FBLB 3ZQ6A 2D7DA 3EWAA 5LB4A 4BRUA 4Q7KA 1UAAA 1DS6A 2D3WA 3ADBA 4M1OA 1II0A 4DWJA 2OBMA 4ZDKA 2VH5R 2AR7A 2BVNA 5FL7D 4Q9IA 4YQFA 1H8HA 4M1WA 4DLUA 4TLBA 3I8SA 2ZI3A 3RS2A 3SI7A 3QENA 4NU0A 2GZDA 1JQJC 4YDSA 2PJZA 1R6BX 3A36A 3SU8A 2Z5FA 1ODFA 1QDEA 3IDQA 3KJGA 2BMDA 2FPKA 2XNSA 4N1AA 3RVBA 3TAUA 4V0KA 2QENA 5TY0A 3QKSA 2VSXA 2W6IA 3AGQA 4E22A 4B47A 4B33A 1R2QA 4AI6A 4DB4A 4OHXA 5CLLA 3PUXA 5IHPA 1OE0A 1E2NA 2AK2A 4DUGA 4BFWA 4LHZA 3LO5A 5IF9A 1OXXK 1Y63A 2QMEA 4A8JA 4U02A 2R8RA 4Q9LA 1W4RA 2VSFA 1EK0A 2ZRCA 4IDPA 4UNRA 1QG2A 2CLCX 1WCV1 3PUWA 3A1UA 3TH5A 1MABA 4PHFA 3NBYC 2FSGA 4JLPA 1HE8B 1GRNA 2EFGA 2V55B 3CW2A 1G1MA 2QP9X 2JDIA 3L0PA 4LX0A 1FQJA 4EJSB 1MKYA 5BWMA 2C8VA 2XTMA 4AKGA 1CULC 4URYR 4MRVA 2WJJA 3VX3A 3EX7C 1D2NA 3F0TA 5AJXA 1G6HA 2DYKA 4GMDA 2XJ9A 1E1QD 2ZRMA 4HZUA 4LPSA 4BEBA 1X8JA 4M1KA 2NMVA 4L4UA 5KNDA 3FHCB 2WICA 5EQTA 4HB3A 4UXJA 2E9SA 2NTYC 1S3GA 3B1YA 5LPNA 1RPZA 2IW3A 2QRNA 3W8RA 4LY6A 1Q57A 2C2HA 1YJ5A 5DSZA 1WA5A 3W6NA 3ZLJA 1AKYA 2IUTA 3KB1A 1VCOA 3AGPA 2QMOA 2RGEA 2OESA 1QRAA 4EDHA 4TQ9A 3WYGA 5DYGA 3BIFA 3VR4A 421PA 4H1VA 4LJAA 4ZI3A 2V7QA 3BERA 4JT2A 2O8FB 3QG5A 2GZAA 1VG8A 2C99A 3B1ZA 5HZKA 4RVCA 5FOSA 1NVXQ 3DMDA 4PC2A 2ZR0A 1ONBA 1OIWA 4KFTA 4HAUA 4US2R 4FMDF 2FEMA 4ZIRB 1ZYUA 3NXSA 4KITB 1KK0A 4IKEA 1VDZA 1E9DA 3Q72A 4PPNA 3VU9A 1AQYA 1TUEA 1X3SA 3A8TA 5CDFE 5K8TA 4CEHB 1G17A 3BJIC 3B60A 3H86A 4A0GA 4BLQA 2BHRA 4Q7LA 1SXJA 4PQRA 2PMDA 1KK2A 2AFHE 1E9AA 4PZZA 1E2JA 5CYOA 2GEUA 3ZH9B 4XWAA 4N0DA 4YMSA 1O87A 2Z4RA 3U4QA 2ERYA 1R4AA 1LS1A 2E1RA 2PT5A 4DUGD 1KI1A 2VLIA 4JLVA 3T15A 1W1WA 1R5NA 4EQ6A 1ELOA 3ONWA 1KDPA 2RB4A 1UBCA 2GBLA 1GP2A 2WTUA 2O8DA 5JS8A 1W48A 2JDID 3UIEA 1FZQA 4Q19A 1T3HA 4BFVA 1U90A 1AS2A 1Z0KA 2QG6A 4EFNA 3AKEA 4WXPA 4EPRA 2JJ1D 1E96A 4IHQA 4JLKA 1XEWY 1E94E 1UKVY 4TYNA 3VR5A 1W0KA 1PVOA 3BB1A 4HLUA 1AK2A 3N2IA 3RC8A 3AF4A 1COWA 3QBVA 3IEUA 4KBFA 4PO8A 4JS0A 4Q47A 2EYQA 4XTRA 3RWOA 3GLFE 2CEAA 1G19A 2G1KA 3DHWC 5UKDA 3TGPA 4Q4AB 4WAUA 2HF8A 1JEEA 2W2TA 2XNDA 3TMKA 3AKDA 4C0SA 1W36C 4OI4A 1N5LA 2AX4A 2NO0A 1IN6A 2VO1A 1QHHB 1NY6A 4K8OA 3THYA 4RZXA 4Z8XA 3RLFA 1KI9A 1G3QA 3T34A 4QJ5A 4EUNA 1SVSA 5IRCD 1U0HC 2C04A 2REOA 4HUQA 3KL4A 3DMNA 3VMFA 4OI1A 4F4CA 2GWHA 5EXPA 1AS3A 2BOVA 3NTUA 5EJEA 4E5UA 3RANA 5L3VA 1KI2A 2IYRA 4NZYA 4Z1MA 5A0FA 1GAJA 3ZVLA 1ZAKA 4V0MA 3BD9A 1OIVA 2R6CA 1QG4A 4NYIR 3UWKA 1UDXA 1X1SA 2WSSA 3OHMA 3AP3A 3ZZUA 1XEFA 3MSXA 4AKHA 3AUXA 4F4IA 3CF0A 1M8PA 2DFNA 2ZSFA 3UK6A 3EARA 5JS7A 3DVLA 2Z6VA 3RABA 4CDGA 1WBDA 2VRWA 2ZVQX 1QHNA 3EZ9A 4I4LA 4B6EA 1TQ6A 2QGZA 4NTZA 3EIQA 5AJVB 4B2PA 1N0VC 1GL7A 4MGZR 2ATVA 3IPXA 4MYHA 4P4TA 4B3GA 1B0UA 1JJVA 2Q3FA 4HZIA 4LUCA 1OW3B 1C1YA 3FMIA 3VKHA 5E7JA 2J7KA 4Y0AA 1R8QA 2FFBA 1GNRA 3VHLB 4MDEA 5TV2A 4DLZA 3OIVA 2J87A 1AM4D 3PIRA 3A37A 1GKUB 1KI6B 3TW8B 1Z47A 2WWGA 3KJIA 1G64A 3L43A 4DLTA 3D3QA 1OH6A 3SS8A 4LYJA 2B7BA 1L4UA 1T8UA 1NKSA 3CLVA 3PV0A 2ZRLA 4CIDA 3QPUA 2R9VA 1YRAA 1EX7A 2CNWA 2P2LA 2ZEJA 3DO6A 4LV5B 4TL6A 5FBQB 1JQLB 3K8YA 1XPOA 1P72A 4MRRA 5D3MA 3QVVA 4A15A 1L4YA 1Q3TA 2WMOB 1XJ0A 4Z8YA 3H84A 4NCJA 4BZQA 2XZPA 1COWD 2WKQA 1N5JA 1OHHA 2FOLA 2QAGB 2OUKA 4A1FA 1ZIOA 3B78A 4RFVA 1DAIA 3M1IA 3TSOA 3VR3A 2CVFA 3CH5A 1RJ9B 1DOAA 3NH9A 4Q66C 2BC9A 5FBWB 4FMBB 4RZ3A 1FL9A 4IOMA 4OKSA 3QKRB 4A4DA 3CPJB 1KY3A 5B2ZA 4PZYA 2OXRA 3G0HA 1DG1G 2HYIC 2FZLA 3W9YA 2J0QA 3NVAA 3IIKA 4JLMA 3KJEA 2JLYA 4BLOA 3VHXA 1II8B 5F98A 1UKEA 2V8OA 1Z6GA 2XOKA 1JR3E 4ABYA 4YMVA 2ZS7A 3GD7A 2C9CA 2VEDA 3CNLA 3R9WA 1G16A 4NKRA 2EW1A 1PV4A 3C41J 4A2WA 3R20A 3A58B 4PFSA 1XP8A 1JAIA 2WSSD 2ZJBA 4Q7MB 1CR4A 4M9QA 2PCLA 1WRBA 1LV7A 2ZYTX 5DHFA 5CYPA 1OFUX 4CZ2A 2D4HA 3BORA 3HPRA 5FTMA 4B71A 2X77A 4HUTA 2Q6TA 2ZSBA 5TVKA 4W5JA 2H17A 1E2FA 4FXPA 3ZQJA 3D31A 4P31A 3U44B 1KGDA 2FN4A 1E2LA 4PSVA 3FDIA 4XIGS 3TUZC 2CE7A 3T06B 3H0KA 4II7A 5P21A 4XVUA 4MITA 3SHWA 1R5OA 3OE7A 1Z0JA 1D2EA 4BPBA 2P5SA 2WHXA 5KSYA 2GCOB 1US8A 3U3RA 3K0SA 4B2LA 1G8YA 3I61A 4HDOB 4YXWA 4A0FA 5EXXA 1P73A 4IRUB 1XDBA 4QGAA 2ZRKA 2GJKA 3S1AA 2IYUA 5J4VA 1T3SA 1M34E 4DXAA 1TQ2A 1KHTA 1E9EA 4CRWB 4ZCIA 1KSFX 4X8HA 1CU1A 1B23P 3DM5A 4NYJR 5JEEA 1GITA 4MYCA 2QZ4A 2PCJA 4BLTA 5J5CA 3OEED 4ZDJA 1R0YA 2NZJA 4XD7A 4GDFA 1OHHD 3NC1C 4LHWA 2XGJA 4FN5A 1F2TA 4QNMA 4C7OA 1UBEA 1CR0A 3C14C 3DM9B 3LX5A 1G7SA 1E9SA 1G7CA 3JZMA 3FMOB 4CT5A 5C2JB 2W6JA 4HAXA 1EX6A 2G83A 4TT3A 3K1JA 3DKVA 2BM1A 3BFXA 4DLYA 5C4GB 2C78A 3RWMB 1KNXA 3MG9A 1AA9A 2QQ0A 4KFUA 1NJFA 5H68A 4LDJA 4P3YA 4RY2A 3KZ1E 4TYPA 5EZ6B 1JECA 2WV9A 2DFLA 3BB4A 3MCAA 4XTCS 2IWHA 2RGDA 3NHAA 1Z0AA 1X6VA 2BBSA 2X2EA 2ZR9A 1FTNA 2IYWA 3MJHA 521PA 3SDZA 1VYUA 4IEIA 4XSHA 3RYTC 4OQMA 4PQFA 3MWJA 1NMYA 2PEYA 2IHYA 1HTWA 1DAKA 1J8YF 1NVVQ 1SKYB 2V4ZA 3EPJA 4JL5A 2F1IA 4XH9B 1C9KA 4JJZA 3H1TA 4CEJB 4KVAA 4YLGA 2IT1A 3VR6A 5FTLA 3O47A 1GIAA 4KO8A 4GPTA 1LF0A 1Q21A 4A8JC 3FE2A 3LDAA 3VR1A 1WBBA 3CRMA 4JBXA 3GPLA 2A5YB 4YDHB 2XXAB 2AKYA 4GT1A 4M21A 2EFEB 3EIEA 3PFIA 2GVDC 4NH0A 2R44A 3OE7D 4GMXA 3M4YA 4PHGA 1AZTA 2JLUA 1ZIPA 3EA0A 4JMPA 2ASEA 2RGXA 3CPEA 2FEOA 4F38A 1J8MF 3ETLA 2VP2A 4AYTA 4RCYA 1DBSA 2MSCB 2AWOA 4NCKA 4F7WA 4NONA 2BBTA 4KU4A 1CJUC 1HQCA 4YXWD 2OCBA 4HLCA 1E0SA 1HA3A 1DAFA 2UZIR 1Z0FA 2ZE7A 3NDPA 1QHIA 4RJLA 3IPYA 4P33A 2GXQA 5HCIA 4AC9A 4C0HA 1G9XA 2ANCA 2EYUA 4MGIR 3SBDA 3KQLA 1EG7A 1ZM4A 2FPLA 1FMLA 1Z2AA 3QEJA 4PPGA 1GVNB 1HY3A 2ZS9A 3UMRA 1OLOA 2ZXUA 3P27A 4LZZA 1H65A 1FQKA 4LPKA 4GL2A 2ZUDA 1GFIA 5EUQB 4UNNA 4CF7A 3BFKA 3RS4A 4TZ6A 1BO6A 2VHCA 2Q3HA 4ACAA 5JRZA 4TT3D 1DAHA 2J0VA 3CM0A 3D8BA 1QBKC 1N0WA 4Q5IA 4BLPA 4C4PA 2F43A 2HEIA 2JATA 3U6KA 3C15C 4J0QA 1RFLA 3QXJA 1IXZA 1P3JA 1XWIA 4TSFA 2L0XA 2QP3A 1J7KA 3LRPA 3T1VA 1SXJB 4Q18A 4IJMA 4GOJA 3KDSE 1I4TD 1OKKA 4O25A 1NBME 2TMKA 2ANBA 3CR8A 3NIBA 2BBWA 3SFZA 4MUBA 3WBJA 5L3SB 2IYYA 2BBOA 1ZNWA 3RRZA 4ZCMA 4A6PA 3X1YA 4IFBA 2OCPA 4EQ6B 4JIMA 5JZVA 3GMTA 3A4MA 3Q85A 1NG1A 2FFHA 3AB3A 2NZ8A 3VAAA 4C2UA 4B3XA 1E9RA 5D3QA 3CRQA 3SJCA 2A78A 1XBTA 2RMKA 3L0OA 4URXR 4QFMA 4HAZA 4PZLA 1KSJA 4ZO4A 4Z54A 4FCVA 1R5BA 4MKIA 5FUVA 3DKPA 2ZAOA 5FUXA 4DCNA 1VIYA 3QKTA 3NBXX 2GBLC 3AV0B 1PUJA 2BCJQ 4M0LA 4RD1A 2G88A 2Q9CA 3CX6A 3D7MA 3U3KA 5JSZA 2W0MA 1T8TA
chains in the Genus database with same CATH superfamily
4L76A 1O6CA 2VSOA 4L6AA 2Z4SA 2BKAA 3M5DA 2UXDM 5C9ZA 3W8NA 5FULA 1XTSA 1Z5PA 3DXXA 1UBNA 1VSVA 1DGHB 1YR1A 4RDHA 1HEIA 1JSZA 4DGQA 1SQGA 1V43A 3SX0A 3W8DA 2XXJA 2OKGA 4ARZA 3D6FA 1PQUA 2C9ZA 1XZFA 2ONCA 1NRJB 4BU0A 2QBYA 2TMGA 3SFVA 1JZSA 1M67A 2IH4A 4LKRA 3ROTA 4F6RA 2ZWOA 1DKRA 1RIFA 2ORVA 3F2VA 2ZUVA 1UADA 4V02A 2I2BA 1CRQA 5DHSA 4RIIA 3IOYA 5BR4A 4BZXA 3WLLA 1AK1A 4YROA 4R7GA 1NUSA 1DELA 2YVAA 3DFUA 3SEAA 4JGBA 1HI9A 1RRVA 4R4JA 4UTZA 2JZ0A 2PZEA 1PRBA 2E4XA 5HJ7A 2BFBA 4FFNA 5LB2A 3S40A 1PJ2A 3B1XA 4XJSA 4UQOA 1DSSG 4UNPA 3SS9X 3SSMA 3AOGA 3A3YA 2B5OA 1H2AS 2QTVA 3CBGA 1PL8A 4B7FA 4B73A 4CTMA 1KMNA 3FYHA 1NNJA 3ANYB 1FS4A 2ZAYA 3C8DA 2HNBA 1U1EA 3P2KA 3PGA1 1M7HA 1NVDA 4Q9KA 2QTTA 3F96A 3OZGA 2BRUC 2XMDA 5G4LA 2I03A 2HNAA 1Z0IA 4BNFA 4H7IA 1MQ9A 4KR3A 4P3OA 3BREA 2FSHA 1XVIA 4G0XA 3U3OA 2ZLBA 4GC9A 1QK4A 3W8EA 2JXNA 3BXOA 1H94A 1J2UA 4UTPA 1NW9B 4LA4A 5AR1A 4DCJA 2NTNA 1Q17A 1ODKA 2OENG 4G0NA 4IRMA 1HZZA 5ALOA 3DR3A 1IY1A 1Z3CA 4FW9A 2PD4A 3T1OA 3ASYA 1T34A 2VPXA 1M9NA 1USVA 2X40A 4F9FA 3MT8A 4XJVA 3UYKA 7REQB 2OZLA 2V54A 2G25A 1H2RS 1XZIA 5FHRA 3HP7A 3VSAA 2CXRA 3SEQA 4ZZ2A 3HXOA 3L77A 3VVLA 5AKKA 2J0UB 4OU7A 4Q3CA 4Q7JB 5ELXA 2O8BB 1CUSA 2YH2A 3HBJA 2GKGA 4H7HA 1DKPA 1EWQA 3B51X 1J07A 3AP2A 1MH1A 3RIHA 1HC7A 2HFKA 2F4VB 3NB0A 3K0CA 4E2WA 4GNKA 3T1YM 1XD2A 1JR3D 4X62B 3BL5A 2M60A 3VPFA 2KB0A 3IB6A 1CNEA 4PR0A 1CW2B 4EY3A 2IY7A 3ORSA 4CBVA 3B7GA 4UE6A 4QDOA 1E0DA 1FYXA 4V24A 4HI0E 4HSGA 3KYDB 1VQ1A 3T7TA 1M0TA 5KYWA 2OYRA 5C37A 2LNHC 4HNVA 1LNZA 3V8PA 3SXUA 5IC4A 2IS6A 2X8AA 3F49S 1KH3A 1AQUA 4H7FA 1TGVA 3L1IA 5B37A 3DZHA 4L22A 3O7MA 4BVGA 4BB0A 1EQAA 1W0JD 3UAOA 3NTVA 3OX4A 2IZ6A 3SICE 4R81A 4J91A 4P4GA 3OTOB 4E2FA 2PUCA 2HJVA 4N6OA 3FFTA 2QZPA 4MRMA 5GZ3A 2AZMA 2ZPUA 1H0KA 3QY0A 2O4CA 4L07A 1QOPB 5C8ZA 2M6LA 4DV7B 2G5PA 3HHXA 1B3RA 4I2NA 4K9OA 5LC1A 4B2YA 1LI4A 3WR5A 1R3DA 4LFAM 3EF1A 4O63O 5KYVA 3L0BA 4I55A 1Q7TA 4TL9A 1JTFA 2QVXX 4LF6B 1FQWA 5EP3A 1T4MA 3JR7A 3Q0TA 5G0SA 4KQFA 1MOZA 3CNOA 1MX9A 4UPVA 3SAJA 3ILXA 2CFTA 1D5CA 2FW6A 4M1EA 3TIXB 2Y1FA 1X86B 2XWQA 3IUYA 3FVWA 3IVRA 2Z6QA 3K5HA 4YP7A 4CKYA 1DL5A 1DXOA 3OH8A 3KR2A 4OL9A 4NBUA 3PI6A 1TMGE 2WYVA 2EKFA 4QKQA 1K2VN 3WKBA 4FYIA 4N41A 3GO4A 1ZCFA 4M76B 1IBMM 4BJ6A 3I9V6 4S04A 3PQDA 4MR7A 5AVKA 2P75A 2B4RO 3ZCQA 3U4QB 2PRYA 3LAWA 3H8JA 1HRDA 3UJ3X 2PUEA 5KPTA 3QYAA 1UZUA 5FOUA 1JG7A 4GDMA 4L72A 2KHHA 4XW2A 2YMQA 5M34A 4MX8A 3KYCB 1EWYA 1LQTA 1A2OA 3KALA 2QAGA 3DT9A 1GGEA 2PFSA 1AT1A 2Q3CA 3HO6A 3JQ6A 5EIBC 3K70D 2HU8A 2X22A 5KYYB 3I0ZA 1H69A 2QF7A 2W37A 3B9BA 1KJJA 2ERCA 3WK4A 5LYJB 4G9GA 5KQGA 2R6FA 3UATA 5AM4A 1UKYA 4DCUA 1XL0A 4F5DA 3JWPA 5DASA 5EYPA 2YOHA 2VK1A 3RVKA 3V7NA 1H93A 3Q40A 4V0LA 3NBAA 1G4HA 7YASA 3WIVA 3JCZA 1SUIA 2XGMA 3MRSA 4EMBA 4D4HA 2JFXA 2BUCA 2AKEA 4TMFA 2DPMA 1NQOA 1RM0A 4OQFA 4PLWA 5JJCA 1E79A 3L79A 2ZBVA 1EGAA 1GNSA 2B8WA 2RH8A 3LPDA 4CM5A 3QIAA 1FK8A 3HA7A 5LR6A 2H4WA 1ZGBA 2EW8A 2OHOA 2UYCA 4NX2A 3QM1A 4M1YA 1YL6A 1I7PA 2YBDA 1N2EA 2QM0A 2WYUA 3LHDA 2B4QA 1JA0A 1E7SA 5CNJA 1N6HA 3I4LA 3A06A 3S1AB 3MEQA 5JS6A 4M8KA 3M9WA 4HDAA 5DJ5A 3PKIA 1UXJA 2DZDA 3ABIA 4EJ0A 5HTKA 5LDHA 4D8UA 1I7LA 3WQSB 5EE0A 4Z99A 4XWYA 3G0OA 4AUMA 3U4GA 2E48A 2CGEA 2ONYA 2YWDA 4LJ6A 8AT1A 2D59A 1DC5A 1CKEA 2P3QA 1Z6QA 4ENTA 4WKNA 2I2DA 3HCOA 3HCAA 5HUJA 2ZBRA 4LXGA 4HGNA 4LDZA 4GLLA 3C4JA 2C7OA 2QQ5A 2BUAA 3KEFA 2AEJA 1Q14A 4RWZA 4BFUA 2G28A 5AI0A 3NHYA 2X6TA 2Q1YA 4RZIA 1MVOA 4OQZA 5ECGC 1E2PA 2IP1A 4Z3KA 5HOEA 3Q12A 4ZYWA 3SARA 5DDIP 3M70A 2UXDB 4U0KA 4YMTA 3PSAA 4JJEA 4IFEA 4PSKA 1O58A 1PJAA 3ZDFA 3R5XA 1AZWA 4JYPA 4G5QA 3ME5A 1EWRA 3O90A 4YY3M 2HR1A 3GP3A 4MR8A 5FPHA 1PDWA 3GA5A 4G8CA 4L8WB 5DRTA 2IV7A 1N92A 3C70A 4HNSA 1Z6AA 4TUWA 4BBPA 5JHHB 4DLWA 3UG7A 2PZJA 2A0WA 2WYOA 1JDBB 4CNQA 1E4EA 2XV1A 2OEPA 2GBGA 4QPNA 2QTFA 4CMCA 5F33A 2R6HA 4JJFA 2W22A 2VP6A 3G9ZA 4NG4A 3ZY4A 1GNQA 1U7DA 3G9XA 1LUAA 3LT2A 3QTLA 1YS1X 2H00A 2XTJA 4OXNA 4I55F 2NOAA 4K1XA 2JJ2A 1DEHA 4MP3A 4HHEA 4TUYB 1OU0A 3BB3A 4AKTA 1B6RA 1AB5A 4BV9A 2OOKA 2X3YA 5ALHA 3QLTA 4EITA 5A2QS 1I9CA 1R9GA 1SNYA 1XAIA 4UBKA 3PNYA 2JW5A 3C6ZA 3I1JA 1XEWX 3FKJA 1FU4A 4WN9B 1TAGA 4ROTA 4GMHA 4I7EA 1WLYA 1N3BA 3LCUA 4X63A 3KJXA 4TYYA 2CNWD 3EW7A 4FWIB 1X87A 3S8EA 4IIXA 2BKUA 2AQIA 1BRTA 1FBNA 3Q3JB 2C7GA 3K9QO 2JY7A 3M9LA 4YCCA 4CKZA 1YDWA 1AQJA 1FNCA 1VLZA 2B7LA 4X97A 4RAOA 4R68A 3USCS 3TLMA 4E5MA 1CQIA 1LPBB 1BW9B 4W9RA 1CUDA 1TA0A 3THSA 5KHAA 4Q1AA 2ZWAA 3KKQA 2X14A 1XN1A 1WF3A 1R16A 4CM9D 4HGPA 2ECPA 4NZPA 2QM3A 2X1HA 1HX7A 1Z26A 1WMBA 3KVOA 2QXYA 2JVIA 2DVWB 1GAXA 1NUPA 4D2IA 2VIIA 3BD7A 3TE7A 5DNDA 1SWWA 5JXJA 4ALKA 4DLVA 1VJRA 4DM4A 5IYZA 1G5TA 3CKYA 3I01A 3QVJA 5ALYA 1ZP6A 3S81A 2CBGA 5AUNB 3ZHTA 1W1IA 3TDKA 1ZVMA 5DBIA 3QF4A 1S7GA 4ZK2A 3A2MA 1SZDA 3MTIA 3F97A 4UUAA 3JQQA 4CGZA 1AGXA 3N75A 3T1YB 3RFWA 2VTBB 4P83A 4NV3A 3HPQA 3DB2A 2IHUA 1Z13A 2RKWA 2ZR7A 5ALFA 3ZE7A 2GTIA 4QD3A 3VC3A 1WOYA 4MHSA 1K86A 5LXTB 5CFZA 1Y81A 1WDKA 1OV4A 2P9YA 2YRWA 4DILA 1WSDA 2BL4A 5K0CA 4F7DA 3RYFB 2O0KA 3ANLA 4HLUC 3DTNA 2ZYSA 3OEWA 5K45A 2JY6B 3PTLA 3PI7A 4OFWA 3L0SA 1P44A 2NYVA 2NGRA 5HFAA 2RRUA 2ODBA 4LY0A 1LU9A 1XMPA 4EB6B 2RK6A 3FAZA 4R1LA 3D6AA 2HMUA 4KQEA 4P3KA 4IDNA 4DLRA 1KP3A 2C0QA 5KOYA 1IZ8A 1UM9B 4IBOA 2BP7A 1KKUA 3L4BC 1QVRA 4DV4B 4YT5A 5JZBA 1VTKA 3KR9A 2UKDA 4NFYA 1JPVA 1E7RA 2YV2A 3I2KA 4XIFA 3OZ7A 2D7DA 2CW5A 1GRCA 4Q7KA 4OGGA 5D7NA 2I4RA 4XKJA 2WHQA 1EEXB 1KVQA 3LDFA 4KDRA 5BR7A 1AQLA 1C41A 5SV2A 1HSZA 1G8AA 1WXIA 2VSNA 5K0BA 4YCMA 2G9ZA 4MV1A 5K0EA 3VH1A 5IF9A 3V8RA 4WL0A 2V55B 3D7SA 4EJSB 1FQJA 3PFFA 3FTDA 3VH4A 4LF9M 2PZMA 1PIWA 1J24A 2PQ6A 3ZLJA 3AT1A 2V5VA 3WWEA 2AOXA 4ZI3A 4UQLA 1XDUA 4UW9A 3A6HA 4UBJA 3ZGVA 4PC2A 1NUQA 2E7ZA 5IAKA 1IBMB 2G36A 1EXNA 1X3SA 3NEAA 1G17A 3BJIC 2KA6B 3O3CA 2HSWA 4Z49A 4DXHA 3V4SA 3MT7A 4OLAA 5T57A 2RK3A 1LS1A 1PHPA 1DIHA 2WUDA 5MN5A 2OV3A 1LBHA 4YPVA 5SY9A 5ESDA 1Z5NA 2DPYA 1GQYA 2QG6A 2Y92A 3AKEA 1T26A 4AJIA 3HZOA 4EI9A 1IOVA 3BXPA 3BAZA 2X5OA 2EYQA 1EUDB 5CTJA 2CUTA 1Z74A 3F6SA 3O2QB 3BTVA 4KNVA 2UYHA 3FPFA 5BT8A 3PE4A 4MW2A 1SVSA 2GX6A 5LMNM 4M0WA 1G55A 3SHTA 1N9KA 1SPXA 3L06A 1RLMA 4NYIR 4AKHA 1KVUA 8MHTA 2VRWA 2ZVQX 1ZR2A 2DAEA 1JJVA 3KOWE 1IUNA 4FLFA 3H2JA 3FMIA 4ESOA 3N28A 4I50B 4BVEA 1G64A 1OH6A 1DO8A 3PD0A 3CJQA 5MHTA 4BJ5A 2ZRLA 2R9VA 1EX7A 3DO6A 2NQ8A 1N75A 5ERYA 2FUNB 3RE1A 1COWD 2FOLA 3UFXA 1JHDA 1RJ9B 3GRZA 2YIJA 4I8OA 1KBOA 2ZIVB 4ZZ1A 2ROQA 1DG1G 5JR3A 3DD1A 2F3SA 3SYRA 2EP5A 3M5WA 4PYJA 3WGTA 1QU3A 4OQEA 1S2LA 1IHXA 5K3EA 2DZOB 2GZRA 2EIXA 1Q83A 5TX7A 4INJA 2XXAB 4C29A 4HUTA 3GUZA 2Q6TA 3RFUA 3ZQJA 3O74A 4ZQHA 5E6SB 5H02A 1E2LA 3BMOB 1JA1A 3MA0A 4LVUA 5B53A 4Y9TA 2DX7A 1G66A 5L7YA 1PS9A 2Y66A 1SZCA 3H4JA 1ISGA 4ZMRA 4A0FA 2YX1A 5J59A 5B55A 1NDQA 4ZCIA 5HFJA 4J1TC 4HGRA 4YRAA 2PN1A 2G71A 5ITVA 2HPHA 1TLTA 2QJTA 1GXSA 1JXQA 4G1VA 1FU8A 4QNMA 1H2WA 2QXUA 3DM9B 4NSOB 2FI1A 3LS2A 1EX6A 3BMXA 5TS2A 3PJFA 3VDMA 2BM1A 4Q34A 4KSYA 2O3RA 1NJFA 5KMGA 1V5IA 1C0IA 4R1NA 5JT1A 5A4IS 1TVMA 4MYSA 3QH4A 3IEXA 3M34A 2DI0A 3MELA 4IUDS 4P92A 3FE2A 3STVA 2GAIA 3UT5A 1IZZA 2XTAA 3AI2A 4BVBA 2DLCX 1SIBE 2BBTA 3F6BX 2YFYA 2M6KA 1DAOA 4DR6B 5H0IA 3VUEA 1RAFA 3OM1A 1I3LA 1EG7A 3EVNA 5C80A 1O4WA 3O92A 5AVOA 4Z7JA 4FYMA 3RVRA 2Q3HA 4BBZA 1NJ5A 4E33A 4DV2M 2VS1A 3C15C 4J0QA 3UXEA 1ZITA 1OKKA 3CR8A 5IS2A 4G56A 3DPSA 4KFCA 3LWDA 3X1YA 1VXOA 4JIMA 2ZBKB 1FVXA 1C9DB 3PC6A 2PTGA 3FNHA 3W5CA 1KSJA 1QYVA 3HGQA 4Z4GA 2C8JA 5FPQA 4XD2A 5ETJA 2CF6A 1L5GB 2QROA 4YUVA 4C0XA 1K7FB 4IJKA 2FE8A 1ZLYA 1KJYA 3X1JA 4C7BA 3G8BA 4ZHSA 3HFSA 2XH9A 1JKFA 1E5QA 1ICEA 1LPMA 4IFIA 1HJPA 2WJPA 1Y5MA 5AD1A 3JW8A 4KE9A 3WLPA 1ECBA 1P5JA 4IDEA 3EZ7A 3GJYA 4TLLB 1MBZA 3C3BA 2DWNA 2GTPA 1ABFA 4MRSA 4HADA 1PGOA 4NDZA 3NTLA 1DIBA 1MQSA 4RA9B 3THGA 4XI9A 3DAFA 2VHTA 3HFGA 3VKFA 3TEMA 1ZI8A 5BQFA 4MMZB 1T5TA 2JIRA 3TO5A 2H1RA 1W4AA 3Q7QA 2EP7A 4HEA6 1NGSA 2HUPA 4R8LA 3WLIA 3FSRA 1Z15A 3AEQB 3RB8A 1O5TA 3AR5A 1PR9A 1X92A 4V1CA 1Q77A 3DDOA 3FUXA 3BHMA 4BQRA 2OSVA 4QU8A 4GE0A 3TNDA 3OCXA 4IR7A 4KRXA 2G5TA 3D8LA 3WK7A 4MV8A 2FQWA 4HDNA 4DQVA 3WHKA 3QNMA 3CWZA 2D5IA 1RRGA 3BL6A 1GOTA 4QYSA 3NBUA 1IHDA 4YIHA 4UZEA 5KKNB 2OYCA 3IP3A 1U80A 3O2NA 1CZHA 1YS7A 2RG1A 2YJ5A 5EP4A 4EJSC 1V1MA 1XKTA 3OOWA 4XX0B 3WNVA 2K6BA 1CTQA 2D74A 5TGDA 4N7JA 2XZTA 3GELA 3DEFA 2P4QA 1VHTA 1WZUA 1A9PA 4AZFA 2YJZA 5A9TA 1IY0A 2ET6A 2O19A 3STXA 4DA7A 4U2FA 4BQPA 4AMUA 2DBQA 4N9WA 2XEDA 2ZJFA 1L5YA 1IJBA 3HB0A 1MH9A 1PFKA 1RQPA 4Y9DA 3TN7A 4BATA 2HL7A 3U6SA 1S2MA 4A0SA 3MINB 3C3MA 3S7TA 1B7GO 1Z88A 4Q1EA 1MENA 4RV4A 5DN9A 3ZEAA 2R8PA 1CX9B 2AN5A 3PE6A 1U0EA 4X6YA 4D5GA 3GFTA 1HETA 2BH9A 4BO4A 4LC0A 4G0YA 1A2BA 5BSVA 2O8EA 1NQUA 4ZYYA 3ZU4A 1Y3HA 1D2RA 1WB5A 2VHWA 1M34A 3AG5A 2MHCA 1O94C 3LQ1A 3AL3A 1ST2A 2ODNA 1P1FA 4YPFA 4ISBA 1F7UA 3NBKA 1YTUA 4CMIB 4D4GA 3QGMA 1IY8A 4UDNA 1BIFA 1IN8A 2H48A 1XTTA 2D2IA 4N76A 3NU1A 4CM7A 3A0UA 4AO8A 5KSOA 4ML3A 1ORTA 4YV7A 2WF7A 4S0ZA 4PFQA 1G5RA 4F97A 3BT7A 2L2DA 4EUFA 2LGJA 4AMGA 1BU8A 9ABPA 4YACA 4H7EA 4N8SA 4OJKA 4BEVA 4ZKEA 2QVGA 2W2MA 1FLVA 3OSZA 1ZJZA 1ZUWA 3IRUA 1B16A 4RK7A 5L4SA 4ZQIA 4E88A 1PJ3A 5AI6A 1H2EA 1ZMWA 3BK7A 3QVGB 3HP1A 5HK9A 3YASA 5GQSA 4M46A 5CH3A 3FCAA 2MYUA 1VFNA 4D0NA 3LOQA 2OAP1 2QL9A 1UMCB 5IJ0A 1U0LA 3RS5A 3OEHA 1S7CA 4D99A 1LJLA 2ZM5A 5KPJA 4GVPA 3DZIA 5B36A 2MSEB 3PZBA 1NHWC 5C8DA 1IM5A 1KU0A 1TMKA 1A4UA 1B3BA 5KOHB 2D1QA 3I58A 4XM1A 1CJKC 2F6RA 3V4LA 1GYPA 4JYCA 2R0IA 4RY0A 4ASUD 2GCNA 3OZFA 4NE9A 1RRCA 2P1DA 1CLUA 2BTQB 2CVHA 3P0FA 2OV2A 2JFWA 3GJ8A 3NEYA 1E7QA 1QE5A 3BRWA 3O4HA 1H0RA 2UXBB 2FJPA 2ZTMA 2UYOA 2PAFA 5J58A 4AZ0B 2DLNA 1Q39A 1OGIA 2YQ4A 3WP1B 5FAKA 5C31A 4XWGA 1Q95A 1TM2A 2FK7A 2H9AA 3EIWA 1PP4A 2X3UA 4MEBA 2PT9A 3LC1O 3AM1A 2QTWB 2YOFA 4DR5M 2HDOA 1J39A 4E1VA 5BURA 3DE2X 2YMMA 3VNSA 3MLBA 4N7RA 4BC1A 5FPYA 1N2CE 1FMJA 5AUQA 3ZXUB 1VGRA 4MDFA 2E1PA 1HYEA 1ESDA 4BFCA 1RVDA 5EFZA 2JFUA 1TXGA 5L3RA 3JASB 3H5OA 4I3GA 3REGA 4PRZA 1I4WA 4CJ6A 1SELA 3IDZA 3T5DA 1P2TA 2HXYA 4JBYA 4KTVE 3QXSA 1YBMA 3ZWBA 4DEXA 4LRUA 3FNGA 3QE2A 3LP6A 3V2HA 1UZAA 3M1AA 3PHIA 4BP8A 3X1WA 4Z7OB 1OX5A 2XMBA 3NWOA 1MV5A 3BGSA 1VMAA 2FWPA 3F4KA 4F6LA 3WQHA 3VOSA 1J70A 1BXRA 3OICA 3DV0A 1FDSA 1EBUA 4PPFA 1Z0SA 5K3OA 3I2GA 4W1SA 3WNBA 2VEOA 4LOAA 1EP3B 3QAUA 4DDTA 3UJHA 1D1TA 3QV2A 1J0AA 3ONEA 4P3XA 2W4QA 2OY0A 2W11A 1FMFA 1Z6XA 2Y8EA 4RSGA 5KPZA 1ZDMA 5DNYB 1VI2A 3E3LA 1LFDB 4KPEC 3ED5A 4LQDA 1T9GS 2CBXA 1LPNA 4TZTA 4X3CA 3H2YA 1Y1SA 4ZCLA 4PX2A 2HGZA 3FFWA 2VG8A 4LRYA 4UMDA 1C1DB 3I37X 1U7ZA 3MJTA 4XVCA 4NC6A 3ZX5A 4J6FA 4YJKA 1XJCA 2F4VM 3M3HA 2EA0A 3LF2A 4QJ4A 4X62M 1JHQA 5DB4A 1V92A 3JQBC 1ZA2A 1XRNA 2AZ4A 3FNEA 2O7QA 2RGBA 1D4FA 5LZ2A 2RAVA 4X41A 1AY0A 4EAAA 1W29A 3F67A 4MVJG 3KPWA 4L6CA 3VNBA 2TECE 2ZSDA 4X90A 1NG9A 4G4SP 5AM2A 1QKKA 1NT4A 3EK2A 4HF7A 1BMTA 3CLHA 3T0GA 3E18A 3PD1A 3V4VB 4GP7A 3AHHA 5FAXA 3VHXB 4UU0A 1TZJA 1EJ0A 1VE1A 3F5DA 4RKFA 4EHAA 4UXIA 3WGJA 1WGNA 3SNHA 3EWNA 1OXMA 3TQSA 1U1IA 1MMFB 1P1IA 3LRXA 2HK7A 1FJGM 3LP5A 1IMJA 1CJVC 1Q0TA 1US8B 4K1LA 3ORRA 4WE3A 1U0SY 3GCWA 1J6UA 1LVGA 5JAUA 3LUJA 3HEMA 3EVGA 1F6BA 3MLEA 4PLYA 3N0TA 3LUPA 4YAIA 2O5EA 3C98A 2KXEA 5EWJB 3ZBTA 4HTFA 4TRNA 4EM6A 1FLDA 4OIFA 3SC3A 3IV6A 3DE3X 5ALJA 4JQYA 3P4XA 4OK5A 3I83A 4Q0MA 1ZW6A 4BKPA 3HB9A 3BWYA 2H2FA 4MRNA 2CLLB 1ZO8A 3KJQA 3W90A 5ICMA 1JBQA 5IEJA 3DAGA 1N5DA 5CDSA 4O4IB 3W3ZB 1MTZA 4WY2A 2QZJA 4RVSA 4XGKA 4DV2B 4M2LA 4BEJA 4DA0A 1KZ6A 3QA3E 4BBAA 3TBHA 1FLNA 2AT1A 4OMFG 4YA6A 4IIEA 1GEEA 4FVTA 1EGVB 4JV5B 2AF4C 1FLAA 1CQXA 3IIMA 3QEMA 3IX7A 5K6RA 4C21A 4X92A 3WMGA 3OUTA 3TZCA 4ERXA 3O1HB 1U3DA 1ESCA 4W8GA 3OBBA 1RP1A 3TQFA 4KK3A 4NXMB 4JA0A 2FH5B 1GPUA 4HFJA 4IBGA 3L7KA 1E7YA 2AHOA 4DR2B 1RBMA 2GF9A 1MNQA 4Z3OA 4FDAA 1NQ5A 4FNOA 5EQJB 2V7QD 1V8OA 1GJSA 5HIIA 5ALQA 2YN4A 1I32A 3H9CA 2YR0A 3VXKA 2VDVE 2DULA 4G81A 1Z35A 5IK2A 1V39A 1Y4AE 4V03A 2VJKA 3RQSA 3H5LA 5AVUA 4ILEA 1IXRC 4FONA 4RGBA 2RHMA 2O52A 4CKEA 1YS6A 1TVCA 1TTTA 2QIOA 5IUKC 3ZKWB 3OCJA 4WEOA 2AVDA 1DQRA 3P26A 4BKOA 1KTIA 3GEDA 4A6XA 3Q7SA 5DLYA 3Q15C 1C4OA 1ZJ4A 1TEHA 1KMMA 1KOLA 3MGCA 4DREA 4WNAB 1IG3A 4MUFA 2KWIA 4TV8B 2VP4A 4JC0A 4R8VA 5BV0A 3C3XA 4IJFA 4JOBA 3OSUA 4X7MA 3UO8B 1KEEB 2JFZA 4CT0A 4ZAWA 3RVOA 4RF3A 2GK3A 4QHYA 3AVTA 4J0IA 2PKQP 2NXWA 2F55A 3TQQA 2R85A 2VAMA 3FNRA 4ID3A 2QN3A 5CA0B 3GAZA 1B26A 4PONA 3L1JA 4G5RA 4INPA 4FFWA 1XMVA 2YY6A 1EE1A 1QWOA 2D1SA 3NHJA 1E1NA 1RLUA 3SG0A 1DKLA 2ES4A 5CBKA 5D6OA 3U5ZB 1OAAA 2M6SA 3V6MA 3ULKA 5E6UA 1SB8A 2DTXA 1F8YA 4P38A 1Q15A 2G8NA 3SQDA 3BFVA 3H2ZA 4X44A 2JI7A 5F1KA 1BYUA 1YVUA 4L8FA 4PDGA 2XLCA 3FZNA 4BQFA 3RGGA 3QFCA 1PVVA 3WIBA 1NF2A 3QXXA 3IKMB 3LHFA 3NOOA 3RRYA 5CRIA 4MLDA 3DZBA 1Y1PA 4EL5A 3AVOA 1QDUA 2VYFA 4KN9S 3TB4A 1XKLA 2G06A 4NMXB 2W43A 2ZRBA 1V71A 1ZONA 3MQ2A 5A4FS 4M6WA 3NONA 1N5OX 1T8SA 2B61A 2QD3A 4OGWA 5FUYA 3RSCA 3L7BA 3DL0A 2OHFA 2O0HA 4ZOLB 1SXIA 1UBTS 1XTUA 2R751 2VN8A 1YA6A 4Q3KA 3HR8A 4DNXA 1HURA 4FQ8A 3H5IA 1Z5VA 4UASA 4REMA 2Q5FA 2KSQA 3THWB 3HG7A 2EBFX 2J3KA 2Z8YM 5BORA 1E2GA 3MAAC 3I5MA 3JYOA 1LNSA 3B1JA 3KWMA 3ZXIA 3H8SA 4FYJA 5LN1A 5FL7A 2IZ0A 5TE9A 2I67A 3EPLA 1WM1A 5SZJA 3F8TA 2FHSA 5FWAA 3KXPA 5JNTA 2D5LA 1NU6A 5EIHA 3IAM1 1CPYA 1ZI9A 2DT8A 4XJXA 3H6GA 4JT8A 1KYTA 2F5QA 1KY4A 1RE0A 1Z3IX 3AR9A 1KO7A 2C31A 3NOQA 1UMDB 2ECFA 2ZE8A 2V7GA 4Q21A 1ZMBA 1ZUIA 4FWTA 1KEWA 3GYGA 3PQEA 2OBXA 3NATA 2AK3A 4TTRA 4B6OA 1IVSA 1ZD3A 3VU0A 1C14A 4B75A 2GJSA 4XA8A 3C4VA 1K98A 3ADBA 4Y6RA 1CERA 1RWKA 3ZR4B 3HXMA 1P2FA 3RS2A 2NTJA 3V1KA 4NU0A 4BNZA 2A4KA 3RVLA 2EBHX 3ZEIA 1A50B 1QVVA 1DCTA 3CXRA 5I7AA 2C5BA 2HSEA 4A8JA 2R8RA 4PHFA 3K73O 1HE8B 3CW2A 1G1MA 1XC7A 1Z6ZA 2G04A 1PM5A 3V1MA 1CULC 5LP6A 4IJQA 1K92A 4C7XA 3U3ZA 2XMPA 4HZUA 1G71A 3KXDA 4DR5B 1OAIA 1NQXA 5JPDA 2NTYC 2ALJA 3NYIA 4CLOA 1A9SA 2C2HA 4YVFA 4Y8VA 4ATNA 2FR8C 3VAZA 2GDZA 3WYGA 4MYRA 3QVKA 1DCMA 3NX4A 1WZEA 2PLWA 1GPKA 3JYHA 4KFTA 3FTPA 1QRTA 4RFLA 3EGDA 2NXNA 2R8ZA 1WV0A 3B7QA 2D1FA 3UXHA 4A6EA 3M83A 1EKXA 5I7RA 1XT6A 1IPEA 2XYHA 3GBVA 5H9WA 4I6GA 1E62A 1VFPA 3LYUA 3TRIA 4QUHA 1LPOA 2WD8A 5AK4A 3WGIA 1W0KA 3PDUA 2XR1A 2AX3A 3EXIA 4MVJH 3DHWC 5UKDA 1GUFA 4YFVA 4N54A 1IB6A 2REOA 3WWDA 3FD8A 1KJ9A 1WP4A 4F9GA 5FJJA 1NUTA 4NEGA 5A0FA 3SIRA 2FE1A 1OIVA 1QG4A 3DFFA 2WSSA 4RL4A 3SLKA 2OAGA 2GPSA 3EZ9A 3WAGA 2N1MA 4NK4A 2ATVA 4GWLA 4MYHA 2VDNB 2E5FA 3DOCA 3INNA 4Y2QA 2FFBA 1RMQA 2RIPA 4O4LB 3RUDA 5DHQA 5C5EA 1QORA 3GEGA 1GFSA 2B7BA 4CIDA 1OX4A 1YRAA 1SXQA 2GI4A 1P72A 4OLFA 5CA1F 2RJNA 4NCJA 2OUKA 4PD2A 1B00A 3MC1A 1ZIOA 4P81A 3B74A 2CVFA 3CH5A 2ZW9A 5FBWB 1L7DA 1ITZA 2FUCA 2E5WA 5JIBA 5A4KA 2ZYAA 2NT4A 2WTBA 3JQ7B 4WD3A 2VEDA 3S8MA 3C41J 2AFHB 3R20A 5J1TB 4W5NA 4L0MA 2H17A 2NP6A 1Q1NA 1JLMA 4DMMA 2PGOA 3VTFA 2CE7A 1EX1A 1QVZA 4DV4M 1ZH8A 2WHXA 2JFHA 4TOIA 2JS7A 1G2OA 1FJGB 4E94A 1T3GA 4BE4A 3P71T 2FZGA 4IRUB 3RGSA 1F12A 2WUEA 3GDFA 5CVJA 1ACMA 4MYCA 3FTFA 4BLTA 3MJ4A 1QGAA 4JFRA 5D2CA 3DOOA 1U2DA 1PJCA 4E5SA 1P2DA 3S29A 3TZLA 4HAIA 1PGNA 3KV3O 1EH5A 4FFRA 4P3YA 3H1GA 4IJUA 2BBSA 2X2EA 3ZHBA 3DP9A 4PQFA 3MWJA 5BV8A 1AUOA 4NPAA 2FWNA 5JY1A 3PXBA 3H1TA 4CEJB 4KVAA 3X2FA 1KC3A 5FTLA 3FWHA 1Q21A 3GPLA 4U4AA 5D3ZA 4BGEA 3RR2A 2AJLI 3RO7A 3W9BA 3CPEA 1V8BA 2CLEB 1PQWA 5IT4A 4RCYA 1MGPA 1Y9JA 5F73A 3BMQA 3JQAB 3MAJA 1QHIA 1NAIA 1OBHA 4EY7A 1KE1A 3IP6A 1LC0A 1HY3A 1GQFA 1GTZA 4AJEA 3W5AA 4X1KA 4S1OA 3O75A 2F8SA 3K92A 4JYMA 1DAHA 2X7JA 4CTNA 3HN6A 4WLUA 1N7JA 1VDDA 5DYNA 2FN8A 4FGWA 1VMKA 4IFBA 1NQVA 2G40A 4ZVOA 1NQWA 1APBA 3GMTA 3P2IA 4MEAA 2B9VA 2K2WA 2R4UA 4MKIA 1LPPA 1XRSB 1RI1A 5JY6A 2GBLC 1UIMA 1Z12A 3FRHA 3TTYA 4QQFA 3PQ6A 4QVKA 3ZKAA 2GFHA 2MSLA 1E6KA 4NJEB 4D97A 3IP5A 4RD3A 5AUOB 3FCYA 5BSRA 5TC4A 3WIEA 1OYYA 5T6BA 4DLXA 4P32A 1J8FA 2ZRAA 2HV8A 3LBNA 2Z58A 2C1ZA 2AFVA 4RQUA 3IMFA 4JB3A 2A3RA 3P2MA 3KKNA 2F59A 4WOPA 5IKEA 5BSHA 1BMQA 2EFCB 2WPDA 5LP6F 2J4CA 5C4MA 1PTKA 3ORQA 3OLZA 4DE5A 2DP4E 4D4JA 3IQEA 2X4DA 3QVLA 3CINA 4PSAA 4S1VA 2LP4Y 4E14A 2BGKA 2BWEA 2Q4TA 2WP0A 3IQDB 2C77A 4HN2A 1H66A 3LY9A 2VT2A 1SUPA 2J4FA 3L7AA 2Y1XA 4B7UA 3M82A 4QTTB 4FZ5A 2D2FA 3FPLA 1O95A 1ZJ5A 3BXZA 3W1WA 4WFQA 4GS5A 1EIZA 1E18A 3DMRA 3DDCA 3VPAA 3H4MA 5B12A 1ZXBA 5SYNA 5HMMA 4NP6A 3ANNA 4RA6B 4G5GA 4Y9RA 3Q6MA 4RU1A 3MTAA 3AKZA 3RRXA 1Z8NA 2WLTA 2ZRNA 5I5GA 1IJEA 1IYZA 4JHLA 2FRDA 1B42A 2XNKA 5G02A 1NATA 5FRDA 2NXCA 1X7YB 1UBLS 2HC9A 4NCHA 3ZXSA 3OIUA 2XRFA 1J33A 1KI8A 4L27A 2NO9A 3A2NA 3WMXA 2WOJA 4BVAA 2JEZA 3I6BA 1WZCA 2AJCA 2IE0A 2OBNA 4HQRA 3ZHYA 1I0LA 1U0GA 1D09A 2CC2A 3CLRC 4P98A 1K8QA 1E5DA 4BU1A 2Q2QA 1F14A 2QUHA 5J2TA 4KWHA 1RCFA 1DVRA 4DR6M 1BGWA 1ZXLA 4X8OA 1H9AA 3IECA 3FDFA 1KIMA 5I7FA 1UBGA 2YHSA 3EY4A 3N53A 3QXCA 4C7VA 3CRNA 2DHCA 1SIOA 1RC1A 3VTKA 3OU7A 1Y0BA 4RIEA 4J75A 3WRXC 4KO1S 1NWCA 3HDHA 2Q0HA 3VZDA 1HPLA 2ZQYA 1TR8A 2G1JA 4KXQA 4B46A 4D46A 1VSTA 1P4GA 3U7RA 1OLUA 3QWBA 2DEUA 4D9EA 1MAAA 4E7PA 2O2YA 3IVXA 4EPVA 2HFJA 5AOAA 3TW6A 1KMHB 4FU0A 5H7XA 2M98A 4KI7A 3OJWA 5DW3A 2O23A 3UQYS 4JVMA 4Q05A 4RMGA 3EVCA 2WQ6A 5LMZA 2YC2C 1EDZA 4LS3A 1WX1A 2B34A 3I12A 3QEOA 5JJKA 3F6RA 4E2ZA 1OC2A 1WABA 3FKQA 2PD6A 4MS3B 1IIBA 2RHOA 1NJSA 1O4VA 3FPGA 2N3ZA 4IDFA 1ORRA 4TLCA 2Y20A 4XYMA 4JJ7A 4CG3A 4HYEA 3MS2A 1CVLA 5AVWA 2Z7JA 1XHLA 1E3LA 1RWOA 2EU8A 4KTTE 1RMYA 1T9HA 4JHXA 1JB0F 3IAEA 4IIJB 3W2FA 3VZBA 2Z6UA 2WAXA 4EENA 3IQGX 1I5OA 5JC1A 5AVJA 3W5JA 4RLQA 1I2AA 4JLDA 5D86A 2JLWA 3ZK7A 1E3WB 1A72A 4AY4A 1ZINA 3LXMA 5DSTA 2QUAA 3QKSB 4I3HA 4M8IA 4MV7A 4JN6B 2FY8A 1X1RA 13PKA 4CEHA 3IUNA 3TRKA 2Y1DA 2GR9A 1ZI6A 1JALA 4PYKA 2NPIA 3ES9A 2QI9C 2WEKA 3PQFA 2Z1DA 1RXSA 3MWDA 1JI0A 1YCGA 1FVHA 1ZHOA 2PUGA 1VECA 2A94A 1PT6A 3I4VA 1NVVR 1L7AA 1JEQA 4ES6A 4N49A 4GPIB 3NT5A 3STTA 1YS2X 1RHJA 4ZVKA 4OB7A 4FYKA 2J5XA 1V47A 1Z2EA 3A26A 4P3PA 5F5XA 5LUAA 5I9IA 2C4TA 3O3MB 2DMRA