3TEEA

Crystal structure of salmonella flga in open form
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
213
structure length
206
Chain Sequence
QDINAQLTTWFSQRLAGFSDEVVVTLRSSPNLLPSCEQPAFSMKLWGNVNVVARCANEKRYLQVNVQATGNYVAVAAPIARGGKLTPANVTLKRGRLDQLPPRTVLDIRQIQDAVSLRDLAPGQPVQLTMIRQAWRVKAGQRVQVIANGEGFSVNAEGQAMNNAAVAQNARVRMTSGQIVSGTVDSDGNILINLSSSVDKLAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagella basal body P-ring formation protein flgA
publication title Structural flexibility of the periplasmic protein, FlgA, regulates flagellar P-ring assembly in Salmonella enterica
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Chaperone
total genus 48
structure length 206
sequence length 213
ec nomenclature
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08666 SAF SAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.760 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3teeA02
3VKIA 3FRNA 3TEEA 3VJPA
chains in the Genus database with same CATH superfamily
1M9SA 3CCJT 1OU9A 2BZXA 2LC4A 4D6WA 1KJWA 4ZNXA 3UF4A 3FIFA 4YTLA 2CDTA 2XHCA 2BKDN 2EYZA 1LJOA 5DLQE 1K8AC 4MMLA 1HD3A 2QI2A 3GF5A 3A8MB 4X9DA 2EGEA 5IHIA 4XTVA 3OY9A 2FL7A 3CC7Q 1M5Q1 2D1XA 3M4YA 3SD4A 5IHNA 1VQ6T 2ZPHB 5CAIA 4KH1B 2JW4A 2EYQA 4Y28E 2C06A 4E7KA 2M1HA 3OW2S 4O5VA 3LWHA 4XTXA 2K6DA 2QA4A 2RI2A 3VYGA 1YHQT 2DXBA 2K3XA 3MHXA 5LL6S 1JJ2P 1HK9A 2F2XA 2KK4A 1ABOA 1C1AA 4MDXA 4B9WA 3CMAQ 2OJ2A 1M90R 4NL3A 5IN1A 2DBKA 2XG8D 1U8RA 1X6OA 1ZUYA 2RQVA 4OGCA 4JZ3A 2FHDA 4MZPA 4D8KA 2EQUA 3FJ5A 5CQXA 4M7DD 4PJOA 1NEGA 3V8KA 3NTHA 4B9XA 4QQ6A 2OTLQ 1EIFA 2KROA 2ECZA 4A4FA 2CREA 2GQIA 3CC2A 1M90C 3VJPA 1S1NA 3JV3A 2HDAA 2FZGB 2COYA 1WHGA 3HFOA 2L89A 1BU1A 1D1AA 1G3YA 1QKWA 2QK0A 1IREB 3G4SA 4LD6A 3UWNA 3I55Q 2B8AA 4F7UF 1WNLA 1X01A 2BZYA 3M54A 4AFSC 1WYXA 3LH0A 4M78D 4KBMB 2HBPA 3VRYA 3LLRA 1WXUA 2EKHA 1SG5A 2YT6A 1Q81U 3CCVT 3CMET 2QEXA 1QVFS 4C8QF 4CC3A 1GXIE 3TREA 3TVTA 1RL2A 1SEMA 4XU0A 2VXFA 1VUBA 4M7AE 4J9FA 2PVGB 3Q1JA 2EQIA 2LQ8A 1XTDA 3QO3A 4PK4A 3CC4A 2LTOA 2YUOA 2MPXC 3JCMW 2D0NA 5CK9A 1V1CA 5GANe 2DL3A 2GNCA 2DL5A 2EQJA 2K7AA 1EZZB 3QWXX 4M7AB 3HL8A 2E6ZA 1NZ9A 2ZPFB 1VYTA 2DE0X 2JT4A 4J6WA 5A0DA 2E12A 4OB0B 4KGVB 4FU6A 3U23A 1PSEA 1D09B 1HXDA 2O88A 1C0MA 4FM4B 4JRPA 1BIAA 1UGPB 5KYYA 2RQRA 1KD1C 3M5AA 4E2FB 5GAN7 3WVDB 5FU6C 3TSZA 1VQMA 4PJOB 3LW5E 1OULA 1N8RC 9ATCB 1AOJA 2Y90A 4ZGJB 1VQ9Q 1M3AA 1KC8R 2MWOA 3LYIA 1QQJA 1Q86U 4XAXB 4GBQA 3OA6A 1H641 3A8LB 3VS1A 2M9UA 1UGSB 2EYWA 4A53A 1KIKA 2JJ9A 5FU7C 2EBPA 1VQ7Q 1AWXA 1UGQB 4FW2A 1Y96A 3R6NA 2F5TX 3GIBA 1QWFA 2M0OA 1VQOA 2GBQA 4M75A 4JJCA 3CCMT 2E5KA 1A0NB 1D1BA 2X4WA 3GNFB 3VYHB 3OB9A 1VQLT 1PM3A 4E6RA 2D6FA 3IQLA 4CI0C 1X6BA 2DYIA 1GCPA 2DXCA 1OZ3A 2XMFA 3CCQQ 1AWOA 2OTJQ 2YHTA 2JS0A 1VQPQ 1UB4A 3TCJA 4C92E 2DTOA 4F16A 3OSVA 4LDXA 2J05A 2QGFB 5AYFA 1B7TA 2VASA 4NL2A 3M59A 1U3OA 1QP3A 2K5LA 3JCMg 3DLMA 3I56Q 3LWIA 4BE2A 1UJYA 1S72Q 1WPYA 4E7IA 1YJNA 2KEAA 3JCMQ 1CKAA 2P0PA 3M53A 3CCUQ 3JAME 1YJWA 1VIFA 1XOVA 2ZPEB 2DL8A 4C5GA 3LGLA 5KE3A 3EGXA 3JCMX 4QQDA 5KYWA 2LNVA 3OBWA 2RHZA 3H41A 4J9HA 3META 4E7ZA 2E65A 1YIJT 2A0FB 3QHSA 2FPDA 1QKXA 5A2QE 4M7DA 2L5QA 1SPKA 3CD6Q 4M75E 3S3OA 4XTYA 2DF6A 4C0DB 1KSWA 5FRNA 2ENMA 4QKUA 3VKIA 2DD5A 4C92C 1Y96B 2MCNA 4M77E 4RTWA 1QVGA 2DVEA 1WHJA 1UGRB 1KFZA 4L6V5 3OYMA 1RI0A 4M75B 2DTHA 3L2UA 2O9VA 2RA2A 4X1VA 2RHXA 4NS5A 2YRCA 1B3QA 2KRNA 4R0KA 1VQ6A 5GJWB 4E7HA 4M77B 2RI5A 3E9GA 3NTKA 4CRIA 4M78A 2A28A 5GMKl 3CC2T 1RADB 3GBQA 2V8JA 5GAOn 1ZLMA 4DBRA 3CPWS 1MMGA 4EIKA 4II1A 2JTMA 1TUDA 2RNAA 4GY5A 3UDCA 2QA4Q 5I21A 1KQSA 2DIQA 1I81A 3G4ST 3ASKA 4DBHA 5AT1B 1G5VA 3HRSA 2DRMA 1G3TA 3HHTB 1U5SA 2ATCB 2DIGA 1D0XA 4LDWA 2A3LA 3QPHA 2E4HA 3BFMA 5GAN3 2YWWA 4C0GA 2EQMA 1NPPA 1TG0A 1T0HA 1OOTA 4XTZA 4MDWA 2QEXT 3EGXB 4Y92A 3GPLA 2VVKA 4VUBA 3VS6A 2CZ0B 5KYWB 4M7AD 4ZN3A 1SRLA 2ED1A 3EFSA 3RBBB 1N9SA 2RHUA 4PJOF 4IUQA 1X6GA 3GNGA 4BI4A 3A98A 2NLUA 4OB2B 3CC4T 3V8JA 2LQKA 2KMTA 1GRIA 2ZCFB 2AK5A 4QQGA 4N0AC 3MP8A 2FYKA 2RM4A 1WQWA 3OYJA 1TWBA 3OYYA 3OS5A 4PLIA 2JM9A 3LGFA 1WJSA 2AKLA 2LJ0A 3CCVA 1NEBA 1M2VA 2DTIA 3G6EQ 1D1CA 3QIIA 2DX1A 3RDVA 4FCYA 4HCBA 2V1QA 1Q95G 2V1RA 2FG0A 1UGVA 1Q7YR 4XK8E 1WQ7A 1JJ2S 1NJIR 1X2KA 1VQ4A 2ZPIB 5GAN8 1LPLA 2EW3A 1NJIU 4IKFA 1K73U 4KGXB 4EMKC 4LDYA 1OU8A 2E41A 4J8OA 2MI6A 2VXEA 4XU2A 4OGEA 2LX7A 4C5IA 2W0ZA 4RTUA 2RMOA 1TH7A 2LZ6B 4M4ZA 3CXCS 3VRZA 1RAFB 1VQ8A 2KXCA 4LNPA 1SSFA 1N9RA 3ZL7C 1UHCA 3TU4K 2QTVA 1YJ9Q 2KQWA 2LCCA 1VQ5Q 1M1KR 4OMNA 1UECA 2AZSA 1VQMQ 2NUPA 4ORZA 3HPWA 2G6FX 5CVIA 1ACMB 1PSFA 5KE2A 3M9QA 4FW1A 1M4ZA 2JUFA 2HSEB 1PD1A 2MOXA 1N27A 3VV0A 1M2OA 1OX8A 4C92D 1M1GA 3KBGA 2EPDA 1QWEA 1YWOA 4HVUA 1I8FA 3CCEQ 5GAOm 1QVGP 4JJDA 4UC4A 3UT1A 1TXQA 2JTEA 1Q82R 2JN0A 2C0TA 3QYHB 5D6YA 3CCMA 5J3BA 3V7CA 3L2VA 2FVUA 5IAYA 3QBYA 3HFNA 4KT0E 1YI2A 2GGRA 1YJNT 1M2VB 1QCOA 2LVMA 2YXYA 3URGA 1VQOQ 3M0TA 1ZBJA 5ECAA 1YJWT 4A63B 3OYGA 2YLCA 4HVVA 1Q82C 2HKQB 3OMGA 4M75F 2GCXA 2J6OA 1PRMC 2CP5A 1WA7A 1M1FA 1SHGA 4IIMA 2MYSA 4ZTFA 4K11A 1TS9A 1K9MC 3UA7A 2XIDA 4FYYB 1KQSP 3CCRT 5GANf 2DL4A 2QQBA 2YUPA 2HL5C 3RUXA 1VYVA 2L8DA 2CZ6B 2EWNA 3G1JA 4OMMA 1JQQA 4M77D 4FT4A 1FYNA 3OYAA 2RN8A 5D6WA 2PZ1A 1GCQC 2DA9A 4L5GA 1MV0B 1QMCA 1GFDA 2LQWA 4HT9A 5GANd 1BKBA 2B86A 2I0NA 3JB9I 3VS3A 1K8AU 3SEMA 2KRSA 1QP2A 2A08A 2DZCA 2EVRA 4J6XA 3MPUB 2NUPB 4LD9K 3VS2A 4OB3B 2QDLA 3OW2A 3NFCA 1RAHB 1YIJA 2LMJA 3HRUA 2XI9A 3X28B 5C0MA 1UEBA 1D0YA 1CSKA 2DXTA 3H8ZA 4BI3A 1YITT 5CKFA 2F69A 3CCJQ 1VQKA 2HSPA 2JTFA 7AT1B 4M7AA 1VOMA 2ESWA 1I5LA 4M7DF 4CC2A 4FSSA 3M0SA 3PMIA 4OB1B 3RKXA 2RQWA 5CKDA 4P5NA 2HEQA 2PUKB 5DY9A 4RTYA 1DJ7B 1VYUA 1VQ6Q 3H0FA 1V29B 4NOYA 1RAGB 1IB8A 2EFIA 2RQTA 4M78F 2AZVA 1YHQQ 2DL7A 2E3HA 2O9SA 3NPFA 3UATA 1R8OB 2NWMA 4XQ3A 3H0IA 2QQAA 3OSSC 2MF2A 4BDYA 1JXMA 1Q81R 3KUFA 3NMZC 2WACA 4X9CA 3OQ5A 2QASA 2AT1B 4OP0A 2MMPA 1QVFA 2HBWA 1SRMA 3OYDA 2BE9B 3OYHA 5GAOp 2RJEA 4BB7A 2KSSA 3PMTA 5GANj 1ZA1B 5FU6B 4LDUA 3N5BB 1KK7A 1Q81C 1TUCA 1VQ4T 1R77A 3S6WA 1VQNA 4JLIA 5M9OA 4O6JA 3EG1A 4J9CA 3WXMB 3VS5A 4Z8AA 5HKCA 3ZEHA 2COWA 1RAAB 2YDLA 2ZZDA 4BE1A 4RCCA 2DZ9A 2P84A 4PJOG 3JB9G 4GLKA 2VYTA 3D7SB 4KUIA 5CCAA 5FU7B 5FRMA 1BI0A 3HTRA 5LJ3d 4C92A 1VQ8T 3H0HA 4E7SA 3AHUA 1K1ZA 2RK1A 1ZUKA 4IUVA 3OS0A 1RLQC 3H9NA 2HQEA 2PVOB 1NLOC 3CMEQ 3CCVQ 1KD1U 4V2SA 1PHTA 1MMDA 2KYMA 1UE9A 2JMCA 1MV3A 2W10A 3KXTA 3P8BB 3RNJA 5KYXA 1Q86R 1N8RU 2CS7A 5J39A 2CSIA 5HK3A 1NYFA 3RESA 2RO0A 5I11A 2CYZB 4BE0A 4J9BA 3L2ZA 3QSUA 4DA4A 2D9TA 1MGQA 2G3RA 3L2RA 2KYBA 3UA6A 1Q86C 4D8DA 4OMOA 3EH1A 3DKMA 1KC8C 2SRCA 1PC0A 5GMKe 2KT1A 2OTJT 4N4IA 2NYSA 2GFUA 1YI2T 3TSWA 1H3ZA 2YSQA 4BDZA 4AFQC 2E10A 1M27C 2LJ3A 2VKNA 3OW2P 4M77A 1AD5A 5J26A 4J83A 3CBPA 2K3YA 1ABQA 2LDMA 2EJFA 1TTHB 2K5IA 3E9FA 2OAUA 5HK0A 1JXOA 2JS2A 2RHYA 2CH4A 4A4KA 3QXEB 2LT4A 1I1JA 3RERA 2CSQA 3INZA 1X27A 3JCMJ 1W2BS 1H3HA 2FB7A 5DLOA 2DD4A 2EQKA 4N0AA 1WHLA 1YN8A 2EJGA 3LH5A 3QYGB 3MO8A 1UG1A 1MHNA 4HVWA 3QDFA 4C92B 4Z02A 1K0SA 3G71Q 3CCMQ 2KT8A 1TU0B 2QYZA 5CKHA 5GANh 3M0UA 3ULRB 1VQLQ 2BE7D 2M16A 3BY7A 5LJ3j 1RUWA 4CC7A 1JBMA 5KYXB 4FYVB 2LP5A 1ZBXA 5CKEA 1Z9ZA 3FC3A 1BCMA 3PFSA 4PKCC 4RG8A 2D8HA 3CC7A 3TQ7P 3CCRA 2YUQA 3PVLA 1SSHA 4MZMA 1LCKA 1YBYA 4HA8A 5LJ3e 3QZ5B 3EG9B 3PIOA 1M30A 4MMKA 3JCMb 5D7UA 3NGPA 2QQSA 3FDRA 4EMKA 3OYIA 1VQKT 1H8KA 5GANg 5FWBA 4PFPA 2X3WD 3VS0A 1UUEA 3E19A 4J7IA 3AT1B 4BD3A 1QVFP 4KH0B 2GQVA 5CO7A 3BDUA 3TEEA 3PIPA 4OMLA 2P4TA 3MEUA 2DPPB 1SHFA 2YRVA 3FRNA 2VV5A 3L1AA 1JO8A 4PFZA 3M57A 4LUDA 3M55A 3CPWA 2JMAA 3P8DA 1I07A 1YIJQ 1ARKA 4KULA 4ATOA 2F5KA 1YITA 2C0IA 5CR2A 2L3QA 4F17A 1QCFA 3X26B 1Y71A 1RI9A 2OAWA 2Y4YA 2QGGA 1T3SA 2O31A 2EYXA 4M7AF 5CIUA 1MNDA 1KHCA 2FPEA 1WHMA 3JB9J 3T9NA 2ED0A 4M7DG 1RABB 1IZ6A 2KRMA 1G8XA 2LX9A 4RCBA 1PNJA 2RPNA 5GAMe 4C5HA 2M02A 2NUZA 2MIOA 4AT1B 2HNIA 3H6ZA 3CC2Q 3RKYA 1OI1A 4RG2A 1VQNT 4AG1C 1D3BA 1M8MA 2ZAEA 5GMKm 2E70A 5D6XA 1WGSA 4Z88A 4EMKB 1BI3A 1I5OB 3G4SQ 2XDPA 3EH2A 3CCST 3DB4A 4C0FA 2CP0A 2WSCE 1IRXA 4L59A 4IIOA 3EHRA 4M78G 3REBB 1BI2A 2QXFA 1IHVA 4EPCA 4F7UG 2GF7A 1GCQA 3PE0A 3OYFA 4PJMA 1JJ2A 2QEXQ 3GP8A 3CCLT 1K73R 2YUNA 1PKSA 1X2QA 1AWJA 3J7AF 1C6VX 3SWNC 5GAN2 2X3XD 5GAOr 4C0ZA 1AWWA 1CKBA 5I2SA 2PNIA 4C8QG 4OVAA 5L23A 4F7UE 1FMVA 3PTAA 1W6XA 3VUBA 1Y57A 3CC4Q 4ZGEB 2K79A 1Q7YC 3C94A 1NJIC 2KY9A 3JCMc 4M7DC 1K4US 2AKKA 3CXCA 3X20B 3MEWA 1WHHA 1ZSZC 2LCLA 2ROTA 2K3BA 2WSFE 4C8QE 4R56A 1RAEB 2FRWA 1K76A 2DAQA 1VQ7A 3KFVA 3UPUA 1VIEA 3RMSA 3M0QA 1MUZA 2YRDA 3HP9A 2JNGA 4FYXB 4C92F 2L0AA 5FLXE 1W4SA 1K9AA 4PLLA 2VGMA 1GFCA 2F1LA 3HKSA 4M78C 1M1KC 1D3BB 4JRIA 3V7RA 1PD0A 2F2WA 2J7IA 2M51A 4BY6C 1OV3A 2X51A 1QCNA 3CCQA 1WZOA 3NTIA 2DMOA 2OTJA 1BIBA 3QJYA 4IUUA 4ZTJA 2XD0A 2GTOA 2O4XA 2X4YA 1IGQA 2QG9B 1V76A 4PFOA 3I9QA 4A4GA 1YWPA 1OX9A 2V26A 4ANJA 3R6OA 4C8QC 2RQUA 1M3BA 2CUBA 2ZPBB 4Q5WA 3JCMf 3FB9A 1R0BG 2HQHA 3M4GA 4ZGDB 3I56A 1S72A 2XDDA 3CPWP 4ME7A 3G7ZA 4TVRA 2H8HA 1XNIA 3OMCA 5IH2A 2RJCA 1SF9A 3EG3A 4DBQA 2K2VA 3MP1A 4RTXA 4XTWA 3LX7A 3JCMd 3P8HA 4HXJA 1EFNA 4M77F 3OYEA 3CC7T 1ZQ1A 2DJQA 4E47A 2K4YA 2MAMA 1K9MU 5GAN5 2DEUA 4FIBA 4QW2A 2A7YA 2X35A 4DQ2A 3CD6A 1G3SA 1PWTA 2RF0A 3MEAA 3L2WA 1K8AR 2V8IA 2FO0A 1YJNQ 1RAIB 3PNWC 5GJVB 2J6FA 4RUGA 3E2UA 2IVWA 4PJNA 1YJWQ 1W1FA 2K2MA 3CMAT 3REAB 4HCCA 1X75C 3QUIA 1UFFA 3JSCA 4ZN1A 1J3TA 2H3JA 2OTLT 3A1PA 2KXDA 5CQYA 3CCRQ 4DBFA 3HRTA 3GOXA 1LVKA 1FMKA 2IG0A 2E64A 3JCMV 5HCKA 4J9IA 4DEYA 1BCOA 4EMHA 2LQNA 2O4XB 2COZA 1AT1B 1UTIA 3OBYA 2A37A 2RB6A 2ZGWA 4R55A 1E7OA 3OS2A 3L2QA 1TOVA 2EAYA 3I55T 1YNZA 3RR6A 3OYLA 1E6HA 3J81E 2KBTA 3VS4A 5EG2A 3DLLA 4LUEA 2HCKA 1TUGB 2BUDA 3RIRA 4OF1A 3M0RA 3E1SA 2CUDA 4JJNK 1M90U 2HL3A 4XTUA 1WI7A 2VC8A 4J9DA 3EAEA 3GLXA 3QKJA 3CXCP 2X9HA 1PRLC 2IIMA 1E6GA 3O8VA 4WTOB 1YITQ 4N4HA 4WF2A 1U1TA 2K5FA 4J5YA 4QVCA 1IO6A 5HY6A 1FMWA 1BYMA 4EDUA 2KGTA 2GFAA 2BTTA 2L3PA 4RTZA 3SDZA 3FEOA 2PVDB 4E7JA 2CZ1B 3I5RA 3JCMe 1GBQA 1VA7A 3OYBA 2CKKA 2ABLA 1OPLA 4LE9A 3G6EA 4M7AG 4A4EA 1G83A 4EMGA 2M0YA 2CT4A 4X34A 3RKWA 5KCOA 5LJ3f 1BI1A 3NHNA 3OYKA 2YLBA 4AFUC 1W70A 2XICA 2DETA 1VQ9T 5KYNA 2DEQA 2QAZA 4DOVA 2E5QA 3CCSA 2ZPGB 2HAXA 1FX7A 4C8QD 4RTVA 3THKA 2FZCB 5KCHA 4BACA 3CBOA 3JRZA 1KD1R 2XU8A 2V8KA 4JS4A 4FT2A 2XK0A 1PG5B 5FROA 2PU9B 1VQ7T 5A0LA 2HMAA 4PJOE 3JCMP 1N8RR 3QG1A 3CCLA 1GBRA 3C95A 2HQXA 4F14A 2FRYA 2IPOB 3MEVA 2EGAA 2DNUA 5GMKj 1YJ9A 1VQ4Q 1VQ5A 2QDYB 5I2MA 2BIVA 4IUTA 3F70A 1I0CA 1QVPA 3ZBDA 3EG9A 2F2VA 3PT9A 2DO3A 3CCQT 1H92A 5KH6A 2WSEE 5L8RE 1T0JA 2PTKA 4ELYC 2P0KA 1AZEA 2OI3A 1F1BB 1VQPT 1KC8U 4M7AC 4J9GA 2EYYA 3ME9A 1VQ8Q 1MMNA 2O2OA 3CCEA 2KNBB 4AMCA 2JZ2A 1AEYA 3X25B 2PQWA 4J7FA 4XU3A 5GAMf 2DLPA 3I56T 2FEIA 4JRQA 2R57A 2ROLA 1S72T 2MWPA 2LCSA 4PJOC 5GAN6 1WIEA 3G71T 1UHFA 3CCUT 1Y0MA 3CQTA 4WCIA 3C4SA 4AFZC 3BW1A 4FYWB 1IHWA 4GLMA 5FWCA 3JCMh 2RD1A 4JJBA 4PL6A 1KQ1A 2K9GA 5A0GA 4ELZC 3SB2A 4C92G 1OZ2A 4FL6A 1GL5A 5GAMd 5LJ5f 1RACB 1Y07A 1YCSB 2DVJA 3OYNA 1W2BA 1OYXA 2DXUA 2L2PA 2MK5A 2L3SA 1WFWA 1JRIA 3L42A 3EGDA 3CD6T 1QW1A 1NE8A 1XQHA 2H3EB 3MCAB 5LJ5d 1YI2Q 4QT7A 4BUGA 1SKUB 2P0QA 1AZGB 3MKDA 3CEYA 1HSQA 1NBEB 1NM7A 4ESRA 4MZTA 4OMQA 5KYYB 1T3LA 2FPFA 1BB9A 4M75G 3SWNA 5IHKA 1WX6A 4QVDA 4IUPA 1KG1A 1ZHIA 5CKBA 2LRQA 5C6SA 3VUZA 3ZFJA 2CGHA 4HKEA 4KGZB 3J80E 4F04B 2Y4XA 4M77G 2DFUA 8ATCB 5I22A 3V7SA 1IXDA 3WVEB 2RH2A 2VB6A 1ZSGA 3CCJA 1ZSZA 2QA4T 1OEBA 2HKNA 1AHJB 1WXBA 1IGUA 2HZYA 1NYGA 3CMAA 5GMKh 4Y91A 3CPFA 2XKOC 1WJQA 1N6AA 3ER0A 2XDBA 3QDRB 3A8HB 5GAN4 1QVGS 2LT1A 1R0CB 2RJFA 5IT9E 2NUTA 1N5ZA 4JZ4A 2A36A 2DK3A 2OTLA 4DEXA 3SHWA 5IXBA 4RMOA 3M56A 2DILA 2R5MA 1VQKQ 3MJXA 4C0DC 1YCYA 3VU3C 5GAMj 5KYUA 1ZX6A 1M8VA 4F7UA 3EGDB 3I55A 1YHQA 4Z89A 1X69A 1XJWB 2QQRA 2O01E 5IXFA 1KQ2A 3MP6A 2QTXA 1QLYA 2K57A 1KQSS 3EG2A 4M75C 3RMQA 4RKUE 1PKTA 2C0OA 2RHIA 3M58A 1G2BA 4C8QA 5LJ5j 2SEMA 2KR3A 1NLPC 2LJ1A 1RLPC 4JS5A 3G6ET 4M77C 1Y7XA 4A54A 2CP6A 1HYOA 4FSXA 4M7DE 2CZ7B 2VUBA 4JRKA 2RK2A 3SWNB 2DKGA 3BE3A 3C0CA 1WXTA 5LJ5e 1U1SA 3X24B 4PJLA 4B6MA 3CBMA 3C12A 1O9SA 3JB9F 1M3CA 2KI7A 4M7DB 3I5SA 5LJ3h 1ZSZB 8AT1B 3FJPA 2EIFA 2E6NA 4JLGA 1UJ0A 1FXXA 3OYCA 4PJOD 2DJZA 2J06A 3M0PA 1OPKA 5EC7A 3JB9D 5GMKi 2CH4W 4LXCA 2PUOB 4HCKA 4OMPA 5GAOq 2X4XA 4M78E 2GTJA 3JB9H 2NUTB 3CMEA 2CP3A 1PCXA 1YJ9T 2E3IA 2CP2A 4JUVA 3DB3A 1VQ5T 1VQNQ 1KHIA 2OX7A 1VQMT 1W2BP 1VQ9A 6AT1B 1K73C 1LNXA 4M78B 2EJ9A 3S3MA 5LJ3g 2DM1A 4HT8A 1Q7YU 1FWZA 2KAFA 1WLPB 4A4HA 3QWYA 4BY6B 2AIRB 3EFOA 2JVVA 4PNOA 5KYUB 2DYBA 4J6YA 4F7UB 3SFMA 1B34A 2X4JA 5GAOl 3CCSQ 2E1HA 2L3RA 3A5ZB 2EKOA 1B07A 4QVZA 1ZUUA 2JM8A 3CCET 1LOJA 4JPBW 1NG2A 3BDLA 1WJRA 1MNEA 2VGNA 1NPRA 2RJDA 3PGGA 4C8QB 3CCLQ 2P4RA 2JOYA 1JB0E 2RI3A 1VQOT 3VS7A 1TSFA 4LDVA 1O75A 4JDSA 4XU1A 4AG2C 4DOWA 1K0XA 3EGUA 1WDXA 2R5AA 3OS1A 2I2LA 3EHQA 3EFRA 2BZ8A 1BBZA 5GAMh 1M1KU 4N4GA 2DRKA 3O5ZA 2HD0A 1U06A 2R58A 2KVQG 1JEGA 1MMAA 1VQPA 1G3WA 1EX4A 4CC4B 4IURA 1HJDA 2DBMA 3A8GB 2QQ9A 4KUDK 2CP7A 2KE9A 4HCZA 1Z9QA 4KRTA 1WHKA 2Z0WA 4OMFB 1OQKA 5LJ5h 4LN2A 2EGCA 4RTTA 3G71A 3CCUA 1YFNA 3QJ6A 4E7LA 1I4K1 2FZKB 1JU5C 1Q82U 4BI8B 5GAMg 2LNHB 3QZ9B 3S3NA 2D8JA 1VQLA 1K9MR 2D0QB 1ZA2B 5FW9A 2VWFA 2J6KA 3V8LA 4J9EA 2CT3A 3FLGA 1D0ZA 3HSBA 5DM7R 2KDSA 3PVQA 1BK2A 1X43A 5LJ5g 3A8OB 3EFOB 4C5EA 4PJJA 2AHJB 1UDLA 3I35A 1B34B 1YP5A 3EG0A 1AVZC 4M75D 2DERA 2JXBA 1P92A
chains in the Genus database with same CATH topology
1M9SA 3CCJT 2XICA 3FC3A 3CCVA 1VQ9T 2DEQA 3PFSA 2DTIA 4PKCC 4DOVA 2E5QA 3CCSA 2LC4A 3QIIA 4RG8A 3CC7A 4D6WA 2ZPGB 2HAXA 4HCBA 3CCRA 1FX7A 4C8QD 3FIFA 4YTLA 2XHCA 4MZMA 2BKDN 4HA8A 1YBYA 5LJ3e 4XK8E 5KCHA 1LJOA 4BACA 1WQ7A 5DLQE 1K8AC 3QZ5B 3CBOA 3JRZA 4MMLA 3PIOA 4MMKA 3JCMb 1VQ4A 2XU8A 2V8KA 2QI2A 4JS4A 4FT2A 2ZPIB 2QQSA 3A8MB 3GF5A 3FDRA 4X9DA 4EMKA 5GAN8 2XK0A 5FROA 3OYIA 1VQKT 2PU9B 5CKEA 1NJIU 1VQ7T 4IKFA 5GANg 5A0LA 1K73U 4XTVA 4PJOE 3JCMP 3OY9A 3QG1A 3CCLA 4EMKC 2FL7A 3E19A 4J7IA 1M5Q1 3C95A 4LDYA 2E41A 2HQXA 3M4YA 3SD4A 4J8OA 2MI6A 2VXEA 4XU2A 4BD3A 4OGEA 3MEVA 1VQ6T 2GQVA 5CO7A 5GMKj 2ZPHB 5CAIA 1YJ9A 3BDUA 4C5IA 3TEEA 3PIPA 2EYQA 4Y28E 2QDYB 1VQ5A 4E7KA 2C06A 2P4TA 2M1HA 1TH7A 5I2MA 2BIVA 3OW2S 4IUTA 3F70A 3CXCS 3MEUA 4O5VA 2DPPB 3LWHA 4XTXA 2YRVA 1QVPA 3FRNA 2VV5A 2QA4A 2RI2A 3L1AA 1VQ8A 3ZBDA 3VYGA 1YHQT 3M57A 1SSFA 2DXBA 3PT9A 2K3XA 3M55A 2DO3A 1N9RA 3MHXA 3CPWA 5LL6S 5KH6A 3CCQT 1HK9A 2WSEE 5L8RE 3TU4K 3P8DA 2KQWA 2LCCA 4ELYC 2KK4A 2P0KA 4KULA 4C5EA 4ATOA 1VQPT 2F5KA 1KC8U 4M7AC 4B9WA 1YITA 4MDXA 3HPWA 5CVIA 5CR2A 1PSFA 5KE2A 3M9QA 4NL3A 5IN1A 3ME9A 1M4ZA 2JUFA 2XG8D 3CCEA 1U8RA 1X6OA 3X26B 1Y71A 4OGCA 4MZPA 2FHDA 2EQUA 2JZ2A 5CQXA 3X25B 2PQWA 4M7DD 1N27A 3VV0A 4PJOA 4J7FA 4XU3A 5GAMf 3I56T 3V8KA 3NTHA 4B9XA 2Y4YA 4JRQA 4QQ6A 2R57A 1EIFA 1S72T 2MWPA 4C92D 1M1GA 3KBGA 4A4FA 4PJOC 3CC2A 5GAN6 1M90C 4M7AF 3VJPA 5CIUA 1KHCA 3G71T 3CCUT 3JB9J 1I8FA 3C4SA 3T9NA 3HFOA 5GAOm 2L89A 4M7DG 3BW1A 1IZ6A 3JCMh 2RD1A 4UC4A 3UT1A 4PL6A 1G3YA 1KQ1A 2JN0A 2LX9A 4RCBA 4ELZC 5A0GA 3QYHB 5D6YA 3SB2A 4C92G 1OZ2A 5J3BA 4FL6A 3CCMA 1IREB 3V7CA 5GAMe 4C5HA 2FVUA 5IAYA 3QBYA 3HFNA 5GAMd 5LJ5f 4KT0E 3L2VA 1YI2A 1YJNT 3G4SA 1Y07A 4LD6A 3UWNA 3OYNA 1W2BA 2HNIA 2LVMA 1OYXA 2DXUA 3H6ZA 3URGA 3RKYA 1OI1A 4RG2A 1VQNT 2B8AA 4F7UF 1WNLA 1YJWT 1X01A 3OYGA 1JRIA 2YLCA 1D3BA 3L42A 1Q82C 3CD6T 3OMGA 3M54A 4M75F 2GCXA 3LH0A 4KBMB 2HBPA 4M78D 5GMKm 3LLRA 2E70A 5D6XA 1QW1A 1WGSA 1NE8A 1XQHA 5LJ5d 3MCAB 4EMKB 1BI3A 1M1FA 1Q81U 3CCVT 3CMET 4ZTFA 4BUGA 2P0QA 2QEXA 1K9MC 1QVFS 2XDPA 4C8QF 3CEYA 3DB4A 4C0FA 3CCST 2WSCE 2XIDA 4L59A 1GXIE 3TREA 4M78G 3CCRT 1RL2A 5GANf 2QQBA 4XU0A 4MZTA 1BI2A 2QXFA 2VXFA 3RUXA 1VUBA 4M7AE 2L8DA 2CZ6B 2EWNA 2PVGB 3Q1JA 4EPCA 4F7UG 2GF7A 2LQ8A 1XTDA 3QO3A 3CC4A 2LTOA 4M77D 3OYFA 4FT4A 1JJ2A 4M75G 3OYAA 3SWNA 3GP8A 3JCMW 5D6WA 3CCLT 4QVDA 4IUPA 4L5GA 1KG1A 5CK9A 1ZHIA 5CKBA 2LRQA 5GANe 5GANd 3J7AF 4HT9A 1BKBA 3SWNC 5GAN2 2EQJA 3JB9I 5C6SA 3VUZA 4M7AB 2CGHA 4HKEA 3HL8A 2E6ZA 1NZ9A 2ZPFB 3ZFJA 4C0ZA 1QP2A 5I2SA 4C8QG 4J6WA 4OVAA 3J80E 5A0DA 2DZCA 2Y4XA 4M77G 2E12A 4OB0B 4J6XA 4F7UE 4FU6A 3PTAA 4LD9K 1PSEA 3V7SA 1HXDA 3VUBA 3WVEB 4ZGEB 2RH2A 1Q7YC 4FM4B 3CCJA 4JRPA 1BIAA 4OB3B 1UGPB 3C94A 1NJIC 2QA4T 1KD1C 3OW2A 2KY9A 3M5AA 3NFCA 3JCMc 5GAN7 3HRUA 1YIJA 1AHJB 3WVDB 3X20B 3CXCA 4M7DC 3MEWA 5FU6C 1VQMA 2LCLA 2XI9A 5GMKh 3X28B 3LW5E 5C0MA 1UEBA 4Y91A 3CPFA 3CMAA 2WSFE 4PJOB 2XKOC 1N8RC 1WJQA 1N6AA 4C8QE 4R56A 3ER0A 2Y90A 2DXTA 3H8ZA 2XDBA 5GAOr 3QDRB 4BI3A 3A8HB 4ZGJB 5GAN4 1QVGS 2LT1A 1YITT 5CKFA 2F69A 2DAQA 2RJFA 5IT9E 1VQ7A 2JTFA 1VQKA 4M7AA 2DK3A 3UPUA 2MWOA 1VIEA 3LYIA 2OTLA 1I5LA 4M7DF 1Q86U 3RMSA 4XAXB 3HP9A 2JNGA 3PMIA 4RMOA 1H641 3A8LB 3M56A 3OA6A 4OB1B 4C92F 3RKXA 2M9UA 4P5NA 5FLXE 5CKDA 1UGSB 4A53A 2PUKB 5DY9A 1W4SA 5FU7C 2R5MA 1DJ7B 4PLLA 2VGMA 4C0DC 1YCYA 1UGQB 1Y96A 3HKSA 3VU3C 4M78C 5GAMj 1M1KC 4M7DB 2F5TX 1D3BB 4JRIA 4F7UA 3GIBA 3V7RA 1M8VA 3I55A 1YHQA 2M0OA 4BY6C 1VQOA 2QQRA 3CCQA 4M75A 2O01E 3CCMT 1KQ2A 3MP6A 2X4WA 2QTXA 3NTIA 3GNFB 3VYHB 1V29B 4NOYA 2OTJA 1BIBA 3QJYA 4IUUA 3OB9A 1VQLT 2K57A 1KQSS 4ZTJA 4M75C 3RMQA 2XD0A 2EFIA 4RKUE 2O4XA 2D6FA 2X4YA 2RHIA 3M58A 4C8QA 4CI0C 4M78F 5LJ5j 4A4GA 2DXCA 1OZ3A 4JS5A 4C8QC 1R8OB 3R6OA 2ZPBB 4Q5WA 3JCMf 3G6ET 4M77C 1Y7XA 3FB9A 4A54A 4XQ3A 4ZGDB 3M4GA 3I56A 4FSXA 2QQAA 2YHTA 3OSSC 4M7DE 2CZ7B 2VUBA 1S72A 4JRKA 2XDDA 2MF2A 2RK2A 3SWNB 4BDYA 1UB4A 2DKGA 3TCJA 4ME7A 3KUFA 3G7ZA 2DTOA 4C92E 2WACA 3OSVA 1XNIA 4TVRA 4X9CA 3OMCA 4LDXA 5LJ5e 2RJCA 3OQ5A 5AYFA 4OP0A 1U1SA 2K2VA 2MMPA 3MP1A 4NL2A 4XTWA 3X24B 1QVFA 3LX7A 3JCMd 3M59A 3CBMA 3P8HA 3C12A 3OYDA 1O9SA 4M77F 1QP3A 3JB9F 3OYEA 3OYHA 3CC7T 1ZQ1A 2K5LA 2RJEA 3DLMA 3JCMg 4BB7A 2KSSA 3PMTA 4E47A 5GAOp 3LWIA 4BE2A 2K4YA 5GANj 2MAMA 1WPYA 5FU6B 4E7IA 5LJ3h 4LDUA 1YJNA 1K9MU 3N5BB 1Q81C 5GAN5 3JCMQ 2P0PA 3FJPA 2EIFA 3M53A 1VQ4T 2E6NA 4JLGA 3S6WA 1FXXA 4FIBA 4QW2A 1VQNA 4JLIA 2A7YA 3JAME 3OYCA 4PJOD 1YJWA 1VIFA 2DJZA 2X35A 1XOVA 2ZPEB 4O6JA 4DQ2A 5M9OA 3JB9D 1K8AU 3WXMB 3CD6A 5GMKi 1G3SA 3MEAA 4C5GA 3L2WA 3LGLA 5KE3A 2PUOB 5HKCA 3ZEHA 5GAOq 2X4XA 2V8IA 3JCMX 4M78E 3JB9H 2ZZDA 4QQDA 4BE1A 2LNVA 3PNWC 3OBWA 4RCCA 2RHZA 3CMEA 2DZ9A 3META 1YJ9T 4PJOG 2E65A 4JUVA 2IVWA 1YIJT 3DB3A 3JB9G 4GLKA 1VQ5T 3QHSA 2VYTA 1KHIA 5A2QE 4M7DA 1VQMT 2L5QA 4KUIA 3CMAT 5CCAA 5FU7B 1VQ9A 5FRMA 1BI0A 4M75E 3S3OA 4XTYA 5LJ3d 1JJ2S 4HCCA 4C92A 4C0DB 1K73C 1VQ8T 1LNXA 1X75C 4M78B 5FRNA 2EJ9A 3S3MA 5LJ3g 3AHUA 2RK1A 4HT8A 4IUVA 1Q7YU 1FWZA 2KAFA 3VKIA 3OS0A 2DD5A 2HQEA 2PVOB 3QUIA 4A4HA 4BY6B 3JSCA 1Y96B 4C92C 1KD1U 4ZN1A 4V2SA 2JVVA 4PNOA 4J6YA 4F7UB 3SFMA 2H3JA 1B34A 2X4JA 4M77E 5GAOl 3KXTA 2OTLT 2E1HA 3P8BB 2DVEA 1QVGA 1UGRB 5CQYA 2L3RA 4L6V5 3OYMA 1RI0A 3HRTA 4M75B 1N8RU 2DTHA 2CS7A 3L2UA 5J39A 3A5ZB 2IG0A 2EKOA 3GOXA 2E64A 4QVZA 3JCMV 2RA2A 5HK3A 2RHXA 4NS5A 3RESA 3CCET 1LOJA 2RO0A 3BDLA 4EMHA 1WJRA 2O4XB 2VGNA 1NPRA 2RJDA 3PGGA 1VQ6A 2CYZB 4C8QB 4E7HA 4BE0A 4M77B 3L2ZA 2ZGWA 2RB6A 3OBYA 4R55A 4DA4A 2RI5A 2D9TA 3QSUA 3OS2A 1MGQA 3E9GA 3NTKA 4CRIA 2JOYA 4M78A 3L2QA 2G3RA 1JB0E 2EAYA 2RI3A 3I55T 3L2RA 1Q86C 3OYLA 5GMKl 1VQOT 3CC2T 4LDVA 2V8JA 3DKMA 5GAOn 1O75A 1KC8C 4JDSA 5GMKe 4XU1A 3J81E 3CPWS 4DOWA 2OTJT 5EG2A 4II1A 2JTMA 2R5AA 3OS1A 4N4IA 2I2LA 2GFUA 3EFRA 4GY5A 3DLLA 5GAMh 1M1KU 4N4GA 3UDCA 2BUDA 5I21A 1KQSA 2DIQA 2HD0A 1I81A 3RIRA 4OF1A 1YI2T 2R58A 3E1SA 2KVQG 3G4ST 4JJNK 3ASKA 1M90U 1H3ZA 4BDZA 4XTUA 1VQPA 1G5VA 1G3WA 3HRSA 2VC8A 2E10A 4IURA 3A8GB 3EAEA 3GLXA 4M77A 3QKJA 1G3TA 2QQ9A 5J26A 3HHTB 2DIGA 4KUDK 4J83A 4LDWA 3O8VA 4HCZA 2A3LA 3QPHA 3CBPA 4OMFB 4N4HA 2K3YA 1U1TA 3BFMA 4WF2A 5LJ5h 5GAN3 2K5FA 2LDMA 4C0GA 2EJFA 2EQMA 1NPPA 2K5IA 4J5YA 3E9FA 4QVCA 2OAUA 5HK0A 4XTZA 5HY6A 4MDWA 2QEXT 2RHYA 4A4KA 3QXEB 3G71A 3CCUA 2LT4A 3QJ6A 3GPLA 4E7LA 1BYMA 4VUBA 4EDUA 1I4K1 2GFAA 3RERA 2CZ0B 1Q82U 4M7AD 3SDZA 4BI8B 3INZA 3FEOA 3QZ9B 4ZN3A 3EFSA 5GAMg 3S3NA 2PVDB 1VQLA 4E7JA 1N9SA 2RHUA 2CZ1B 4PJOF 3JCMe 3JCMJ 1W2BS 3OYBA 2D0QB 2FB7A 5DLOA 4IUQA 2DD4A 3GNGA 4BI4A 2EQKA 2CKKA 4N0AA 2EJGA 2NLUA 4OB2B 3QYGB 3CC4T 3V8JA 3MO8A 1MHNA 2LQKA 4C92B 2KMTA 2ZCFB 4Z02A 3V8LA 3G6EA 4QQGA 3FLGA 4M7AG 4N0AC 3MP8A 2FYKA 4A4EA 5CKHA 3HSBA 5DM7R 2RM4A 5GANh 1WQWA 4EMGA 3OYJA 2KDSA 5LJ5g 2M16A 3A8OB 3OYYA 4X34A 3OS5A 3BY7A 2AHJB 4PLIA 3RKWA 5LJ3f 5KCOA 5LJ3j 1BI1A 1B34B 1JBMA 3LGFA 3OYKA 1WJSA 4M75D 1ZBXA 2YLBA 1P92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VKI A;  3FRN A;  3TEE A;  3VJP A; 
#chains in the Genus database with same CATH topology
 1M9S A;  3CCJ T;  1OU9 A;  2BZX A;  2LC4 A;  4D6W A;  1KJW A;  4ZNX A;  3UF4 A;  3FIF A;  4YTL A;  2CDT A;  2XHC A;  2BKD N;  2EYZ A;  1LJO A;  5DLQ E;  1K8A C;  4MML A;  1HD3 A;  2QI2 A;  3GF5 A;  3A8M B;  4X9D A;  2EGE A;  5IHI A;  4XTV A;  3OY9 A;  2FL7 A;  3CC7 Q;  1M5Q 1;  2D1X A;  3M4Y A;  3SD4 A;  5IHN A;  1VQ6 T;  2ZPH B;  5CAI A;  4KH1 B;  2JW4 A;  2EYQ A;  4Y28 E;  2C06 A;  4E7K A;  2M1H A;  3OW2 S;  4O5V A;  3LWH A;  4XTX A;  2K6D A;  2QA4 A;  2RI2 A;  3VYG A;  1YHQ T;  2DXB A;  2K3X A;  3MHX A;  5LL6 S;  1JJ2 P;  1HK9 A;  2F2X A;  2KK4 A;  1ABO A;  1C1A A;  4MDX A;  4B9W A;  3CMA Q;  2OJ2 A;  1M90 R;  4NL3 A;  5IN1 A;  2DBK A;  2XG8 D;  1U8R A;  1X6O A;  1ZUY A;  2RQV A;  4OGC A;  4JZ3 A;  2FHD A;  4MZP A;  4D8K A;  2EQU A;  3FJ5 A;  5CQX A;  4M7D D;  4PJO A;  1NEG A;  3V8K A;  3NTH A;  4B9X A;  4QQ6 A;  2OTL Q;  1EIF A;  2KRO A;  2ECZ A;  4A4F A;  2CRE A;  2GQI A;  3CC2 A;  1M90 C;  3VJP A;  1S1N A;  3JV3 A;  2HDA A;  2FZG B;  2COY A;  1WHG A;  3HFO A;  2L89 A;  1BU1 A;  1D1A A;  1G3Y A;  1QKW A;  2QK0 A;  1IRE B;  3G4S A;  4LD6 A;  3UWN A;  3I55 Q;  2B8A A;  4F7U F;  1WNL A;  1X01 A;  2BZY A;  3M54 A;  4AFS C;  1WYX A;  3LH0 A;  4M78 D;  4KBM B;  2HBP A;  3VRY A;  3LLR A;  1WXU A;  2EKH A;  1SG5 A;  2YT6 A;  1Q81 U;  3CCV T;  3CME T;  2QEX A;  1QVF S;  4C8Q F;  4CC3 A;  1GXI E;  3TRE A;  3TVT A;  1RL2 A;  1SEM A;  4XU0 A;  2VXF A;  1VUB A;  4M7A E;  4J9F A;  2PVG B;  3Q1J A;  2EQI A;  2LQ8 A;  1XTD A;  3QO3 A;  4PK4 A;  3CC4 A;  2LTO A;  2YUO A;  2MPX C;  3JCM W;  2D0N A;  5CK9 A;  1V1C A;  5GAN e;  2DL3 A;  2GNC A;  2DL5 A;  2EQJ A;  2K7A A;  1EZZ B;  3QWX X;  4M7A B;  3HL8 A;  2E6Z A;  1NZ9 A;  2ZPF B;  1VYT A;  2DE0 X;  2JT4 A;  4J6W A;  5A0D A;  2E12 A;  4OB0 B;  4KGV B;  4FU6 A;  3U23 A;  1PSE A;  1D09 B;  1HXD A;  2O88 A;  1C0M A;  4FM4 B;  4JRP A;  1BIA A;  1UGP B;  5KYY A;  2RQR A;  1KD1 C;  3M5A A;  4E2F B;  5GAN 7;  3WVD B;  5FU6 C;  3TSZ A;  1VQM A;  4PJO B;  3LW5 E;  1OUL A;  1N8R C;  9ATC B;  1AOJ A;  2Y90 A;  4ZGJ B;  1VQ9 Q;  1M3A A;  1KC8 R;  2MWO A;  3LYI A;  1QQJ A;  1Q86 U;  4XAX B;  4GBQ A;  3OA6 A;  1H64 1;  3A8L B;  3VS1 A;  2M9U A;  1UGS B;  2EYW A;  4A53 A;  1KIK A;  2JJ9 A;  5FU7 C;  2EBP A;  1VQ7 Q;  1AWX A;  1UGQ B;  4FW2 A;  1Y96 A;  3R6N A;  2F5T X;  3GIB A;  1QWF A;  2M0O A;  1VQO A;  2GBQ A;  4M75 A;  4JJC A;  3CCM T;  2E5K A;  1A0N B;  1D1B A;  2X4W A;  3GNF B;  3VYH B;  3OB9 A;  1VQL T;  1PM3 A;  4E6R A;  2D6F A;  3IQL A;  4CI0 C;  1X6B A;  2DYI A;  1GCP A;  2DXC A;  1OZ3 A;  2XMF A;  3CCQ Q;  1AWO A;  2OTJ Q;  2YHT A;  2JS0 A;  1VQP Q;  1UB4 A;  3TCJ A;  4C92 E;  2DTO A;  4F16 A;  3OSV A;  4LDX A;  2J05 A;  2QGF B;  5AYF A;  1B7T A;  2VAS A;  4NL2 A;  3M59 A;  1U3O A;  1QP3 A;  2K5L A;  3JCM g;  3DLM A;  3I56 Q;  3LWI A;  4BE2 A;  1UJY A;  1S72 Q;  1WPY A;  4E7I A;  1YJN A;  2KEA A;  3JCM Q;  1CKA A;  2P0P A;  3M53 A;  3CCU Q;  3JAM E;  1YJW A;  1VIF A;  1XOV A;  2ZPE B;  2DL8 A;  4C5G A;  3LGL A;  5KE3 A;  3EGX A;  3JCM X;  4QQD A;  5KYW A;  2LNV A;  3OBW A;  2RHZ A;  3H41 A;  4J9H A;  3MET A;  4E7Z A;  2E65 A;  1YIJ T;  2A0F B;  3QHS A;  2FPD A;  1QKX A;  5A2Q E;  4M7D A;  2L5Q A;  1SPK A;  3CD6 Q;  4M75 E;  3S3O A;  4XTY A;  2DF6 A;  4C0D B;  1KSW A;  5FRN A;  2ENM A;  4QKU A;  3VKI A;  2DD5 A;  4C92 C;  1Y96 B;  2MCN A;  4M77 E;  4RTW A;  1QVG A;  2DVE A;  1WHJ A;  1UGR B;  1KFZ A;  4L6V 5;  3OYM A;  1RI0 A;  4M75 B;  2DTH A;  3L2U A;  2O9V A;  2RA2 A;  4X1V A;  2RHX A;  4NS5 A;  2YRC A;  1B3Q A;  2KRN A;  4R0K A;  1VQ6 A;  5GJW B;  4E7H A;  4M77 B;  2RI5 A;  3E9G A;  3NTK A;  4CRI A;  4M78 A;  2A28 A;  5GMK l;  3CC2 T;  1RAD B;  3GBQ A;  2V8J A;  5GAO n;  1ZLM A;  4DBR A;  3CPW S;  1MMG A;  4EIK A;  4II1 A;  2JTM A;  1TUD A;  2RNA A;  4GY5 A;  3UDC A;  2QA4 Q;  5I21 A;  1KQS A;  2DIQ A;  1I81 A;  3G4S T;  3ASK A;  4DBH A;  5AT1 B;  1G5V A;  3HRS A;  2DRM A;  1G3T A;  3HHT B;  1U5S A;  2ATC B;  2DIG A;  1D0X A;  4LDW A;  2A3L A;  3QPH A;  2E4H A;  3BFM A;  5GAN 3;  2YWW A;  4C0G A;  2EQM A;  1NPP A;  1TG0 A;  1T0H A;  1OOT A;  4XTZ A;  4MDW A;  2QEX T;  3EGX B;  4Y92 A;  3GPL A;  2VVK A;  4VUB A;  3VS6 A;  2CZ0 B;  5KYW B;  4M7A D;  4ZN3 A;  1SRL A;  2ED1 A;  3EFS A;  3RBB B;  1N9S A;  2RHU A;  4PJO F;  4IUQ A;  1X6G A;  3GNG A;  4BI4 A;  3A98 A;  2NLU A;  4OB2 B;  3CC4 T;  3V8J A;  2LQK A;  2KMT A;  1GRI A;  2ZCF B;  2AK5 A;  4QQG A;  4N0A C;  3MP8 A;  2FYK A;  2RM4 A;  1WQW A;  3OYJ A;  1TWB A;  3OYY A;  3OS5 A;  4PLI A;  2JM9 A;  3LGF A;  1WJS A;  2AKL A;  2LJ0 A;  3CCV A;  1NEB A;  1M2V A;  2DTI A;  3G6E Q;  1D1C A;  3QII A;  2DX1 A;  3RDV A;  4FCY A;  4HCB A;  2V1Q A;  1Q95 G;  2V1R A;  2FG0 A;  1UGV A;  1Q7Y R;  4XK8 E;  1WQ7 A;  1JJ2 S;  1NJI R;  1X2K A;  1VQ4 A;  2ZPI B;  5GAN 8;  1LPL A;  2EW3 A;  1NJI U;  4IKF A;  1K73 U;  4KGX B;  4EMK C;  4LDY A;  1OU8 A;  2E41 A;  4J8O A;  2MI6 A;  2VXE A;  4XU2 A;  4OGE A;  2LX7 A;  4C5I A;  2W0Z A;  4RTU A;  2RMO A;  1TH7 A;  2LZ6 B;  4M4Z A;  3CXC S;  3VRZ A;  1RAF B;  1VQ8 A;  2KXC A;  4LNP A;  1SSF A;  1N9R A;  3ZL7 C;  1UHC A;  3TU4 K;  2QTV A;  1YJ9 Q;  2KQW A;  2LCC A;  1VQ5 Q;  1M1K R;  4OMN A;  1UEC A;  2AZS A;  1VQM Q;  2NUP A;  4ORZ A;  3HPW A;  2G6F X;  5CVI A;  1ACM B;  1PSF A;  5KE2 A;  3M9Q A;  4FW1 A;  1M4Z A;  2JUF A;  2HSE B;  1PD1 A;  2MOX A;  1N27 A;  3VV0 A;  1M2O A;  1OX8 A;  4C92 D;  1M1G A;  3KBG A;  2EPD A;  1QWE A;  1YWO A;  4HVU A;  1I8F A;  3CCE Q;  5GAO m;  1QVG P;  4JJD A;  4UC4 A;  3UT1 A;  1TXQ A;  2JTE A;  1Q82 R;  2JN0 A;  2C0T A;  3QYH B;  5D6Y A;  3CCM A;  5J3B A;  3V7C A;  3L2V A;  2FVU A;  5IAY A;  3QBY A;  3HFN A;  4KT0 E;  1YI2 A;  2GGR A;  1YJN T;  1M2V B;  1QCO A;  2LVM A;  2YXY A;  3URG A;  1VQO Q;  3M0T A;  1ZBJ A;  5ECA A;  1YJW T;  4A63 B;  3OYG A;  2YLC A;  4HVV A;  1Q82 C;  2HKQ B;  3OMG A;  4M75 F;  2GCX A;  2J6O A;  1PRM C;  2CP5 A;  1WA7 A;  1M1F A;  1SHG A;  4IIM A;  2MYS A;  4ZTF A;  4K11 A;  1TS9 A;  1K9M C;  3UA7 A;  2XID A;  4FYY B;  1KQS P;  3CCR T;  5GAN f;  2DL4 A;  2QQB A;  2YUP A;  2HL5 C;  3RUX A;  1VYV A;  2L8D A;  2CZ6 B;  2EWN A;  3G1J A;  4OMM A;  1JQQ A;  4M77 D;  4FT4 A;  1FYN A;  3OYA A;  2RN8 A;  5D6W A;  2PZ1 A;  1GCQ C;  2DA9 A;  4L5G A;  1MV0 B;  1QMC A;  1GFD A;  2LQW A;  4HT9 A;  5GAN d;  1BKB A;  2B86 A;  2I0N A;  3JB9 I;  3VS3 A;  1K8A U;  3SEM A;  2KRS A;  1QP2 A;  2A08 A;  2DZC A;  2EVR A;  4J6X A;  3MPU B;  2NUP B;  4LD9 K;  3VS2 A;  4OB3 B;  2QDL A;  3OW2 A;  3NFC A;  1RAH B;  1YIJ A;  2LMJ A;  3HRU A;  2XI9 A;  3X28 B;  5C0M A;  1UEB A;  1D0Y A;  1CSK A;  2DXT A;  3H8Z A;  4BI3 A;  1YIT T;  5CKF A;  2F69 A;  3CCJ Q;  1VQK A;  2HSP A;  2JTF A;  7AT1 B;  4M7A A;  1VOM A;  2ESW A;  1I5L A;  4M7D F;  4CC2 A;  4FSS A;  3M0S A;  3PMI A;  4OB1 B;  3RKX A;  2RQW A;  5CKD A;  4P5N A;  2HEQ A;  2PUK B;  5DY9 A;  4RTY A;  1DJ7 B;  1VYU A;  1VQ6 Q;  3H0F A;  1V29 B;  4NOY A;  1RAG B;  1IB8 A;  2EFI A;  2RQT A;  4M78 F;  2AZV A;  1YHQ Q;  2DL7 A;  2E3H A;  2O9S A;  3NPF A;  3UAT A;  1R8O B;  2NWM A;  4XQ3 A;  3H0I A;  2QQA A;  3OSS C;  2MF2 A;  4BDY A;  1JXM A;  1Q81 R;  3KUF A;  3NMZ C;  2WAC A;  4X9C A;  3OQ5 A;  2QAS A;  2AT1 B;  4OP0 A;  2MMP A;  1QVF A;  2HBW A;  1SRM A;  3OYD A;  2BE9 B;  3OYH A;  5GAO p;  2RJE A;  4BB7 A;  2KSS A;  3PMT A;  5GAN j;  1ZA1 B;  5FU6 B;  4LDU A;  3N5B B;  1KK7 A;  1Q81 C;  1TUC A;  1VQ4 T;  1R77 A;  3S6W A;  1VQN A;  4JLI A;  5M9O A;  4O6J A;  3EG1 A;  4J9C A;  3WXM B;  3VS5 A;  4Z8A A;  5HKC A;  3ZEH A;  2COW A;  1RAA B;  2YDL A;  2ZZD A;  4BE1 A;  4RCC A;  2DZ9 A;  2P84 A;  4PJO G;  3JB9 G;  4GLK A;  2VYT A;  3D7S B;  4KUI A;  5CCA A;  5FU7 B;  5FRM A;  1BI0 A;  3HTR A;  5LJ3 d;  4C92 A;  1VQ8 T;  3H0H A;  4E7S A;  3AHU A;  1K1Z A;  2RK1 A;  1ZUK A;  4IUV A;  3OS0 A;  1RLQ C;  3H9N A;  2HQE A;  2PVO B;  1NLO C;  3CME Q;  3CCV Q;  1KD1 U;  4V2S A;  1PHT A;  1MMD A;  2KYM A;  1UE9 A;  2JMC A;  1MV3 A;  2W10 A;  3KXT A;  3P8B B;  3RNJ A;  5KYX A;  1Q86 R;  1N8R U;  2CS7 A;  5J39 A;  2CSI A;  5HK3 A;  1NYF A;  3RES A;  2RO0 A;  5I11 A;  2CYZ B;  4BE0 A;  4J9B A;  3L2Z A;  3QSU A;  4DA4 A;  2D9T A;  1MGQ A;  2G3R A;  3L2R A;  2KYB A;  3UA6 A;  1Q86 C;  4D8D A;  4OMO A;  3EH1 A;  3DKM A;  1KC8 C;  2SRC A;  1PC0 A;  5GMK e;  2KT1 A;  2OTJ T;  4N4I A;  2NYS A;  2GFU A;  1YI2 T;  3TSW A;  1H3Z A;  2YSQ A;  4BDZ A;  4AFQ C;  2E10 A;  1M27 C;  2LJ3 A;  2VKN A;  3OW2 P;  4M77 A;  1AD5 A;  5J26 A;  4J83 A;  3CBP A;  2K3Y A;  1ABQ A;  2LDM A;  2EJF A;  1TTH B;  2K5I A;  3E9F A;  2OAU A;  5HK0 A;  1JXO A;  2JS2 A;  2RHY A;  2CH4 A;  4A4K A;  3QXE B;  2LT4 A;  1I1J A;  3RER A;  2CSQ A;  3INZ A;  1X27 A;  3JCM J;  1W2B S;  1H3H A;  2FB7 A;  5DLO A;  2DD4 A;  2EQK A;  4N0A A;  1WHL A;  1YN8 A;  2EJG A;  3LH5 A;  3QYG B;  3MO8 A;  1UG1 A;  1MHN A;  4HVW A;  3QDF A;  4C92 B;  4Z02 A;  1K0S A;  3G71 Q;  3CCM Q;  2KT8 A;  1TU0 B;  2QYZ A;  5CKH A;  5GAN h;  3M0U A;  3ULR B;  1VQL Q;  2BE7 D;  2M16 A;  3BY7 A;  5LJ3 j;  1RUW A;  4CC7 A;  1JBM A;  5KYX B;  4FYV B;  2LP5 A;  1ZBX A;  5CKE A;  1Z9Z A;  3FC3 A;  1BCM A;  3PFS A;  4PKC C;  4RG8 A;  2D8H A;  3CC7 A;  3TQ7 P;  3CCR A;  2YUQ A;  3PVL A;  1SSH A;  4MZM A;  1LCK A;  1YBY A;  4HA8 A;  5LJ3 e;  3QZ5 B;  3EG9 B;  3PIO A;  1M30 A;  4MMK A;  3JCM b;  5D7U A;  3NGP A;  2QQS A;  3FDR A;  4EMK A;  3OYI A;  1VQK T;  1H8K A;  5GAN g;  5FWB A;  4PFP A;  2X3W D;  3VS0 A;  1UUE A;  3E19 A;  4J7I A;  3AT1 B;  4BD3 A;  1QVF P;  4KH0 B;  2GQV A;  5CO7 A;  3BDU A;  3TEE A;  3PIP A;  4OML A;  2P4T A;  3MEU A;  2DPP B;  1SHF A;  2YRV A;  3FRN A;  2VV5 A;  3L1A A;  1JO8 A;  4PFZ A;  3M57 A;  4LUD A;  3M55 A;  3CPW A;  2JMA A;  3P8D A;  1I07 A;  1YIJ Q;  1ARK A;  4KUL A;  4ATO A;  2F5K A;  1YIT A;  2C0I A;  5CR2 A;  2L3Q A;  4F17 A;  1QCF A;  3X26 B;  1Y71 A;  1RI9 A;  2OAW A;  2Y4Y A;  2QGG A;  1T3S A;  2O31 A;  2EYX A;  4M7A F;  5CIU A;  1MND A;  1KHC A;  2FPE A;  1WHM A;  3JB9 J;  3T9N A;  2ED0 A;  4M7D G;  1RAB B;  1IZ6 A;  2KRM A;  1G8X A;  2LX9 A;  4RCB A;  1PNJ A;  2RPN A;  5GAM e;  4C5H A;  2M02 A;  2NUZ A;  2MIO A;  4AT1 B;  2HNI A;  3H6Z A;  3CC2 Q;  3RKY A;  1OI1 A;  4RG2 A;  1VQN T;  4AG1 C;  1D3B A;  1M8M A;  2ZAE A;  5GMK m;  2E70 A;  5D6X A;  1WGS A;  4Z88 A;  4EMK B;  1BI3 A;  1I5O B;  3G4S Q;  2XDP A;  3EH2 A;  3CCS T;  3DB4 A;  4C0F A;  2CP0 A;  2WSC E;  1IRX A;  4L59 A;  4IIO A;  3EHR A;  4M78 G;  3REB B;  1BI2 A;  2QXF A;  1IHV A;  4EPC A;  4F7U G;  2GF7 A;  1GCQ A;  3PE0 A;  3OYF A;  4PJM A;  1JJ2 A;  2QEX Q;  3GP8 A;  3CCL T;  1K73 R;  2YUN A;  1PKS A;  1X2Q A;  1AWJ A;  3J7A F;  1C6V X;  3SWN C;  5GAN 2;  2X3X D;  5GAO r;  4C0Z A;  1AWW A;  1CKB A;  5I2S A;  2PNI A;  4C8Q G;  4OVA A;  5L23 A;  4F7U E;  1FMV A;  3PTA A;  1W6X A;  3VUB A;  1Y57 A;  3CC4 Q;  4ZGE B;  2K79 A;  1Q7Y C;  3C94 A;  1NJI C;  2KY9 A;  3JCM c;  4M7D C;  1K4U S;  2AKK A;  3CXC A;  3X20 B;  3MEW A;  1WHH A;  1ZSZ C;  2LCL A;  2ROT A;  2K3B A;  2WSF E;  4C8Q E;  4R56 A;  1RAE B;  2FRW A;  1K76 A;  2DAQ A;  1VQ7 A;  3KFV A;  3UPU A;  1VIE A;  3RMS A;  3M0Q A;  1MUZ A;  2YRD A;  3HP9 A;  2JNG A;  4FYX B;  4C92 F;  2L0A A;  5FLX E;  1W4S A;  1K9A A;  4PLL A;  2VGM A;  1GFC A;  2F1L A;  3HKS A;  4M78 C;  1M1K C;  1D3B B;  4JRI A;  3V7R A;  1PD0 A;  2F2W A;  2J7I A;  2M51 A;  4BY6 C;  1OV3 A;  2X51 A;  1QCN A;  3CCQ A;  1WZO A;  3NTI A;  2DMO A;  2OTJ A;  1BIB A;  3QJY A;  4IUU A;  4ZTJ A;  2XD0 A;  2GTO A;  2O4X A;  2X4Y A;  1IGQ A;  2QG9 B;  1V76 A;  4PFO A;  3I9Q A;  4A4G A;  1YWP A;  1OX9 A;  2V26 A;  4ANJ A;  3R6O A;  4C8Q C;  2RQU A;  1M3B A;  2CUB A;  2ZPB B;  4Q5W A;  3JCM f;  3FB9 A;  1R0B G;  2HQH A;  3M4G A;  4ZGD B;  3I56 A;  1S72 A;  2XDD A;  3CPW P;  4ME7 A;  3G7Z A;  4TVR A;  2H8H A;  1XNI A;  3OMC A;  5IH2 A;  2RJC A;  1SF9 A;  3EG3 A;  4DBQ A;  2K2V A;  3MP1 A;  4RTX A;  4XTW A;  3LX7 A;  3JCM d;  3P8H A;  4HXJ A;  1EFN A;  4M77 F;  3OYE A;  3CC7 T;  1ZQ1 A;  2DJQ A;  4E47 A;  2K4Y A;  2MAM A;  1K9M U;  5GAN 5;  2DEU A;  4FIB A;  4QW2 A;  2A7Y A;  2X35 A;  4DQ2 A;  3CD6 A;  1G3S A;  1PWT A;  2RF0 A;  3MEA A;  3L2W A;  1K8A R;  2V8I A;  2FO0 A;  1YJN Q;  1RAI B;  3PNW C;  5GJV B;  2J6F A;  4RUG A;  3E2U A;  2IVW A;  4PJN A;  1YJW Q;  1W1F A;  2K2M A;  3CMA T;  3REA B;  4HCC A;  1X75 C;  3QUI A;  1UFF A;  3JSC A;  4ZN1 A;  1J3T A;  2H3J A;  2OTL T;  3A1P A;  2KXD A;  5CQY A;  3CCR Q;  4DBF A;  3HRT A;  3GOX A;  1LVK A;  1FMK A;  2IG0 A;  2E64 A;  3JCM V;  5HCK A;  4J9I A;  4DEY A;  1BCO A;  4EMH A;  2LQN A;  2O4X B;  2COZ A;  1AT1 B;  1UTI A;  3OBY A;  2A37 A;  2RB6 A;  2ZGW A;  4R55 A;  1E7O A;  3OS2 A;  3L2Q A;  1TOV A;  2EAY A;  3I55 T;  1YNZ A;  3RR6 A;  3OYL A;  1E6H A;  3J81 E;  2KBT A;  3VS4 A;  5EG2 A;  3DLL A;  4LUE A;  2HCK A;  1TUG B;  2BUD A;  3RIR A;  4OF1 A;  3M0R A;  3E1S A;  2CUD A;  4JJN K;  1M90 U;  2HL3 A;  4XTU A;  1WI7 A;  2VC8 A;  4J9D A;  3EAE A;  3GLX A;  3QKJ A;  3CXC P;  2X9H A;  1PRL C;  2IIM A;  1E6G A;  3O8V A;  4WTO B;  1YIT Q;  4N4H A;  4WF2 A;  1U1T A;  2K5F A;  4J5Y A;  4QVC A;  1IO6 A;  5HY6 A;  1FMW A;  1BYM A;  4EDU A;  2KGT A;  2GFA A;  2BTT A;  2L3P A;  4RTZ A;  3SDZ A;  3FEO A;  2PVD B;  4E7J A;  2CZ1 B;  3I5R A;  3JCM e;  1GBQ A;  1VA7 A;  3OYB A;  2CKK A;  2ABL A;  1OPL A;  4LE9 A;  3G6E A;  4M7A G;  4A4E A;  1G83 A;  4EMG A;  2M0Y A;  2CT4 A;  4X34 A;  3RKW A;  5KCO A;  5LJ3 f;  1BI1 A;  3NHN A;  3OYK A;  2YLB A;  4AFU C;  1W70 A;  2XIC A;  2DET A;  1VQ9 T;  5KYN A;  2DEQ A;  2QAZ A;  4DOV A;  2E5Q A;  3CCS A;  2ZPG B;  2HAX A;  1FX7 A;  4C8Q D;  4RTV A;  3THK A;  2FZC B;  5KCH A;  4BAC A;  3CBO A;  3JRZ A;  1KD1 R;  2XU8 A;  2V8K A;  4JS4 A;  4FT2 A;  2XK0 A;  1PG5 B;  5FRO A;  2PU9 B;  1VQ7 T;  5A0L A;  2HMA A;  4PJO E;  3JCM P;  1N8R R;  3QG1 A;  3CCL A;  1GBR A;  3C95 A;  2HQX A;  4F14 A;  2FRY A;  2IPO B;  3MEV A;  2EGA A;  2DNU A;  5GMK j;  1YJ9 A;  1VQ4 Q;  1VQ5 A;  2QDY B;  5I2M A;  2BIV A;  4IUT A;  3F70 A;  1I0C A;  1QVP A;  3ZBD A;  3EG9 A;  2F2V A;  3PT9 A;  2DO3 A;  3CCQ T;  1H92 A;  5KH6 A;  2WSE E;  5L8R E;  1T0J A;  2PTK A;  4ELY C;  2P0K A;  1AZE A;  2OI3 A;  1F1B B;  1VQP T;  1KC8 U;  4M7A C;  4J9G A;  2EYY A;  3ME9 A;  1VQ8 Q;  1MMN A;  2O2O A;  3CCE A;  2KNB B;  4AMC A;  2JZ2 A;  1AEY A;  3X25 B;  2PQW A;  4J7F A;  4XU3 A;  5GAM f;  2DLP A;  3I56 T;  2FEI A;  4JRQ A;  2R57 A;  2ROL A;  1S72 T;  2MWP A;  2LCS A;  4PJO C;  5GAN 6;  1WIE A;  3G71 T;  1UHF A;  3CCU T;  1Y0M A;  3CQT A;  4WCI A;  3C4S A;  4AFZ C;  3BW1 A;  4FYW B;  1IHW A;  4GLM A;  5FWC A;  3JCM h;  2RD1 A;  4JJB A;  4PL6 A;  1KQ1 A;  2K9G A;  5A0G A;  4ELZ C;  3SB2 A;  4C92 G;  1OZ2 A;  4FL6 A;  1GL5 A;  5GAM d;  5LJ5 f;  1RAC B;  1Y07 A;  1YCS B;  2DVJ A;  3OYN A;  1W2B A;  1OYX A;  2DXU A;  2L2P A;  2MK5 A;  2L3S A;  1WFW A;  1JRI A;  3L42 A;  3EGD A;  3CD6 T;  1QW1 A;  1NE8 A;  1XQH A;  2H3E B;  3MCA B;  5LJ5 d;  1YI2 Q;  4QT7 A;  4BUG A;  1SKU B;  2P0Q A;  1AZG B;  3MKD A;  3CEY A;  1HSQ A;  1NBE B;  1NM7 A;  4ESR A;  4MZT A;  4OMQ A;  5KYY B;  1T3L A;  2FPF A;  1BB9 A;  4M75 G;  3SWN A;  5IHK A;  1WX6 A;  4QVD A;  4IUP A;  1KG1 A;  1ZHI A;  5CKB A;  2LRQ A;  5C6S A;  3VUZ A;  3ZFJ A;  2CGH A;  4HKE A;  4KGZ B;  3J80 E;  4F04 B;  2Y4X A;  4M77 G;  2DFU A;  8ATC B;  5I22 A;  3V7S A;  1IXD A;  3WVE B;  2RH2 A;  2VB6 A;  1ZSG A;  3CCJ A;  1ZSZ A;  2QA4 T;  1OEB A;  2HKN A;  1AHJ B;  1WXB A;  1IGU A;  2HZY A;  1NYG A;  3CMA A;  5GMK h;  4Y91 A;  3CPF A;  2XKO C;  1WJQ A;  1N6A A;  3ER0 A;  2XDB A;  3QDR B;  3A8H B;  5GAN 4;  1QVG S;  2LT1 A;  1R0C B;  2RJF A;  5IT9 E;  2NUT A;  1N5Z A;  4JZ4 A;  2A36 A;  2DK3 A;  2OTL A;  4DEX A;  3SHW A;  5IXB A;  4RMO A;  3M56 A;  2DIL A;  2R5M A;  1VQK Q;  3MJX A;  4C0D C;  1YCY A;  3VU3 C;  5GAM j;  5KYU A;  1ZX6 A;  1M8V A;  4F7U A;  3EGD B;  3I55 A;  1YHQ A;  4Z89 A;  1X69 A;  1XJW B;  2QQR A;  2O01 E;  5IXF A;  1KQ2 A;  3MP6 A;  2QTX A;  1QLY A;  2K57 A;  1KQS S;  3EG2 A;  4M75 C;  3RMQ A;  4RKU E;  1PKT A;  2C0O A;  2RHI A;  3M58 A;  1G2B A;  4C8Q A;  5LJ5 j;  2SEM A;  2KR3 A;  1NLP C;  2LJ1 A;  1RLP C;  4JS5 A;  3G6E T;  4M77 C;  1Y7X A;  4A54 A;  2CP6 A;  1HYO A;  4FSX A;  4M7D E;  2CZ7 B;  2VUB A;  4JRK A;  2RK2 A;  3SWN B;  2DKG A;  3BE3 A;  3C0C A;  1WXT A;  5LJ5 e;  1U1S A;  3X24 B;  4PJL A;  4B6M A;  3CBM A;  3C12 A;  1O9S A;  3JB9 F;  1M3C A;  2KI7 A;  4M7D B;  3I5S A;  5LJ3 h;  1ZSZ B;  8AT1 B;  3FJP A;  2EIF A;  2E6N A;  4JLG A;  1UJ0 A;  1FXX A;  3OYC A;  4PJO D;  2DJZ A;  2J06 A;  3M0P A;  1OPK A;  5EC7 A;  3JB9 D;  5GMK i;  2CH4 W;  4LXC A;  2PUO B;  4HCK A;  4OMP A;  5GAO q;  2X4X A;  4M78 E;  2GTJ A;  3JB9 H;  2NUT B;  3CME A;  2CP3 A;  1PCX A;  1YJ9 T;  2E3I A;  2CP2 A;  4JUV A;  3DB3 A;  1VQ5 T;  1VQN Q;  1KHI A;  2OX7 A;  1VQM T;  1W2B P;  1VQ9 A;  6AT1 B;  1K73 C;  1LNX A;  4M78 B;  2EJ9 A;  3S3M A;  5LJ3 g;  2DM1 A;  4HT8 A;  1Q7Y U;  1FWZ A;  2KAF A;  1WLP B;  4A4H A;  3QWY A;  4BY6 B;  2AIR B;  3EFO A;  2JVV A;  4PNO A;  5KYU B;  2DYB A;  4J6Y A;  4F7U B;  3SFM A;  1B34 A;  2X4J A;  5GAO l;  3CCS Q;  2E1H A;  2L3R A;  3A5Z B;  2EKO A;  1B07 A;  4QVZ A;  1ZUU A;  2JM8 A;  3CCE T;  1LOJ A;  4JPB W;  1NG2 A;  3BDL A;  1WJR A;  1MNE A;  2VGN A;  1NPR A;  2RJD A;  3PGG A;  4C8Q B;  3CCL Q;  2P4R A;  2JOY A;  1JB0 E;  2RI3 A;  1VQO T;  3VS7 A;  1TSF A;  4LDV A;  1O75 A;  4JDS A;  4XU1 A;  4AG2 C;  4DOW A;  1K0X A;  3EGU A;  1WDX A;  2R5A A;  3OS1 A;  2I2L A;  3EHQ A;  3EFR A;  2BZ8 A;  1BBZ A;  5GAM h;  1M1K U;  4N4G A;  2DRK A;  3O5Z A;  2HD0 A;  1U06 A;  2R58 A;  2KVQ G;  1JEG A;  1MMA A;  1VQP A;  1G3W A;  1EX4 A;  4CC4 B;  4IUR A;  1HJD A;  2DBM A;  3A8G B;  2QQ9 A;  4KUD K;  2CP7 A;  2KE9 A;  4HCZ A;  1Z9Q A;  4KRT A;  1WHK A;  2Z0W A;  4OMF B;  1OQK A;  5LJ5 h;  4LN2 A;  2EGC A;  4RTT A;  3G71 A;  3CCU A;  1YFN A;  3QJ6 A;  4E7L A;  1I4K 1;  2FZK B;  1JU5 C;  1Q82 U;  4BI8 B;  5GAM g;  2LNH B;  3QZ9 B;  3S3N A;  2D8J A;  1VQL A;  1K9M R;  2D0Q B;  1ZA2 B;  5FW9 A;  2VWF A;  2J6K A;  3V8L A;  4J9E A;  2CT3 A;  3FLG A;  1D0Z A;  3HSB A;  5DM7 R;  2KDS A;  3PVQ A;  1BK2 A;  1X43 A;  5LJ5 g;  3A8O B;  3EFO B;  4C5E A;  4PJJ A;  2AHJ B;  1UDL A;  3I35 A;  1B34 B;  1YP5 A;  3EG0 A;  1AVZ C;  4M75 D;  2DER A;  2JXB A;  1P92 A; 
#chains in the Genus database with same CATH homology
 1M9S A;  3CCJ T;  2XIC A;  3FC3 A;  3CCV A;  1VQ9 T;  2DEQ A;  3PFS A;  2DTI A;  4PKC C;  4DOV A;  2E5Q A;  3CCS A;  2LC4 A;  3QII A;  4RG8 A;  3CC7 A;  4D6W A;  2ZPG B;  2HAX A;  4HCB A;  3CCR A;  1FX7 A;  4C8Q D;  3FIF A;  4YTL A;  2XHC A;  4MZM A;  2BKD N;  4HA8 A;  1YBY A;  5LJ3 e;  4XK8 E;  5KCH A;  1LJO A;  4BAC A;  1WQ7 A;  5DLQ E;  1K8A C;  3QZ5 B;  3CBO A;  3JRZ A;  4MML A;  3PIO A;  4MMK A;  3JCM b;  1VQ4 A;  2XU8 A;  2V8K A;  2QI2 A;  4JS4 A;  4FT2 A;  2ZPI B;  2QQS A;  3A8M B;  3GF5 A;  3FDR A;  4X9D A;  4EMK A;  5GAN 8;  2XK0 A;  5FRO A;  3OYI A;  1VQK T;  2PU9 B;  5CKE A;  1NJI U;  1VQ7 T;  4IKF A;  5GAN g;  5A0L A;  1K73 U;  4XTV A;  4PJO E;  3JCM P;  3OY9 A;  3QG1 A;  3CCL A;  4EMK C;  2FL7 A;  3E19 A;  4J7I A;  1M5Q 1;  3C95 A;  4LDY A;  2E41 A;  2HQX A;  3M4Y A;  3SD4 A;  4J8O A;  2MI6 A;  2VXE A;  4XU2 A;  4BD3 A;  4OGE A;  3MEV A;  1VQ6 T;  2GQV A;  5CO7 A;  5GMK j;  2ZPH B;  5CAI A;  1YJ9 A;  3BDU A;  4C5I A;  3TEE A;  3PIP A;  2EYQ A;  4Y28 E;  2QDY B;  1VQ5 A;  4E7K A;  2C06 A;  2P4T A;  2M1H A;  1TH7 A;  5I2M A;  2BIV A;  3OW2 S;  4IUT A;  3F70 A;  3CXC S;  3MEU A;  4O5V A;  2DPP B;  3LWH A;  4XTX A;  2YRV A;  1QVP A;  3FRN A;  2VV5 A;  2QA4 A;  2RI2 A;  3L1A A;  1VQ8 A;  3ZBD A;  3VYG A;  1YHQ T;  3M57 A;  1SSF A;  2DXB A;  3PT9 A;  2K3X A;  3M55 A;  2DO3 A;  1N9R A;  3MHX A;  3CPW A;  5LL6 S;  5KH6 A;  3CCQ T;  1HK9 A;  2WSE E;  5L8R E;  3TU4 K;  3P8D A;  2KQW A;  2LCC A;  4ELY C;  2KK4 A;  2P0K A;  4KUL A;  4C5E A;  4ATO A;  1VQP T;  2F5K A;  1KC8 U;  4M7A C;  4B9W A;  1YIT A;  4MDX A;  3HPW A;  5CVI A;  5CR2 A;  1PSF A;  5KE2 A;  3M9Q A;  4NL3 A;  5IN1 A;  3ME9 A;  1M4Z A;  2JUF A;  2XG8 D;  3CCE A;  1U8R A;  1X6O A;  3X26 B;  1Y71 A;  4OGC A;  4MZP A;  2FHD A;  2EQU A;  2JZ2 A;  5CQX A;  3X25 B;  2PQW A;  4M7D D;  1N27 A;  3VV0 A;  4PJO A;  4J7F A;  4XU3 A;  5GAM f;  3I56 T;  3V8K A;  3NTH A;  4B9X A;  2Y4Y A;  4JRQ A;  4QQ6 A;  2R57 A;  1EIF A;  1S72 T;  2MWP A;  4C92 D;  1M1G A;  3KBG A;  4A4F A;  4PJO C;  3CC2 A;  5GAN 6;  1M90 C;  4M7A F;  3VJP A;  5CIU A;  1KHC A;  3G71 T;  3CCU T;  3JB9 J;  1I8F A;  3C4S A;  3T9N A;  3HFO A;  5GAO m;  2L89 A;  4M7D G;  3BW1 A;  1IZ6 A;  3JCM h;  2RD1 A;  4UC4 A;  3UT1 A;  4PL6 A;  1G3Y A;  1KQ1 A;  2JN0 A;  2LX9 A;  4RCB A;  4ELZ C;  5A0G A;  3QYH B;  5D6Y A;  3SB2 A;  4C92 G;  1OZ2 A;  5J3B A;  4FL6 A;  3CCM A;  1IRE B;  3V7C A;  5GAM e;  4C5H A;  2FVU A;  5IAY A;  3QBY A;  3HFN A;  5GAM d;  5LJ5 f;  4KT0 E;  3L2V A;  1YI2 A;  1YJN T;  3G4S A;  1Y07 A;  4LD6 A;  3UWN A;  3OYN A;  1W2B A;  2HNI A;  2LVM A;  1OYX A;  2DXU A;  3H6Z A;  3URG A;  3RKY A;  1OI1 A;  4RG2 A;  1VQN T;  2B8A A;  4F7U F;  1WNL A;  1YJW T;  1X01 A;  3OYG A;  1JRI A;  2YLC A;  1D3B A;  3L42 A;  1Q82 C;  3CD6 T;  3OMG A;  3M54 A;  4M75 F;  2GCX A;  3LH0 A;  4KBM B;  2HBP A;  4M78 D;  5GMK m;  3LLR A;  2E70 A;  5D6X A;  1QW1 A;  1WGS A;  1NE8 A;  1XQH A;  5LJ5 d;  3MCA B;  4EMK B;  1BI3 A;  1M1F A;  1Q81 U;  3CCV T;  3CME T;  4ZTF A;  4BUG A;  2P0Q A;  2QEX A;  1K9M C;  1QVF S;  2XDP A;  4C8Q F;  3CEY A;  3DB4 A;  4C0F A;  3CCS T;  2WSC E;  2XID A;  4L59 A;  1GXI E;  3TRE A;  4M78 G;  3CCR T;  1RL2 A;  5GAN f;  2QQB A;  4XU0 A;  4MZT A;  1BI2 A;  2QXF A;  2VXF A;  3RUX A;  1VUB A;  4M7A E;  2L8D A;  2CZ6 B;  2EWN A;  2PVG B;  3Q1J A;  4EPC A;  4F7U G;  2GF7 A;  2LQ8 A;  1XTD A;  3QO3 A;  3CC4 A;  2LTO A;  4M77 D;  3OYF A;  4FT4 A;  1JJ2 A;  4M75 G;  3OYA A;  3SWN A;  3GP8 A;  3JCM W;  5D6W A;  3CCL T;  4QVD A;  4IUP A;  4L5G A;  1KG1 A;  5CK9 A;  1ZHI A;  5CKB A;  2LRQ A;  5GAN e;  5GAN d;  3J7A F;  4HT9 A;  1BKB A;  3SWN C;  5GAN 2;  2EQJ A;  3JB9 I;  5C6S A;  3VUZ A;  4M7A B;  2CGH A;  4HKE A;  3HL8 A;  2E6Z A;  1NZ9 A;  2ZPF B;  3ZFJ A;  4C0Z A;  1QP2 A;  5I2S A;  4C8Q G;  4J6W A;  4OVA A;  3J80 E;  5A0D A;  2DZC A;  2Y4X A;  4M77 G;  2E12 A;  4OB0 B;  4J6X A;  4F7U E;  4FU6 A;  3PTA A;  4LD9 K;  1PSE A;  3V7S A;  1HXD A;  3VUB A;  3WVE B;  4ZGE B;  2RH2 A;  1Q7Y C;  4FM4 B;  3CCJ A;  4JRP A;  1BIA A;  4OB3 B;  1UGP B;  3C94 A;  1NJI C;  2QA4 T;  1KD1 C;  3OW2 A;  2KY9 A;  3M5A A;  3NFC A;  3JCM c;  5GAN 7;  3HRU A;  1YIJ A;  1AHJ B;  3WVD B;  3X20 B;  3CXC A;  4M7D C;  3MEW A;  5FU6 C;  1VQM A;  2LCL A;  2XI9 A;  5GMK h;  3X28 B;  3LW5 E;  5C0M A;  1UEB A;  4Y91 A;  3CPF A;  3CMA A;  2WSF E;  4PJO B;  2XKO C;  1N8R C;  1WJQ A;  1N6A A;  4C8Q E;  4R56 A;  3ER0 A;  2Y90 A;  2DXT A;  3H8Z A;  2XDB A;  5GAO r;  3QDR B;  4BI3 A;  3A8H B;  4ZGJ B;  5GAN 4;  1QVG S;  2LT1 A;  1YIT T;  5CKF A;  2F69 A;  2DAQ A;  2RJF A;  5IT9 E;  1VQ7 A;  2JTF A;  1VQK A;  4M7A A;  2DK3 A;  3UPU A;  2MWO A;  1VIE A;  3LYI A;  2OTL A;  1I5L A;  4M7D F;  1Q86 U;  3RMS A;  4XAX B;  3HP9 A;  2JNG A;  3PMI A;  4RMO A;  1H64 1;  3A8L B;  3M56 A;  3OA6 A;  4OB1 B;  4C92 F;  3RKX A;  2M9U A;  4P5N A;  5FLX E;  5CKD A;  1UGS B;  4A53 A;  2PUK B;  5DY9 A;  1W4S A;  5FU7 C;  2R5M A;  1DJ7 B;  4PLL A;  2VGM A;  4C0D C;  1YCY A;  1UGQ B;  1Y96 A;  3HKS A;  3VU3 C;  4M78 C;  5GAM j;  1M1K C;  4M7D B;  2F5T X;  1D3B B;  4JRI A;  4F7U A;  3GIB A;  3V7R A;  1M8V A;  3I55 A;  1YHQ A;  2M0O A;  4BY6 C;  1VQO A;  2QQR A;  3CCQ A;  4M75 A;  2O01 E;  3CCM T;  1KQ2 A;  3MP6 A;  2X4W A;  2QTX A;  3NTI A;  3GNF B;  3VYH B;  1V29 B;  4NOY A;  2OTJ A;  1BIB A;  3QJY A;  4IUU A;  3OB9 A;  1VQL T;  2K57 A;  1KQS S;  4ZTJ A;  4M75 C;  3RMQ A;  2XD0 A;  2EFI A;  4RKU E;  2O4X A;  2D6F A;  2X4Y A;  2RHI A;  3M58 A;  4C8Q A;  4CI0 C;  4M78 F;  5LJ5 j;  4A4G A;  2DXC A;  1OZ3 A;  4JS5 A;  4C8Q C;  1R8O B;  3R6O A;  2ZPB B;  4Q5W A;  3JCM f;  3G6E T;  4M77 C;  1Y7X A;  3FB9 A;  4A54 A;  4XQ3 A;  4ZGD B;  3M4G A;  3I56 A;  4FSX A;  2QQA A;  2YHT A;  3OSS C;  4M7D E;  2CZ7 B;  2VUB A;  1S72 A;  4JRK A;  2XDD A;  2MF2 A;  2RK2 A;  3SWN B;  4BDY A;  1UB4 A;  2DKG A;  3TCJ A;  4ME7 A;  3KUF A;  3G7Z A;  2DTO A;  4C92 E;  2WAC A;  3OSV A;  1XNI A;  4TVR A;  4X9C A;  3OMC A;  4LDX A;  5LJ5 e;  2RJC A;  3OQ5 A;  5AYF A;  4OP0 A;  1U1S A;  2K2V A;  2MMP A;  3MP1 A;  4NL2 A;  4XTW A;  3X24 B;  1QVF A;  3LX7 A;  3JCM d;  3M59 A;  3CBM A;  3P8H A;  3C12 A;  3OYD A;  1O9S A;  4M77 F;  1QP3 A;  3JB9 F;  3OYE A;  3OYH A;  3CC7 T;  1ZQ1 A;  2K5L A;  2RJE A;  3DLM A;  3JCM g;  4BB7 A;  2KSS A;  3PMT A;  4E47 A;  5GAO p;  3LWI A;  4BE2 A;  2K4Y A;  5GAN j;  2MAM A;  1WPY A;  5FU6 B;  4E7I A;  5LJ3 h;  4LDU A;  1YJN A;  1K9M U;  3N5B B;  1Q81 C;  5GAN 5;  3JCM Q;  2P0P A;  3FJP A;  2EIF A;  3M53 A;  1VQ4 T;  2E6N A;  4JLG A;  3S6W A;  1FXX A;  4FIB A;  4QW2 A;  1VQN A;  4JLI A;  2A7Y A;  3JAM E;  3OYC A;  4PJO D;  1YJW A;  1VIF A;  2DJZ A;  2X35 A;  1XOV A;  2ZPE B;  4O6J A;  4DQ2 A;  5M9O A;  3JB9 D;  1K8A U;  3WXM B;  3CD6 A;  5GMK i;  1G3S A;  3MEA A;  4C5G A;  3L2W A;  3LGL A;  5KE3 A;  2PUO B;  5HKC A;  3ZEH A;  5GAO q;  2X4X A;  2V8I A;  3JCM X;  4M78 E;  3JB9 H;  2ZZD A;  4QQD A;  4BE1 A;  2LNV A;  3PNW C;  3OBW A;  4RCC A;  2RHZ A;  3CME A;  2DZ9 A;  3MET A;  1YJ9 T;  4PJO G;  2E65 A;  4JUV A;  2IVW A;  1YIJ T;  3DB3 A;  3JB9 G;  4GLK A;  1VQ5 T;  3QHS A;  2VYT A;  1KHI A;  5A2Q E;  4M7D A;  1VQM T;  2L5Q A;  4KUI A;  3CMA T;  5CCA A;  5FU7 B;  1VQ9 A;  5FRM A;  1BI0 A;  4M75 E;  3S3O A;  4XTY A;  5LJ3 d;  1JJ2 S;  4HCC A;  4C92 A;  4C0D B;  1K73 C;  1VQ8 T;  1LNX A;  1X75 C;  4M78 B;  5FRN A;  2EJ9 A;  3S3M A;  5LJ3 g;  3AHU A;  2RK1 A;  4HT8 A;  4IUV A;  1Q7Y U;  1FWZ A;  2KAF A;  3VKI A;  3OS0 A;  2DD5 A;  2HQE A;  2PVO B;  3QUI A;  4A4H A;  4BY6 B;  3JSC A;  1Y96 B;  4C92 C;  1KD1 U;  4ZN1 A;  4V2S A;  2JVV A;  4PNO A;  4J6Y A;  4F7U B;  3SFM A;  2H3J A;  1B34 A;  2X4J A;  4M77 E;  5GAO l;  3KXT A;  2OTL T;  2E1H A;  3P8B B;  2DVE A;  1QVG A;  1UGR B;  5CQY A;  2L3R A;  4L6V 5;  3OYM A;  1RI0 A;  3HRT A;  4M75 B;  1N8R U;  2DTH A;  2CS7 A;  3L2U A;  5J39 A;  3A5Z B;  2IG0 A;  2EKO A;  3GOX A;  2E64 A;  4QVZ A;  3JCM V;  2RA2 A;  5HK3 A;  2RHX A;  4NS5 A;  3RES A;  3CCE T;  1LOJ A;  2RO0 A;  3BDL A;  4EMH A;  1WJR A;  2O4X B;  2VGN A;  1NPR A;  2RJD A;  3PGG A;  1VQ6 A;  2CYZ B;  4C8Q B;  4E7H A;  4BE0 A;  4M77 B;  3L2Z A;  2ZGW A;  2RB6 A;  3OBY A;  4R55 A;  4DA4 A;  2RI5 A;  2D9T A;  3QSU A;  3OS2 A;  1MGQ A;  3E9G A;  3NTK A;  4CRI A;  2JOY A;  4M78 A;  3L2Q A;  2G3R A;  1JB0 E;  2EAY A;  2RI3 A;  3I55 T;  3L2R A;  1Q86 C;  3OYL A;  5GMK l;  1VQO T;  3CC2 T;  4LDV A;  2V8J A;  3DKM A;  5GAO n;  1O75 A;  1KC8 C;  4JDS A;  5GMK e;  4XU1 A;  3J81 E;  3CPW S;  4DOW A;  2OTJ T;  5EG2 A;  4II1 A;  2JTM A;  2R5A A;  3OS1 A;  4N4I A;  2I2L A;  2GFU A;  3EFR A;  4GY5 A;  3DLL A;  5GAM h;  1M1K U;  4N4G A;  3UDC A;  2BUD A;  5I21 A;  1KQS A;  2DIQ A;  2HD0 A;  1I81 A;  3RIR A;  4OF1 A;  1YI2 T;  2R58 A;  3E1S A;  2KVQ G;  3G4S T;  4JJN K;  3ASK A;  1M90 U;  1H3Z A;  4BDZ A;  4XTU A;  1VQP A;  1G5V A;  1G3W A;  3HRS A;  2VC8 A;  2E10 A;  4IUR A;  3A8G B;  3EAE A;  3GLX A;  4M77 A;  3QKJ A;  1G3T A;  2QQ9 A;  5J26 A;  3HHT B;  2DIG A;  4KUD K;  4J83 A;  4LDW A;  3O8V A;  4HCZ A;  2A3L A;  3QPH A;  3CBP A;  4OMF B;  4N4H A;  2K3Y A;  1U1T A;  3BFM A;  4WF2 A;  5LJ5 h;  5GAN 3;  2K5F A;  2LDM A;  4C0G A;  2EJF A;  2EQM A;  1NPP A;  2K5I A;  4J5Y A;  3E9F A;  4QVC A;  2OAU A;  5HK0 A;  4XTZ A;  5HY6 A;  4MDW A;  2QEX T;  2RHY A;  4A4K A;  3QXE B;  3G71 A;  3CCU A;  2LT4 A;  3QJ6 A;  3GPL A;  4E7L A;  1BYM A;  4VUB A;  4EDU A;  1I4K 1;  2GFA A;  3RER A;  2CZ0 B;  1Q82 U;  4M7A D;  3SDZ A;  4BI8 B;  3INZ A;  3FEO A;  3QZ9 B;  4ZN3 A;  3EFS A;  5GAM g;  3S3N A;  2PVD B;  1VQL A;  4E7J A;  1N9S A;  2RHU A;  2CZ1 B;  4PJO F;  3JCM e;  3JCM J;  1W2B S;  3OYB A;  2D0Q B;  2FB7 A;  5DLO A;  4IUQ A;  2DD4 A;  3GNG A;  4BI4 A;  2EQK A;  2CKK A;  4N0A A;  2EJG A;  2NLU A;  4OB2 B;  3QYG B;  3CC4 T;  3V8J A;  3MO8 A;  1MHN A;  2LQK A;  4C92 B;  2KMT A;  2ZCF B;  4Z02 A;  3V8L A;  3G6E A;  4QQG A;  3FLG A;  4M7A G;  4N0A C;  3MP8 A;  2FYK A;  4A4E A;  5CKH A;  3HSB A;  5DM7 R;  2RM4 A;  5GAN h;  1WQW A;  4EMG A;  3OYJ A;  2KDS A;  5LJ5 g;  2M16 A;  3A8O B;  3OYY A;  4X34 A;  3OS5 A;  3BY7 A;  2AHJ B;  4PLI A;  3RKW A;  5LJ3 f;  5KCO A;  5LJ3 j;  1BI1 A;  1B34 B;  1JBM A;  3LGF A;  3OYK A;  1WJS A;  4M75 D;  1ZBX A;  2YLB A;  1P92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...