3TEKA

Thermodbp: a non-canonical single-stranded dna binding protein with a novel structure and mechanism
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
139
structure length
139
Chain Sequence
b'RGEVRSELITKGEKKLVLIRWNTGKTSAGRLFGRYGPGGRPEFFKLLFGAVAGSLREQFGPDGENIFNRIRDSEKFRETSRELFDGLKKWFFEEAVPRYNLERGDIFMISTELVLDPDTGELLWNRDKTQLIYWIRSDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ThermoDBP-single stranded DNA binding protein
publication title Displacement of the canonical single-stranded DNA-binding protein in the Thermoproteales.
pubmed doi rcsb
source organism Thermoproteus tenax
molecule tags Dna binding protein
total genus 40
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18361 ssDBP_DBD Single stranded DNA-binding protein ss DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.50 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 D-amino Acid Aminotransferase; Chain A, domain 1 3tekA00
3TEKA
chains in the Genus database with same CATH superfamily
3GJXB 5I5XA 1IOWA 4NZOA 1GSAA 1KJ9A 3TW6A 3T9AA 3TQTA 2XD4A 1GSOA 5JH7F 3TEKA 1CKNA 2ABJA 1JKJB 4XZ3B 2EJ3A 4MV3A 5DGHA 1OBGA 2YRWA 5JVDF 4IIJF 3U0GA 3N8DA 2DZDA 5CA1F 4L1KA 2OLSA 5CM0A 4TM5A 2R7MA 3UFXB 4ME6A 1EKFA 4K6NA 4DAAA 1XDNA 2YYAA 2CNQA 2HVQA 4IWYA 2NU6B 4O7LA 2R87A 1KJIA 1I2LA 4QSHA 5K3WA 3S24A 2YRXA 1DV1A 2ZDHA 2W6QA 5EZYF 3WO1A 1CKOA 1VS0A 2YS7A 3CSWA 1W93A 3T9EA 2COGA 5BMVF 2Q2TA 2YZLA 3QFFA 3VPBA 5CA0F 2HHFA 3JZ6A 3TY9A 3MJFA 1DIKA 5BWWA 2R85A 3OUZA 1CS0A 4FFMA 1GGOA 3KREA 5I5TA 2C00A 2DIKA 1P16A 2ZDQA 2Y4RA 4CC6A 2ODTX 2NU9B 1IYEA 2HDKA 3T9BA 3KAJA 5DISC 2PVPA 3LQSA 5I5YA 2XCLA 5IYZF 5LYJF 3DF7A 4HR7A 5HBRB 4I50F 4TVIA 1A0GA 1JDBB 3GLKA 4O7ZA 4M0JA 2GPSA 4O7SA 4CE5A 5BWXA 2W71A 1I7NA 4HN2A 1M0WA 3N6RA 3Q1KA 2R82A 1JLLB 5I47A 3ETHA 2V58A 1FVIA 1WR2A 4MV8A 5BWRA 1KT8A 3DTGA 3QQMA 2FPPB 3VOTA 3PN1A 4E4TA 1S68A 4ZQIA 3UQ8A 5H80A 3BA8A 3WWJA 4EEQA 1B6RA 4XYMB 2HG8A 3TINA 3BAAA 4FFOA 2R7LA 3VNNA 3BG5A 5BWTA 5JQGF 1EYZA 5DGIA 2HIVA 3WO0A 3MWEA 4O4LF 3TIGA 3UZBA 2W70A 3HB9A 5KX5F 2DWCA 4O7RA 4NZNA 1CE8A 3LP8A 1KEEA 3QWUA 3DTFA 1ZAUA 1IYDA 1EUCB 3OUUA 2QK4A 3BABA 4LH6A 4FU0A 2VR1A 3HO8A 5HV6A 3I12A 2QB5A 2GQRA 2Z04A 5K2MA 2V59A 4O4HF 5KKNB 5KS8A 2Q2UA 2YZMA 1XK5A 3DAAA 2J9GA 1A0IA 3G8DA 2A1HA 4MA0A 4O7NA 4CKCA 1G2WA 2HGSA 4JXUA 4E6NA 1KJQA 4ZOLF 3NBZB 5D1OB 2W6OA 2YWVA 3BA9A 4CC5A 4UCTA 1EZ1A 2QF7A 1DV2A 4WBNF 2V5AA 4FFPA 3G8CA 4PBCA 1BXRA 3KYHC 5I60A 1CQIB 4MV1A 4IWXA 1JDEA 3Q2OA 4EGQA 5GONF 3JZFA 2NU8B 3V4SA 4C5CA 4CHIA 3R5HA 3MWDA 1KC7A 2IP4A 4M9UA 4RCNA 2VPQA 4O83A 2DLNA 2GLTA 4EQ5A 1A3GA 1KUTA 4FE2A 4C5AA 1AUVA 2COJA 4O86A 3UYYA 2YW2A 1E4EA 2FPIB 2ZGIA 3CEBA 3AW8A 4CKBA 5I5UA 2HVSA 2FP4B 4Q4DA 2ZDGA 1KJ8A 3T7AA 3JRXA 3W5OA 1VBHA 3ETJA 3VPDA 3T54A 2I8CA 3JSLA 2FPGB 1OBDA 4YAJB 2EIYA 2YL2A 5LOVF 2SCUB 2X0SA 2YS6A 5I5VA 1TA8A 4O7VA 3NUAA 4FGRA 3TY5A 5JVLA 3RTXA 5BYAA 3W1GA 5C1PA 1ULZA 4XX0B 4MV4A 5C1OA 4DQNA 5DMXA 3K5HA 4CMDA 5CR5A 2EJ0A 5DAAA 3TY8A 1Z2OX 4HNVA 3WNZA 4TV8F 5BYBA 1SCUB 3K3PA 3VPCA 2W6PA 3GB8B 3ORQA 3RR5A 3U9TA 5LP6F 3RUPA 1C3OA 4CKEA 4XYLB 4O84A 2I80A 1DGSA 2I87A 4EFBA 4EFEA 3GDEA 4HQ6A 2OWOA 3BACA 2CNVA 3R23A 4FFRA 4O82A 4Y8VB 5CB4F 3T9CA 1Z2PX 4FFNA 5I5SA 5LXTF 1V9PA 4UCRA 3L2PA 3GIDA 5FPOA 2HVRA 5C8YF 4PZ7A 1KBLA 2VUGA 1CKMA 2Q7DA 4C5BA 5BPHA 3U9SA 2WYOA 1Z2NX 1C30A 4YBZB 1CKNB 1I7LA 1KTAA 2DAAA 4PZ6A 5I5WA 1ET0A 5FNVF 3W1BA 4TV9F 5FR9A 1CQJB 1B04A 2W6ZA 4CMFA 4O4IF 3LULA 3SGIA 1B6SA 3AX6A 4ZHQF 3V4ZA 3KAKA 2HGXA 2FB9A 2DABA 4UUGA 1GLVA 4O4JF 3WWIA 4UCOA 1KJJA 5CAEB 3NBYB 3RV3A 4NZMA 4GLWA 5D1OA 2GPWA 3LWBA 4FFLA 4UFZA 4O7TA 1PX2A 4O2AF 4MV6A 1VKZA 5FPRA 5LA6F 5JQWA 2W6NA 3RFCA 3NC0B 3SE7A 2R7NA 3TW7A 2HHFB 2NU7B 2CZGA 4O7YA 4WHXA 5CE8A 3VMMA 4MAMA 2HJWA 5BWVA 1E4EB 3KALA 4YAKB 5D8DA 5BWUA 4EGJA 3HT5A 2HGWA 2HIXA 1I1LA 2R84A 3WWHA 2R7KA 2P0AA 4O81A 2COIA 3U55A 1A9XA 3ORRA 2NUAB 4RZQA 2W6MA 1WRVA 3PFFA 4TUYF 3R9RA 1I2KA 3SNOA 3JZIA 4YJ2F 5E25A 3UZOA 3T99A 4Q4CA 4IZOA 1A48A 2PN1A 3JRWA 1EHIA 4PZ8A 4NYEA 4UCSA 1BNCA 2YZNA 3K5IA 3R5FA 1UC9A 3R5XA 3JSNA 1DAAA 4O2BF 4DLKA 4UCUA 2PBZA 4EG0A 3T9FA 1T36A 3TIIA 1EKVA 1UC8A 4DRFA 1EUDB 4ZI7F 2X5RA 1M6VA 2EJ2A 3U54A 4IHJF 1I1MA 2R86A 3RV4A 1GSHA 5HNEA 4HNTA 2CFMA 4UCVA 1X9NA 4DIMA 4LH7A 2CNUA 1IOVA 4O7WA 4I4TF 4MV7A 2Z02A 2YZGA 4I55F 3T9DA 1VBGA 2GQSA 1W96A 2VQDA 1TAEA 1AUXA 4MA5A 1I1KA 5BPFA 5D1PA 1M0TA 4YJ3F 4MV9A 5J2UF 4GLXA 1PK8A 4YB8B 1EKPA 3E5NA 1P8LA 3HBLA 3VA7A 5J2TF 4HNUA
chains in the Genus database with same CATH topology
5I5VA 5I5XA 5BWTA 4NZOA 5DGIA 3T9AA 3TW7A 5BYAA 2HHFB 3TEKA 3UZBA 2ABJA 4WHXA 4DQNA 5CE8A 2EJ3A 4CMDA 4NZNA 5CR5A 2EJ0A 5BWVA 5DGHA 5DAAA 5BWUA 3DTFA 3HT5A 1ZAUA 1IYDA 2HGWA 1I1LA 3WWHA 5BYBA 3U0GA 2COIA 5CM0A 4TM5A 2QB5A 1EKFA 4K6NA 1WRVA 4DAAA 3PFFA 1I2KA 5K2MA 4IWYA 3SNOA 5E25A 4CKEA 1I2LA 5K3WA 5KS8A 3UZOA 3T99A 4Q4CA 3DAAA 3BACA 2A1HA 3CSWA 3T9EA 4CKCA 1G2WA 2COGA 4JXUA 1UC9A 3T9CA 5I5SA 1DAAA 2HHFA 3JZ6A 5BWWA 3T9FA 5I5TA 1EKVA 1UC8A 2X5RA 4PBCA 2Y4RA 2EJ2A 5I60A 4IWXA 2Q7DA 2ODTX 1IYEA 1I1MA 2HDKA 1KTAA 4CHIA 2DAAA 5HNEA 3T9BA 5I5WA 3LQSA 1ET0A 5I5YA 4RCNA 5FR9A 4TVIA 1A0GA 4CMFA 4M0JA 1A3GA 4CE5A 3T9DA 5BWXA 3LULA 3SGIA 2COJA 4HN2A 3UYYA 2ZGIA 3CEBA 2HGXA 1I1KA 4CKBA 2DABA 4UUGA 5I5UA 4Q4DA 3WWIA 5I47A 3T7AA 3VPDA 5BWRA 1KT8A 3DTGA 3T54A 4NZMA 3QQMA 4GLWA 1EKPA 2EIYA 3WWJA 2HG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TEK A; 
#chains in the Genus database with same CATH topology
 3GJX B;  5I5X A;  1IOW A;  4NZO A;  1GSA A;  1KJ9 A;  3TW6 A;  3T9A A;  3TQT A;  2XD4 A;  1GSO A;  5JH7 F;  3TEK A;  1CKN A;  2ABJ A;  1JKJ B;  4XZ3 B;  2EJ3 A;  4MV3 A;  5DGH A;  1OBG A;  2YRW A;  5JVD F;  4IIJ F;  3U0G A;  3N8D A;  2DZD A;  5CA1 F;  4L1K A;  2OLS A;  5CM0 A;  4TM5 A;  2R7M A;  3UFX B;  4ME6 A;  1EKF A;  4K6N A;  4DAA A;  1XDN A;  2YYA A;  2CNQ A;  2HVQ A;  4IWY A;  2NU6 B;  4O7L A;  2R87 A;  1KJI A;  1I2L A;  4QSH A;  5K3W A;  3S24 A;  2YRX A;  1DV1 A;  2ZDH A;  2W6Q A;  5EZY F;  3WO1 A;  1CKO A;  1VS0 A;  2YS7 A;  3CSW A;  1W93 A;  3T9E A;  2COG A;  5BMV F;  2Q2T A;  2YZL A;  3QFF A;  3VPB A;  5CA0 F;  2HHF A;  3JZ6 A;  3TY9 A;  3MJF A;  1DIK A;  5BWW A;  2R85 A;  3OUZ A;  1CS0 A;  4FFM A;  1GGO A;  3KRE A;  5I5T A;  2C00 A;  2DIK A;  1P16 A;  2ZDQ A;  2Y4R A;  4CC6 A;  2ODT X;  2NU9 B;  1IYE A;  2HDK A;  3T9B A;  3KAJ A;  5DIS C;  2PVP A;  3LQS A;  5I5Y A;  2XCL A;  5IYZ F;  5LYJ F;  3DF7 A;  4HR7 A;  5HBR B;  4I50 F;  4TVI A;  1A0G A;  1JDB B;  3GLK A;  4O7Z A;  4M0J A;  2GPS A;  4O7S A;  4CE5 A;  5BWX A;  2W71 A;  1I7N A;  4HN2 A;  1M0W A;  3N6R A;  3Q1K A;  2R82 A;  1JLL B;  5I47 A;  3ETH A;  2V58 A;  1FVI A;  1WR2 A;  4MV8 A;  5BWR A;  1KT8 A;  3DTG A;  3QQM A;  2FPP B;  3VOT A;  3PN1 A;  4E4T A;  1S68 A;  4ZQI A;  3UQ8 A;  5H80 A;  3BA8 A;  3WWJ A;  4EEQ A;  1B6R A;  4XYM B;  2HG8 A;  3TIN A;  3BAA A;  4FFO A;  2R7L A;  3VNN A;  3BG5 A;  5BWT A;  5JQG F;  1EYZ A;  5DGI A;  2HIV A;  3WO0 A;  3MWE A;  4O4L F;  3TIG A;  3UZB A;  2W70 A;  3HB9 A;  5KX5 F;  2DWC A;  4O7R A;  4NZN A;  1CE8 A;  3LP8 A;  1KEE A;  3QWU A;  3DTF A;  1ZAU A;  1IYD A;  1EUC B;  3OUU A;  2QK4 A;  3BAB A;  4LH6 A;  4FU0 A;  2VR1 A;  3HO8 A;  5HV6 A;  3I12 A;  2QB5 A;  2GQR A;  2Z04 A;  5K2M A;  2V59 A;  4O4H F;  5KKN B;  5KS8 A;  2Q2U A;  2YZM A;  1XK5 A;  3DAA A;  2J9G A;  1A0I A;  3G8D A;  2A1H A;  4MA0 A;  4O7N A;  4CKC A;  1G2W A;  2HGS A;  4JXU A;  4E6N A;  1KJQ A;  4ZOL F;  3NBZ B;  5D1O B;  2W6O A;  2YWV A;  3BA9 A;  4CC5 A;  4UCT A;  1EZ1 A;  2QF7 A;  1DV2 A;  4WBN F;  2V5A A;  4FFP A;  3G8C A;  4PBC A;  1BXR A;  3KYH C;  5I60 A;  1CQI B;  4MV1 A;  4IWX A;  1JDE A;  3Q2O A;  4EGQ A;  5GON F;  3JZF A;  2NU8 B;  3V4S A;  4C5C A;  4CHI A;  3R5H A;  3MWD A;  1KC7 A;  2IP4 A;  4M9U A;  4RCN A;  2VPQ A;  4O83 A;  2DLN A;  2GLT A;  4EQ5 A;  1A3G A;  1KUT A;  4FE2 A;  4C5A A;  1AUV A;  2COJ A;  4O86 A;  3UYY A;  2YW2 A;  1E4E A;  2FPI B;  2ZGI A;  3CEB A;  3AW8 A;  4CKB A;  5I5U A;  2HVS A;  2FP4 B;  4Q4D A;  2ZDG A;  1KJ8 A;  3T7A A;  3JRX A;  3W5O A;  1VBH A;  3ETJ A;  3VPD A;  3T54 A;  2I8C A;  3JSL A;  2FPG B;  1OBD A;  4YAJ B;  2EIY A;  2YL2 A;  5LOV F;  2SCU B;  2X0S A;  2YS6 A;  5I5V A;  1TA8 A;  4O7V A;  3NUA A;  4FGR A;  3TY5 A;  5JVL A;  3RTX A;  5BYA A;  3W1G A;  5C1P A;  1ULZ A;  4XX0 B;  4MV4 A;  5C1O A;  4DQN A;  5DMX A;  3K5H A;  4CMD A;  5CR5 A;  2EJ0 A;  5DAA A;  3TY8 A;  1Z2O X;  4HNV A;  3WNZ A;  4TV8 F;  5BYB A;  1SCU B;  3K3P A;  3VPC A;  2W6P A;  3GB8 B;  3ORQ A;  3RR5 A;  3U9T A;  5LP6 F;  3RUP A;  1C3O A;  4CKE A;  4XYL B;  4O84 A;  2I80 A;  1DGS A;  2I87 A;  4EFB A;  4EFE A;  3GDE A;  4HQ6 A;  2OWO A;  3BAC A;  2CNV A;  3R23 A;  4FFR A;  4O82 A;  4Y8V B;  5CB4 F;  3T9C A;  1Z2P X;  4FFN A;  5I5S A;  5LXT F;  1V9P A;  4UCR A;  3L2P A;  3GID A;  5FPO A;  2HVR A;  5C8Y F;  4PZ7 A;  1KBL A;  2VUG A;  1CKM A;  2Q7D A;  4C5B A;  5BPH A;  3U9S A;  2WYO A;  1Z2N X;  1C30 A;  4YBZ B;  1CKN B;  1I7L A;  1KTA A;  2DAA A;  4PZ6 A;  5I5W A;  1ET0 A;  5FNV F;  3W1B A;  4TV9 F;  5FR9 A;  1CQJ B;  1B04 A;  2W6Z A;  4CMF A;  4O4I F;  3LUL A;  3SGI A;  1B6S A;  3AX6 A;  4ZHQ F;  3V4Z A;  3KAK A;  2HGX A;  2FB9 A;  2DAB A;  4UUG A;  1GLV A;  4O4J F;  3WWI A;  4UCO A;  1KJJ A;  5CAE B;  3NBY B;  3RV3 A;  4NZM A;  4GLW A;  5D1O A;  2GPW A;  3LWB A;  4FFL A;  4UFZ A;  4O7T A;  1PX2 A;  4O2A F;  4MV6 A;  1VKZ A;  5FPR A;  5LA6 F;  5JQW A;  2W6N A;  3RFC A;  3NC0 B;  3SE7 A;  2R7N A;  3TW7 A;  2HHF B;  2NU7 B;  2CZG A;  4O7Y A;  4WHX A;  5CE8 A;  3VMM A;  4MAM A;  2HJW A;  5BWV A;  1E4E B;  3KAL A;  4YAK B;  5D8D A;  5BWU A;  4EGJ A;  3HT5 A;  2HGW A;  2HIX A;  1I1L A;  2R84 A;  3WWH A;  2R7K A;  2P0A A;  4O81 A;  2COI A;  3U55 A;  1A9X A;  3ORR A;  2NUA B;  4RZQ A;  2W6M A;  1WRV A;  3PFF A;  4TUY F;  3R9R A;  1I2K A;  3SNO A;  3JZI A;  4YJ2 F;  5E25 A;  3UZO A;  3T99 A;  4Q4C A;  4IZO A;  1A48 A;  2PN1 A;  3JRW A;  1EHI A;  4PZ8 A;  4NYE A;  4UCS A;  1BNC A;  2YZN A;  3K5I A;  3R5F A;  1UC9 A;  3R5X A;  3JSN A;  1DAA A;  4O2B F;  4DLK A;  4UCU A;  2PBZ A;  4EG0 A;  3T9F A;  1T36 A;  3TII A;  1EKV A;  1UC8 A;  4DRF A;  1EUD B;  4ZI7 F;  2X5R A;  1M6V A;  2EJ2 A;  3U54 A;  4IHJ F;  1I1M A;  2R86 A;  3RV4 A;  1GSH A;  5HNE A;  4HNT A;  2CFM A;  4UCV A;  1X9N A;  4DIM A;  4LH7 A;  2CNU A;  1IOV A;  4O7W A;  4I4T F;  4MV7 A;  2Z02 A;  2YZG A;  4I55 F;  3T9D A;  1VBG A;  2GQS A;  1W96 A;  2VQD A;  1TAE A;  1AUX A;  4MA5 A;  1I1K A;  5BPF A;  5D1P A;  1M0T A;  4YJ3 F;  4MV9 A;  5J2U F;  4GLX A;  1PK8 A;  4YB8 B;  1EKP A;  3E5N A;  1P8L A;  3HBL A;  3VA7 A;  5J2T F;  4HNU A; 
#chains in the Genus database with same CATH homology
 5I5V A;  5I5X A;  5BWT A;  4NZO A;  5DGI A;  3T9A A;  3TW7 A;  5BYA A;  2HHF B;  3TEK A;  3UZB A;  2ABJ A;  4WHX A;  4DQN A;  5CE8 A;  2EJ3 A;  4CMD A;  4NZN A;  5CR5 A;  2EJ0 A;  5BWV A;  5DGH A;  5DAA A;  5BWU A;  3DTF A;  3HT5 A;  1ZAU A;  1IYD A;  2HGW A;  1I1L A;  3WWH A;  5BYB A;  3U0G A;  2COI A;  5CM0 A;  4TM5 A;  2QB5 A;  1EKF A;  4K6N A;  1WRV A;  4DAA A;  3PFF A;  1I2K A;  5K2M A;  4IWY A;  3SNO A;  5E25 A;  4CKE A;  1I2L A;  5K3W A;  5KS8 A;  3UZO A;  3T99 A;  4Q4C A;  3DAA A;  3BAC A;  2A1H A;  3CSW A;  3T9E A;  4CKC A;  1G2W A;  2COG A;  4JXU A;  1UC9 A;  3T9C A;  5I5S A;  1DAA A;  2HHF A;  3JZ6 A;  5BWW A;  3T9F A;  5I5T A;  1EKV A;  1UC8 A;  2X5R A;  4PBC A;  2Y4R A;  2EJ2 A;  5I60 A;  4IWX A;  2Q7D A;  2ODT X;  1IYE A;  1I1M A;  2HDK A;  1KTA A;  4CHI A;  2DAA A;  5HNE A;  3T9B A;  5I5W A;  3LQS A;  1ET0 A;  5I5Y A;  4RCN A;  5FR9 A;  4TVI A;  1A0G A;  4CMF A;  4M0J A;  1A3G A;  4CE5 A;  3T9D A;  5BWX A;  3LUL A;  3SGI A;  2COJ A;  4HN2 A;  3UYY A;  2ZGI A;  3CEB A;  2HGX A;  1I1K A;  4CKB A;  2DAB A;  4UUG A;  5I5U A;  4Q4D A;  3WWI A;  5I47 A;  3T7A A;  3VPD A;  5BWR A;  1KT8 A;  3DTG A;  3T54 A;  4NZM A;  3QQM A;  4GLW A;  1EKP A;  2EIY A;  3WWJ A;  2HG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...