3TEUA

Crystal structure of fibcon
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
MLDAPTDLQVTNVTDTSITVSWTPPSATITGYRITYTPSNGPGEPKELTVPPSSTSVTITGLTPGVEYVVSVYALKDNQESPPLVGTQTTGGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibcon
publication title Design of novel FN3 domains with high stability by a consensus sequence approach.
pubmed doi rcsb
molecule tags De novo protein
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2011-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3teuA00
1U8IA 3QIWD 1A5FL 4W4OC 3O3BB 4FQXD 2GT9B 3ZKSD 4ZMAT 1T0MA 1BQLL 1YEIL 2DOCA 4YPGA 2VDPL 4HXAL 1T6WA 2D0FA 4ZPTB 1PG7W 5CZVH 3T08A 2W91A 2OS7A 3H3PL 1TIUA 3O3EB 1CFTB 1BBDL 2W65A 4EI6A 2QSVA 1EFXB 3RWCA 4U1HB 4FQPA 1DJSA 1P9MA 35C8L 1I3GL 2C3HA 1RURH 3UXFA 5TE4L 3Q6FB 4N5ED 1DANU 3PXJA 2F8VA 4U1NB 2DJUA 1IGYA 4L9DA 2NNAA 4Y16B 1FORL 2VERN 4H20L 5I75B 1AO7B 2IQAA 4GAGL 3ULUL 2MQ3A 3NIFF 3UJTH 4F33A 5MEQB 4ZXBC 3PIQB 4L4VB 5KTEH 4PV9B 4X7FC 4N0FA 4U3HA 4P2QB 3U46B 3TO2B 4TUOB 3D39D 1NFDE 1B88A 3VD7A 3O2WH 3UTTE 1L7IL 3VH8G 2KQNA 1JJUA 4RDQG 4H8WL 1T1ZB 4TNVF 4U3XA 4OBRA 4DN3L 3KJ6H 1F58L 5C0AE 3OV6A 4NSKB 2XFXB 5DI8B 1IQDA 1HSAB 2WWMD 5D1ZC 2H8PA 1MFDH 4TPRL 2FHCA 1QOKA 5L2KE 3GDBA 2IPUG 1I8IB 1RAMA 3H9ZA 4MXWH 1D6EB 4OTXL 1S8DA 4GG8B 4NRZA 1A6WL 2ADGB 3U0WH 5CEXB 3FB5B 3RNQA 4DCQA 2I5YH 4OZIE 5CJQL 1BQHG 5DO2D 4N9GA 2VLJD 4YHYC 1AHWC 4X6EB 4BKLB 5GJTL 2HTLD 1G84A 3VRLF 3DGGA 4N8VA 1ZGLB 3L5HA 1OSZB 4MNQB 5ICZB 1T89C 2CK0H 4FQLL 4UB0H 1XF3A 4S1RL 4M62H 4Z7VB 2PYEE 5F6IB 4JFOB 1GZQA 4WEMB 3WXWL 3OKLB 5F7MC 5C0BE 5DTFB 3HZMA 4YDKH 1MVUB 5IP4A 5IBUG 4F2MA 1J0ZA 3BUTA 3QEHA 1S3KL 4KQ4H 5HHVL 2BZDA 1C5CL 3DHMA 1KCSH 2DI9A 4PV8B 4DKFH 1IAIL 1X6NA 3EOTH 1GJIA 4LASH 5J9PA 2YD7A 3SE4C 3F8UB 4XPBL 2X4NB 4YXLH 1M05B 5E03A 1BOYA 5BQ7A 2XN9E 5EBGA 1EJOL 1P7KA 1VPOL 2LVCA 4TNWK 4ZDHB 3DOSA 1I8LA 4H5SB 3UC0H 3OJVC 3DROA 3HE6B 2NY3D 5J1TC 3V0VB 5BOPA 2ED9A 2RR3A 1IKNC 2YD5A 1ZHNA 3Q6GL 4N0CD 3E8UL 2O93L 1ZEAL 3VMOA 3G5XB 2ZCKH 3KPLB 2GKIA 1IM3A 2XZCL 1YEJH 5J06A 2V2XB 2NY4D 5D1XD 4EVNA 5IOPB 3SCMC 1U91A 3OX8A 1A7NH 4R0LC 5LAXB 4E41A 1RK0B 3C5SB 1HI6A 4GG6B 5DEFB 1N64H 3VA6A 4ODUB 5HI3D 1EJ6A 4L3EB 2Z31A 3QXUA 3M45A 4R8WH 4ZUUA 4WJ5A 3VFNB 1ORSA 2A6KB 2KZWA 4ZUWA 1MCOH 5T1LA 5DA0B 4OZFB 5EU4A 5TE6L 1VEOA 1CBVL 1U93A 4HS8H 5HHMD 2HFGH 5BS0A 3UZQA 2B7DT 4Z7OE 2PXYA 3GMNB 4HF5H 2BK8A 3FOLA 2UVFA 5F7NC 3STLA 3VWJD 2ZJSL 1EIBA 2UY6A 1RFDH 1T4KA 1T66C 3WJLA 2BXZA 4U0RC 2ZG2A 4WCYL 5J7CC 2H32A 3O45B 4PJ7E 4CUCA 4Z8FH 1R0AH 2BSED 2VABB 3RWGB 3F7YB 3W81A 3MACL 2V7NB 2Y6SD 5IJKA 4MJ2A 1T80A 4PRHB 3BDYL 1RSFA 2A73A 4JE4B 1EEZB 3FT4B 4Z7UF 2XQYG 3UX9B 1CGXA 4P59L 1U3ZA 2BC4A 1G9MC 3PGFL 1JK8B 2VXUH 3QCTL 5D7LD 1SJEA 4HULB 1JNHB 1VFAA 4JFED 3QG6B 3JVGA 1DVFD 4JQVA 1CL7H 2VIRA 1CLCA 5TGBA 2SEBA 3UP1A 2QQKL 3QXAA 1P7QD 4GMTH 5J6HB 4ODWB 1FE8L 4NN6C 2IANB 1ZANL 1AR1C 2GUOB 5HBBA 3LEXA 5F9JB 3DTXB 4OZGA 5FUCC 3HMXL 1OTUD 2X4TA 3QP3A 4MD0B 4WWKB 3U7WL 2GCYA 4KMTL 3SQOL 3WBDA 3WNMA 1MJ8H 3MV9B 3IDNB 1WZ1L 1LILA 3ORJA 1DSFL 2GAZB 1XF4A 3MRCA 1CI5A 2OSLB 2ESVA 4PUBL 4FQQB 4TSCH 4HQQL 3PDOB 4Y16D 3BD4A 2CKBA 2CDFA 2YEZA 1NPUA 4KRPC 1AO7D 4OB5H 1FIEA 1P7HL 3NAAH 1MH5A 5I6XC 3V6BR 3IXTB 4NPYB 4L4VD 4GAJL 1UWGL 4P2QD 3V5KA 2WBJB 1Z5LB 5GGSB 4Z6AT 1T1YA 1ETZA 3FQRA 4W4NA 2H32H 1BQSA 1CD1A 1N0LA 5GGUA 2BMKA 1QFPA 1K2DA 5GJSH 5CEZE 1UWXK 2P5EE 5DEGA 1GC1H 3RFZC 3GHEH 1XGTA 4HX1B 1AQDA 1ZLUK 4LCUA 2NXZD 5F7DB 3RY6C 1F5WA 1YZZA 3OKMA 4U6XB 4HPYL 4QY8A 4HPOL 5IHUH 5SWQB 4M1CC 1YUHB 4NQXA 1RUMH 2AVGA 5DEZA 3AY4A 1MPAL 4GW4A 4G43A 1UXSA 1FVDA 1WUNT 1BFSA 4FQ2L 5J6GA 5EBWA 4Z77A 3GSQA 3KLAB 1DQML 5T5FL 5CP3A 4K55A 5JOFB 2EDRA 1WBYA 4JZNB 5IMMB 4P2RA 4P4KC 1FRGH 2VL5B 4RZCB 1P1ZB 1ZLVK 1R24B 4NN7B 1S9XB 5TF0A 2XKNB 5L8JB 2DLEA 3EJYD 4M5YH 1JWSB 3FQUA 1DUYB 4NOBA 5HVHB 2CO7B 4NT6B 3UTTB 1K8IA 1MIEH 3QFDB 5JXEA 1CICD 4I3GA 5HDBF 1CU4H 5EWIH 1J1PH 5D2NE 4KKAD 1I1AD 4G8IA 5JHDA 4XGZA 1KXQE 5FOBA 5C0AB 1RJCA 2CKBH 3LN9A 1NGQL 4LARL 5E8OB 3MREB 1KPUA 1OTSC 4HLZG 2F54B 4KKBC 2FECL 4FN0A 5L2KB 2RCSH 1T21B 4O51A 5TE7L 1KJ2A 2X4PB 3P9WB 4ZO6A 5D7SL 1RURL 4OKVA 2K9UA 4MX7B 4TUKH 1AJ7L 4OCYH 4QHKJ 5C07D 1YEHL 3GNMH 5DQJA 2AP2A 1RJLA 2E8ZA 3K8MA 2PTTA 3O6FA 1HKLL 1RI8A 2YMXH 3MBXH 4UDUB 4KZDL 3FOMB 3T2OA 4LIQE 1X5XA 3CNKA 4ZTPH 3MRHA 32C2A 3S36L 4GAYB 4XPFL 3O2WL 1JGUL 4YAQB 1FN4A 4MZ3A 2YRZA 1F11A 1INDH 2PYEB 3GMOB 1D9KD 3GJFA 5C0BB 1YEFH 1J87A 5GGTA 3KJ6L 4WHTB 1YQVH 2Z4QB 5CP3H 4JO4H 4U7KA 1S7TB 4NQTA 4PLJC 3MRJB 3SDDB 5IB5A 4NZRH 3KLSA 5FYLH 3SGDH 1EUUA 2ZUSA 3VFSB 4MXWL 4PJCF 2ZG1A 2WIIB 4F7PB 1WBXA 4TULH 4BZYA 3F58H 2XN9B 3CZJA 4HIEA 4KJQC 1SYVB 2C1PA 5E6ID 5E95B 5GGRA 4M5ZL 2I24N 1MFCH 2PO6A 1I1YB 3S34H 3LEVL 5E5UB 4APQD 4X6DE 2V9TA 5J57B 3L9RA 2Q8AH 4UB0L 5IR1A 5JUEH 5EO1B 3D6GA 5ISZE 1CGUA 4LSVH 3UDWA 2CIKB 2QADD 3EYQC 3U30B 2Y06H 2ED8A 4QHMA 2VDKH 1N3NA 4F7CB 1KJ2H 4RAVB 3VU2A 1HEZA 1SMAA 2KQMA 1R5IB 4R4FL 3RX5A 4N1HB 3P9MB 1VCAA 4DKFL 2HA1A 4LASL 4QRRB 4PG9A 3VWKD 3SY0B 2G75A 4POUB 1CDBA 3HPLB 1A4JB 3I6LD 2FEEI 1VFOA 4MB5A 1NLDL 4X7SH 3A67H 2DBLL 1QRNB 3MRIB 4NQED 1SEBB 1KPRA 2YK1H 3U6RA 1RUAH 2E3VA 2UZIL 3KS0H 4XHQA 1NCNA 4GUPB 3RVTC 3GJFH 3VFUA 4RWYH 5GGTH 1QSFE 1FVCA 1LNUA 4R26H 5FDWA 4X4YB 2B1AL 4NIKB 3FN9A 3ILPB 1H3WM 1OM3H 3N1FC 4WTWA 3D3VD 1FZMA 4PJ7B 1LK3H 4YNYB 5DUBB 2MJWA 3DV6B 3BP5B 3HTLX 3PP3H 5I8OH 1QA9B 3EO9L 4W4OA 1K8DA 3SHSA 3X14A 2P8MA 2R23A 4YK4B 3P11H 1FFPB 1A7NL 4KK6D 5E4EB 3BWAA 1BOGA 2R0WL 2VXTH 3T4YA 5GZOC 3GSWB 3TZVA 5EORL 2CSPA 4XNZC 4AK1A 1QO3B 3NCBB 4XWGL 4LSDA 4J3OC 2R29L 3SO5A 5I1LB 5H94B 2KUTA 4D9RE 2Z91A 5MEOA 4ZAKC 5E2VH 5EU7E 3VXSA 3NACL 1KIPA 2FHBA 1XH3B 5EC2B 3PV6B 4YQXH 3OXSA 2NY2C 4ZO8A 1SY6A 4J1UB 3BHBA 1IQWL 5DDHB 1EEYB 3OB8A 2BNUA 1D5ZA 2WANA 4PGEA 5IB1A 1U58B 1NMAH 4XP9L 2Y25A 4LPYA 4TSBL 2HKFL 1KT2B 3TVMA 4PJHB 3HG1E 3CU7A 4AIXA 4PB0H 4ZXBA 3P0YL 2ZSVA 4CMHC 1L9MA 4OLVL 4TNWF 3GSXA 2H6PA 4NBZB 3EW3B 4PJIE 3BP6B 3ZDXF 4I77L 5I8KL 4OKDA 1G7PB 5F6HI 5I76A 2WW8A 3STBA 4K23H 5IV2B 5JOPE 1EXUA 3QDGB 4JANB 2DIAA 5DHVB 2LE9A 2XRAL 2ERJB 5K9QG 5LGJB 1BZ7B 4KGLA 3LIZL 4LVNB 5IIEB 3VJ6A 1OWRM 1J12A 1JV5B 5E9DE 1UZ8A 2QLVB 5TF1L 3B4NA 1CL7L 4XP1L 3TWCH 4W81A 2CKNA 4OCNC 3WL9A 5ITBH 4JQIH 4XAKD 5DUPH 2P5EB 2B5IC 5C2BH 3HMWH 4LCCB 6FABL 1U8OA 2AK4E 5GPRA 1EZVY 1AHWA 4LCWA 3MRFA 5BXFB 5C0AD 3IVKA 1OT1A 2WAHA 2EXWC 4ODSH 3HNTL 4FNLH 1T89A 2FH8A 3UBXA 5GRJL 1AQKL 3C6LD 4LMQI 4ZUSA 1FVEA 1MJ8L 3BVNB 4L8BB 2A74A 5L2KD 4GBXC 1GSMA 1K85A 1CFQA 4JB9H 3RPIA 4P57A 4MA8H 1S7RB 2YD6A 3QZWA 1F3RB 4DZ8B 2H1PL 4RSVA 1KEGL 1SY6H 3JWDC 5KSUB 4G9FA 1K4DB 1U3HB 3KPMB 3RZWA 2E6JA 3CUPB 4DGVL 5T3XD 3NAAL 3MRNA 1B0WA 2MOVA 2OMNA 1B0RB 4IJ3C 3MUZ1 3UTPE 1NFIA 3VFVB 3QB7C 4FFVC 3RVUC 2HKHH 4OFIA 4Y5YB 3H42H 4YFEA 5LWYH 2PYED 5EO0A 4D9QE 3MLVH 4P2CG 2WWKO 1YJDL 3WIFA 4H0IA 4LAQL 5C0BD 3GHEL 5D1QB 5J3HD 1HYRC 5D2NB 1JNNL 2XTJE 4G6JL 3G5YB 1NCUA 3MRDB 5F3HB 5CP7A 1PAMA 4WI2A 2Z92A 5DMJB 1RUML 5BVJA 1IKNA 3MRPA 1LEGA 2YSSA 1LP9F 3ARPA 3GIZL 4IOIB 4X6BA 5L7XL 3CFJB 4NQDA 4DKEL 3SDYL 1ZA6A 4H25B 4FA8A 5T5NG 4LEXL 3W0WA 1QSVA 3R8QA 5DZOA 2FATH 4P2OB 43C9A 4OM1L 1RUPH 4IIQA 2VSDA 3ARSA 1MIML 5I1AB 4IRSB 5IW6B 5JTWA 2HRLA 3K2UH 5B8CA 1MLBB 2PR4H 4QHUB 2A6IB 4HS6B 2B0SH 4HMCA 5D96B 4DK3A 3AMKA 1UVQB 1XF2B 1PYWB 5DJXB 2IMNA 4UV4H 3WN5B 5I73C 3Q0HA 1ZTXL 4BH8A 5C0DB 3V6ZA 1HHGA 5J56B 2FEDD 2IBBA 5FXCH 25C8L 4JKPH 4OCLC 3TJHC 1KCLA 3D18A 1AGFB 2ICWB 2R1XA 1CLYH 4LPTA 3ZT6A 5K9JL 4HT1H 4Q7DA 1HK6A 2N4IA 1SJXA 1A3LH 1FNAA 1X44A 2VWEE 1NLBL 1TQCC 4M61B 4GRLB 4RFNC 4EDXB 4AEEA 1H3PH 2D0HA 5CMAA 3HR5A 4S1DD 4FFZH 4MJIA 3MCG1 3X12B 4MLIA 1T1WB 5GGSY 1JGLH 1CE6B 4L5FH 5EA0H 4QTIH 1U8MB 5D6CA 3NVQA 3QDMD 4NQCB 4KC3B 1U0QA 2NY1B 1INQB 1ZLWK 1UM4H 4QHNB 3L6FB 1W2KT 4MAYC 2K3TA 4ZTPL 3L3GA 4ONFL 1JE6A 1QHOA 4QRQB 1RJYB 5ISZB 3TT3L 1JWUA 4Z0XB 1INDL 1S7QA 1XF5B 4PPTA 1HH6B 3ULUD 2D31B 1FL6A 3UO1H 5ADPL 1TLKA 2D7MA 3HE7B 4CDHA 1P4LA 4NO2B 1QFWI 4WI9A 1KIRA 5IFAH 2XZAL 5K9KB 2DTSA 3DHJA 2HH0H 4B0MM 1KCVL 3VXRA 3TCLA 4JPKL 4FFWC 3G6JF 4XMLL 4WU5A 2P49B 4E41E 2DLFH 1HQRA 2I26N 4CN1A 4WO4D 5HYSG 1F13A 4DK6A 5ITFB 1T03L 2HJFB 1ORQA 3QBTB 5JOEA 2RQ8A 4RX4D 5JLZA 1FV1A 4PGZA 2FX8L 3X3FH 3ZKMD 1JI2A 4OZHA 4TSAH 3EOAB 5BS0E 5HPMB 3TC9A 3CMOH 1X9QA 4WFHE 5HGBB 1YQ2A 2FX9L 1ES0A 1J0HA 2VDKL 3AVEA 3VW3L 1E4XL 2G2RB 1X5FA 1F2QA 3WIIL 4JFXB 5HJ3B 5D6DC 3RY6A 2W60A 2EDYA 4O4YL 5DRZA 4L4JA 4FQ1L 4A6YA 1KPVA 5E00A 3P77B 1G9MH 3GJEB 1Z0NA 4WFEE 4F57H 4DKDC 3QEQA 5D72L 5HD8C 1S7XB 2YK1L 4M43H 4S0TD 1OTTD 2QR0B 2H9GB 3VFWB 1RUAL 5IEHB 3QNXB 5JPNB 2DYPA 2FJFB 2EICA 3CFDA 5CEZD 1N2RB 1QHPA 4QTHB 4YWGH 3R06A 1MLCB 5CSGA 5KAQF 1A7QL 3U7YL 3DUUB 4R26L 2RHEA 3SKJL 2XZQH 1NCAL 2YUXA 1FDLH 1IL1A 3UTZB 3GB7B 3ZE2E 3HG1B 1I8MB 4NKMB 1JGVL 2OBGA 2WINA 4YGVB 3RU8H 5KN5B 1A6TB 1EGJA 3O41B 3CCHB 1KN4H 1MREH 3TP4A 4MQXD 1U92B 4HKBA 1BIIB 4OZGE 4NFBA 2OYPA 2WIMA 2B4CL 4G9DA 4G6KH 1PY9A 2DDQL 3KPQA 4YHLH 1J05B 2I07B 2JLLA 5EBMA 5T3ZL 1L0XA 3VGEA 3PL6D 3OHXB 3UAJD 5C0IB 3L7EA 3P30H 1OQXA 2ESVE 4M6OH 3KPSB 5E9DB 2CGRH 4YQXL 5B4MD 4R2GC 2Z8VC 3HCVB 4LLVA 4Y5XC 2VQ1B 4JFYB 3GKZA 3V6OA 3O6KH 5JO5B 4XPTH 2DS4A 3QRFM 1WSST 3SKMB 3TN0D 3TPUB 5D1QD 2MTPA 4AIZB 2ITCA 3Q1SL 2DBJA 2NPLX 4ISVA 2Q1EA 1MUJB 2UVEA 2AK4B 1U95B 4PJCA 4JEGB 4BSWB 3SEPA 1KG0A 1ACZA 3NZ8A 4M4PA 3EYUH 4NQUA 4HUVB 1U8IB 3ET9F 4NWTH 4J3UA 4A6YH 1RD6A 5MEPA 3FQTA 1SJVA 1DFBH 3L7FA 2J6EA 2R69H 1JFQL 4KPHH 1FC1A 4N0RA 3BP7B 4YPGB 4ERSL 1S5IH 5GS0D 5MERB 4OF7A 2P24A 4K23L 5ESAA 1KIQA 2CDGB 4JN2A 3MJ7A 1VGEL 1I1FA 1GXEA 5K9QI 1H3VA 2W65B 1IGIH 2HT2D 2B4CC 2H2PD 1QLEL 4P9ML 3LKQA 4MXQC 1D5IH 3RVVD 3WNOA 3HFMH 4JY6A 3TWCL 2W0FA 2GK2A 1BVLA 1MCSA 4P2RE 1EGJH 5DR5L 4P23D 1OGAB 2NNAB 5DUPL 4MAUH 5FYLE 3DVNA 3IXAA 2JJSC 2BCKA 3HMWL 3O6MH 2IQAB 1JPTH 4FZEH 4NUGH 1IAOB 1YYML 2M26A 4I18B 1YC8A 4UZGA 4ODSL 2JIXB 4K71C 3VFRB 1MQ8A 3WV0A 4AG4L 3HI5H 5F1NA 2P42B 2ICEA 3GRWA 4G8FB 4M7KL 2EYSA 1ZWIA 5JHDE 3F7RA 5KVEH 1I7ZA 2FX7L 2MKLC 1H5BB 4ZNCD 1IQDB 1NC4D 3AREB 4YXKL 5CZXD 5BRZA 5GIRA 5FEBA 5DVLA 1F3DJ 4EZMA 1BM3H 2V9RA 3T0EB 4JFHE 3B5HA 5LWYL 1UXWA 4DCQB 3CVIH 3QAZC 1OAQH 2J6EH 2H41A 1BBJB 5GRVK 4N9GB 5D7KE 3PWVA 5E08L 1Z6JT 4YLQT 3BKCH 4XVSL 3IDGA 1X5JA 3IF1A 2I60H 4PJXB 3DGGB 4N8VB 5DGRA 3BEVA 3VGAB 3CLEL 1UKTA 1XF3B 1E4WH 2IALA 1BMGA 1HHJA 5BMFL 1IM9D 4JHAH 1WFNA 3QPQC 3HZMB 4I5BA 4NN5B 1OLZA 2FATL 1IKFL 4LVHB 2XWTA 1DLHB 3DMMC 4RMVA 3IAGC 4DUWA 4F2MB 1XIWA 3QEHB 5EO9B 4EI5B 1NBYB 1E4JA 5FECA 1RUQL 1UYWH 4CVXA 5JW4Q 1ITBB 4LHUA 5KSBA 4GXVH 1E28A 2EDJA 4OIIL 5ACLA 1QSFD 2NW2A 4R7NB 3EDEA 5EZOL 3SO3B 1MFEL 1D6VL 1ERNA 1QUNA 2AJYL 4Z7WB 1NEZA 5DC4B 2XY1A 5IG7B 3V4PL 2B0SL 1F4AA 2J8UF 4ZQKA 5BQ7B 4CL7A 4WI5A 4YO0A 3LKSB 5FKPA 1DEEA 4N90E 1RZ7H 2FJHA 4UV4L 3KLHC 4NDMB 3MRLA 3GRWH 5GGQH 3ISWA 1KELH 4HK0A 4J8RA 1LEIA 2DQTH 1BHGA 1CDGA 3KLDA 1MJJA 2XWBA 4XHJC 2NLJA 3IRPX 5KS9A 5IBTH 3GO1L 4JKPL 3DGCR 3WXVH 5I30H 1DLFH 5HYQA 1ZHNB 4XXCA 4PRIA 4WI8A 4OLEA 2HT4D 3B2UD 1IM3B 2WLYA 4JGUA 4UU9A 4KKLD 2C3WA 4D9RD 2R56H 3MV11 4EVNB 1LWRA 5JW4M 3O2DA 2OTWA 1L7TL 4LKCB 2AJXH 4P2YA 1TQBC 3HC3H 4U1SB 1HI6B 2D0GA 2NXYD 5T1KA 3H8NA 5E1AA 3S8WA 4FXKA 2ZCHH 5HHPB 1A1OA 4AZ8A 5GRWA 2R4SH 3AS1A 4OLZH 4WJ5B 1ORSB 4ZUWB 4OCWL 2HMID 5T1LB 5EU4B 3B5TA 3HG1D 5A3IC 3WO4C 3W2DL 4OCXL 3NPZB 5BS0B 4CN4A 3V7AE 2FIRT 3X13A 2ZCLH 4XAWL 4L8SB 2PXYB 3MRGA 5EOQL 4LQFH 5DJ2A 3FB8A 4NO3B 5B39G 4S1QH 2BVPA 2VRAA 5FF6A 3RGHA 4LKXB 2R9HC 5F89B 1PZ5B 4MDJA 2D3VA 1NEUA 1T4KB 5JOPD 1MRDL 5IFAL 4POYA 3MLWH 5I1EH 4OGAD 3NIFE 3RAJL 1CLZH 4LPXA 2AJVL 1Q0XH 4NNPL 3HLAA 3VXOA 1JGDA 3T2PA 4PG2A 3TBWA 5IFJA 2YBRA 3O4LA 5HHQB 3WFCL 3U48A 1YEGL 3MBEB 1YEEH 4LRNL 2W0KA 1Q9LA 3MOAH 4OF8A 1BAFH 2HVKA 3WJJC 4JZJC 3TPKA 1SJEB 5JW4N 4DOHB 3RDTD 3VXSE 1WQVT 4FFYH 1A7RH 5KG9A 3X3FL 3HA0A 1NGWA 4KRLB 4LSQH 2AGJH 4Z5RB 2EEBA 3EZJB 3QXAB 1FPTL 5K59E 2E8YA 3O2DH 1TDQA 1T7VA 5CJOH 1NCBL 5J13C 3GM8A 3G5ZA 4K3EH 4JO3L 4OZGB 4OV6F 1VEMA 2X4TB 4RCAA 5KW9H 2GCYB 1C8PA 3P9LA 3VXMB 2E27L 5FYKL 2Q86A 3GIVA 3LQZA 4NNXA 1XF4B 3MRCB 2GITB 3L5IA 2MKWA 1JHLL 4P5TB 2ESVB 5GHWL 4KGJA 3OBAA 4GW1A 3K1KC 4MNGA 2DQEL 2VXVH 4XVTL 1G1YA 1IC1A 2FYYA 3MA7B 4D9QD 2CDFB 2YEZB 1FLRH 1OAYH 3BXNA 4UQ3A 3V95A 2R1WB 3UTSD 2PKDA 2XTJD 3V5KB 5LBSH 1JUFA 1T1YB 4D9LH 1ETZB 1CD1B 2E5EA 3BUYA 5F72S 5GGUB 3KPOA 3D85A 5M7QA 5CD5C 1CFNA 2AV7B 2A77L 4YC2C 1XGTB 3MLZH 4LCWE 1AQDB 4LCUB 1JZ4A 4XP5H 3OKMB 1AFVH 2P8LB 4X4MA 2AJZA 5IROC 3LS4H 4M7ZC 4NQXB 4YHLL 1R3KA 1BLNA 1WT5A 3ROLB 3AGVA 5IFHH 2HN7A 3GFUA 2FHFA 1AGCB 3K4AA 1UXSB 3BIKA 1KTLA 3QI9A 1FVDB 5F44A 4YEFA 2CGRL 4R4NC 4Z77B 4O5LL 3KNBA 4G9FE 1OF2A 2W59A 1OLLA 3TFKD 1IARB 1NSNH 1T6VN 5C0CA 1WBYB 1QBLL 1YNTA 3O6KL 4P2RB 1G7HA 3ARGB 1J18A 1C1EL 3VXQA 1OSPL 2BSTA 2XKUA 1HOCA 1QYGH 4MXVF 4GT7A 2QTEA 3EYUL 3FQUB 5LXGH 3TA3B 4PJEF 2F58L 3FTGB 4Y19A 1DFBL 2CK2A 1K8IB 3PDGA 4Y4KB 4JFDD 4XTRD 3SBWC 1JF5A 3UYOD 4O58H 3VG9C 1MAKA 4G8IB 3BAEH 4PRPB 5JHDB 4XGZB 2D9CA 1QLRA 2BVTA 3B2VH 5FGSA 3BDBA 1IGCH 5B22A 2KDGA 3U9UA 1IGIL 3VA2C 4NQDE 4O2FA 4HKZA 1ZLUH 3RWFB 3MCKB 3N1PC 3W0WE 4O51B 2VDMH 1KJ2B 1X5IA 1F6AA 1WIUA 2ARJA 1LO5A 5A40E 5GS2H 3LKNA 4XBPA 2OI9B 1UB6A 3D0VA 3NZHL 3PUCA 2AXGB 2CLZA 4FZEL 2YWZA 2IQ9H 1V3LA 1SBSL 2PTTB 2V7HA 3O6FB 4HHAA 1U9KA 3EYOA 3ZL4H 5HYJB 5I18L 2IAMB 1IC4L 4G3YH 3HI5L 5C6PB 4ENED 1FN4B 5GSRA 3KPRA 1F11B 2XNAB 3GJFB 3BPOC 4E41D 4U6VL 2JCCF 3T0BA 2IGFL 5DJZA 3TYFA 2P47B 1UM6H 3LEYH 4F15C 3CFBA 4PGBA 4Q2ZA 2QHLA 5B3JE 1Q1JH 2Z31D 1A6PA 1TJIH 5IB5B 1FSKC 3NCCB 1A6UL 3JWOC 4OSUH 3MLUH 2FGWH 4YJZL 3I02B 1KLGA 3EFDH 4ODXB 4G6AC 2EH8L 1WBXB 4MJIE 3VFOA 4HDIA 2QBWA 3MMEA 3QH3A 3CVIL 4HIEB 1NL0L 2PXYD 3QQ3A 4U1JA 1LDPL 1MRCH 4QYOA 5EU5A 4WFHD 4UT9H 5E6YA 4LSTH 2C1PB 5DSCB 2W07A 3E6HA 5GGRB 5F21B 2PO6B 2XY2A 5FAAA 2LQRA 3KAAA 5FKAB 2HWZL 4PB9L 1JNJA 2AABH 4LLMA 1E4WL 5JNYB 3S4SA 2RFXB 3RTQB 2FIKB 4CN6A 1HHKA 1XGPA 4QHMB 4WFED 4D0BB 2HFFA 4M7JL 5DLMH 2HG5A 1N3NB 1HEZB 4JVUA 1ZT1B 4U2ZA 5E8DH 5TDOA 4F58H 3C08H 4XNXL 5HGDA 5JA8B 1VERA 3MFFB 1RZIB 4HIIB 4PG9B 2FRGP 2G75B 3LPFA 1FGVH 1UQSB 2CLVB 3VXRE 4GOSA 1Q9WA 4YBHA 1KB5A 1MFAH 5KJRH 3RGVA 3FFDB 5D2LF 1M1SA 1LO3H 1OVZA 5EU6B 1A1NA 4K3HA 1KPRB 4OLXH 4TRPL 2ADIA 1DDHA 1FZKA 5L8KB 4OF6A 2DQTL 1UH3A 3AS2A 1N5YH 1Q9KA 5J11C 3ZE1F 4KHXL 4PJ5A 2YPKB 2D7OA 4OZHE 2FCBA 5TQ0H 3RBGA 3HC0A 3KJ4C 4KROB 5KANG 1FZMB 3D1MC 3MV8A 3RNKB 3BZ4B 1K8DB 3X14B 2P8MB 4XCFL 3QUZC 2AJXL 4MHHI 2DWEA 4NNYA 5DQDH 3BWAB 2XA8H 1DUZA 4Y8DC 5IMKA 4AMKH 3VRJA 2FLBT 4X6CA 2VITB 2ZCHL 3PF2A 2WQRA 4JRXB 3VXUB 3K46A 2VDLH 3QDJB 3WKML 5DJ6B 1IC7L 2YPLB 4OD3L 2PW2B 3FO9A 4ZO7A 5FA3A 2VLRB 2Z91B 4HUNB 4QWWC 3QEQE 5TQ2L 4G5ZH 1G6RB 1A9EB 3MLRL 5K9OB 3OXSB 2GJZB 1NMCB 2Y23A 4Y89A 2P7TB 4KKCD 1C12A 4ONHB 1OP3H 4PGEB 4KUCF 5IB1B 4PGCB 3SJVA 4KXZI 5HDQL 4K8RL 3TVMB 3A6BL 5D5MF 3ARBA 4ZXBB 2Y36L 4Q6YA 4I1NB 5ESVA 3ZHKA 2YR3A 3NCFB 4GXUN 3Q3GA 1FNSL 4WEUD 3SOBL 3GSXB 2H6PB 5I1EL 2JJWA 1KB5H 3LD8C 1G7QA 1BFVL 2CR6A 2ZPKH 4FHBD 4N8VG 1IEBA 1GOFA 1JPSL 1AIFB 5EOTA 4I0PC 4P2RD 1EXUB 4CADA 2O5YH 2Y7QB 5CSZB 1KV3A 3MOAL 5FYLD 1LE5A 4ZPVA 3T65A 2O26U 5D1ZB 1D5XA 1UGNA 4G7YH 1N0XL 3VJ6B 2NYYD 1LHZA 3I75A 2X44D 3WS6C 4NM8H 2AGJL 5EB9A 3G6AA 5BO1H 4NRYA 5ACZA 3V6OE 1A7PH 4OCMC 4OIBA 3HZKA 3DYPA 5JXED 2WBWB 4XP6L 5ANMB 3S98A 5CJOL 2BHYA 5GRZA 4XZUB 1U8OB 1ZT4A 5JHDD 1CE1H 3FMGL 5CS7A 4YHYB 4PJCE 1AHWB 4LCWB 2J8UA 1T04B 4KTDL 3TBVB 1EFQA 1DBJH 2VDRH 5KW9L 5E5RB 3UTOA 3K74B 2XQYK 2DQCH 1HZHL 2OTPA 5EZJA 4ZUSB 1FVEB 2ZSWA 4X8JA 1MQKL 3BMVA 4AQOA 5AD0B 3O0RL 3O81A 3FN0H 4JPVL 1CFQB 4H26B 4JFHD 1HH9B 4P57B 5C0FB 5KVDL 4YDJA 3DMMA 4G9FB 1A14L 1CGSL 2ICWI 3MO1A 5CIPA 4P3DB 4CW1A 3PWPA 1OAYL 3O6FD 5I71C 1G1CA 2Q7YA 1LO0H 4ORGB 4Q9QL 1NFIB 4D9LL 1ZLSH 4A2MA 2Y07H 1AI1H 3KPPB 4XMKH 3QWOB 4U1LA 43CAB 4KTEL 2BVQA 4CMMA 2AJ3A 5EO0B 3I6KB 2OXGA 2EH7L 1IGML 4IRJA 4LSPH 5ILTH 3B9DA 3SE3C 3LRSA 4W6YB 3I9GH 5KZCB 4GMSL 1RU9L 2VC2L 1CFVL 2Z92B 1GGUA 1ZVHA 3QCUL 1F8TH 1RVFL 5D7JA 5BVJB 3MRPB 1NC2A 5IFHL 5JW4R 1C5DB 2COQA 3HI6H 1N7MH 4NQDB 1ZA6B 2MCG1 4AEFA 2Z8SA 4HIJA 3GZKA 5AWNL 4D8PA 2L7UA 2EDXA 3SCMB 2OJZH 1LK2B 4R0LB 3TBSA 4N90D 4KVNH 2VSCA 1N4XH 3KXFB 5BRZE 2PW1B 3BT2H 3CJJA 4HFWA 1I4FA 2X70B 1J10A 3S96A 2J4WH 5IVOA 5T3ZD 1KCUL 1UCTA 4UINL 1B4JH 5LXGL 2IADB 4PRDA 4Z7UB 4TOYH 3O6LL 4OV5A 5DJCA 1P6FA 4C4KO 4ODVH 3V6ZB 1HHGB 2DQHL 1QACA 4O58L 1ZE3C 2ENSA 3BAEL 4XVUC 5ADOL 4HUWB 1OW0C 5J89A 3B2VL 2PCPA 5CIPH 1B3JA 3D18B 1OCWH 1G9NH 2YPVH 4U0RB 2VAAB 1QSED 3RPKA 4KJPC 2CDEA 1FBIH 3AROA 4QGYA 4K3DL 4RMTA 2VUOA 2HLFC 4PP2B 1RMFL 4Y4HC 2ZOLB 4G6FB 4RGNE 1VFUA 8FABA 3HR5B 3LKPA 3IFNH 2YA2A 4MJIB 5SX5K 5KSBE 2A83B 3HB3D 3O3BA 1XR9B 3ZDXE 4OLYL 5D6CB 3I84A 2GT9A 3PHQA 4PRBA 2FJGB 2NTFB 3P40A 1F4YH 2QSTA 2NY5L 3X3GH 3T2QA 1I9JH 2HVJB 1S7QB 2E6QA 4OJFL 3AXLB 4L29A 1F3DH 5F9OH 5KS9E 1UM6L 1OHQA 4U1HA 2CRZA 4JO2H 1D5BB 3D87B 4HAGA 1XFPA 3TZVD 2XG4A 1P4LB 1Q1JL 5CLTA 4J12A 4PRIE 4RMWA 1VA9A 3KR3L 4U1NA 4DUVA 5I1IH 1H3XA 3VXSD 2W9DH 2ZUYA 4WU5B 3U79A 3PIQA 3M1BB 1TZHA 5TFSH 2GEEA 3U46A 2D9QB 1TXKA 3TO2A 3U83A 3RWDA 1ORQB 4KRPB 5BVPL 2C9AA 4KUZL 3TVMD 2NY6C 5I6XB 4ZXBD 3CX5K 1T1ZA 2H26A 1CK0L 4CVWA 5JORA 3N9GH 5D9SB 4XBGA 2XFXA 5DI8A 5EUOF 7CGTA 1HSAA 4NGHL 1A64A 5C0EA 3EYVB 3BP4A 3RZCC 3E6FA 2NY5C 4R90L 4JO1L 2C26A 3H7LA 4Y0GA 5IK3B 1LO4L 4K94L 4W6WB 1IAKA 1D6EA 5GRUH 5DK0A 2OCFD 2W60B 2ADGA 3FB5A 5DRZB 1KPVB 2OJEB 1MWAL 1BGXH 1YMMA 5E00B 3MOBH 5IROA 1MCEA 4FP8H 1BWMA 1MFAL 5KJRL 1TITA 4JHWH 4GQ9H 4X6EA 4EIGB 4BKLA 2FEEL 2DQUH 3QEQB 3ARXA 2D03L 2NY0C 3LKRA 3O4LE 1OSZA 4MNQA 5ICZA 2DYPB 3ZDZE 5CILL 3H2WA 3E2HB 5HYIA 3R06B 1N6QH 1J8HA 3FZUD 5HHXL 3SDAA 5MI0C 4P4KB 3MGTA 4MA1C 3OKLA 4LSRH 2G9HA 3C60C 3PHOA 1PG7X 1IL1B 4JRWA 1FAKT 2ZOKA 3K8KA 3C2SA 2AS5M 2WINB 2AEPH 2YXMA 5H35B 5DFTA 2G5BA 3EUUA 5IF0B 4C59B 4OZ4A 4FOMA 3O8XC 4L3AA 5FUOL 3MR9B 4HKBB 2X4NA 3SBWA 2XA8L 5E2UH 4QXWA 1F6FB 1M05A 1UADC 2H3NA 4G9DB 5HI4D 3OF6A 1GIGH 3EYSL 4ZOEA 4MCYB 1EZVX 3QRGH 3BISA 4J3SA 3UJJL 5EBMB 4XPGL 3C6SA 5KSVB 2EXYD 2WWKT 4H5SA 2JCCA 5IMLA 1MCQA 3L7EB 3HE6A 4MNGE 3V0VA 5GGRY 4NJ9H 4ZYKA 4LLVB 4YHOL 1PVHA 4PBVC 4H88H 3OB0K 3KPLA 2A0LC 2VZ1A 1QNZL 3NIDF 5KVFL 5KZCD 3TO4D 2R2EA 4PJCB 2I25N 3NFSH 5H8DA 1KG0B 1RK0A 3NZ8B 2E7LA 3LN4B 3ETBF 1YY9D 5CINH 5MEPB 1ACYL 2WBKA 3FQTB 4X80L 1RZJC 1OGTA 1KB5L 4WHYH 4ALAH 3L7FB 4L3EA 2Q8BH 3HI1A 3W0WD 3ARTA 3VFNA 3N85H 4GFTB 4HCRL 5CZKA 5HDLA 2P24B 4OZFA 3LQAH 4X4ME 4PJ9C 1NAMA 1IGJB 4MCZB 3MJ7B 4KTYA 4EOWH 5EOCJ 2UWEF 4G7YL 4JG1L 4X9GA 3R0MA 1KLUB 2HLAA 3LKQB 2N7BA 1QR1B 5ENWA 3L3HA 2G60L 4JY6B 2VDOL 3ARVA 5C0CE 5BO1L 1BVLB 1I1CA 2C1OA 5DQ9B 5FDYA 5DFWH 4POZD 5C71A 5CAYB 1DQDH 3O45A 4JFPA 3DVNB 3RWGA 2BCKB 3BH9A 3TT1L 5D2LA 2R0LL 5EOCL 3UPRB 5ID0A 2D7QA 3QPXL 3LHPL 3PQYB 4PRHA 1F97A 4N0YL 2DLHA 3V7AG 1ZHKA 3BD3A 3DXAB 4Y19E 3FT4A 3NABL 5AZ2H 5F1NB 1AKJA 12E8L 5AG9A 5D8JH 2BJML 1U8PB 4X7TB 1GPOL 1KXVC 2EYSB 1ZWIB 3T3ME 1PEZA 4JM4L 4MJID 3QG6A 4ODBD 1GL4B 3S88H 5D71L 1HYSD 5GIRB 2OZ4A 4DAGL 5J6HA 1I9RH 1YYLH 4ODWA 2IANA 2OR9H 3ARWA 3QIWC 4TVPH 2GUOA 2W0LA 4J3WA 1O0VA 4O2EB 3WFZA 4Z95H 1A6ZB 4AEIH 3EO1B 4P46D 4FQXC 4U7MA 1JZ8A 3DTXA 2NMSA 1JZ2A 3F7VB 3UPCA 1KOAA 2VXQL 3TNMB 3MTRA 3DX6A 1Z9SA 4KKNA 2W0PA 2VDQL 3PWVB 4TQEL 3DSFH 3VGBA 3MV9A 3L5XH 2IJ0C 4R9HA 3IF1B 1WZLA 3ELAT 5CEYA 2AK1L 4OZFH 2GAZA 3BEVB 1NAMH 2EYRB 3T8XA 2BVYA 3QEGL 4I8DA 2WQ8A 4J3VA 4DQOH 1Y0LA 2OP4H 5E7FA 3KPRE 3PDOA 3ULVC 2IALB 1XGYH 2I27N 1N7ML 3VXRD 4XCCL 4M6MH 2R0ZL 3V4UL 1P84K 1S9WB 3JWOH 4PS4L 5JW5A 4FTVB 2F19H 3DYMA 1ONQB 3IXTA 4BK4A 4N5EC 4DGIH 5DURB 1U8JA 2XWTB 5D5MA 3QUZA 1XIWB 4KK5D 4KVCL 1A4KA 4L4TA 5FECB 4Z7NE 2E7CA 1J8KA 2WLZA 2WUCH 1FJ1B 1I3UA 1BJ1J 2C4XA 4XNZB 1E28B 4MMXC 2NW2B 1NEZB 4NYLB 2V5MA 3INUH 3CFIC 4HX1A 3KVQA 4ZQKB 2DMBA 5FO7A 2P43B 3EDDA 4YO0B 4NC1E 5FKPB 1EMTH 2FJHB 2NZ9D 3MC0A 2NY2B 3CXHK 4K07A 4HK0B 1LEIB 3ULVF 1D3CA 2HAZA 2XWBB 3BIBX 1P4BH 2ORBH 3DNKA 4LPCA 1IGTA 3ZTNH 4B5EA 1R3IH 4HZLB 4XH2B 2R8SH 3LSOB 3QNYB 4UTBL 4PRIB 1G9NL 1GH7A 2OZ4H 2YPVL 2BSRA 4JZNA 4LLAA 4CMHB 5IMMA 5JW3L 3P4OA 1FBIL 3MROA 4JDTL 3SQBA 2OTWB 1P1ZA 4RZCA 3QEQD 1R24A 9CGTA 1MHHB 3GKWH 1OP9A 2DYPD 3ECBA 4K9EL 5DO2C 3UBXG 2CH8A 2DB8A 5T1KB 1JWSA 1DUYA 5E1AB 3CSBA 2HTLC 4KV5F 4I0PA 4LGRB 4FXKB 1DQLH 3WFBH 2XQBL 4NT6A 5CJ5A 3CX5J 5BW7C 5DD6B 3QZWG 3QFDA 4M6NH 3AU1B 5L6YH 1F4YL 1ZKAA 4WHDA 3VFPB 1NANI 5IT2L 3NCYP 5GGVH 3X3GL 5ELIA 3WS6A 3X13B 1QD0A 5E8OA 1TZGH 4IRZH 2EE9A 3MRGB 5JHLH 1J86A 2F54A 1RJZB 3FB8B 5E1HB 5I8CB 4L8DA 4YBLC 1J7VR 2AXFB 4PJ5E 5FF6B 3QUYD 4YHPA 2F53B 2B5IB 5C08A 5C9KA 2J12B 3BSZH 2GHWB 1T21A 4ONGH 2X4PA 1G0XA 3BJ91 2D7PA 4X7CC 3MV8E 1QFWL 3FQWA 4XT1C 1PSKH 2LFGA 3UMTA 5HXMA 5C7XH 5DMGD 1KJ3H 1TNMA 4GBXB 4M8VA 2CUMA 1JGDB 3TBWB 5IFJB 4RISL 4BJLA 4QNPF 2YBRB 3NMEA 3O4LB 1HHIA 2V5TA 5EN2B 3WLBB 4I48A 4X6CE 2VDNH 4PLKD 2QHRL 2AJUH 4GH7B 3C2AL 1LP9B 2NY3C 1Q9LB 3W9DB 3T4AA 1DE4B 4EKXA 4YAQA 5F97E 2HVKB 1LD9B 3GMOA 4LMQE 4ZSOA 4N0CC 5IMOA 1BVZA 3DRQB 4DTGL 5HGGS 5KG9B 4IJ3B 3N9GL 2NY4C 1TPXB 5D1XC 5HVWA 3MCLH 1OAXH 3C87A 1S9VB 4M7LL 3SJVE 4XCEB 1A6VH 3HZYA 2XZZA 4MJ6A 1UJ3C 4OGXL 4C56B 5FYKU 4IS6A 3MV01 3G5ZB 3NN8B 3CFEB 4LEOA 3VFSA 5HI3C 4E5XA 5GRUL 2WIIA 4U0QB 3FO2A 3MOBL 4FP8L 3JXAA 1MCWW 2QEJA 2Q86B 3GIVB 4NNXB 2AEQL 2FD6H 4FS0A 2YZ8A 5A2FA 5HTSA 7FABL 1GAFL 3SGJA 5EO1A 3VWJC 4KJQD 4KDWA 4OF0A 2JJVA 3K81A 5F9AC 3BXNB 4UQ3B 1RHFA 3VXNA 3RIFK 4RAVA 3DWTA 5T1DH 3L3JB 2OR8A 3BUYB 1EO8L 4FQJH 3T2NH 3OPZH 5CFHA 3KPOB 3D85B 2I9TA 2JB5H 3SGKA 4QRRA 3EYQD 3SY0A 3MJ9A 1CFNB 1BD2D 3HPLA 5I73B 1YDPB 1A4JA 3ZHLA 5F70A 2J8UE 1TVHB 1QRNA 3QQNA 3MRIA 1SEBA 2AJZB 3OAUH 3OJMB 4N5UA 4RGOL 5BRZD 5IQ9B 3SN6N 1F2XK 1BLNB 2YUWA 2ZUWA 2HN7B 4HC1A 1FIGH 2DIBA 1XGRA 4BUHA 1KTLB 5FGBC 1DVFC 4OQ1A 3EO0B 3D2UA 4RWHA 4PJ8D 2YHGA 4G8GB 3V8OA 4Q9RL 5DRWA 4NO5A 4NJ9L 1OF2B 4X4YA 2GQHA 1TQCB 4QRPA 5C0CB 2E9IA 4RFNB 1YNTB 4HWZB 3PWPE 5TPWH 1PDKA 1G7HB 3BP5A 3U1SL 4WEBL 1PGRB 3KHOA 3G6JB 1VKXB 1HOCB 1OTUC 5JIIA 3J7HA 4MDIB 4RAUA 2CMRH 1LO2H 4LSSL 1J88A 4MAYB 5E8NA 3EOYG 4BZ1H 1SYSA 3A6CL 5DURD 3FAXA 4ETYA 5H94A 2C4FT 1MEXH 1XIWD 1QPPA 2DQGH 4QOKA 4Y16C 1PLGH 4RGND 4PJXF 5I75C 1UA6H 1QLRB 4XC1H 1DBAH 4LHUD 2FZ3B 3PV6A 3B5GA 4J1UA 4D0DA 5DDHA 3U9UB 1VACA 1EEYA 3BZFA 3J8F7 4O2FB 1P5VA 4HKZB 5IB2B 4LF3B 5E2WH 1U58A 3CVHL 4ZUVB 3MNVB 4M6AA 4JG0H 5AYUL 4Z0BH 1F6AB 5DD0H 1JPST 5DMIH 1I9IH 1KT2A 4K3GA 4PJHA 3DSNA 5IBLC 3ZZ1A 4S1SH 2NY2D 3MLSL 1VESA 1DQDL 1XCTB 3D0VB 2NXZC 3MJ9H 3SKOB 1OARL 2XACC 2V7HB 4X5WA 5C6WH 3EYOB 2BRRH 2APWA 3BP6A 3VD5A 1MCNA 1G7PA 2N7AA 2Y5TB 1PFCA 3W9EA 3BEWA 5D4QA 5KVGL 3ZYIA 4P48A 1P84J 5B21A 3QDGA 5E8EA 4HC1H 5DHVA 5D8JL 4HJ0D 1CQKA 1WWWX 3MSPA 1BZ7A 3QUML 1FNFA 3I3DA 1P4IH 2BNRA 3LN5B 4HFUH 1KLFA 3TYFB 4PGBB 1JV5A 5L88H 1II4E 5T1KD 2E7BA 3GBNL 4ZFGH 2CJUL 3K2MC 3IGAB 4UBDD 5FFLA 3VI4F 4QHLB 1OP5H 5C1MB 5IESL 3MUGA 3G08A 1YYLL 2KBGA 4FMKA 4GW5A 2UV3A 3EJYC 1MOEA 1FYTA 4OCSH 1UZ6F 3V0WH 1K6QH 1LMKA 4JY4A 4PY8J 4K7PH 2JB6A 5BXFA 3VFOB 4HDIB 1A6AA 3MMEB 4U1JB 3QQ3B 1NAKH 1CICC 3CXHJ 5EU5B 4PGJA 3E1F1 4KKAC 1I1AC 3E6HB 3DSFL 3BVNA 4L8BA 5SV3A 3N06B 1A7OL 2DLIA 4YEEA 3UYRL 2AV1A 1FL5A 4FMFA 2VL4A 4DZ8A 3EOBB 3C60A 2J1KA 1IFHH 5KSUA 2EIZA 1JVKA 1K4DA 1U3HA 1XGYL 3S4SB 5DRNA 1F4WH 5CGMA 1HHKB 1XGPB 2DQJL 2HFFB 2VH5H 2HG5B 4QXUL 3RL1A 5I9QC 2EDOA 2GJ6A 1LGVA 1WISA 2CUIA 3QG7H 5I19L 3VFVA 3GBMH 4BK5A 4EQ3A 5DWUH 2DD8L 1A2YB 1AXTH 5TDOB 4JDVB 3CDCA 5HGDB 4Y5YA 3NBNA 4UILH 5A1AA 4F37K 4GRWF 5F93C 3FCTA 2LAGB 1FL3A 3KPTA 4EBQL 3CDYA 2W9LA 4JQXA 2CRMA 2ADIB 4X83A 3RUGF 1D9KC 1DDHB 1FZKB 4JGMA 5DHVH 1U41A 1MCHA 2O5ZH 3TIDB 2VZOA 1FG9C 2UWEA 4Y5XB 1Q9KB 1X6LA 5FB8B 1NCWH 4HIXH 1KB9K 2VE6A 4PJAF 4PJ5B 2FO4B 3JTSA 2A9NH 3ZTNL 1YPZF 4I3SH 2R8SL 1N6VA 1KEMH 3BKYL 3T0VA 3HC0B 3MRKA 5FHAH 4UT7H 2ADFH 4BFIB 3CSGA 1Z3GL 4IRSA 2X40A 1FCGA 2EE2A 4NNYB 1MLBA 5CWSB 5E6IC 4M1GH 1CXEA 5IMKB 3VRJB 3MNWA 1H8SA 1YMME 1MNUH 1PYWA 4APQC 3WN5A 1MF2H 4GRMB 2R4RH 5FHBH 2C4FU 1NUDA 1I85C 2YZ1A 3QCVL 1YN6A 4MNQE 4UQ2A 3U4BH 2QADC 2Z8RA 5GS2D 4H0HB 3ZT5A 2W9EL 4IRZL 5SWZB 1J8HE 1JGEA 1UENA 3SJVB 4PLNC 4CVZA 2XT1B 2VQUA 2GY5A 1MAJA 1QQDA 2ZKHH 4DFIA 1JTTA 3DBXB 3VWKC 4KXZH 3ARBB 4EDXA 3TJHD 5C70A 2VZUA 1I7UA 1MJUH 1JTOA 2EZ0D 4JN1H 4Q0XL 3X12A 3QI9D 3NA9H 1AY1L 1G7QB 1CE6A 1EEUA 1S7SA 3LRGA 5T5NF 1KGCE 1B0GB 3CSYA 1IEBB 4LHQB 1BEYH 2J88L 4GKZA 1SQ2N 4NQCA 5C0CD 5AAMA 3GI9H 1ND0A 1OAUL 3QDHA 5EOTB 1P53A 4OI9A 4QHNA 1CCZA 3ROOA 3QO1B 2MMXA 2AJUL 1CLOL 5CJ8A 1LE5B 4QRQA 1RJYA 2AQ2A 4JHBA 3T65B 1D5XB 1XF5A 3HNVL 2JCCE 5E94B 2QJDA 1HH6A 3I75B 1OAKH 3QIWA 3G6AB 4O02L 4Y19D 4LHUG 3HE7A 4NRYB 5ACZB 1EERB 1DANT 2DQFB 3HZKB 1K4CB 4KK6C 4U31A 1A7BA 1RZJH 3QAZB 4KY1L 1NEZG 1NBZA 4H1LA 3WDJA 4TVPE 2OR7A 2J8UB 3PWLA 2PTUA 1FFOB 5IEKA 2ZSWB 4L3EE 4X8JB 3VG0H 5ITFA 1TJHH 4XXDA 3JV6A 5BV7C 2IFFH 5ICXA 4DW2H 5JIPA 3DMMB 2IH1A 3AFLA 3MO1B 1S7UA 5HPMA 2C3GA 1Z9OA 5HY9B 3PWPB 5HGBA 4I2XB 2Q7YB 5LCVH 4HWUA 1J1OL 1JPFB 5F9WC 1T0NA 2D4DA 2JF1A 4FQJL 4JFXA 4NQSB 4U49A 3T2NL 2BVQB 3KPRD 3EHBD 3PDDA 4CMMB 4Y2DD 3WNLA 3CH1A 4P3CL 3P77A 1O7SA 5D2LE 3GJEA 3LRSB 4KQ3L 1H8OA 1YECH 4G6ML 1RZFH 2OL3A 4JFFB 1CDIA 4PRHE 3G5VA 1S7XA 4MQSB 4M9PA 3T77A 3UEZA 3ZYOA 1IE5A 2QR0A 4OD1H 4XNUL 3BJLA 1NC2B 1RHHB 4Z7QE 1N2RA 4QTHA 3ZE1E 4AT6A 4NZTL 3GSNL 3WE6A 1Z9LA 4MQ7B 4HIJB 2VZVA 3MQIA 4Z9KB 4D8PB 2ZUQC 5I15H 1Q72H 3UTZA 3GB7A 4MLSA 1TQBB 3S3SA 3THMH 2VLJA 4N9OB 1JHKL 3NTCH 3S96B 4YGVA 5KN5A 1A6TA 1INEH 2IANE 4H1LH 5DD1L 3CCHA 4F9PA 4HLJA 1YEDA 5BW7A 1F6LL 4HJJL 3C6LC 15C8H 4PRDB 2CMRL 2VISB 4M8QA 1VGKB 1DBKL 5C0RL 3WO4B 5IM7A 5I1CH 4OV5B 5DJCB 1ZAGA 4BZ1L 3ULVH 1KBGL 1SEQL 1D5MB 3MA9H 3MV9E 1MEXL 2DQGL 4LDLB 1PLGL 3OHXA 1SM3H 5CD3A 1DBAL 3KPSA 1NFDF 3OTTA 2PCPB 4KI5E 1UCBH 5F1IA 2PYFB 2AQ3A 4FQHB 2VQ1A 5IW3A 4JFYA 4LSUH 1DBMH 1F4XH 4M48H 3RGVD 4WUUA 5JO5A 2CDEB 5INCA 3R1GH 2GSIA 5D5ME 1RIUH 4OLWL 5DMIL 3ZE0F 1MUJA 1I9IL 5CCKH 1U95A 4L4TE 2QQLL 4NQVA 4BSWA 5DHXB 5EULV 3LKPB 3TV3H 4OBSA 4X4XA 5J3HC 1F3JB 4PJ5D 3V4VH 4NHCH 1AE6H 2DRUA 3PHQB 4PRBB 3KYMA 2OL3H 3W5MA 4JZJB 3BP7A 4OZIF 5MERA 2GK0B 5KOMC 3MV8D 2Z93B 2CDGA 1JPGA 1RZKC 2V17H 4L29B 4HFUL 1E6OH 1MCPH 4QRTA 2EDFA 5LGHH 5IVXF 1G7LB 5J13B 3C8HA 2AI0H 3IRZA 3O3UN 3ILQD 2YKLL 1HIML 5HGAA 1OGAA 1GGTA 1OPGH 1IAOA 1IT9L 2YOCA 5FCUH 1KENH 1MCKA 1TZHB 2EDLA 2EDWA 4I18A 1V7NH 4UIMB 4JM2C 2F5BH 1NAKL 2JIXA 3SKNA 3FRPA 4NBXB 3VFRA 4BSVB 1KB9J 4MA7L 3VWJA 4WTZA 4WY7H 3RWDB 3T0AA 4G8FA 3ARBD 4NRXA 1P2CA 4LLDA 1NMBH 2DQDH 2H26B 4ONOA 5JORB 5IHZA 1H5BA 1MRFH 5KBNC 4XBGB 4HKXB 3AREA 1DQTA 1QKZL 1RULL 5C0EB 1KFAH 3BP4B 3GM0A 1IZJA 3E6FB 2BOBB 5CUSL 2F54E 2BOCB 3QFJB 1CGWA 5EPMB 1QFHA 4S1DC 4Q6IC 5C08E 1DN0B 4YDIH 3VFTB 3QG7L 2M8XA 4YC2B 1IAKB 5DWUL 3T0EA 3DX9A 2HFEB 5DK0B 4PJEB 3QHTC 1JRHH 4JM2F 1SJHA 1UT9A 4K2UH 4LLQB 1YMMB 1A1MB 4I4WB 4M7ZB 1BBJA 5E56A 4NWUL 2ZUTA 3MNZB 4X9HA 5MENA 2VXSH 5FGBA 2F15A 4PJXA 3LKRB 4N8PA 4AEHL 3U82B 2O5ZL 4LLUA 3ULUC 5F1KC 3VD4A 4GJTB 2QQQA 2ILLA 1J8HB 3SDAB 1G7IA 4ZSOE 3HZVA 1NQBA 3MGTB 5CLWA 2G9HB 5ALCL 1J1XL 3PHOB 4I3SL 1DLHA 4Z7OF 5I1HL 1DQJB 4UV7L 4H8WC 5EUKA 3ARDA 4UT7L 1NBYA 5EO9A 2ZOKB 4EI5A 3IT8D 4YHKH 4JJHA 4XWOD 5CEZL 4CJ1A 1C5BL 5I1DB 1DEDA 4WO4C 3SDCD 4KHTH 1CZ8H 2G5BB 4R7NA 4QLRA 4OZ4B 4XCYB 4B7LA 4Z7WA 1NCTA 3DMMD 3A6OA 3FT2A 3ALPA 3VG9B 5IG7A 2ARJQ 2H3NB 1HINH 4I3RH 4J7RA 5KAQG 3PWPD 4HXBH 1MNUL 3LKSA 5FA4A 4NDMA 4GSDH 3ULUF 3C6SB 4ZG1A 2FSEB 3ZKMC 4PY7A 2GYSA 3QHFH 2JCCB 5IMLB 1KN2H 3U4BL 2BY1A 3HNSL 2XPGA 1T1XB 2ENYA 4JR9H 1G7JB 3U0TA 4ZYKB 1M7DA 3UJIL 1SBBA 4IRJD 2EDNA 1H3GA 4QHKI 4F37F 5CHNA 2A1WL 3K3QA 5D70H 2R2EB 4LKCA 3NCEB 5D7JD 4U1SA 4YUEH 3FO0H 4QRRE 1OGTB 2YN5A 5JXAL 4UDTA 5HHPA 3L1OL 3HI1B 3RA7H 4X6FA 1OTTC 4BZ2H 4BFEA 3ZT7A 5JMRA 3BPOB 2BP3A 1WFTA 2ZNXA 1QRNE 2YRLA 1NAMB 3S4SG 4F15B 1CTNA 2AJSL 2EDQA 4LK4A 3P4LA 4DVRH 4G7VL 5ALBL 4AH2B 5HHOB 4L8SA 3BW9A 3IFPA 5F7EL 1FO0A 1FSKB 1I3RB 4C4KT 2HLAB 3FN3A 4NO3A 5GRXG 5ENWB 2VLME 3L3HB 1DBBL 4LKXA 3IFLH 5F89A 5GS0L 4QRPE 1PZ5A 2C1OB 4Y4FD 3MLYH 2DLGA 4LCIH 4MQXC 5DD3H 4JFPB 1FGNH 4KDTA 5C0JA 1CICA 4QXGL 3BH9B 3Q5OA 5F7YC 5D2LB 1XEDA 3WFDH 5ID0B 1X5LA 4LIQL 3CLFH 3RUGA 1ZHKB 2Q3ZA 1NGPL 4XX1G 3OB0H 4XP4H 5HHQA 3PL6C 3MBEA 3SE8L 3UAJC 3I2CH 4KMQA 1AKJB 1JP5A 1UJTA 1ADQA 4M7LT 4DGYL 4E42A 4UT6H 4QOKE 4PJAA 3RQ3A 5H2BA 4DW2L 4NJAH 1NGYA 3RX7A 4YBQD 4N1EA 4XC3H 3TN0C 5D1QC 2DQIH 5D2NC 4RAHA 4Z5RA 4XBEL 1VB9A 3I50L 3QHZL 3N0PB 1OB1A 5LCVL 2EDEA 1SHMA 2UY7A 4JREC 4YX2H 4PJHE 5T33L 4X5XB 5FM5O 1H3TA 4Q58C 1W72A 4JFZL 4JY5H 1EHXA 3DX6B 3TH4T 3VXMA 5GS0C 2O5XH 1EFXD 1RQ5A 3TGXA 2XTLA 5CEYB 3VFGL 2ADJB 3BE1L 1BWWA 5DFVC 5J11B 4E9LA 2ITDA 4WGVB 3T8XB 2GITA 1JZ7A 4ZTOH 1NDMA 4P5TA 1S5HB 1OAZH 5C6TH 1Y0LB 2H2PC 3QDGE 3MA7A 2BX5A 4YGAB 3RVVC 1UM5H 3IS0X 3KJ4B 1FO0H 1CF8H 1UWEL 3LDBC 2BNRE 3C5ZA 4NKIL 5JW5B 1WZMA 3SE9L 2R1WA 4NKQB 1U8JB 5EH1A 1YY8B 5D5MB 5I15L 3QUZB 4P23C 2E7HA 3QIUC 4ETQB 3WUWB 1A4KB 4L4TB 3GSUB 3LAFA 4NM4H 4U2YA 3MODL 5E6IA 5MP6H 4XPHL 4KAQH 1FYTE 3LS5H 4XVJH 3ZDYF 4D3CH 2AV7A 2BVOB 3FFCB 3OKEA 4F8QA 2JJTC 3KWWB 15C8L 2HRPH 3BKMH 1CDUA 1I85A 5FO7B 2P8LA 5I1CL 1JNLL 1ADQH 4GAFB 3ROLA 2X9YA 1X5HA 1AGCA 5CZXC 4IDJL 1TJGL 4MS8C 1ZT7B 2R0KL 5LGKA 4R4BB 1IGTB 4M00A 3MRRA 3SPVB 4XB7A 1YMMD 3BQUC 3R0NA 4ZS6D 2BSRB 2B1HH 4OCRH 3NIDE 3P4OB 5DS8B 3MROB 4RRPA 3RWEB 2QQNH 3ARGA 5E5MB 2H45A 3LD8B 1RIUL 2GJ6E 3VD3A 2X1XR 4MNQD 1CR9H 4OUUB 3IU4L 3ECBB 1W72H 2P5WB 3TA3A 4JJ5B 4OAWB 1J8HD 3BGAA 3SDAD 4I0PB 3FTGA 5JR1H 3L5JA 1AE6L 5JQ6H 1YNLH 4Y4KA 3QWQB 3UTQB 4PRPA 5CZVL 5AZEH 5CJXC 1NANH 3WFEH 3H7BA 4RA3A 2UWEE 4AJ0A 5I1JH 2J3SA 1RUKH 2V17L 1KGCD 3JV4A 1F02I 4L8DB 4KH2A 5IW1B 3RWFA 3MCKA 4YHPB 5C08B 3QXDA 3P4NA 4UIKH 1T7WA 4HBCH 3FQWB 2ATKB 3IETB 3QULA 3HE6D 5ESQA 2AXGA 5IGXH 3UJTL 4OF5A 5KTEL 2MPAH 1HHIB 4I48B 5HYJA 2IAMA 3FRUB 4PBWD 1DN2A 3CZFA 3T4AB 2DLTA 4OGYH 2IG2H 2XNAA 4ZSOB 2C7UA 4KJWD 4TVPD 5I71B 5IMOB 4JZOB 1KACB 5AEAA 1NMBL 1AH1A 2EE3A 4B41A 2HT4C 3B2UC 3H0TB 4P99A 5I1GH 4OQTA 1MRFL 2X1PA 3LKOA 4KKLC 4D0CA 1IEAA 2CD0A 4L3ED 5F96H 1MFDL 3HZYB 4MJ6B 3L3IA 4IS6B 4MB3A 4Z18A 2NXYC 3I02A 4J4PA 4LEOB 3H9SB 4E5XB 3NOIA 4JRYA 4ODXA 3U0WL 1KCRH 1FAIH 2I5YL 3JV5A 2HMIC 3FO2B 5IVZB 2KZ1B 3EYFA 1UH2A 2Z35A 5DSCA 4PTUA 2VXSL 1GHFH 4NQCE 1G9EA 5FKAA 2CK0L 3CPLB 3WIHA 4M62L 2Z9TA 1NH6A 1YNKH 5JNYA 2RFXA 3RTQA 2FIKA 3PWNB 3VXNB 4D0BA 5D7IF 3OR7B 4PRHD 4YDKL 5J12C 3ZYJA 1ZT1A 1AD9A 2BNQA 4KQ4L 5CBAA 4YHKL 3C6LA 1KCSL 2I9TB 3MFFA 2LABA 3MLXH 3EOTL 1RZIA 2LAAA 4HIIA 1CZ8L 1L0QA 3CXDH 1UQSA 2CLVA 4LVOC 4XPAH 3IJSA 4FG6D 2APTA 5BV7H 3FFDA 1DL7H 4FABH 1WICA 1QFWM 4YXLL 3MRBA 5EU6A 2Z8WC 3S35H 3PWJA 4FQCH 3RDTC 2J8OA 4GSDL 4MSWA 4PJIF 3ULVE 1FHGA 2IAND 3IKCB 1XGRB 3X11A 3UC0L 1F00I 3DO7A 3D2UB 1RK1B 2CQVA 1IC5H 4OQTH 5IVXA 5DC9B 5DRWB 4K3JH 4NO5B 3E0GA 2YPKA 4QRPB 3HN3A 4RBPH 3MJ8A 4WWKD 1I7TA 1NBVH 3ZKXB 2ZCKL 1YEJL 3MV9D 3RNKA 3WMSA 3BZ4A 5D70L 2EDTA 3DX7A 3L3OA 3WDHA 1VFMA 4KI5D 1VENA 2NY7H 4RAUB 1N64L 4KV5E 1P9MC 3FO0L 4Y8AA 3FONA 5E8NB 3GJFK 4IOFD 2VITA 3GMMA 4NZUH 4R8WL 4JRXA 1SYSB 3DI3B 4AL8H 3VXUA 1JIBA 1WWBX 3QDJA 4Y88A 1MCOL 5DJ6A 2YPLA 2PW2A 2WBJD 4QOKB 4WW2C 2VLRA 1W0WB 3WIHH 4HS8L 1G6RA 1A9EA 5K9OA 2HFGL 5EUOB 5A2LH 2GJZA 2P7TA 2XTJC 4HMDA 3EJZC 4HF5L 4JPWH 4QT5B 5KOVC 1VACB 3BZFB 4ONHA 4D0DB 5C86A 3BPLC 1UACH 2WZPD 4HK3N 4PGCA 2O61A 3QEUA 1GGIH 1T2QH 2QSCH 1CN4A 3TYGH 4P9HH 1RFDL 2YA1A 1FNGA 3MLYL 4S2SA 3KPNA 4LCIL 4UOJA 2VLJE 4WHYG 4JM2A 4Z8FL 1R0AL 3P0GB 5E4IA 1Y18B 4OM0H 1X4ZA 1B2WH 4X5WB 3MLPA 1N59A 3RKDC 4QNPE 3JV0A 2NY6B 3W9EB 3BEWB 2F5AH 1EUTA 1QBAA 4JCLA 4WW2F 4XP4L 1AIFA 2J8HA 2WP3T 5E8EB 2Y7QA 5CSZA 1IMHC 1GGCH 4IHOB 3RZCB 2VXUL 5D1ZA 3RJQB 3TFKC 2BNRB 1IBGH 3LV3B 5F8QC 3KPSE 1KUMA 3CFCH 4XC3L 2DQIL 4U6YA 4XI5D 3VH8B 3OKDB 1HQ4B 3GUTA 3UTTD 4F7TA 4WUUE 3MUGB 3FQXA 3G08B 3MXWH 4GMTL 3QDMA 3GSVB 4GW5B 4HGWB 1FYTB 2V2WB 5KSAC 5ANMA 3UCRA 4M1DH 4XZUA 4DZBA 1P5UA 4JY4B 1HXYA 1VSCA 2JB6B 2HJKB 1A6AB 1JYXA 1UEYA 4QF1A 1MJ7H 1T04A 4XTRC 2NY0B 5D93C 3TBVA 3AM8C 3EDJA 2F54D 3PHSA 1KC5H 5DJDA 2IPTH 2MWCA 1RZKH 5AD0A 2ZG3A 5MI0B 1J5OH 1G6RH 4MA1B 4ZTOL 2AV1B 1FL5B 1HH9A 4H26A 1CTOA 1H0DA 5C0FA 1A3RH 3C60B 4TSCL 5C6TL 3D48R 1CG9A 3FHQA 4MVBD 2VMFA 1BQHB 2EIZB 5DUMH 4Y7MA 5FOJA 1ZGLM 1UG9A 2FH6A 5DRNB 1CF8L 3DO3A 4OB5L 4P3DA 1FNLA 3RL1B 3WDIA 1TTUA 2A9MH 2GJ6B 4ORGA 1ITCA 3SE4A 2RIKA 5I66A 4KZEH 2YD4A 3O8XB 3KPPA 3QWOA 43CAA 1NGZB 3B8YA 5GJSL 1OGAE 3I6KA 4XVJL 4J6RH 1GC1L 2DTMH 5DJYB 5BZWB 3FCTB 3PGCB 4OZFG 1IGFH 5I1KH 2NZIA 1FL3B 4JAMA 4I0CC 2KPNA 4ENEC 1A5FH 4ZFOB 5J4MA 5FGCE 5IJVB 3JTTA 5IHUL 3SDDD 4R3SA 1I75A 2E9WA 4ZFZA 3CAFA 1BQLH 2UWEB 1YEIH 3RWJA 1C5DA 2VDPH 4XRCA 4HXAH 3T3PE 1ZS8B 2VE6B 2Z31C 4RIRA 1WJ3A 3H3PH 3JTSB 5K93A 5IHBA 1U8NA 1R3JB 2BY0A 4C83B 1V3KA 3SCMA 2XN9D 1LK2A 3BWUC 2BDNH 5ERWA 4YFLF 3BDXA 1BBDH 3MRKB 4K7FB 4R0LA 2CO6B 1X4YA 3KXFA 1FRGL 5EU3B 3D5OF 2PW1A 4KJYA 4DEPC 2X70A 1ODAA 35C8H 1I3GH 1CXKA 1CR9L 2PXYC 4PR5A 5TE4H 2LU3A 4F7EB 3T0EE 4MD4B 2E9JA 4M5YL 5FK9A 2IADA 3B83A 1FORH 3MNWB 4PJ9B 4Z7UA 1BJ8A 5JR1L 4GAGH 3ULUH 4I9WE 2YUVA 1MIEL 3BN9C 4N8CH 5MENE 1CU4L 1U8QA 1CYGA 5EWIL 1J1PL 2RGSA 4B53A 4PJXE 1R3HB 4NC0B 1YN6B 2IH3A 4UQ2B 5BOZG 5AZEL 1GC1C 4J23A 3P73B 4BH7A 1YJDC 1L7IH 4HUWA 2CKBL 5IJKC 4OFKA 4QRRD 5J1AA 1JGEB 1RUKL 1L9NA 4HUXA 1A9BA 2VAAA 4U1KB 4DN3H 5JDJA 4WENB 5DT1H 4CVZB 1F58H 1CT8A 4F7MA 5GGVY 1AR2A 1U3YA 2RCSL 1QQDB 5BCAA 1QRND 3ARZA 4PP2A 4X99A 3D0LA 3GHBH 2ZOLA 4TPRH 1I7UB 5EIIA 1ZGLP 3JVGC 4TUKL 4XNQA 4OCYL 5HVGB 2A83A 1S7SB 3GNML 1WIPA 3CSYB 1XR9A 5DXWA 4OTXH 2VLMD 2YRPA 1A6WH 4Z7WE 4GKZB 2YMXL 1JZ5A 3MBXL 2FJGA 3MYJA 4QRPD 2NTFA 4YHIA 5CJQH 3NPSC 1ND0B 2JELH 1CXFA 3ROOB 2ARWA 1TENA 3H9YA 2HVJA 1W0VB 3T0WA 3AXLA 3V6FA 1YEFL 1L6ZA 1YQVL 3U7AA 3QIWB 2EKJA 1D5BA 4JO4L 3K0WA 3VI4E 5F96L 3WXWH 3P2TA 4FQXB 3LMJH 1XGQA 3EFFB 4NZRL 3ES6B 3QISA 5FYLL 5B3NA 1JTPA 1UZ6E 1NBZB 4QOKD 2YC1A 4H1LB 2Z0BA 1S3KH 5HHVH 3ZE2F 3BFOA 1XCQA 1C5CH 3ZTJH 4PJBB 3PWLB 2VLLA 3M1BA 1FNHA 4HMEA 4TULL 1HSBA 3F58L 5IEKB 4QRSB 2R1YB 2R2HA 3LQMA 3TH2T 4XXDB 3JV6B 1MFCL 1UB5A 1S7WB 3S34L 4KKCC 1M6OB 4YZFF 3VXTB 3TBTB 4OFYA 5ICXB 4WIQA 5H37H 1TCMA 2Q8AL 1VPOH 3BPCA 2IH1B 5JUEL 5L2JA 4P23A 1S7UB 4LSVL 3QIUA 5D9SA 3PGDA 2F8XC 3F65A 1BPVA 3EYVA 2Y06L 4LNRA 4PRNB 3GGWB 1KJ2L 3EIFA 3Q6GH 3HAEA 3KS0J 5IK3A 2N56A 1T0NB 3QQ4B 5JPMA 2JJTA 3QDGD 2XZCH 1NKRA 2NQCA 2UUDH 1T2XA 4HW6A 1OD7A 2V5RA 2BNRD 2OJEA 3CH1B 1KTKE 3JZ7A 3MGOA 4FABL 2FWOB 4X7SL 3A67L 5I2IA 2OL3B 3IDMB 1NC4A 3G5VB 1RZ8A 3HMXA 3MOQA 3RUGE 3T77B 1BF8A 5GSVA 3Q2CA 4FQCL 1JI1A 3TNNA 1EBAA 3ESUF 5I74C 2HTKC 5FYJH 1FYTD 1HILB 2P5ED 3RVXD 3BQUA 4AT6B 5TE6H 4PJAE 4RWYL 1CBVH 5GGTL 1W0YT 2CXGA 4P4KA 3WE6B 4AQ1B 4DOHE 1WITA 4OQTL 2YD9A 4R96A 5A2IH 4YIQA 5JXEC 3PXHA 1OM3L 1NBVL 3QO0A 4PFEA 1LK3L 2VLJB 3OAZH 5I8OL 1QVOB 2BHZA 3RP1A 2ZJSH 5DJ0A 4ZOBA 4TTDC 4KK9C 5I8EA 3P11L 3WUZA 5H35A 5IF0A 1YEDB 2IEPA 3DLQR 2VTFA 3C60D 3VRIA 3PNWB 1RV6X 3U2SB 2BVUA 3MR9A 3OGCB 4M8QB 2VXTL 3JBG7 4MD5A 3PJSA 1U3HD 2HFTA 5EIVA 2XYCA 5IM7B 4BQ6A 5CJXA 3VXME 5F7HA 4MCYA 3OAYH 1LDSA 2ATPA 2P8PB 1HXMA 5LG1A 5DMKB 3BDYH 5KSVA 4CVUA 3C09C 5E2VL 1VHPA 5CD3B 1H15A 3RY5A 3WEXA 4FXLA 5JZ7D 4P59H 5F1IB 3PGFH 3S7GA 1BQUA 5C0NC 4JPWL 3P3YA 4PRAA 4WUUB 1UACL 1NMAL 2BSSB 3DUSB 1CIUA 1GGIL 3HAEH 5INCB 3HRPA 2GSIB 4FRWA 4PB0L 4NQVB 2QQKH 2BERA 3LN4A 1FE8H 5C8JA 1ZANH 4X4XB 1B2WL 1PEWA 1FZOA 2Q20A 2NY3B 1B90A 1RZGA 2DKMA 3REVB 4BYHA 3KYMB 2VOTA 4DJMA 3HMXH 4P2OD 2F5AL 4KMTH 2XKSA 4UUJB 3SQOH 5L0QC 1IGJA 2NY4B 1WZ1H 4MCZA 5D1XB 2H2SD 3GMRB 1Y6KR 4IRSD 1JPGB 4ZNEA 2YD1A 5E2JA 5D7IA 4QRTB 1EAPB 4CBPA 1KLUA 4HQQH 5E7BA 4ZO9A 1QR1A 3QJHB 4HH8A 4E0RA 3HS0A 5ITBL 4Y5VC 5DQ9A 5HGAB 4JQIL 1LEKA 1R3LA 2IBGA 4RQQA 1UWGH 2BY2A 4V1DA 3UDWC 1NKOA 5C2BL 1AC0A 3B3IB 5HHMB 3VXPA 3UPRA 4ORZC 5FGCB 3PQYA 1GYAA 4FNLL 5GZNC 1LQSR 3SKNB 3ZKND 4L9LC 3DXAA 4LGPB 4YR6A 4PJGF 1JF1B 2JE8A 3VWJB 4K7PY 3SGEI 1J5OL 3U4AA 3AUVA 2X41A 1U8PA 4X7TA 4HPYH 1G6RL 4NRXB 4GRLD 4JB9L 4UNUA 1P2CB 2GI7A 4MA8L 4PRPE 4LLDB 2HT3C 5DYOB 1SY6L 5IHZB 1CS6A 2XA3A 5DUML 3QR2A 3AAZA 4ESKA 3GMPA 2VUYA 4NQCD 1DQMH 2NY1D 5T5FH 1IEHA 4KZEL 3BYYA 3HB3C 2V5SA 4O2EA 3DX9B 2HKHL 4RA0C 1A6ZA 3EO1A 5ISZD 3H42L 1SJHB 3F7VA 3MLVL 3TNMA 1X5YA 2NR6D 4JLRA 5E24E 3DETC 1CGTA 2X42A 4JFEB 5MENB 1DVFB 3HE7D 4JFQA 2EYRA 5HYJE 1P7QB 4LLUB 3K1DA 1QFOA 4J3TA 1G7IB 2EDKA 3TZVC 3HZVB 2WSKA 1S9WA 2CR3A 4FTVA 1ONQA 1NGQH 4LARH 4PGDA 1YA5A 2BDNL 5EUKB 3ARDB 4MQTB 1RUPL 4ELMF 3ULVD 5EFIA 1FJ1A 4ODTH 1NMCC 2BY3A 5TE7H 1VADB 5D7SH 2MFNA 3OR6A 3K2UL 2PR4L 3FT2B 4JDZB 4JRYE 4NYLA 4ZODA 1CFSB 2GIYA 1AJ7H 4WW2A 3WFHB 3GSRB 4ZAKA 4NC2B 1YEHH 3TVMC 3DRTA 1PJ9A 1JL8A 5FA4B 1HKLH 1U42A 4N8CL 3UTSA 4PY7B 1FFRA 4KZDH 4HJGB 3IDUA 5JIKA 3S36H 2XPGB 4XPFH 3KYAA 4XAKE 1JGUH 3U0TB 1M7DB 4HZLA 4XH2A 3LSOA 3QNYA 1Y6MR 5CHNB 5DT1L 1CLYL 4HT1L 3ME0A 3IAPA 2NXZB 3T04D 1A3LL 3ZE0E 4MHHG 2ZZUT 2BNQE 3GHBL 1MHHA 1H3PL 5K59F 5ABDE 4FFZL 4CRPA 2X89D 2V9QA 4UDTB 1JGLL 1PQZA 4DVBB 4L5FL 5EA0L 4QTIL 4X6FB 8CGTA 3T0DA 4U7SA 5DD6A 3RWHB 2JELL 3AU1A 1UM4L 5EU6E 4HD9A 3VFPA 3FZUC 1W8OA 5T3XE 4HKJB 4M5ZH 4LLWB 2EO9A 3BW9B 3LEVH 3IFPB 2PETA 5HI5D 1FO0B 4WV1C 1RJZA 5I8CA 3UO1L 5IVXE 2AXFA 5KSAA 2F53A 2WNGA 4LPVA 3LMJL 2VJXA 5GS3A 2B20A 1CICB 3CVHB 4JFDA 5C0JB 4F9LC 2HH0L 3AM8A 4GRWB 1I1AB 4HBQA 3RVWD 5HI4C 4R4FH 1DR9A 3KPSD 1PBYA 4IM8A 2DLFL 3LH2H 5E9DD 4GBXA 1IAIM 3RUGB 2EXYC 5EN2A 1QLFA 1QZ1A 3WLBA 4WUUD 2X09A 4JRXE 1LP9A 1NLDH 3VXUE 3W9DA 1DE4A 2DBLH 3QDJE 4E42B 2YPLE 2UZYB 4QRUB 1LD9A 5I17A 4PJAB 2VLRE 2AK4D 5H2BB 1R5VA 3DRQA 1NGYB 1YPZB 2UZIH 5I9QB 4F3FA 2VLKA 1MCRA 4TSAL 4UAOC 1QEWB 4LDEB 3CMOL 3TO4C 5C07B 2P46B 2OXHA 4ACPA 3QUMB 1TCRA 2UYLA 1S9VA 1OB1B 2B1AH 4XCEA 1J0IA 1YY9C 1HN1A 4C56A 1HE7A 3PABB 2YXFA 3CC5B 3NN8A 3CFEA 3M07A 2GY7B 4XCNA 5LKNA 3F62A 1V5JA 3IJHA 3MFGB 1W72B 2VR9A 3EO9H 1JHTA 3C8DA 1D9KB 3QXTA 2K7PA 4IIQC 5TDPB 1G9ML 1UFUA 4F57L 3TLRA 3BRFA 2R0WH 3VRLE 1G7MB 2WUBH 3UTPD 2ITDB 5EORH 4M43L 1NDMB 2C3VB 4XWGH 2X4OA 2R29H 3MLTA 5B8CC 2L7JA 1S7VB 1OGAD 4AENB 4XMPH 5FYJL 4YWGL 1OOAA 2VZSA 4GS7C 3N1MC 3GMLB 1K3ZA 3C5ZB 3RY4A 1TFHA 3NACH 4QXTA 1MHCB 4G80A 4POZC 3QUXC 5CBEA 2XZQL 1FDLL 2JIXD 1IQWH 3L3JA 4NCC2 1NJ9A 5E6IB 4XP9H 4MJ5B 4KMLB 3RU8L 4LLYB 4TSBH 3QDME 2HKFH 1KN4L 1MREL 5ANME 1C7TA 3I3BA 4PP1C 4APQB 3P0YH 1YDPA 3OKEB 4OLVH 4XNMB 3ARED 4M9OA 1TVHA 2DKUA 4G6KL 2QADB 2VR4A 5IQ9A 3JWDH 3QT2A 4OD2A 4D2NA 3ULUE 3MUHL 4I77H 5I8KH 4OGZA 3B9KC 2DN7A 3P30L 3C8KA 3EO0A 2XWJA 3T0ED 3L3KA 1HYSC 4PYHA 4M6OL 4G8GA 2X4SB 2XRAH 1WWCA 3ARRA 3MRRB 3VWKB 3CDGB 1IZKA 4YHZH 4I9WD 3LIZH 5AYQA 5SX4H 4HWZA 1KYOK 3WS3B 4XPTL 3VD9A 4H1LG 1J0JA 5MEND 4P46C 4S0SD 4CU6A 5TF1H 4XNYH 4G8EA 3G6JA 4XP1H 5B3JF 4NQEB 1VKXA 2EEDA 4MDIA 1VFBB 4A6YL 4NWTL 4Y1AA 4MAYA 6FABH 1FFNA 4M3JA 2R69L 4KPHL 1WZKA 1ZSDB 3O11A 1S5IL 3HNTH 3ARDD 4EI5D 5GRJH 1V8HA 3BESR 3D3VB 1AQKH 1UWXH 3H7BB 3OKNA 2FZ3A 2X4QA 4UOW1 5SV4A 5L9DH 3NCMA 3NFPB 4KK5C 3JV4B 2VN4A 3V7MA 4EXKA 1KEGH 2H1PH 5IB2A 4OIAA 4LF3A 1A02N 1D5IL 4ZUVA 3QXDB 4U1GC 3B6SB 3MNVA 4NUJA 3HFML 3P4NB 4U1MA 4DGVH 2VKXA 4WDIB 3KXFE 1X5GA 1EGJL 3KHQA 4JKKA 1XCTA 4MAUL 3QULB 3SKOA 5ESQB 3O6ML 4NUGL 1JPTL 3FB6A 2J5LC 2NZ9C 3GSOA 5BV7B 5C9JB 2Y5TA 5IBLD 3NIGF 1OL0A 1FLTX 1YJDH 4PD4K 4Z7UE 4LAQH 3W11D 3PWUA 1DQQB 3CZFB 1ZLVH 1RIHH 4ZFFB 1JNNH 4G6JH 2C7UB 1UKQA 3PE9A 3LN5A 4HIHB 1MI5A 5KVEL 5F71A 5HYSB 2CXKA 3GIZH 3LKOB 3TEUA 4D0CB 4BQBA 5L7XH 1IEAB 3O3AA 5F9WB 1EX0A 4DKEH 3IGAA 3SDYH 4QHLA 4LEXH 5D6DA 4Q9CA 4R7DA 3T0XA 3L3IB 4KRMB 3E2HC 4GQPH 1BM3L 5T1LD 4OZHF 4OM1H 3IB4A 1MCDA 1T2JA 4JRYB 5BS0D 1AGBA 1WC7B 2Q3AA 1MIMH 5LQBH 1OAQL 4CJ0A 2J6EL 1XR8B 3EYFB 1YC7A 2Z35B 1GOGA 3BO8A 4PTUB 2A38A 2X7LA 3VDCA 3TBYA 3BKCL 2I60L 3O2VH 2AW2A 1NFDB 2ZUQB 3EOBA 1V3MA 1ZTXH 1JWMB 3V5HA 1X4XA 5DJ8A 3S97C 3D69A 3IDIB 3QUYC 5FYJE 25C8H 4JHAL 3MRQB 2IPUK 3KDMA 3F7PC 3QUKB 4LBEB 3P0VH 3F12B 2EIEA 1AD9B 2BNQB 3MBED 5CBAB 4LPWA 4XB8A 1A2YA 3C6LB 5K9JH 1UYWL 3O9WC 3CU1A 4JDVA 3RBSA 1HNGA 5DMGC 5FUCE 4ODTL 3MRMA 3ZDYE 4GXVL 1NLBH 3FB7B 3IJSB 1WF5A 4LPUA 3V6OC 5DVMA 4UI2A 4PLKC 2P4AB 3VCLB 3O4OC 4WI4A 4OZIB 4S10A 3MRBB 3B8SA 4WFGE 3PWJB 4LRIC 1JMZA 4GXUM 1RZ7L 4MSWB 3GRWL 5GGQL 3TIDA 4HAFA 1KELL 1IILE 4Y5XA 3X11B 4U1IA 5C0GB 1UC6A 3DO7B 5FB8A 2V2TA 5IVXB 5IBTL 4ONFH 1U6AH 2FO4A 3WXVL 5I30L 1DLFL 3TT3H 3HPJA 3MJ8B 4R97C 3S3JA 3VXMD 1UKSA 1I7TB 3GSNB 3GMQB 4BFIA 5ADPH 2R56L 3DX7B 2WK2A 3L3OB 4P5TD 2ESVD 3IAQA 4MB4A 2X1OA 5CGYC 3HC3L 3FRPG 5CWSA 2XZAH 1JYVA 1U8LA 3T09A 3FONB 1KCVH 4WTZG 1B6DA 4PJGA 4JPKH 3C5ZD 4XMLH