3TEKA

Thermodbp: a non-canonical single-stranded dna binding protein with a novel structure and mechanism
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
139
structure length
139
Chain Sequence
RGEVRSELITKGEKKLVLIRWNTGKTSAGRLFGRYGPGGRPEFFKLLFGAVAGSLREQFGPDGENIFNRIRDSEKFRETSRELFDGLKKWFFEEAVPRYNLERGDIFMISTELVLDPDTGELLWNRDKTQLIYWIRSDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Displacement of the canonical single-stranded DNA-binding protein in the Thermoproteales.
pubmed doi rcsb
source organism Thermoproteus tenax
molecule tags Dna binding protein
molecule keywords ThermoDBP-single stranded DNA binding protein
total genus 40
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18361 ssDBP_DBD Single stranded DNA-binding protein ss DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.50 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 3tekA00
3TEKA
chains in the Genus database with same CATH superfamily
3U54A 3NBZB 5CM0A 3LP8A 2QB5A 3TEKA 3UFXB 2FPPB 5K3WA 2GPSA 5I47A 1KJ9A 1IYDA 3W5OA 2ODTX 3VPBA 3G8CA 1KJ8A 1WRVA 4LH7A 1I7LA 2DABA 4ZQIA 4UCOA 2CZGA 2GQRA 4TV9F 2Z02A 3JSNA 2NUAB 5BYBA 2EJ3A 2QK4A 2V58A 3T9DA 1DGSA 3SGIA 1VBGA 2R7LA 5LYJF 3JSLA 1M0TA 1TAEA 2CNQA 1CQJB 4K6NA 1CKMA 3TIIA 3VA7A 3KAJA 3OUUA 4FU0A 5JQGF 3U9TA 4EGJA 1ULZA 5BWUA 2W6NA 2FPIB 1ZAUA 3QFFA 5HV6A 4UCVA 3I12A 2Q2UA 3HT5A 2COIA 5FNVF 2FPGB 4UCUA 5FPOA 1CQIB 3S24A 2COGA 4O86A 5DGHA 2DZDA 2Q2TA 5KKNB 4EGQA 3KYHC 3V4SA 3CSWA 4O2AF 4NZMA 5BPFA 2W6QA 3QWUA 1M0WA 3TY5A 4YAKB 1BXRA 2OWOA 2EIYA 5BWRA 2HVRA 5GONF 2ZDHA 4CKBA 1AUXA 4MV8A 1OBDA 2HG8A 3G8DA 1KJJA 4WHXA 2DIKA 3W1BA 3R23A 4FFLA 1JKJB 4FFNA 1W93A 2Q7DA 3AW8A 2YS6A 2EJ0A 5LA6F 2HHFB 3GLKA 4HNVA 4I50F 4RZQA 4CKEA 2R7KA 3JRWA 2W6PA 4I4TF 3RTXA 5I5VA 3PN1A 1W96A 4FGRA 4EFEA 2V5AA 1ET0A 4PBCA 4YJ3F 3ETHA 5I5WA 1KT8A 2SCUB 2HDKA 3DAAA 4FFMA 4DLKA 4O7NA 3TY9A 4UFZA 2XCLA 5C8YF 1KC7A 1GSOA 4FFRA 4CKCA 4C5CA 2YZLA 2NU8B 2COJA 2EJ2A 3GJXB 3TY8A 4O4IF 4IWXA 4QSHA 5C1PA 3GDEA 3JRXA 3BAAA 4NZNA 1GGOA 2DAAA 1AUVA 2YRWA 3TQTA 5CAEB 4MV1A 4O7VA 2YYAA 3MWDA 3WNZA 4IIJF 3R5HA 4DIMA 4PZ6A 2HIXA 1DAAA 1A9XA 3MJFA 3ETJA 3OUZA 3DF7A 1C30A 3LULA 1XK5A 2X5RA 4O4JF 2YZGA 4YB8B 4M9UA 2FB9A 2QF7A 4TV8F 1CKOA 5K2MA 2PN1A 5CE8A 5HBRB 4O7LA 4DQNA 2GLTA 2PBZA 4MV7A 4I55F 4ME6A 3L2PA 5E25A 1UC9A 4DAAA 5BWTA 4CHIA 5FPRA 2YW2A 4MV6A 3CEBA 2HGXA 3PFFA 4UUGA 3RUPA 5D1PA 3WO1A 4EG0A 1I2KA 1M6VA 5LP6F 3T9CA 2YS7A 5LOVF 4DRFA 2W6OA 5D8DA 1BNCA 3TW6A 3T9FA 1KTAA 5I5XA 2PVPA 1I1MA 5IYZF 2CNVA 1EKPA 1I7NA 4MAMA 2HGWA 1CS0A 4FFPA 1P8LA 1JLLB 4MV4A 5J2TF 4UCTA 1T36A 3RR5A 3TINA 2I80A 1XDNA 5JQWA 1GSAA 5DAAA 4O7RA 5FR9A 5I5YA 4CC6A 3JZFA 5BPHA 4YBZB 4UCSA 4O4HF 3JZ6A 2R85A 4EFBA 2R82A 4E6NA 5I5UA 2GQSA 2VQDA 4MV9A 3AX6A 3W1GA 3BA8A 5D1OA 5J2UF 3MWEA 3TIGA 5KS8A 2ABJA 1PK8A 3RFCA 4CE5A 2C00A 2A1HA 4C5BA 2VUGA 3ORRA 4UCRA 1A3GA 3HBLA 4Q4CA 5BMVF 5CB4F 4FE2A 4PZ8A 5JVLA 5I5SA 5KX5F 4O7TA 4C5AA 4NYEA 3VPDA 3TW7A 3N6RA 3T9BA 2HGSA 3BABA 3K5IA 1I1KA 4HQ6A 4Q4DA 1S68A 2FP4B 2ZDGA 3T9AA 3KAKA 4MA0A 1E4EA 4GLWA 1IYEA 4WBNF 3UQ8A 2NU7B 2CFMA 3WWHA 4CMDA 3LWBA 3NC0B 4TM5A 2R86A 1EHIA 2XD4A 1DV1A 1TA8A 2WYOA 3UZOA 1EKVA 2W71A 2YZNA 1A48A 1Z2PX 5DISC 2HVSA 3ORQA 1I2LA 5I60A 1A0GA 2DLNA 3VMMA 4JXUA 1JDBB 2W6MA 5CA1F 4LH6A 1UC8A 2ZGIA 1B6SA 3BACA 1B6RA 3NBYB 4XX0B 2HVQA 3N8DA 3U0GA 2IP4A 4ZOLF 5CA0F 2NU9B 1EZ1A 3WWJA 1E4EB 1DV2A 3V4ZA 5BYAA 4FFOA 2P0AA 1VKZA 2NU6B 2I8CA 2R84A 2HHFA 3DTFA 3E5NA 5DGIA 2Y4RA 4YAJB 5BWWA 1VBHA 1IOWA 1V9PA 3QQMA 4O7YA 1X9NA 5JVDF 1KJQA 1KUTA 3WO0A 2YZMA 4O7ZA 3R5XA 3LQSA 1DIKA 1GSHA 4MA5A 2R87A 5C1OA 4XYMB 4ZI7F 3HO8A 4YJ2F 3KREA 4O4LF 4E4TA 5D1OB 3KALA 3UZBA 2OLSA 4NZOA 2CNUA 3VPCA 3T99A 2W70A 4IZOA 2YRXA 4EEQA 4MV3A 4O7WA 5CR5A 5BWXA 4XYLB 2GPWA 2ZDQA 3SNOA 3DTGA 1SCUB 4O83A 3T54A 5EZYF 1CKNA 1OBGA 3Q2OA 3GIDA 3K5HA 4O7SA 1PX2A 5H80A 4TUYF 5BWVA 4GLXA 5LXTF 2W6ZA 4RCNA 1EUDB 4O84A 4EQ5A 1C3OA 1KBLA 4L1KA 4CMFA 3VOTA 3U55A 1KJIA 5DMXA 2R7MA 4ZHQF 3K3PA 4CC5A 3U9SA 3R5FA 1JDEA 1A0IA 2VR1A 4TVIA 3RV4A 3NUAA 3BA9A 1Z2OX 1GLVA 4O2BF 1B04A 2YWVA 3WWIA 4IHJF 3BG5A 3HB9A 2YL2A 4IWYA 1G2WA 1Z2NX 1EKFA 3VNNA 5JH7F 1I1LA 2V59A 1VS0A 2J9GA 4O81A 1KEEA 1EYZA 1P16A 1CKNB 3Q1KA 5I5TA 3T9EA 2X0SA 5HNEA 4HNTA 2R7NA 4M0JA 3SE7A 4Y8VB 4PZ7A 2DWCA 1EUCB 4O82A 1WR2A 4XZ3B 3UYYA 4HNUA 2Z04A 4HN2A 3R9RA 1CE8A 2HIVA 3GB8B 2I87A 2VPQA 3T7AA 1FVIA 1IOVA 3JZIA 3RV3A 4HR7A 2HJWA
chains in the Genus database with same CATH topology
5I5VA 5CM0A 2QB5A 3TEKA 5DAAA 5FR9A 5I5YA 5K3WA 1ET0A 3JZ6A 5I47A 4PBCA 1IYDA 3UZBA 4NZOA 5I5WA 1KT8A 3DAAA 2HDKA 5I5UA 2ODTX 3T99A 5CR5A 5BWXA 1WRVA 4CKCA 5KS8A 3SNOA 2ABJA 2DABA 3DTGA 2COJA 2EJ2A 4CE5A 3T54A 4IWXA 2A1HA 4NZNA 1A3GA 2DAAA 4Q4CA 5BYBA 2EJ3A 5BWVA 3T9DA 3SGIA 5I5SA 1DAAA 4RCNA 4K6NA 3VPDA 3TW7A 3T9BA 1I1KA 4CMFA 4Q4DA 3LULA 3T9AA 5BWUA 2X5RA 1ZAUA 4GLWA 1IYEA 3HT5A 2COIA 3WWHA 4CMDA 2COGA 5CE8A 4TM5A 5K2MA 4DQNA 5DGHA 4TVIA 3UZOA 1EKVA 3CSWA 4NZMA 5E25A 1I2LA 1UC9A 5I60A 3WWIA 1A0GA 4DAAA 5BWTA 2EIYA 4JXUA 4CHIA 4IWYA 3CEBA 2HGXA 1UC8A 2ZGIA 3PFFA 4UUGA 5BWRA 1G2WA 1I2KA 3BACA 1EKFA 3U0GA 4CKBA 2HG8A 3T9CA 4WHXA 3WWJA 1I1LA 5BYAA 5I5TA 2Q7DA 3T9EA 3T9FA 1KTAA 5I5XA 5HNEA 2HHFA 4M0JA 1I1MA 3DTFA 5DGIA 2EJ0A 2Y4RA 3UYYA 1EKPA 5BWWA 2HHFB 4HN2A 2HGWA 3QQMA 4CKEA 3T7AA 3LQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TEK A; 
#chains in the Genus database with same CATH topology
 3U54 A;  3NBZ B;  5CM0 A;  3LP8 A;  2QB5 A;  3TEK A;  3UFX B;  2FPP B;  5K3W A;  2GPS A;  5I47 A;  1KJ9 A;  1IYD A;  3W5O A;  2ODT X;  3VPB A;  3G8C A;  1KJ8 A;  1WRV A;  4LH7 A;  1I7L A;  2DAB A;  4ZQI A;  4UCO A;  2CZG A;  2GQR A;  4TV9 F;  2Z02 A;  3JSN A;  2NUA B;  5BYB A;  2EJ3 A;  2QK4 A;  2V58 A;  3T9D A;  1DGS A;  3SGI A;  1VBG A;  2R7L A;  5LYJ F;  3JSL A;  1M0T A;  1TAE A;  2CNQ A;  1CQJ B;  4K6N A;  1CKM A;  3TII A;  3VA7 A;  3KAJ A;  3OUU A;  4FU0 A;  5JQG F;  3U9T A;  4EGJ A;  1ULZ A;  5BWU A;  2W6N A;  2FPI B;  1ZAU A;  3QFF A;  5HV6 A;  4UCV A;  3I12 A;  2Q2U A;  3HT5 A;  2COI A;  5FNV F;  2FPG B;  4UCU A;  5FPO A;  1CQI B;  3S24 A;  2COG A;  4O86 A;  5DGH A;  2DZD A;  2Q2T A;  5KKN B;  4EGQ A;  3KYH C;  3V4S A;  3CSW A;  4O2A F;  4NZM A;  5BPF A;  2W6Q A;  3QWU A;  1M0W A;  3TY5 A;  4YAK B;  1BXR A;  2OWO A;  2EIY A;  5BWR A;  2HVR A;  5GON F;  2ZDH A;  4CKB A;  1AUX A;  4MV8 A;  1OBD A;  2HG8 A;  3G8D A;  1KJJ A;  4WHX A;  2DIK A;  3W1B A;  3R23 A;  4FFL A;  1JKJ B;  4FFN A;  1W93 A;  2Q7D A;  3AW8 A;  2YS6 A;  2EJ0 A;  5LA6 F;  2HHF B;  3GLK A;  4HNV A;  4I50 F;  4RZQ A;  4CKE A;  2R7K A;  3JRW A;  2W6P A;  4I4T F;  3RTX A;  5I5V A;  3PN1 A;  1W96 A;  4FGR A;  4EFE A;  2V5A A;  1ET0 A;  4PBC A;  4YJ3 F;  3ETH A;  5I5W A;  1KT8 A;  2SCU B;  2HDK A;  3DAA A;  4FFM A;  4DLK A;  4O7N A;  3TY9 A;  4UFZ A;  2XCL A;  5C8Y F;  1KC7 A;  1GSO A;  4FFR A;  4CKC A;  4C5C A;  2YZL A;  2NU8 B;  2COJ A;  2EJ2 A;  3GJX B;  3TY8 A;  4O4I F;  4IWX A;  4QSH A;  5C1P A;  3GDE A;  3JRX A;  3BAA A;  4NZN A;  1GGO A;  2DAA A;  1AUV A;  2YRW A;  3TQT A;  5CAE B;  4MV1 A;  4O7V A;  2YYA A;  3MWD A;  3WNZ A;  4IIJ F;  3R5H A;  4DIM A;  4PZ6 A;  2HIX A;  1DAA A;  1A9X A;  3MJF A;  3ETJ A;  3OUZ A;  3DF7 A;  1C30 A;  3LUL A;  1XK5 A;  2X5R A;  4O4J F;  2YZG A;  4YB8 B;  4M9U A;  2FB9 A;  2QF7 A;  4TV8 F;  1CKO A;  5K2M A;  2PN1 A;  5CE8 A;  5HBR B;  4O7L A;  4DQN A;  2GLT A;  2PBZ A;  4MV7 A;  4I55 F;  4ME6 A;  3L2P A;  5E25 A;  1UC9 A;  4DAA A;  5BWT A;  4CHI A;  5FPR A;  2YW2 A;  4MV6 A;  3CEB A;  2HGX A;  3PFF A;  4UUG A;  3RUP A;  5D1P A;  3WO1 A;  4EG0 A;  1I2K A;  1M6V A;  5LP6 F;  3T9C A;  2YS7 A;  5LOV F;  4DRF A;  2W6O A;  5D8D A;  1BNC A;  3TW6 A;  3T9F A;  1KTA A;  5I5X A;  2PVP A;  1I1M A;  5IYZ F;  2CNV A;  1EKP A;  1I7N A;  4MAM A;  2HGW A;  1CS0 A;  4FFP A;  1P8L A;  1JLL B;  4MV4 A;  5J2T F;  4UCT A;  1T36 A;  3RR5 A;  3TIN A;  2I80 A;  1XDN A;  5JQW A;  1GSA A;  5DAA A;  4O7R A;  5FR9 A;  5I5Y A;  4CC6 A;  3JZF A;  5BPH A;  4YBZ B;  4UCS A;  4O4H F;  3JZ6 A;  2R85 A;  4EFB A;  2R82 A;  4E6N A;  5I5U A;  2GQS A;  2VQD A;  4MV9 A;  3AX6 A;  3W1G A;  3BA8 A;  5D1O A;  5J2U F;  3MWE A;  3TIG A;  5KS8 A;  2ABJ A;  1PK8 A;  3RFC A;  4CE5 A;  2C00 A;  2A1H A;  4C5B A;  2VUG A;  3ORR A;  4UCR A;  1A3G A;  3HBL A;  4Q4C A;  5BMV F;  5CB4 F;  4FE2 A;  4PZ8 A;  5JVL A;  5I5S A;  5KX5 F;  4O7T A;  4C5A A;  4NYE A;  3VPD A;  3TW7 A;  3N6R A;  3T9B A;  2HGS A;  3BAB A;  3K5I A;  1I1K A;  4HQ6 A;  4Q4D A;  1S68 A;  2FP4 B;  2ZDG A;  3T9A A;  3KAK A;  4MA0 A;  1E4E A;  4GLW A;  1IYE A;  4WBN F;  3UQ8 A;  2NU7 B;  2CFM A;  3WWH A;  4CMD A;  3LWB A;  3NC0 B;  4TM5 A;  2R86 A;  1EHI A;  2XD4 A;  1DV1 A;  1TA8 A;  2WYO A;  3UZO A;  1EKV A;  2W71 A;  2YZN A;  1A48 A;  1Z2P X;  5DIS C;  2HVS A;  3ORQ A;  1I2L A;  5I60 A;  1A0G A;  2DLN A;  3VMM A;  4JXU A;  1JDB B;  2W6M A;  5CA1 F;  4LH6 A;  1UC8 A;  2ZGI A;  1B6S A;  3BAC A;  1B6R A;  3NBY B;  4XX0 B;  2HVQ A;  3N8D A;  3U0G A;  2IP4 A;  4ZOL F;  5CA0 F;  2NU9 B;  1EZ1 A;  3WWJ A;  1E4E B;  1DV2 A;  3V4Z A;  5BYA A;  4FFO A;  2P0A A;  1VKZ A;  2NU6 B;  2I8C A;  2R84 A;  2HHF A;  3DTF A;  3E5N A;  5DGI A;  2Y4R A;  4YAJ B;  5BWW A;  1VBH A;  1IOW A;  1V9P A;  3QQM A;  4O7Y A;  1X9N A;  5JVD F;  1KJQ A;  1KUT A;  3WO0 A;  2YZM A;  4O7Z A;  3R5X A;  3LQS A;  1DIK A;  1GSH A;  4MA5 A;  2R87 A;  5C1O A;  4XYM B;  4ZI7 F;  3HO8 A;  4YJ2 F;  3KRE A;  4O4L F;  4E4T A;  5D1O B;  3KAL A;  3UZB A;  2OLS A;  4NZO A;  2CNU A;  3VPC A;  3T99 A;  2W70 A;  4IZO A;  2YRX A;  4EEQ A;  4MV3 A;  4O7W A;  5CR5 A;  5BWX A;  4XYL B;  2GPW A;  2ZDQ A;  3SNO A;  3DTG A;  1SCU B;  4O83 A;  3T54 A;  5EZY F;  1CKN A;  1OBG A;  3Q2O A;  3GID A;  3K5H A;  4O7S A;  1PX2 A;  5H80 A;  4TUY F;  5BWV A;  4GLX A;  5LXT F;  2W6Z A;  4RCN A;  1EUD B;  4O84 A;  4EQ5 A;  1C3O A;  1KBL A;  4L1K A;  4CMF A;  3VOT A;  3U55 A;  1KJI A;  5DMX A;  2R7M A;  4ZHQ F;  3K3P A;  4CC5 A;  3U9S A;  3R5F A;  1JDE A;  1A0I A;  2VR1 A;  4TVI A;  3RV4 A;  3NUA A;  3BA9 A;  1Z2O X;  1GLV A;  4O2B F;  1B04 A;  2YWV A;  3WWI A;  4IHJ F;  3BG5 A;  3HB9 A;  2YL2 A;  4IWY A;  1G2W A;  1Z2N X;  1EKF A;  3VNN A;  5JH7 F;  1I1L A;  2V59 A;  1VS0 A;  2J9G A;  4O81 A;  1KEE A;  1EYZ A;  1P16 A;  1CKN B;  3Q1K A;  5I5T A;  3T9E A;  2X0S A;  5HNE A;  4HNT A;  2R7N A;  4M0J A;  3SE7 A;  4Y8V B;  4PZ7 A;  2DWC A;  1EUC B;  4O82 A;  1WR2 A;  4XZ3 B;  3UYY A;  4HNU A;  2Z04 A;  4HN2 A;  3R9R A;  1CE8 A;  2HIV A;  3GB8 B;  2I87 A;  2VPQ A;  3T7A A;  1FVI A;  1IOV A;  3JZI A;  3RV3 A;  4HR7 A;  2HJW A; 
#chains in the Genus database with same CATH homology
 5I5V A;  5CM0 A;  2QB5 A;  3TEK A;  5DAA A;  5FR9 A;  5I5Y A;  5K3W A;  1ET0 A;  3JZ6 A;  5I47 A;  4PBC A;  1IYD A;  3UZB A;  4NZO A;  5I5W A;  1KT8 A;  3DAA A;  2HDK A;  5I5U A;  2ODT X;  3T99 A;  5CR5 A;  5BWX A;  1WRV A;  4CKC A;  5KS8 A;  3SNO A;  2ABJ A;  2DAB A;  3DTG A;  2COJ A;  2EJ2 A;  4CE5 A;  3T54 A;  4IWX A;  2A1H A;  4NZN A;  1A3G A;  2DAA A;  4Q4C A;  5BYB A;  2EJ3 A;  5BWV A;  3T9D A;  3SGI A;  5I5S A;  1DAA A;  4RCN A;  4K6N A;  3VPD A;  3TW7 A;  3T9B A;  1I1K A;  4CMF A;  4Q4D A;  3LUL A;  3T9A A;  5BWU A;  2X5R A;  1ZAU A;  4GLW A;  1IYE A;  3HT5 A;  2COI A;  3WWH A;  4CMD A;  2COG A;  5CE8 A;  4TM5 A;  5K2M A;  4DQN A;  5DGH A;  4TVI A;  3UZO A;  1EKV A;  3CSW A;  4NZM A;  5E25 A;  1I2L A;  1UC9 A;  5I60 A;  3WWI A;  1A0G A;  4DAA A;  5BWT A;  2EIY A;  4JXU A;  4CHI A;  4IWY A;  3CEB A;  2HGX A;  1UC8 A;  2ZGI A;  3PFF A;  4UUG A;  5BWR A;  1G2W A;  1I2K A;  3BAC A;  1EKF A;  3U0G A;  4CKB A;  2HG8 A;  3T9C A;  4WHX A;  3WWJ A;  1I1L A;  5BYA A;  5I5T A;  2Q7D A;  3T9E A;  3T9F A;  1KTA A;  5I5X A;  5HNE A;  2HHF A;  4M0J A;  1I1M A;  3DTF A;  5DGI A;  2EJ0 A;  2Y4R A;  3UYY A;  1EKP A;  5BWW A;  2HHF B;  4HN2 A;  2HGW A;  3QQM A;  4CKE A;  3T7A A;  3LQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...