3TEUA

Crystal structure of fibcon
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
MLDAPTDLQVTNVTDTSITVSWTPPSATITGYRITYTPSNGPGEPKELTVPPSSTSVTITGLTPGVEYVVSVYALKDNQESPPLVGTQTTGGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Fibcon
publication title Design of novel FN3 domains with high stability by a consensus sequence approach.
pubmed doi rcsb
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2011-08-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3teuA00
5HYEA 1VEOA 3HKFA 2VERN 3U0TB 5DO2D 1A14H 1A7OL 3C2AH 4QRRA 2GUOB 5GGTH 1EMTH 2BMKB 2AABH 4XNMA 4GSDL 4QXTB 3SY0A 5T5NG 2CKBH 1UH4A 2KZ1B 3DECA 1OGAD 3DXAE 4OD3L 5EBGA 4GUPA 2FDBP 4HJGB 5GGVH 3HPJA 3QXVA 3A6BL 2CSPA 2VLRA 4WIQA 1CICA 5C7XL 3O9WD 3VXNB 3SCMD 1NFDF 2F58H 4M3JA 1HI6B 2XWJA 3UYRH 4AY0A 2AGJH 1QLRA 2E9JA 1P4BL 4P2OC 3UTZB 5BVJB 5E5RB 4FG6D 3C87A 4YHIB 1GOGA 2YD2A 4L4TD 4MSWB 1MEXH 2YPLE 5K59E 3QQ4A 4IRJA 3V6BR 2QSVA 4LCUB 4P2YA 1CK0L 4OV5B 3TO2B 3BGAA 5EU4B 3BPOB 2Q8BL 4JRXE 3H42L 3SBWA 1T3FB 4WI9A 3S5LA 3VXQB 4UOW1 2EYSA 5CIPA 4D0CA 5FV1L 4H1LH 4BZ1H 4L3ED 4TULL 4YBQC 4APQD 4DKAA 2P5WA 1A6WH 5IJKC 2AJUL 2R4RL 4TUKL 1T1ZA 5IQ7H 3M8OL 4HAFA 4NO2B 1G9NH 4Y16C 3PHQB 5IG7B 4TUJB 4PJHF 5HHOD 4FXLA 4Y19B 3WFHB 1IFHH 4IRZL 4MXVF 5C1MB 5HVGB 1P7QA 3BN9C 3D0VA 2JCCE 1OWWA 3ULVD 2ADGA 2DQGL 1TITA 3CFCH 2YWZA 3FKUS 2Y6SD 5C9JB 4AEEA 3MLTB 4K7PH 4LPXA 4DZ8B 4QRUB 1K4CB 1AXSB 1FL6A 1CDHA 1P5VA 1PVHA 1U8MB 3CFKA 1BGXL 3NH7L 4NHCH 1JE6A 1ONQB 1QBAA 1K4DB 3U7WL 4AH2A 4XC3L 4N0UA 3AAZB 3O6FD 4KRPD 4R96A 1GIGL 4NZTL 5BV7H 2PYEB 3AU1A 1QLRB 4PJ8D 4TTDC 1EFQA 1OTTC 4JM2A 1A7PL 1KENL 5D2LB 4OV6F 5GRVK 1AR1C 2NTFB 3UTTE 4MJIB 2FH8A 4LRNH 5L2KD 3GNML 1Z0NA 5TDOB 5SWZE 1RUAH 4TSAL 3C60B 3QUXA 5TQ2H 2B1AH 2P4AB 4NQSA 5GS1B 4JHWL 4OCXL 3C8KA 3T4AB 5I19H 4I0PC 4CVZA 1I7ZB 4HIHA 4FTVB 2YD7A 5LXGL 3NIDE 5DEGB 4P4KB 1SY6H 5JOFA 2FWOA 5SV3A 4C56A 5L8JB 2GHWB 4MCYA 4OQTH 3SGEI 2GTZA 3Q48A 5L8LB 3WS3A 1A6UL 1PEWA 4G7YH 4X7EC 3OHXA 3I9GH 4LRIC 4N9OB 4RGNB 2QR0B 3IETA 1YN6B 4YXHH 3RY5A 1LO3H 4HKXB 4ODXA 3D0VB 5B3JE 1AE6H 4WO4D 3KPRD 4KPHL 4XP4L 5HGAB 2NX5E 4NQDB 2Q20A 4XCCL 3C6SA 4M62L 1OAQH 2R2HB 4N1CA 4H25A 3S4SG 3H3PL 2L7UA 2AK4E 2UVFA 1GHFH 4MQ7B 5FO9A 5JIKA 1SJEA 3TO4D 1FJ1A 1WTLA 3SDCA 4OLWH 3P4MA 1XEDA 1DQTA 5AZ2H 2P1YA 4DZBA 5ISZE 3VFTB 1ADQH 1RUQH 3MLSL 3FFDA 3GDBA 4F58L 4XBPB 2VITA 3LPWA 5B8CA 5A3ID 4FFYH 3UPCA 3LH2L 1F3DH 4ZO6A 2VDRH 3UBXG 4D3CH 4OM0L 1OCWH 2W0LA 1BEYH 4JFZH 3L5JA 1Y0LB 3DETC 4HPOL 2D7NA 3VXMA 4HS3A 3MGTA 4JO4H 3SPVB 4PRNB 2VDQL 4HIIB 1NBQA 4HX1B 1FGNL 3C8KB 3MPCA 1P6AB 4U1LB 1AI1H 1MQ8A 1ZWIB 5BZDB 2YUZA 2NY0C 4XWGH 2Z35B 3CNKA 1I4FB 3STZA 3SJVE 1AY1L 2EH7L 4P9MH 2HFFA 3KPOB 2IBBA 3L3JA 1CFTA 5FO8B 5IOPA 3QB7C 4HWEL 4Z95H 1OTUC 4UT9L 5F44A 4D9RE 5CEXB 4N9GB 3ZHLA 2EIEA 1LO0L 4OZHA 5A1AA 4HUMB 5BS0E 5GRJL 3NCEB 4YFLI 3JTSB 5FIEA 3F7PC 4JFEA 4Q6IC 4UIMA 4DVBA 2X1PA 4ODXB 5EO9B 3DPBA 1RVFH 3T4YB 3IFPB 2R4SL 4M9OA 3O3DB 3BH8B 3O2DL 3HPLA 5F7DB 1JPTH 4JR9H 3C8HA 3MNZA 1JPFA 2EC8A 2F53B 2V7HB 2OL3A 1VACB 3PP4L 1RIVH 5LGKA 1GRWA 3MMEA 4PRBB 1LO5A 2V7NB 1TZHB 4QOKB 3VGBA 2X7LA 3MNWB 5DRWA 1SVZA 3IDMB 5FHBH 1VFAB 4LLVA 4G6ML 1NJ9B 1CGSH 3N85L 3QUZB 3SKJL 3F12A 3RA7L 2ARJA 3SE8H 1I75A 4HF5L 4PD4K 1FG2B 1R0AH 1AGCB 3AUVA 1T1YB 3V4VH 3TVMB 1QRND 4LCCA 1DEEB 1B0GA 5A2KH 4QRPE 4Z8FL 4AG4L 3WS6C 2ZOLB 3ULVF 2HKFL 4JPWH 2EKJA 2VDLL 1JUFB 4TOYL 4HS3B 5HHQA 1HQRB 2ICEA 5I17B 3G5VB 5IQ9A 4MS8C 4X9GA 1AXIB 3RUGB 2VC2H 3NBNA 2J8HA 1JN6B 1VADA 2G2RB 1ZA3A 5JHDB 1TJHL 3O11A 4NFDA 5I30L 5HYJA 4OLVH 3M17A 5CBEA 4AZ8A 5IOPB 2C3WA 3D85B 1QFWH 2Y07H 2OXHA 3GJFH 5HHMB 5AZEH 1R24B 3F7YA 2NY5L 2R39A 1TCMA 4HGKC 2DLTA 2XIDA 3GUTB 3VFUB 4JJ5B 1AH1A 2WIMA 1X5XA 2AEWA 1IC7L 1LK3L 1I1FB 1AD9B 5EC1B 3C5ZC 4Q9RH 3LMJH 4N8VA 3GRWA 5IW1A 1I3RA 4X9BA 5D71H 3JWNC 3NOIA 1EEZA 3LCYA 4NDMB 3U2SB 5JPNA 1FFQA 1PG7X 3SDAD 3DO3A 3CU7A 5GS0C 1Z5LA 4QHMB 3QWOB 1Q9KA 3TYFA 2CDFB 1GGIH 3REWA 4M6ML 1AIFA 4XNUH 1KIQA 1JPSL 4XP1L 1G7HA 3GM8A 5EBLB 1N3NA 4OGAD 4KY1H 3DROA 3W0WE 4LSDA 4GRWB 2E7MA 3B9KD 3ZTNH 4R26H 1V7MH 5IUSA 4GW1A 1OAZH 4HLZH 3HFMH 4FQ1H 4PTTB 4HIEB 2D4DA 2ZUWA 1IE5A 3GSVA 3RX8A 5HHPA 4PS4L 3LQMA 1J12A 1J9CT 4D9LH 4J3VA 5DVMA 2I60L 4IRSD 5EU5A 1N6UA 1INDL 1ZLUK 3IDXH 1FVDB 3QPXL 5F7UA 2ICEB 5F88A 1RZFH 4CNIA 1R3JA 3JV5A 4IDJH 3VFWB 2D4FA 1T1WA 3S96B 1A4KB 2QTEA 5SWQB 2BVPA 2AP2A 4H0GA 5T5NF 4U0RB 2VDKH 3ALXA 4HJJL 3ZT5A 3IRPX 5HYJB 2C1PA 4RNRB 4IS6B 2PW1B 4H26B 1MCPH 1C08A 2ZPKH 4WFHD 2OQJA 1EGJL 2H6PA 2EZ0D 4YPGB 2XWBA 3UDWA 3GHEL 1SBSH 1SYVA 5KS9E 2YMXH 1DQML 1YY8A 1C5DA 3CDCA 2V17H 2EDHA 4Y5VB 4K3EH 5IW1B 1I3RB 4HK3N 2FO4B 1F6AB 4ZTPH 2DQJL 1RV6X 4EN3D 4LF3B 3RPKA 4CU6A 4KTEH 3PQYB 4JKPH 4YDKL 3RVXD 1OAKH 4OLUH 3D0LA 3GMQA 1W72H 5I1KH 5GJTL 5BO1L 4H8WL 3VG0L 4MNGB 3QUYD 3I50H 1YDPB 5DZLA 5DFWH 4NM8H 3BWAB 3T2NL 3BEVB 2UUDK 4WWKA 2HFTA 3X17A 1E4WL 3WO4B 5GGSB 2F8XC 3FO2B 5D8JH 3BJ91 5GGRY 1DBBL 1RK0B 4PJCE 3IXAA 3BO8A 1D6EA 1IGMH 3PV6B 5TE4L 4RAVB 2WUBL 3TPUA 4OTXH 5TF1H 5F93C 5IBLD 3GMPB 2Z4QA 3BW9A 3N1FC 5D72H 5T3XE 3DV6A 1CXIA 2MKLC 5DSCA 1LNUA 4LHJB 1PX3A 3DXAA 5ESQA 3ZTJG 4Q7DA 5JZ7C 4HZLA 5FYLE 1C5CL 4XP5L 4TRPL 2X4PB 2VSDA 3G6JE 1QLEL 2IPTH 5D1XD 3WNKA 3ULUC 2HVKB 2P5EB 1NQBA 4RGNC 4X4XA 4R4FL 4M5ZH 5BRZE 2HMIC 2BY3A 4FNLH 1NDGB 2GSIA 2YPLA 4KI1A 3N9GH 3S37L 1UG9A 1S7XA 3UO1H 2CMRL 4F7TB 1UM5H 1H8OA 2VZ3A 3MUHL 1VFBB 3MCG1 4LLYA 5ETUA 4JRXA 2R2EB 5DS8A 4FZ8H 1Q1JH 3RQ3A 5KW9L 3VH8A 1HKFA 2NYYC 1JWMA 3SDYH 3BZFA 2X41A 4GRLB 1HKLL 1A9BB 1T83A 4LSVH 1XR9A 5C0AB 5L0QB 3BGMB 4KJQC 1MHEB 2KKQA 1LVEA 2HRPH 4I8DA 4JM2C 3LQZA 5C3TA 1FDLL 5E99H 4UDUB 1B0RA 2JCCA 5CBAA 4JREB 1NANI 3QUXC 5D7IF 4OI8A 3KDMB 1ZANL 4MX7A 4U1GC 3MRGA 4N0FB 5BXFB 2X4SA 3ZHKA 4KFZC 5LAXB 1PBYA 3TPUB 4O58L 5AEAA 1NSNH 2OTPA 1V7NL 2ESVD 4KU1A 5IHUH 1UKQA 1KFAH 5I6XB 2BVOA 3WJJA 1YZZA 2K1MA 4OZIB 3FB5B 3ARBB 3QCUL 3EYOA 3MV9B 1U8JA 2YPVL 3ILQD 1G0DA 4YBQD 4X0KB 4JFDB 2UWEB 4BYHA 2VDPL 1CLYL 3DTXA 5ABDE 4X4XB 1T1XA 5MP6L 2OTUA 1J18A 4XPGH 3UTTA 3ARFD 1RHHB 3SDXE 2OSLB 1A7NL 5SWZA 4DGYL 5JUEL 2IAMD 3V6FB 4KQ4L 1CVSC 4JFXA 3NFSH 5J4MA 1WZMA 2X05A 3HG1B 3QRGH 2EDOA 3WKML 3MSPA 3F8UB 4I18B 4HBQA 4LLYB 2DDQL 1VERA 2C9AA 1U8NB 2D7MA 43C9B 1BD2E 2AQ2A 3O2DA 4GAGL 4JANA 4ONHB 5DMIH 1F4AA 3V52L 1FZKB 3V6OC 4CDGC 4GXVL 3MGAA 3X14A 1KSRA 3T2OA 2GFBB 4S2SA 1FZOB 1NL0H 1QQDA 1H3TA 2EIZB 2BHUA 3Q2CA 4Y4KA 5J3HD 1XGRA 1NDMA 2B8OT 1KT2B 4JG1L 2VDOL 4K8RD 4ZDHA 3GSUA 3KWWA 1UXWB 1MQKL 1Q8MA 1KEMH 1YUHB 3P4LA 4J3WA 1NMCB 3GSRB 4PJEE 3MRRB 1J87A 1JNHB 1UCBH 5DK0B 5E24E 5F72S 4JHBA 1Y18B 2OTWB 1P84J 1I8MA 2NX5A 4P2RD 5A43C 4LSRL 1EIBA 2EEAA 5LCVL 4OIAA 1JYXA 2AK4A 2R1WB 1T0NB 4E41B 2FH6A 5TDPB 1V8HA 5D7KD 3BKJH 1UXSB 2CLRB 3FFCB 3DGGA 3KYKH 3ZE2F 4F8TA 1OSZA 3O4LD 4ESKA 3H0TA 5ISZA 4PLJC 2ADJB 4LLDB 3RTQD 4CUCA 3OAZK 5DT1L 2PXYB 4FFWD 4GAJH 1UCTA 4XWOC 1MWAL 1NCWH 3BUTA 3GFUA 5D6CB 3UPRA 3ISWA 1OQXA 2VL5B 3MROA 2EYTB 3MLXH 4AT6A 1HXMB 1PDKA 4N0RA 2BJMH 4YHNB 4Y4HD 5IR1A 1OM3L 2DLHA 3MFGB 3LEYH 2XTJE 3W9EA 4LSTL 1WGOA 3N0PB 4MDIA 4X6BA 4EUPB 3QFJB 1NMAL 4C55A 5I1GL 2AQ3A 2VXSH 4UT6L 1SBBA 3SJVA 1CQYA 3BXNB 3SQBA 1MRFH 4TNWK 1P1ZB 3MV8B 4OGYL 1YY9C 2A6DB 1EERB 1IAIM 2CPCA 1XGRB 4Z76B 3SQOH 3C5SB 5BS0A 3FAWA 3H7BB 3ULVH 3STLA 1JMXA 4M61A 2ERJB 1TQBB 2F8VA 2PR4L 4LCCC 4JVWA 3WJLA 4ZUUB 1FAIH 3PWLA 1PYWB 1KB5A 1KJ2B 1HSBA 1U41A 3LB6C 4D2NA 1JZ7A 3BJLA 5BOPA 1KPVB 1LD9A 1D5XA 1MCWM 4P5MA 1NC4D 3UP1A 1Q0YH 2YD5A 5LGHL 2IBGA 1R6VA 4U05A 3S36H 1XR8B 1FO0H 1CIDA 1QYGL 2K9UA 3VXPB 2YUVA 3K8KA 4RMQA 4S1DC 5GSVA 4MA7L 2B4CL 1FFNB 1HH9A 4HCRH 5IIEA 4WU7A 1A3RH 4I3SH 3PDDA 3FRPA 4LU5L 3MLWH 3UPRB 1QUNA 2A38A 4QRPA 1XZ0B 5D96B 5GZNC 3IDNA 4QY8A 3EOTH 4UV4L 5JW3H 1EGJA 1U58A 2DMCA 3VGAB 1NCCL 5J06A 5F96L 3LQAL 3BMWA 1WIPA 4F57L 3VWJB 2C3VA 5EBWA 1BREA 4WHYG 3G5XA 4QRSA 1MCEA 3ARXA 4MJ6B 3ZKNC 5KSAA 2M8XA 4HXBH 3M1BB 3L3IA 1A14L 3NVQA 5DC4B 5GGTL 1EMTL 2KDGA 1FVCB 5EB9A 2AABL 3MUJA 4H5SB 5D1QD 2EXWC 4XRCB 3T04D 4QT5A 3STLB 1S7TA 3VFOB 2CKBL 5F3BA 3QO0B 2JIXD 3WO4C 4WUUE 4RCAA 4LPUA 2MQCA 2WSKA 2XXMB 5GGVL 2H3NA 3GSOA 3PWLB 1QG3A 3IDJB 4RFNB 2F58L 3W5MA 3UYRL 1HSBB 2AGJL 2B1HH 4NHUB 5A40E 2N7BA 4NQXA 4YHML 3LRSB 4IHOB 4FQLH 3MR9A 1T03H 4LHUB 1EZVY 1MEXL 2CIIB 4BKLA 3MYZA 5EPMA 3S5LG 5IHZA 1FNGA 1RK1A 2F5BH 1KNOB 5J7CC 4S1QH 1UVQB 3O2VH 2HN7A 3VA6A 3VWKA 1P9MA 1IGJA 1XF5A 3W0WA 1B4JH 4U1HA 1CDBA 4BZ1L 5ACMA 3MRLA 2J3SA 1GZPB 1A6WL 3UDWC 5F9WB 2IALB 5I8EB 5IQ7L 3GGWB 2FEEI 3EO1B 4M9PA 1ETZB 1G9NL 4XTRC 3BVNB 4JRYE 2Q6WA 1TENA 3L3OB 3LN5A 1IFHL 5HSFA 4Q9BA 4JM4H 4GRLC 3GJEB 4FQCL 2AXFA 1Q72H 2BCKA 5L0QC 3LZFH 2SEBA 1KC5H 2VRAA 3CFCL 2WAHA 1OT1A 5DMKB 4YBLB 1J05B 1MFAH 4K7PL 1B9ZA 3FT2B 3OXRB 5C07E 1VGEL 5FCSH 3U36A 1M7DA 4WTWA 3EGSB 4G9FE 1ACYH 1JRHI 4WWKC 2NY7H 3CZFA 5K9KA 4NHCL 3MRHB 3C9NB 3JV6B 3S34H 2FEDC 4LKXB 1YNTA 5EN2A 5KS9A 1I7TB 1YEDA 2YD4A 5C8JA 5BV7L 1HHHB 3QIBD 3GSQB 3TH3T 3MJ8B 4HUKB 3CLEH 4U0QB 5AAMA 3ARED 3DV4B 2AKRB 1W0YT 5I6XC 4R7NA 4NGHH 4LRNL 1RUAL 4AQ1B 2ITCA 1W0VB 3ES6A 3ARBC 2NW3A 5DHVB 4HBCH 5TQ2L 2B1AL 1D5ZA 1J0JA 1FGVH 2V2XA 2BSRB 4OFIA 5FV2A 4YXKH 1VSCA 5I19L 4JFYB 3L5WA 1FZJA 3QNYA 4XNXH 5KSUA 3FN0H 1J1XH 4YK4C 2A6JB 2OJEB 2VE6A 2I5YH 4PJIF 3OJDA 1BQHA 1P7KB 1NFKA 1SY6L 1V05A 4F2MA 3SE3C 4NN6C 3ELAT 4JKLA 4OQTL 4PJCA 4MNQD 4KJYB 1JHLH 1P84K 1IM3A 2FSEB 3P30H 2CUIA 4L3CA 2I27N 4KVNH 3RWHB 5GPRA 1ZHNA 4I18C 2BXZA 1QSEE 1FZMB 2YD8A 4G7YL 2IADB 5SV4A 3I9GL 2WM0A 1WBYA 4YXHL 1LO3L 5J11C 5HDBE 1WVZA 4CADA 2F54E 4Y0GA 2GJ6B 2ZSWA 2H1PH 1OAQL 4FFVC 1T20B 1JNLH 1NCTA 3G6JA 1GHFL 3O3BB 1REIA 4WEMB 3DO7A 3DVIA 1KCRH 2FYYA 5BRZA 4PRHE 3SO5A 4IOFC 5KZCB 2VLRD 1CYGA 1CICD 4OLWL 4LFHD 1XGUA 5AZ2L 1EO5A 1QNZH 4O02H 5C8JB 1RUQL 3OKNA 4IM8A 4BFIA 1MHCA 4XVJH 1U3YA 3E3QE 3QQ3B 5H35A 4M02A 4FFYL 2VXVH 4LGSB 4Z7WB 4EI5A 4IRJD 2VDRL 5J9PA 5KTEL 4D3CL 5IMKB 1JGDA 1OCWL 3ARRA 4QHKJ 3SKOA 1NCUA 1BEYL 4JDVB 3LV3A 4JFZL 2E9BA 1KLFA 4G8GE 4ZUVA 4IMLA 4JO4L 4BQ9A 4HUWA 1X9QA 5HI5D 2APWA 2P5WD 4GBXB 5IB3A 1FSKB 3L5WB 3P4NB 5LJYH 1JHTA 2PXYC 3P9LB 2P44B 4XWGL 4KMLB 5J57B 4GAYA 4KROB 5B4MC 1BQHB 4L8CB 4P9ML 4PJFF 5FKAA 4BFBD 1RU9H 2I9TA 2YN3A 5AG9A 2HJFA 1BFTA 4CGTA 1MWAA 2YR3A 3WNOA 1P7QD 3GIZH 1XT5A 2DI9A 1TPXB 2NNAA 4J6RH 4OAWA 5TGBA 4J3UA 4RAUB 2PN5A 3HR5B 3PJSA 1CE6A 3HNSH 1T89A 5BW7A 1RVFL 2X4RB 4U4BA 1U91B 3HE6A 1JPTL 4JR9L 4U3CA 4X6CF 4Y4KC 1PLGL 4HXAH 4G80B 1RIVL 3ULSA 4G8IB 1TQBC 2Q7NA 3BFOA 5DYOA 1KJVA 3VFPB 1SJXA 3X12A 5FHBL 5GHWH 1EVTC 1CGSL 5FM5M 4Y2DD 3TJEH 2FL5A 2LE9A 3SDXA 2DWDB 1XGUB 3OAUL 3BP4B 3SE8L 2X10A 3MO1B 1XCQB 1SJVA 4P46B 3Q1SH 1R0AL 4QO1A 1FVEA 3V4VL 1BD2A 4K3GA 2X4TA 1ED3B 2HFEB 2VABB 3V4UH 4MWFB 5C92A 3Q3GA 1NANH 4YAQA 4JCLA 3TV3H 4OZFA 1I9IH 4JPWL 3T0DA 4L9LB 3FOLB 5DJDB 4A2LA 1NBYB 4F37K 3DRQA 2VC2L 4RMTA 2P24B 1JHTB 5IM7A 4BQ8A 4MNHA 5E2TH 4XX1G 4C56D 4KK8C 4G8EA 4JPIA 4PJEA 4N0CD 5DJ2B 1PSKH 4OLVL 3QXAA 4BQCA 2NY5C 1QBMH 1NFDE 3VGAC 3VCLB 2Q1EA 3QXDA 1QFWL 1MWAB 2Y07L 1KIPA 2C7UB 4LAJH 5I66A 5AZEL 1DBMH 2F5AH 1ZSDA 4G6AC 4N8VG 1BZ7A 3IFNH 4OLYH 3WNMA 4PRDB 1B90A 1ES0B 3D3VB 3PF2A 4UQ2B 5I9QB 1DVFB 4G43B 2WINA 4Q9RL 3LMJL 1E27A 3VGGA 1XGYH 3F7VA 2HVJA 4GO6B 1HQ4B 5D71L 5GISH 1OSPH 1JHKL 3IU4H 4HH8A 5FK9A 5IMLB 1EEYA 4OFKA 2FGWH 4X5XA 3TWCH 4RRPA 3ESUF 4P23D 4LLMB 1KYOJ 3SDCD 5DYOB 4WV1B 5GGTA 1GGIL 2R0LH 4XVSH 3O6LH 5IMMA 5CEZD 3MRJA 2CKNA 3CK0H 2V9TA 3WJLC 3HZVB 4EVNB 4XNUL 5I8CA 3B83A 1KJMB 3KYNB 1QBBA 4KY1L 5E6ID 1EXUA 4PJHE 5HGHB 2CKBA 4RFNC 3ZL4H 4A6YH 4D9QD 4JFQB 4EBQH 3ZTNL 4R26L 1V7ML 4LSPH 1OAZL 3HN3A 3TBSA 3HFML 4FQ1L 1HHGA 3EO0B 1AGFA 5IW6B 2GITA 4C58B 4X99A 1BP3B 1H3UA 4CMMA 3MLPA 1NCAH 3Q3GB 5DFVD 3OKMA 1ZHLB 2Z0BA 2Z8SA 2A83B 5TH2A 3MRBB 3IDXL 3JTTA 1AR2A 3KPSB 4N90E 5CHNA 1G6RH 1RZFL 4UIKH 1U2CA 4IDJL 1S78C 4HWZA 4XH2A 4PG2A 4NN7B 1R3LA 1FN4A 2CR6A 1TDQA 3LD8C 5DJ6B 2VDKL 2DTMH 2XN9E 5IHLB 1G0XA 3HI6H 3PG2A 4PJEB 4TYUA 1MCRA 4H1LA 2I26N 3RP1A 4JN1H 4P4RB 1MLBB 1AKJA 2IH1A 4V1DD 3QCTL 1F58H 3V4PH 5E9DB 3QXDB 5EZIL 1KTLB 2BOBA 3NTCH 4JFED 1KIPB 1ZGLP 1LGVA 3VFMB 3ZDZF 1MCPL 4GXUN 2ZPKL 4ISVA 1ZSDB 1BQUA 1AO7D 1SBSL 2V5TA 5DJAB 2YMXL 1ORQB 2R9HC 3PDOB 5KAQG 1ITCA 1FYTE 4LAQH 2V17L 1IGIH 2DMBA 4K3EL 2AV1A 2VLKB 4YBLC 3JWDL 4P0DA 4ZUWA 1INQB 4PJ5D 1QKZH 4ZTPL 1LO4H 4ZXBA 5ID0A 4Q9QH 1W0WB 2H9GA 2IPKB 4PJDF 3OR6A 5IVXF 3QULB 4KTEL 4H8WC 5TFSH 4JKPL 1OAKL 4OLUL 1DN2A 2VXTH 1HXYA 1W72L 5I1KL 9CGTA 4ZYKB 2BRRH 3VMNA 4LPTA 4NM8L 2O5YH 1T66D 2NTSP 3NZHH 3I02A 1AGFB 5I0DA 3EFFB 5FB8B 5FOBA 5D8JL 1IGCH 4LGRB 1CD8A 2CO6B 2QQQA 4K8RH 3WN5B 1PKOA 3O41B 3GSNA 4PJGB 1IGML 3ORJA 5IWLA 1P9MC 5C08E 1IGTA 2LQRA 4OTXL 2CUMA 5FYJD 1DSFH 4OKDA 5D72L 4HHAA 5CD5C 4FHBD 3LRHA 1JYNA 2PW2A 4WUUA 4LASH 3L95A 1XF2A 3UROR 3IDUA 4NKMA 1JBJA 3WDJA 3JVGA 4Y8DC 1NC2B 2BNRB 2OX5A 3PP3K 1F3JA 2IPTL 5EU6B 1RZ8B 4RWYH 3QISA 4OQTA 3ROLB 4M5ZL 5F7KC 1MFBH 4FNLL 3KLAA 1UZ8A 3VXUE 1D5IH 4FQHA 2DL2A 4NPYB 3N9GL 3UO1L 4PGEA 1D5MB 1WTGT 5JW4M 2QQNH 2RIKA 2VLJB 1UM5L 3VH8G 1K9TA 3OL2A 3E0GA 1MREH 1VGKB 1J8HE 4FZ8L 2ZCHH 1Q1JL 5E8EB 4Z5RA 1HWHB 3K2UH 5HVWA 3SDYL 1NUNB 5E2UH 1YEEH 1OGAE 1CT8B 4LSVL 1EEQA 1KXQE 4Q74A 4R7DA 3UPAA 1F6FB 2VLLA 1JZ3A 4FMKA 4G3YH 5FYKD 4HQQH 2C4FU 4PGCA 5IVOA 1IAII 4JRYA 1S7UB 3KNBB 5IGXH 2HRPL 4WW1B 1MHPH 5E99L 3VD5A 2H2SC 3QH3A 2L4OA 1F4WH 5A16A 3ILPB 1HK6A 4OKVB 2ZKHH 4JY6B 3UMTA 4ZAKA 1N59B 1OAUH 5C07A 4GBXC 4K7FB 1FSKC 4ODTH 4OCLC 3H9SB 1NSNL 4G9FA 3QDGE 4L3EE 1LP9B 5IHUL 2NY2C 3BZDA 3S8WA 1KFAL 3KPMB 3CMOH 3GSWA 2PW2B 4X6DB 2NW2B 1WWCA 1ZXQA 3X3FH 1DFBH 5B22A 1AXTH 3U0PA 1I3VA 3U46A 3VJ6B 3FO0H 1TPXC 5FKPB 1MFDH 5AYQA 4HPYH 1VFUA 1ZAGA 3ZO0A 4TNWF 4XPGL 1AQDA 2CD0A 5HYFA 1FCGA 5MEQA 5EC2B 3FQTB 5HGBB 3VRLF 3AGVA 1T21A 5M95B 1U95A 2AQ1A 3I6GB 4K9EC 3NFSL 1UGNA 3QRGL 3INUH 1DCLA 4P3DB 3SKNA 4PB9H 3NCCB 2ARWA 3SGDI 3IU3A 5DMIL 4GW4A 4XCYB 5DTFB 5M7QA 1E28A 1MCKA 2P42B 5DC0A 3LPGA 4RIRB 3WFEH 4KI5C 4P46C 1JRHH 3ZE1F 1ZT1A 1MOEA 1K5NA 1QSEA 3PL6B 1WFNA 1KEML 5BOZG 2GTWB 2H8PB 5L2KE 2YHGA 1LK2A 1LE9B 1MY7A 1UCBL 1IGFH 5A16B 2F54A 1YNLH 3L5XH 4YDIH 4LVNB 5C0IA 5KG9A 1BVKA 1D9KB 1WCQA 2KH2B 4EJ1C 4ALAH 4PJ7B 1OARH 5EBMA 1NUFA 3JSSA 4PREB 1FL5A 1KYOK 3DXAD 1LEIB 4LEXH 4KZEH 4M7ZB 4MD4B 1TCRA 4K94H 2P8MB 1MVFA 3I3EA 3BKJL 4PRHA 4LCWE 4PV8B 3HI5H 3FQRB 3IXTA 3KYKL 4JKWA 1BQLH 4OM1H 2DQEH 3OJVC 3QHZH 3FO9A 3BPLB 3CUPA 4GAJL 2YPLD 4ZUTA 3TN0D 3VGHA 3TIDA 3ARYA 1NCWL 1OB1B 1CCZA 4UNTA 5I9QC 4MDJA 1DVFC 5E2VH 3X13A 1NKRA 3GJFA 1FORH 1IEBA 3KPRE 2FHCA 4NC0B 1NGXA 2XKNA 3NN8B 4P57A 1JYVA 1B0WA 4NBZB 4G8GA 3WKNA 5D7JA 1K8DB 5CWSB 1MF2H 4X9HA 1ZLUH 3LEYL 4AIXA 3PDGA 3BI9X 4P2QD 1NBZA 3IAGC 5HD8D 4WV1C 1C5BH 5DMJB 2VXSL 3WDHA 1NH6A 1CLCA 2X09A 3DRTB 1IGYA 1E28B 1MRFL 3IVKB 1E4JA 3U82B 1F6LL 2V5YA 2ZP0T 2HJLB 4KK5D 2CUHA 5D93B 3SQOL 3THMH 3VRIB 3IKCB 4LBEA 3ULVL 4JLRB 1QSEB 3V6ZB 5IV2A 1HHKB 4NQED 3EJZC 4P3CH 5BQ7B 1Q9OA 3QIUA 1FAIL 1LK2B 5EUOF 1CG9A 1G7QA 4NNXB 3RX5A 4U6VH 3T0XA 2Q3ZA 5E4EB 1XGTA 3BN3B 2X4NA 1GGCH 4NN7C 4JZJB 3RNQB 1Q0YL 1QVOB 1OD9A 2B4CC 2MJWA 3S36L 2AXHA 1U8LA 1FO0L 2D0GA 4YHPB 3K74B 3B5HA 1RFDH 1NGWA 2IANE 5D2NB 3EIFA 3FO9B 3FCTB 3FRPG 4HCRL 1ZT4B 4JJHA 1KN2H 4LSQH 3UTTD 4I3SL 2UUDH 3P73B 3LQAC 4MDJB 1A9EB 3LKSA 3T0VA 1KIUA 1YMHB 1MCOH 1I1AB 2XKNB 3EOTL 5JW3L 5CUSH 3O8XD 3J7HA 4FQJH 4NRYB 3UTSB 4WW2B 1DQDH 5ICXB 1SMOA 3DMMB 3OKLA 2O61B 1I7RB 5HGGS 4A2MA 1OAYH 4X8JA 1A7BA 5CP7A 2G9HA 3TBTA 4J1UB 1CFVH 4HXBL 5B39A 1NFDA 4Y4FB 1LEGA 4QLRA 1RUKH 4BSWB 4AENA 3QEQE 4NQUA 1W72A 3H7LA 1CD1B 2XTJC 4N68A 4HUNB 3B9DA 1QRNE 1UB5A 5F7FA 1OF2A 3WN5C 1Q9OB 4L4VE 5DHXB 5JO5A 5KAQF 3D18B 2AI0H 2AK4D 4HKZA 5CSGA 3TA3D 4TQEH 4FQLL 4MJ5A 5F6HI 1T03L 2DD8H 5LWYH 5DK2A 3RVTD 3QFDB 1NAMB 5ISZD 2F5BL 3U4EA 4S1QL 3O2VL 4U3HA 3OB0K 3RZCD 2JLLA 4PJHA 4AYFA 4U1MB 1B4JL 2FD6H 3GMNA 1JK8B 2EIDA 1RJZA 1P4LA 4AIZB 5IROA 5JA9A 5D7IE 1UZ6F 1T2QH 4EI6A 1B6DA 4LHQB 2I9LA 4LLWA 2EDYA 3WLBB 4C4KT 1J0IA 4P3WA 3BIKB 3GB7B 4ZXBC 1Q0XH 4RMSA 3T8XB 5TDNA 5DQ9B 3DUSB 3KJ6H 4JM4L 3SJVD 4QXUH 3PWNB 5IB2A 3BRFA 2XN9A 4R97B 3LZFL 1KC5L 1MFAL 4KK9D 5BS0D 3D9AH 5AYUH 2Y36H 3ZDXF 2DQUH 4MCZB 5FYJU 2EIBA 2UZIH 3MRIA 2NY7L 5JORA 1T22A 1KF9B 4NBXB 1BJ8A 5BV7C 5K59F 3ABZA 4NQVA 3S34L 4J3TA 5I18H 3DURB 3OXSA 5DJCB 1WBZA 3LDBB 4QRTA 1FYTA 4PRIB 5T5FH 5FA3B 4B5EA 5IWLC 1YJDH 4OD2B 3RHWK 3CFBA 3T65A 3DJ9A 3CLEL 3BQUB 5F7NC 4N5EC 1HCVA 5MENE 4NGHL 4X6FA 1A2YB 3LSOA 1I3UA 3ZYJA 4YHOH 4E42A 1UWXK 2VDMH 2W65B 5DD6B 4ENED 3MNVA 4J4PA 4HBCL 2AK1H 3U4EB 1BBJA 1FGVL 4YXKL 1BQHG 3TT3H 5JPMB 5DHYB 1Y6MR 2YS4A 3OPZH 4XNXL 4YR6B 5FM8A 3FN0L 1J1XL 4WFHE 1UWGH 4I2XB 2EDTA 2I5YL 4XXDB 4QRPD 1EA9C 2JCCF 2VO5A 5AD0A 2UV3A 2ENSA 4KKLD 4NWUH 3QDMB 4UUJB 1JHLL 5FYKU 1HDMA 3CD4A 1ERNA 3P30L 3PIQB 1EFXA 4KVNL 3QCVH 5C08A 1MUJB 2Y25A 2BC4B 5T1KB 5KSAD 3KS0J 5IB1B 4JN2A 2X89D 2CDGA 3C6LB 3GO1H 1EH9A 5IBUB 1SM3H 3OSKA 4UTAH 4M7JH 4HKJA 5CEYB 3BP5B 2XN9B 3JBG7 2H1PL 3CSYB 1E6OH 1QO3A 4QHLB 4XPHH 4F3FA 1S9VA 1E6JH 1JNLL 3GI9H 4FP8H 3SKMB 2AXJA 3Q6FA 3RZWA 3X11B 4KVCH 1T22B 3F6LA 1KCRL 4QF1A 3VXUA 2VWEC 4M6AA 3BH9A 4F37F 4LVNC 1QNZL 4O02L 1UADC 5KN5A 3AFLA 1D9KC 1MCIA 4XVJL 4PRPB 4ZAKC 1ZT7B 2VR4A 4L5FH 5CEZH 2VXVL 3SE4A 1MNUH 3EYUH 4JB9H 1WT5A 1J8HA 4JZOB 5IMOA 1NCNA 3WSQH 1OGAA 1TVBB 2ZJSH 3DVNA 2QL1A 3WO3B 4KGJA 5D1ZA 3VWKD 3W0WD 5INDB 4U6TA 3EOBB 4NNYA 1NEZB 5EO1B 4HSQA 3QDJB 1A6ZB 3T0BA 1BOGB 1H15A 3BPLC 3CCHB 5C0EB 4NOBA 2ZCKH 3ZSSA 4HWNA 1KIRB 32C2B 3FB6A 4NO0B 3W9DA 4IBLT 1OGTB 2NR6D 4OUOA 1PJ9A 1RU9L 4Y1AB 2DQDH 3K4AA 3QBTB 4C57C 5CZXD 1QA9A 3LS4H 2BHZA 2IH3B 4U33A 5C08B 5EU7C 4J6RL 5ICYA 3QDGA 2C4XA 4WTXA 4L3EA 3WL9A 4WFFE 3HNSL 4MZ2A 5I1AA 2WIIB 2Q7YA 3ME0A 2YSSA 3NCYS 1KJ3H 4HKJB 4F7CA 4JAMA 2Z9TA 4F7EA 4NRZA 4MAYA 2NY3B 1KLUB 5D93C 3L6FB 4CVXB 4HXAL 4F3FB 4BUHA 2APXA 3O6KH 2OL3H 3OKDA 1DQLH 3LKRB 5GHWL 5JW5B 3TJEL 3TH2T 4PJ9D 3T3PE 1T0PB 2OR9L 4YEFA 1IAIH 3MLUH 4JHAH 4D8PB 5KN5B 4CJ1A 1AJ7H 1FFPB 2PO6A 2XPGA 4KMTH 4QHKI 5DRZB 3Q1SL 2DYPA 3EOYG 4OZFG 4JZJC 1YNKH 4U6HA 1SEBA 1FL3B 3V4UL 4X98B 4G42B 3SOBH 1JFQH 2NZ9D 3TV3L 1M7IA 1UA6H 4NT6A 4YGAB 4ZS6D 3F58H 1I9IL 1F4XL 2F74B 2ZUYA 2AERT 3R06A 3EYVA 5D2NC 3O9WB 3G5ZA 1AHWB 1VESA 3SCMB 3H9HA 5DMYA 1MCLA 4LARH 4PJ8A 3E3QC 4ZQKB 1FG9C 1LWRA 3VE0B 3WHXB 4JVPA 2ZUQB 2ARJQ 3QSKB 5E2TL 4HUXA 1ZGLB 4P49A 1K8IA 5HI4C 1IAKA 4L4TB 5J1TC 5L2KA 3TFKD 2HT2C 4HCRA 3T2QA 3VRJA 1PSKL 1TJGH 3QPQD 1QBML 4WW2C 5J6HA 5T3XD 2V9QA 1HILA 1KTDB 4ORGA 3DMMC 1AGBA 2HLAA 1DBML 2F5AL 2C3GA 3HE7B 4YIQB 2RQ8A 1BMGA 4I4WA 3IFNL 4OLYL 15C8H 4LQ1A 4L3EB 2E6JA 4APQB 5F89A 3NABL 2XWTB 5FYLD 4LCWA 3VXSB 5SX4I 1UJ3B 1J10A 5HYQB 1S5HA 1XGYL 4QWWC 4RRPG 5GISL 4UBDC 3HRZB 1AGEB 3IU4L 3VDAA 3CIQA 1INEH 1U3ZA 2EKSB 3OKKA 4NFCA 4KXZI 3SGDH 3WIFB 5HHOB 2FGWL 4YO0A 3BP7B 5BRZD 3TWCL 2EDWA 5LGJA 1QR1B 3OKDB 4GKSB 1S7SB 3QI9A 2R0LL 4XVSL 3O6LL 1TZIA 3MA7B 4HUVB 3IF1A 4NCDA 1X6NA 3KPQB 3KPRA 2DI8A 3ZL4L 4A6YL 1S9WA 4EBQL 3TBWB 4EI5D 4YC2B 1IC4H 4LSPL 5DZNA 4RA3A 5F7LB 5CFHA 1NLBH 1I8LA 5IW3A 3BP6B 1HH6A 5FYKH 2W1NA 4LDEB 1JVKA 1NCAL 4C83B 3LHPL 2AJ3A 1Q9LB 3FTGA 3O6FB 1G6RL 4KRPB 4TUOA 4UIKL 3D69B 3NFNB 1JF1A 2EDDA 2HWZH 3LEXB 4U2YA 1WF5A 1FO0B 2O5ZH 4PJ8B 4H1LG 5CJQH 4ZD3H 4D94A 4ELME 4J12A 3U48A 2CK2A 2W9EH 5DJ8B 3OX8B 2DTML 1CF8H 1DUYA 3HI6L 1QEWB 3QIWB 1Q9WA 5JIPA 4JN1L 3W11D 1F58L 4LPCA 3V4PL 1JNJA 3NTCL 3X3GH 2HT3C 3T1WA 4F8QA 3HE6D 1YYMH 2JB5H 2V2WB 2CLZA 3L3DA 3B9EA 5GRVL 4R97C 4LAQL 4O51B 1CFSB 1IGIL 3KLHD 2Z8RA 3BEWA 1AGDA 4GQPH 5HYSB 2GIYA 3L9RB 2IANA 4NZJA 1QKZL 5IVZB 1LO4L 2CXGA 4MLSA 1R3KB 3B3IA 4Q9QL 3KVQA 4PG9A 4OUUA 1RIUH 4PJIE 3BUYB 5TFSL 1VFMA 3KPPA 5BZWA 2VXTL 2DICA 2VL4A 3P9WB 4N1HB 4ODWB 2BRRL 2X9XA 3EYFA 4WO4B 1G7LB 3D25A 4Z0XA 2MOVA 3W39A 2O5YL 1J88A 3QNZA 2Q86B 4X8XA 3NZHL 1UQSA 4AMKH 1KTKE 2AV7A 1UB6B 3AC0A 3TO4B 1IGCL 1TXKA 4K8RL 1JTOA 3RGVA 4X83A 1JGEA 3PGCB 3DUUA 2G5BB 1WSST 3W5NA 1BHGA 2XQYG 2UYLA 1XH3B 4ZFGH 1BJ1J 2PYED 5C0FA 1QSZA 1DSFL 3QEQA 1KENH 4AK1A 2WWMD 3K80A 4X6EB 1MJJA 2MQ0A 3CC5A 5KS9F 1QRNA 4Z7UE 1PQZB 4LASL 4WI2A 5IROC 2WP3T 3C60D 1YQ2A 4L1HA 4L4VA 1A8JH 4PR5B 4I0KA 1Y6NR 4MVBC 3DX7A 3FB7A 4KC3B 4YLQT 4LVEA 4JHZA 2YEZA 5D5MF 4RWYL 4FTVD 1VKXB 4OCMC 5IEKB 4JY4B 4QTIH 5DI8B 1CXLA 1BLNA 1MFBL 4GQ9H 4P4KD 3DSNA 2R23A 1ZHBB 2QQNL 2ATPB 2ITDB 5ICZA 1HNGA 1WWAX 3QT2A 3BPCB 5ENWB 1MREL 2ZCHL 3AS2A 1BX2B 3JUZA 4JVUA 4OGXH 3K2UL 3MBXH 1O0VA 5H94B 3MJ7B 5E2UL 5FM4A 1YEEL 3MJ9A 4PJFE 5T1LA 4KJPC 3BYTA 4XCCH 2V2TA 4G3YL 4M62H 5D7IA 1HSAB 4HQQL 1WC7A 4JFOA 4U1IA 3V5HA 3D25B 4MXQD 1JWSA 2XTJD 3BKYH 4UU9B 4E9LA 1LHZA 4MD0A 5IGXL 3SDDA 5HY9A 1HEZA 2JB6B 3KPNB 4AEHH 1MHPL 3N06B 4HT1H 4ZSOB 1QPXA 2YKLH 5DJZA 3VFGH 4ZPVA 4ZOBA 4X6CE 4J4PC 1R5WA 1SEQH 3MOAH 43CAA 2ZKHL 4ODHH 1ZVHA 5GGVY 4ZFZB 2C5DC 2OP4H 1OAUL 1KULA 4GKZA 4ODTL 5C0FB 3G04B 2D9QB 4HFWA 3RL2A 4JQIL 1N64L 4JY5H 3DX6A 1QRNB 3CMOL 3OG6B 4U1NA 1W2KT 3D48R 4GAFB 1P69B 3X3FL 2NXYD 1DFBL 3VGEA 2DJ4A 4IRSA 1CD0A 1AXTL 4B7LA 3NIGE 3WUZA 2YEZB 4JFHE 4JQVA 3FO0L 5JDSB 1MFDL 5KANG 1T4KB 4HPYL 1YEGH 3PWJA 1T5XA 4L29B 1CU4H 4Z9KB 5IK3A 2N7AA 3V9FA 5C6PB 4XB7A 5MENA 2E9IA 2E9WA 4DJMA 5EZOH 4HWEH 3MREA 3DBXA 4Q97A 2NY3C 4ZXBD 1PAMA 3MLYH 2VXQH 3INUL 3V79C 1R3HA 1LDSA 1ROWA 3O4OC 3K7UA 4PB9L 1AP2A 1BPVA 1WIOA 3IDIA 1F2QA 4D0BB 4ZNCD 1OL0A 5F9JA 1F4HA 4KDWA 4P5TA 5DGRA 4XT1C 5D7IB 5DO2C 2BHYA 2MTPA 3V0VA 1JRHL 3S3SA 2B39A 4X5WA 3SE4C 1T7YA 5TQ0H 4KKBD 3SDAB 3S4SB 4K7PY 4EN3A 1CGTA 4AM0A 1RZIB 1S7RB 5EZLA 1A0QH 3WEXA 4M7LH 3RA7H 3FQUB 3QUZD 4HV8A 3RWGA 4BFGA 1IGFL 5D7LD 5D7SH 1YNLL 2X4UA 3CLFH 3L5XL 4YDIL 3TGXA 3B8YA 1R5WB 4G6FD 2KUTA 2IG2H 5C6TH 3O9WC 2X70A 3D87B 5ELIA 3SCMC 4ALAL 1OARL 3B9KB 4LCYB 1IAOA 5AG8A 2ZUQC 5DD1H 5J1AB 4WUUD 5F3HB 1H0DB 3TVMD 4FG6C 4LEXL 4G8FA 5IJVA 5K9OA 4K94L 1PKQA 1WWBX 2R1XA 4M1DH 3SDXF 3VXRB 2HKFH 2VDLH 3UBXB 1BQLL 4O2FB 4OM1L 2DQEL 3QJFB 2X1OA 3ET9F 3MRCB 5GRUH 2X42A 4YZFE 4M43H 3KJ4B 4NOFA 3CDGB 1MJ8H 1NCBH 2YWYA 3B6SA 3NFPA 1T5XB 4APQC 1GZQB 3U7YL 5I1LB 3QUKA 5E2VL 1Y6KR 5DJXB 1FORL 3L3KA 5T1DH 5EZJB 2GAZB 1XF3B 4IOIB 2DM2A 1MY5A 3HZMB 3MUGA 3QEUA 3D85D 1MF2L 2VUOA 4RFEA 1R3HB 2JJSC 5BJTB 4ONOA 5HHMD 5D1XA 5DEFB 1C5BL 2FB4H 1FQ9C 2DTSA 5F9JB 3ULVC 2WNGA 5DD0H 5CLWA 1H5BB 1JJUA 3QEHB 4G6KH 4YC2C 2Y6SC 1KACB 5IFJA 3THML 3ZDZE 2NY1B 2P8LA 3NCBB 1FLTX 4NO5B 2K7QA 4HLZG 2YBRA 1FNEA 3KLDA 4E0RB 2OLDA 4A6YA 4ZFOL 4P3CL 4YDVA 1DANU 1DEDA 2J4WH 5GGRB 2XY1A 5KOMC 3FT4A 4ZAKD 2BNUB 1VCAA 4PGBA 5C07D 3O6FC 4O2CA 4KRPC 4U6VL 1JZ2A 3CGTA 1KB5H 3QUYB 3WIHL 3WE6B 4YHLH 1GGCL 4PJ8C 4PJDE 1MLCB 3MRMB 5IVXE 4BH8B 1PG7H 2C3HA 3P4OB 2HJKA 3MRKB 3IJSA 2BVEA 1RFDL 4K07A 1DE4B 2Z93A 1XCTA 1S7QB 4WHTB 3TBVB 3TZVB 2AEQH 3VU2A 1KN2L 4LSQL 5ACZA 1F3RB 4JFFE 3TNNB 4QEGA 4WU5B 2D31B 2JK5B 3MLVH 2ED9A 1J0YA 4LLUB 2B0SH 3QNXA 1MCOL 5CUSL 4FQJL 4F33B 2CDEA 1C12A 4MB3A 2DWEB 1DQDL 4CU8A 5I76B 2VQTA 2FJGA 1EGJH 4DEPB 2QADB 1D5BA 4PPTA 4BM7A 1OAYL 5B39G 4TNVK 3HA0A 2P7TA 1BFSA 3FHAA 4LEOB 1CFNB 2DBJA 3ARFA 3RHWF 1BAFL 1CFVL 1P2CA 4WO4C 4ETQB 2FZ3A 2I07B 4XNQB 1DLHB 1JWUB 1RUKL 1XF4B 5J13B 1RZ7H 4B0MM 3L3GB 4YNYA 1WFUA 3I75A 1HINH 3MRNA 2Z91B 2JKXA 2IBZX 2F54D 4HK3J 1A47A 3TO4C 1N0XH 3R1GH 1ULVA 4I48A 4Z77B 1S7VB 4MMXC 4PJAE 2AI0L 4RISH 4NCC2 5DRXA 4TQEL 4C59B 4LMQI 5K9QI 5A3IC 2RR3A 4XCNA 2PYFB 4U7SA 2VNCA 1G6RB 1IEHA 3P9MB 5LWYL 1HHJB 4NFBA 5TJWK 5DDHB 1VB9A 3IJSB 2ICCA 5DUBA 4NSKA 5DURD 1KLGB 2FD6L 1NPUA 3NCFB 1MAMH 2E8YA 1IZKA 2WMPA 2GK0B 4OGZA 1OHQA 1RHFA 2ESVB 1W8NA 3E6HB 3V7AE 2J8UE 4U1SB 4G8GD 5D7JD 3DHJA 3CSGA 1T2QL 2KZWA 3C5JA 3LKQA 3HZYB 1YMME 3GSXA 3RDTA 3ZZ1A 1A6AA 35C8H 2FECI 3B2UD 3MRQA 4ODBD 3S6CA 4OCRL 2PTTA 4IJ3C 1U3HD 3DARA 5EIIA 4W4NA 1Q0XL 2KL6A 1MJUL 5EFIB 5JXEA 4FXKB 2DOCA 2XOTA 3KJ6L 4QXUL 4ERSH 3FO1B 5SX4H 5IKCB 4ELMA 2L0DA 5CEZE 2DQTH 1P53A 4WI5A 5DC9B 4HKBA 4Y16B 3ARFB 3CVHB 4PP2A 4D9QE 4KXZH 3QG6B 2IAMB 3D9AL 5AYUL 4MQXD 2BVUA 2DQUL 1BIIA 2E7LA 1YEHH 5L6YH 3VD4A 5L7XH 3QIUD 4OF8A 3MRNB 2QQLH 3IGAB 2W60A 5I18L 3O2WH 4XCEB 3VRLE 3PWVB 1TETL 5B3NA 2X1WL 5JW4Q 4NKOA 2BSED 5T5FL 1MRCH 3PGDB 1YJDL 5DA0B 2G75A 1UYWH 3UXFA 4JRWA 3KLSA 3HS0B 2QKIA 4XGZB 5DF0A 4PJIA 2Y7QB 5HJ3B 1XGPA 1SQ2N 5JR1H 4YHOL 2GJZA 1IQDB 1E4XH 2VDML 4QHUB 4RZCA 4L8BA 3FQWB 1BJMA 2ENYA 4V1DE 3ZE1E 4OI7A 4ZUSB 3O3EB 1R5VB 4P2RB 2YD9A 3TT3L 3VDBA 5FO7B 3OPZL 3T77B 4U6XB 1UWGL 1AO7E 4JO2H 1NC4A 1E4KA 1I8IA 5FGBA 1XGQA 2I24N 1JYWA 2ZSVA 1UJTA 5CD3A 1MPAH 3SKUD 2B2XH 1ORSA 2R1YB 2HT3D 4Z78A 4LOUD 3O4LB 4PJ5E 3QCVL 2XA8H 3RI5K 5EIIB 4Q2ZB 2WQ8A 3RTQB 5I1CH 1A1OA 4CW1A 2GT9B 1SM3L 4UTAL 4Z7UA 5I8OH 4M7JL 3FQXB 1ND0A 4R3SA 5T3XH 2FIRT 4F7MB 1MFEH 4M93B 1E6OL 1KTRL 3HG1D 4LNRA 4XPHL 4Y4HB 2JE8A 5HDLA 1E6JL 3GI9L 1RIHH 4FP8L 1A1MB 1U42A 1LE5B 1GOHA 3SDAC 5FYLH 5IB4B 5F1NA 3WFDH 4MA3B 4HK0A 3DVGB 5ID1A 5D9SA 5E8OB 1Z9SA 1A6VH 2DJSA 4OGAC 2ICWB 2VDOH 4HS6A 3F5WB 2A6IA 4NUJB 3JV4B 4EDWH 3B9KC 4L5FL 3V5DB 3IDGB 1MQKH 3K4DA 5CEZL 5CGMA 1MNUL 3EYUL 4JB9L 3GMLA 1K3IA 3WDIA 5D1QA 3IRZA 3L7FA 3KG5A 1Z9OA 5IBTH 4QHNB 4U1KB 3WSQL 2JIXA 4K23H 2ZJSL 4PJFA 2C1OA 4PY7A 5ANMB 1QFPA 1WFOA 4IRSC 2VAAB 1IKNA 5EOTA 2XT1B 1QFUH 4QTHA 4JFPB 3QJHA 4ELKA 3PGFH 4JQVC 3KJ4C 4LP5A 4PLKD 5J56B 4E41D 3GKWH 3CFJA 4CN4A 2ZCKL 3GBMH 1NC4B 3NACH 3UC0H 3G6AB 5EUOE 3CAFA 4OLZH 3RY6A 3FFCD 2QSQA 4X6CA 2MMXA 5C0GB 1HZHH 3LKPB 4EQ3A 3B43A 3T0ED 3KXFE 4KKCD 3ARGA 5DT1H 3LS4L 2EO9A 5MI0B 3DI3B 4BA8A 1T04B 2A0LD 3KR3H 1JZ8A 1KEGH 4GH7B 1A1OB 3GBNL 1IEAA 1HWGB 3KYMB 2EZ0C 2IF7A 1YEKH 5C0CE 5I2IB 2N4IA 1KJ3L 2WW8A 1UENA 1YYLH 5F7WC 5FYKE 4BELD 2EE6A 2ZG1A 5KVEH 4J8RB 5I71B 5GSRB 4NQCE 4HS8H 1JV5B 4RBPK 3V7MA 2AVGA 5GGUA 5T3ZD 2H32A 3O6KL 4QGYA 2OL3L 4Q6IB 3VD9A 3TBYB 4EN3C 1DQLL 1AQKH 4GG6E 4HDIA 1F45A 2LU4A 1FYTD 3CFEB 1A64A 3RVXC 4OGYH 2WWKT 3NMEA 4M48H 2UZXB 3WUWA 3MV8D 1CFQA 1IAIL 1BFOA 3MLUL 4JHAL 1AJ7L 4KMTL 3PXJA 1M1SA 4ZFOA 2O5XH 3QUYC 4Z7VE 3EFDH 4FRWA 4XPAL 4O2EA 1X5KA 2WK2A 4RDQG 3U9UB 1YNKL 3L7FB 5JNYB 3SOBL 1XIWA 2R2BB 1JFQL 1KELH 3WIHA 1FV1B 2FGZA 2C1OB 3F58L 4PGDB 1C7SA 4POZD 5FA4A 1QFHA 1I1YB 2F15A 4ONFH 1I8KB 4OZFH 1X5IA 5DJ0B 3WXVH 3CFDA 4LARL 3FONA 5DRNA 3ARZA 3MBEA 4PGJA 1U3JA 5IBLC 1A22B 3KPLB 1FFOB 5I75C 4N0YH 1C1EH 2DMKA 2J6EL 1A3QA 5F71A 5H2BA 3HUJB 3AXLA 1TJGL 3RJDA 3JV0A 5HGDB 1J1PH 3OGOE 3MV11 4PTUB 3BZ4A 1KXTB 4W6YB 4DEPC 5D1XC 1WUNT 3FT3A 2RGSA 1MH5A 15C8L 2CRIA 2W0KA 1TFHA 3T1FA 5KVFH 4JG0H 2GCYB 3WFZA 3IJHA 5J13C 2GK2A 1INEL 5EA0H 3OB0H 3ZT6A 3AY4A 4PLOB 3VWJD 4R2GD 3MXVH 3VXUD 5C71A 4XZUB 2GKIA 3U6RA 3PHOA 3C5ZB 5B21A 3JZ7A 5CGYD 5C0ND 1R5IA 1UZ6E 2WP3O 3O45A 2D9CA 5ADPL 4L8SA 1CDIA 5HYIA 1DN0A 3PE9A 1J8HD 2APTA 1IC4L 1C16B 5E1AA 2BZDA 1H8NA 4YEEA 1G7MA 1NLBL 2A1WH 1U92A 2ATKB 5FYKL 1BOYA 5D1ZD 4UQ3B 1N6VA 1P7HL 1YEJH 4OZGB 3ZDXE 4NZDA 4YHMH 5HVFB 2A9NH 3QIBB 1BZ9A 2BSTB 2HWZL 2O5ZL 5CJQL 1M6OA 4ZD3L 4X9IA 3AREB 3P77A 2W9EL 3QUMA 2W91A 4NNPH 2CJUH 1F11B 1CF8L 4F7PA 3MV7E 4POUB 4HH9B 1U8IA 1FC1A 3ARDA 1OP5H 3RVUD 3L3HA 1Z2KA 3HC0A 3X3GL 3QDGD 3ILQC 5JLZA 4P2QE 1T2JA 4KK6D 4PJDA 2FIKB 1DQJA 5IVXA 1W8OA 3GIVB 5D70H 5CAYB 5DQDH 1YYML 2JB5L 3DWTA 4MAYD 5ITFB 3ROOB 3VFVA 3ARFC 1EHLL 4NYLA 2IAMC 4R8WH 1KPRA 1UWXH 3AMKA 2P8PA 4MNQB 1OY3B 2X4QB 3LAFA 4IMKA 4S0TD 1U8OB 3QQ9D 4FQCH 1RIUL 5CZVH 4RAHA 4NQEE 3PABB 3MGOA 4JFFA 2CRZA 1TZGH 3BISA 3PHOB 4YX2H 2Y23A 1CGYA 4PV9A 2PO6D 1CBVH 1DJSA 4RMRA 1VGEH 4L8SB 4QRRB 3RIFK 2DYPD 3TYGH 4XNMB 5ADOH 2HG5A 5J3HC 3SY0B 1NGPH 5FGCE 3BGFC 4K8RC 1U0QA 5TPWH 5LKNA 4AMKL 4GUPB 3TH4T 3HPJB 2VLRB 3RVVD 1KG0A 1CICB 1U6AH 4Y2DA 2XWJB 3REVA 4YUEH 4PJXE 3G5YA 4ZFGL 3GSNH 1NLDH 3AM8C 3MJ6A 5CLTA 1RJLA 3QQ4B 4IRJB 3P77B 5M94B 2X4OA 7FABH 4PJAA 3S5LB 2XKSA 1N4XH 2V9RA 2IMMA 2EYSB 5CIPB 4D0CB 4YGVA 4DFHA 3RTQC 2X6MA 3GMOA 1CFBA 4QTIL 2C3XA 2P5WB 1H3WM 4FFWC 4LCWD 4GQ9L 1GGUA 1T1ZB 2W0FA 4M93C 4Y4HC 3R0MA 3IFLH 4XC1H 3QI9D 4XP6H 1P7QB 1ZHKA 4OGXL 3L7EA 3MBXL 3UTQA 5EOCJ 2CLVA 1QLFA 2ADGB 2BK8A 2J8UA 2LVEA 1YMMA 1ZA6A 5JW4N 3BKYL 1FL6B 1B3JA 3CU1A 3DX8A 3CFKB 4G6JH 5I1DA 1FHGA 5FUCC 2APFA 4P23A 4AEHL 4HT1L 4AH2B 4JDZA 3OZ9H 5KZCD 2YKLL 4N0UB 3VFGL 2WLZA 4R96B 4Y2DB 1SEQL 3MOAL 5E6IA 4ODHL 3AU1B 5IB5A 2OP4L 3P40A 1YPZE 3HCVA 2C4FT 4FXGA 4JM2B 5AWNL 1XFPA 5KTEH 5HTSA 4YFDB 1WBXA 4Q6YA 1TVHA 1E4KC 1RJLB 4JY5L 5C0BE 4HIXH 3QUXB 3KYOA 4FZEH 4U1GB 1S9XA 3K4ZA 3MX0A 4NQSB 3GHBH 4CVZB 4HIHB 1IRAY 5MI0C 1G7IA 5HHVH 2H26A 2EDRA 2VZOA 1YEGL 1CU4L 4KROD 1D6VL 2ZZUT 3BMVA 4LCIH 5JOFB 4EDXA 2FWOB 4M03A 4C56B 3HAEH 4MCYB 5EZOL 4OCWH 2IAND 2GTZB 4HJ0D 1QSFE 5I71C 3MLYL 2VXQL 3WS3B 4V1DA 1T0MA 3TC9A 5IFHL 4YDJA 1DDHA 3EBAA 3OHXB 1I7UA 2R56L 4LLQA 3IETB 4YHZH 3VI4E 5IEHA 5GS2D 3UTQB 3CPLA 1ZS8A 3HZKA 1AO7A 1MCCA 3MYJA 1A7RH 2D03H 4DW2H 1QLFB 4FQ2H 3C6SB 2EDBA 1PLGH 4H25B 1C7TA 4W4OA 1MCJA 3O0RH 4KRLB 4PJ5A 5TQ0L 3RWCA 5FO9B 1SJEB 5D1QC 3U79A 1FJ1B 3SDCB 1QR4A 3B5GA 3ZDYE 3P4MB 3RGVD 1A0QL 4M7LL 1UEMA 3OAUH 5E6ZA 4DZBB 5D7SL 3VI3E 4E5XA 3CLFL 3TIEA 1TTFA 2XYCA 3ZT7A 5MERA 3FFDB 5HPMA 2IG2L 5C6TL 3QEQD 2VITB 4K94C 5B8CB 5E6IB 1ZVSA 2OZ4H 1S5IH 4CN6A 1KXVC 4OB5H 5F6IC 5DD1L 4QYOA 3RWEA 4L4VD 4M1DL 4Y5XA 4GKNA 3VXMB 3MGTB 5LBSH 3IFOA 3KGRA 3LN4A 1KUMA 3ARGC 3FN3A 5GRUL 4TNVF 1ZLSH 2J6EA 5F1KC 4M43L 1MJ8L 1NCBL 2QHRH 3VMOA 3STZB 3DYOA 4RDQF 5AAWA 2E3VA 3MRPA 2HFFB 3L3JB 1DBJH 2EYRA 1CFTB 5E8NA 5T1DL 1S7WA 3G08A 4OZHB 3OF6D 1U93A 1BVLA 1JMZA 4XPBH 4JFEB 5T1LD 2BY2A 2J8OA 4UIMB 4NRXA 3IJYA 4DVBB 4ETYA 1BWMA 1IAMA 3H3BC 1ZS8B 1F2XK 2FB4L 8FABA 3HPLB 5EUOA 5DD0L 3MNZB 1JPFB 2E5EA 4I77H 1JHKH 2OL3B 4Y7MA 4G6KL 3SDDD 2YPKA 4LIQH 3KXFA 3VD7A 3MMEB 3S98A 1LO5B 1IJ9A 2OK0H 2X7LB 5DRWB 4YFLF 5C0RH 4LLVB 8CGTA 2J4WL 5C0CA 4KDTA 3F12B 2ARJB 2F8OA 1JPGA 1MJ7H 3IS0X 1MI5E 2BDNH 3OGCA 2NXZD 2H2PD 1KB5L 25C8H 1JNNH 3QIBC 4GJTB 4NQCA 4YHLL 1H8SA 5FDYA 2RFXA 2GY7B 1SJHA 4LCCB 3U1SL 1PG7L 3AREC 1B0GB 4GG6A 3A0OA 3E6FA 4GKNB 5HHQB 2BX5A 5IQ9B 2QSTA 4M5YH 3KPSD 2BERA 4AIOA 4Z7VA 4PJBF 2AEQL 1YEFL 5MEND 1IBGH 1VADB 2L7JA 1ZA3B 5INCA 3KS0H 3O11B 1VENA 3MLVL 2KQMA 1A02N 3RWJA 3WXWH 2B0SL 3M17B 3GMMA 3Q0HA 5CBEB 2D7PA 3QCTH 2BP3A 5EZIH 5T33L 3LKNA 4R4BA 5DVNA 3F7YB 4R4ND 1MHHA 4P5TD 4NRXB 3RGHA 2VXUH 4N8VB 3JWDH 2HLFD 1MCDA 5EUOB 4L8SC 1EEZB 2IQAA 2VLKD 1QRKA 3NZ8A 1TNMA 5JPNB 2ADIA 3OKEA 2AJZA 5SX5K 1EBPA 5D5ME 2YPKB 1Z5LB 1RZ7L 3WLWD 1U2HA 5EU3A 5C09E 3HHRB 1Q9KB 3TYFB 1HINL 4M8QA 1BM3H 4BJLA 3REWB 5KSVA 1AIFB 4N8CL 1N0XL 1KIQB 2VOTA 3R1GL 1G7HB 1CICC 1N3NB 3ZHDA 3DGCR 1KCLA 3DROB 3MUY1 2K7PA 2MHAA 2WBJA 2BOCA 4RISL 4GW1B 2LV4A 5ESAA 5JIIA 2VZUA 5J6GA 2YUXA 3GSVB 4IRJC 5HHPB 1MCFA 1MVUA 5EU5B 4XHJD 4HIJA 5GIRA 3RI5F 3SBWC 4EEEA 1II4E 5F88B 1G0YR 3ALPA 4CNIB 1R3JB 1EUTA 3QYCA 5HI5C 4H0HB 4I5BA 1MAML 3DX9A 2P49B 4Y88A 1T1WB 1A6TA 2BVPB 1QBLL 3MFFA 2A73A 2EDJA 5C0JA 4U1JA 2Z31A 5E4IA 2C1PB 2DI7A 4IIQA 3HI1A 35C8L 2FX7H 2WANA 3UCRA 1C08B 4IMKC 1GC1H 2OQJB 4XI5D 5HI3C 2H6PB 3TNMA 2XWBB 4I1NB 4B53A 1SYVB 4ERSL 2XQBH 4EIZC 3TN0A 2OMNA 1YY8B 4ZFFA 1C5DB 5SWSE 2DQTL 1FIEA 3MV7A 2A6KA 4XBEH 2VLJD 5EUKA 4P59H 5IFAH 2M1KA 5TF0A 1S9YA 2WLYA 12E8H 3OKEB 4KWUA 5HBBA 1BVZA 1YEHL 5L6YL 4WFFD 5EIQA 4P2QA 5L7XL 2QQLL 1YJDC 3O2WL 5JIHA 3D0LB 3GMQB 4C54A 2GYSA 5T3ZH 5FUZL 3HC4H 4S11A 4Y2DC 1EZVX 1MRCL 3EJYD 3RWFA 3U30B 1NGZA 3VDCA 1UYWL 4GRMA 4KQ3H 4CN1A 4WWKB 2VLMD 2EDQA 2KBGA 1IARB 4U6YA 4MD5A 5FFLA 4NQEA 2DS4A 3IXAB 4FQXA 4ONGH 5JR1L 4PRAA 3BO8B 3EDDA 1Q94A 1E4XL 5FF6A 1D6EB 3AMLA 1PZUB 4CMHB 1PGRB 1JTPA 4ODUA 4PY8I 4OFDA 3BRDA 1OPGH 2Z4QB 3BW9B 3AB0C 1WFTA 3DV6B 5I15L 4JO1H 2VAJA 5FAAA 3AROA 3UTPE 5DSCB 4JO2L 1LNUB 4BK5A 2IFGA 1KJ2H 3MFFB 3DXAB 1UKSA 5ESQB 4DUVA 1B2WH 3BYYA 5IT2L 4HZLB 1MPAL 4N0CC 2B2XL 4JQXA 1EAJA 5FECA 4DCQA 3TJHD 3BDXA 4XCFL 4BH7A 2DQFA 3A67H 4PJXA 1EAPA 4LVOB 4Y19E 2XA8L 3RU8H 4YK4B 1ZGLM 3RAJH 5I1CL 2Y5TA 4HWBA 2GSIB 1M71A 2YPLB 4BQ6A 1WICA 1QTYT 1IM9A 5DFTA 4NN6B 1S7XB 3ZLQC 5I8OL 5T3XL 3BHBA 2MNUA 4MXWH 5EUKB 1MFEL 2IFFH 3O8XA 5ETUB 4JRXB 5DS8B 1RIHL 3VH8B 2ZUUA 1J5OH 5DQJA 1JWMB 5FYLL 3VXOA 3BZFB 1X3DA 5J11B 4P23C 1U8KA 4P2QB 3SDCC 3WFDL 4ZTOH 1XR9B 5I16A 1LEKA 4Y5YA 3EHBD 2MCG1 4D0DA 1ZV5A 1A6VL 2AEIT 4UAOB 5B8CC 5E6IC 2Q87A 1KPUA 1U8PA 4EDWL 4O4YH 2PYEE 1IQWH 1U8HA 2XRAH 3LQZB 2B7DT 2PETA 3PL6D 1HN1A 1N5AA 4HGWA 3VFRA 5D2LE 4FQQA 5IBTL 1KCVH 1B0RB 1WZ1H 4MJIE 4K23L 2JCCB 3FOMA 5CBAB 3E8UH 5H8DA 4MX7B 5DFVC 5HDQH 4U7KA 3RFZC 3MRGB 5GS0L 4ACPA 2X4SB 4ODUB 1QFUL 1H3GA 1CGWA 1PZ5A 2XXCB 3PGFL 4NIKB 3TA3A 4S10A 4FTVE 3GKWL 3GBML 3NGBB 2BVOB 4LP4A 3NACL 3UC0L 1IL1A 4YJZL 3RDTD 1FNLA 1SYSA 4OLZL 2NCMA 3PWPD 3EYOB 2J88H 1K2DA 1U8JB 5ESVA 3V5KA 1HZHL 4PP1D 2D3VA 4Z7OE 4RQQA 5JXED 3RZCA 4KKAD 1RAMA 3STBA 2AS5M 3DTXB 3SGJA 1YPZA 2YOCA 5DJYA 5JQHC 2ED8A 3KR3L 1KEGL 1T1XB 4P2OA 4RGNE 2OTUB 1TIUA 2APBA 3HC3H 3UTTB 3SGEH 2YC1A 4NCC1 1YEKL 2ZWLT 5C0BA 5SWZB 2R8SH 4JFXB 1YYLL 4NQDE 1NGYA 5HHNA 1DQQA 5MEOA 4KZDH 1UACH 5KVEL 2AJVH 4OIIH 4HS8L 4JANB 3RPIA 2AXGA 1ZE3C 4OZ4A 3K81A 3WUWG 1AQKL 3S35X 3X14B 1TLKA 4S2SB 1A4JA 1QQDB 5L8KB 4M48L 5IJKA 3BE1H 1CGXA 1G1CA 1EO7A 3VFNA 4Y4KB 3F7QA 1NDMB 1QSFA 4B7IA 2W0PA 2O5XL 4ZPTA 4ZDHB 1CXFA 3EFDL 2FJFA 3GSUB 3KWWB 1T66C 1BJ1H 1UM6H 1G7PA 4OT1H 4OF5A 1KELL 4L8DA 4Y5XC 1IILE 4NUGH 5C0DA 1I8MB 2NX5B 4ONFL 2JJUA 2AK4B 3WXVL 4HUUA 1I3GH 1Z3GH 4P5KA 1F4YH 3PHSA 4N0YL 1C1EL 3DGGB 2XZCL 3NPSB 1OSZB 5F6HJ 3H0TB 3HMWH 1K85A 1BBDH 5ISZB 5E94A 2V5RA 1J1PL 1HYSD 4X4YA 5B38A 4R9HA 1CGUA 2LFGA 2VQ1A 5GRWA 5DHVH 3L5IA 5KVFL 1JZ4A 3MROB 4AT6B 4JG0L 4U3XA 2W07A 3EOAA 3T3PF 4X5LA 4YDLB 5IR1B 2NLJA 2Z92A 1B88A 1X7QA 5GRYA 3LKOA 1I1AD 5F9OH 2P48B 2F53E 3H6JA 5EA0L 2HTKD 4O00A 3W9EB 4MDIB 5FCUH 4X6BB 3MXVL 4I0PA 5K9JH 4QOKE 2X89A 3V6OE 4KUZH 3SJVB 5BVPH 1D3CA 5D7LE 5TE6H 3KYAA 2BVQA 4FOMA 4Y4FD 2VISA 5BS0B 1GAFH 2FJFB 4M61B 4R6UA 2A1WL 4OFYD 5HHXH 1OTSD 4X7DC 4LFHG 2XACC 1G7PB 4KGLA 1KB5B 3JUYA 3N1MC 5C3LD 1YEJL 3DYMA 1KCSH 3GBLA 3D2UD 4XMPH 1LD9B 1D5XB 2A9NL 4P5MB 3RUGE 3RKDD 2YZ8A 3CH1A 5E8PA 4OJFL 1RJYA 1Q38A 3UZVB 2EDNA 1MAKA 3MODH 4NNPL 2CJUL 1TVDA 4UINH 5JHDE 2Q76A 5LQBH 2BSSA 3ARGD 5GSVB 1XMWA 3NA9H 4X7TA 1X5GA 1ZMYA 1MI5A 1HH9B 1N2RA 4XMLH 2JTDA 4DN3H 4Z7NE 5IIEB 5KVGL 1GL4B 1NEUA 4WU7B 5HHME 1MFCL 4IDLA 4J3SA 3LD8B 1NAKH 3GZKA 5D70L 3B5TA 5DQDL 3NCMA 3O81A 4QRPB 3RVWD 3IDNB 4QY8B 2HTLD 1U58B 1X7QB 3RL1A 4R8WL 4PYGA 4JFHD 2C3VB 5EBWB 3G5XB 4QRSB 4YPJA 4PJ7F 4J3OC 4LMQE 4S1RH 5CZVL 1QFWI 5KSAB 1TZGL 4EXPX 4YX2L 4TSBH 1CBVL 3L3IB 1J8KA 1V3LA 3U30C 3TYGL 5GS2H 5DWUH 5F9AC 1DTUA 5ADOL 3N1GC 1NGPL 5IP4A 1X5YA 5FGRA 2FJHA 4QT5B 5L9DH 3QDAA 1S7TB 4YE4H 5F3BB 1XIWD 5TPWL 5HPOA 4ELMF 2A74A 1EHNA 2A77H 4K9EH 4J7RA 3V95A 3PWUA 5E5MA 2H3NB 4HWUA 3ZKMD 4LL9A 1L7IH 3GSOB 1U6AL 5AUMA 4CMHC 3VXTA 4PJ9A 4GLRI 1ZVYA 3QZWA 4YUEL 3MBED 4NQXB 3SEPA 3GSNL 5D5MA 1NLDL 3MR9B 3BQUD 2FO1A 5C09A 5CSZA 4BKLB 1XAUA 1JTTA 4N8PA 5EPMB 5IHZB 1FNGB 4OD1H 1RK1B 1RZGA 2Q76B 4S0SD 2VH5H 2HN7B 3VWKB 3W0WB 1IGJB 1XF5B 4IIQC 7FABL 2XZAH 1N4XL 4LVOC 4U1HB 4KHXL 2DQIH 3MRLB 4WCYH 3BZEA 2ZOKA 5GZOD 3TN0C 2EICA 3RWIA 4PBVC 1X4XA 2LTQB 4LNVA 1ZLVH 3QEGL 3QDMD 5CJOH 3WS6A 3NCJH 4MA8H 4ZO7A 2Q6WB 3IFLL 2VN7A 4NKDA 4QRQA 3LN5B 4XC1L 4XP6L 3V7AG 5T1KD 5F70A 1JPST 1DLFH 1T83C 2QEJA 5HD8C 3C6LD 4LSSH 2AXFB 3PQYE 4XBGA 4YHKH 2IC2A 1J1OH 2BCKB 5E00A 2SEBB 4CBPA 3IAPA 3MJ9H 4Z18A 4UAOC 4MNGE 4WFED 3U36B 1M7DB 4KK5C 5KSBF 5E08H 3OMZA 3CZFB 4L4JA 4G6JL 4WDIA 5T1MA 5K9KB 3UZQA 4Z7UF 3ETBF 1YNTB 5EN2B 3T0AA 3OZ9L 5KS9B 4DQOH 4HMCA 4UDTA 2Y06L 1X5HA 5SWSA 1YEDB 5CKAA 3U0TA 5DLMH 1A1NA 4NJ9H 3E1F1 2GUOA 2BMKA 1AD0A 1RUMH 5D5MB 4QXTA 4RBPH 3NGBC 5ERWA 4HC1H 4R7NB 3WJJC 1QPPA 3ARDD 2ITCB 3ES6B 4HIXL 3WFCH 2NW3B 4FZEL 4CRPA 4HJGA 4UTBH 1T2XA 4MA1C 1D5ZB 5I1IH 1MAJA 1A21A 3SN6N 2V2XB 3GHBL 1O5DT 4OQ1A 3QDJD 3VXNA 2X1QA 3ARSA 3QHTC 1FZJB 3QNYB 4M6NL 5E1HB 5KSUB 5LG1A 2P5EE 2NY2B 4LPVA 5HHVL 2W38A 4KJWC 3UTZA 5BVJA 2VE6B 3D39D 3OJDB 4I3GA 4YHIA 2RAMA 3MRFA 4CU7A 2IQ9H 4LIQE 4RGMC 4LCIL 4F2MB 4MSWA 5DD5L 5F8RC 4PJCB 1ODAA 4OCWL 4LCUA 4Y1AD 2FECL 1ZK9A 1IM3B 2CR3A 3HB3D 4L3CB 5E56A 4OV5A 1G9EA 1ZHNB 3TO2A 3O8XC 5HI3D 5EU4A 1T3FA 4JFFD 3VXQA 1WBYB 4YHZL 2WZPD 4W6WB 1GYAA 4CADB 1A7RL 2D03L 4DW2L 4XVUD 1LDPH 5CS7A 4FQ2L 5C0AE 2ZSWB 3VG9C 4XB8A 4GFTB 4HW6A 5E8DH 4NO2A 4DTGH 1RURH 2QLVB 2F9BT 3PHQA 3O0RL 3G6JB 2E27H 2FX8H 3OWEA 4TUJA 3UYOD 3WNLA 2DIAA 1IT9H 4Y19A 3WFHA 3DO7B 4UNVA 2FYYB 5BRZB 2XA3A 2DL9A 1CXKA 2OR9H 4RWHA 1ZEAH 3OKNB 4BFIB 1MHCB 1A1NB 3P2TA 5C9JA 2OZ4L 5H35B 3MLTA 3NIGF 1S5IL 3IDYB 4DZ8A 4EI5B 4QRUA 3TA3C 1K4CA 1AXSA 4OB5L 5J9PB 1AD0B 1JGDB 1U8MA 4WUKH 1CN4A 1I9JH 1N26A 5ERWB 3SKOB 1ONQA 2JJVA 3LV3B 1K4DA 3NPSC 5DEZA 1T80A 1F4XH 4XAKE 4OZIE 4LGPB 4ZUVB 3RVTC 4IMLB 5LBSL 3AAZA 4HUWB 3MV9E 2HT4D 3RZCC 5IB3B 1ZLSL 1NCDH 2NY6D 4JFDE 2PYEA 3SGJC 2UWEE 2DQHL 3EJJX 2O93L 4GAYB 1X5ZA 2QHRL 5EIVA 5D2LA 2RBLA 3MRFB 5FKAB 2NTFA 2I9TB 4MJIA 1DBJL 5F8QC 4YDLC 2DM7A 5TDOA 2HJFB 4CJ0A 3C60A 3MC0A 4K3DH 3HG1E 3LRGA 5GS1A 4UV7L 3T4AA 2NNAB 4OAWB 4Y8AA 4XPBL 5TGBB 5JDJA 1I7ZA 3HE7D 4FTVA 1FNHA 3NABH 1L0QA 3PJSB 1CE6B 3ALWA 5DEGA 3B2VH 4P4KA 4XNYH 1YMMD 3PV7A 3HE6B 3VXSD 3A6CH 4I77L 3UAJD 4KK9C 4M1CD 3VD3A 4LIQL 3ULSB 1G1YA 1HE7A 1KJVB 2OK0L 3X12B 5C0RL 2QR0A 1YN6A 1M7XA 3MV01 3RX7A 4HKXA 2FL5B 3SDXB 1HNFA 1KGCD 4LKCA 5DUMH 1MJ7L 1JP5A 5HGAA 2BDNL 4NQDA 5I1EH 3QRFM 1FVEB 4FS0A 2R2HA 25C8L 1JNNL 2AJXH 4YZFF 1BD2B 2X4TB 4K71C 2R0WH 4E41E 3FZUD 4MQ7A 4YAQB 4OZFB 3LHPH 4CVWA 5EO0A 3FFCE 3MZGB 4OBRA 2N1KA 4X4ZA 4ENEC 4MHHI 1DANT 4M5YL 3VFTA 1V3KA 3T0EE 3DRQB 4MB5A 1CD9B 4XBPA 3HTLX 5IM7B 4MNHB 1IBGL 3V8OA 4G8EB 2VIRA 4JPIB 4JPVH 5EOQH 3WXWL 1J86A 3QXAB 3QIWD 4KKLC 1OD7A 1Y0LA 4GS7B 4FABH 3SPVA 4PRNA 4HIIA 5I66B 5T3ZE 4HX1A 4WHCA 1BZ7B 4U1LA 2EXYD 5KSAC 4I0CC 1ZWIA 5BZDA 3QFJE 2VXUL 2Z35A 2WINB 1I4FA 1E27B 1TQCC 3F7VB 2H45A 2B5IB 2HVJB 3KPOA 3MV8E 1MSPA 3BDYH 5FO8A 5FK9B 5CEXA 1EEYB 4N9GA 4X5XB 1OQOA 4MB4A 1P5UA 1CVRA 1BM3L 3JTSA 4RMVA 5IMMB 3MRJB 3RKPA 5I8CB 5A2IH 1WISA 5EO9A 2FCBA 3T4YA 1EXUB 3IFPA 2CKBB 3O3DA 4LKCB 3BH8A 5F7DA 1H3PH 2F53A 2V7HA 3TBSB 2BFVH 1HHGB 1VACA 2XTJB 3EYSH 5I73B 2JJTA 1ZTXH 4DGVH 4MZ3A 5MEPA 2GITB 4PRBA 2V7NA 4GMTH 4X99B 4CMMB 1TZHA 3K8LA 4QOKA 3MNWA 3IDMA 3V6OA 1VFAA 3OKMB 1NJ9A 5I1HH 1FYHB 5TH2B 5EO0B 3JTTB 3QUZA 5D7LA 3VWKC 5CHNB 5JMRA 4RGOH 3R8BB 2MCPH 1CWVA 1FG2A 4HWZB 4XH2B 5CILH 1R3LB 1FN4B 1AGCA 1L0YA 1T1YA 3TVMA 4OI9A 3MOQA 3MLZH 2VIRB 1DEEA 4H1LB 2LTQC 2NR6C 1AKJB 2IH1B 2ZOLA 5KBNC 3K1DA 2NXYB 1JUFA 2BOBB 1HQRA 2FX7L 5I17A 3G5VA 1GC1L 5CZXC 4ISVB 3RUGA 2XQBL 3ARUA 1KCUH 1JN6A 5IESH 2G2RA 5JHDA 2AV1B 1F13A 4XBEL 4PJAF 4IEFB 4P59L 3KXFD 5IFAL 4ZUWB 1AC0A 2JELL 2R0ZH 4TVPE 4ZXBB 12E8L 3D85A 5ID0B 2H9GB 3P0YH 1L4IA 1MFNA 3OR6B 4ODVH 2YK1H 1R24A 5C0CD 3GUTA 3VFUA 2NY4D 4JJ5A 5C2BL 2VKXA 3OV6A 1HXYB 1BF8A 1I1FA 2FATH 1AD9A 5T3ZL 3HC4L 5EC1A 4L3AA 1N0LA 4PJ9C 4NQCD 3KAAA 2DIBA 1RMFH 5TE7H 3U2SA 4NDMA 4KQ3L 4Y89A 1CGVA 3DIFA 3I02B 5BCAA 5BV7B 3TM6A 4QHMA 5C70A 5MEPB 5FOBB 3QWOA 2FNBA 3MXWH 2J8UF 4ONGL 2CDFA 3LEVH 3GSNB 2NZ9C 5H37H 3QDHA 1EJOH 4ZS6C 5D7LB 5EBLA 1IGTB 3E2HC 5DVKA 4V2BA 1OPGL 4G6FB 3H3KA 3MQIA 4HHAB 4JO1L 4QGTA 4JQIH 1N64H 2CO7B 4PTTA 1KJ2L 3CZJA 4HIEA 4WUUB 3L95B 1XF2B 1YEIH 3EDKA 4KDVA 1B2WL 4NKMB 3TFKC 4DN4H 4NJAH 3NIFE 2ZUVA 1CQKA 3QPQC 1FVDA 1F3JB 2AEPL 3A67L 3U9PH 3RU8L 3HAEA 3CJJA 4I13B 3RAJL 2VMFA 1CL7I 1X44A 3KLAB 4N1EA 1UZ8B 5BMFL 4FQHB 5E7BA 3VFWA 1EK3A 5IVNA 3S96A 1A4KA 5SWQA 4PGEB 3B4NA 3RWDA 4MXWL 2VDNH 2IFFL 1GJIA 4RNRA 4IS6A 4DKEH 3OBAA 2PW1A 4Z5RB 4F9PA 1J5OL 4H26A 4R7DB 4YPGA 4ZTOL 2VLLB 2KPNA 3C09B 2WBJD 4PGCB 2YA1A 4LDOB 4Y5VA 2PCPA 4JRYB 2FO4A 3IDYC 4O4YL 4EI5C 1IQWL 2XRAL 1F6AA 3DIFB 5E7FA 1I85A 3U4BH 1JL8A 4LF3A 3I3DA 2D7QA 4EOWH 3QH3B 1KCVL 1WZ1L 4TVPL 2OZ4A 5GRXG 3E8UL 3PQYA 2OM5A 4DUXA 4GLRH 5HDQL 4ZAKB 5C07B 1MIMH 4MNGA 1YDPA 1Z6JT 4QXGH 4UB0H 4G9FB 5EDXA 3BWAA 3BEVA 2Z31D 3DYPA 3GSWB 2EC9T 2AJSH 3VXRD 2OJZH 5GGSA 3FO2A 1RK0A 2J88L 3BT2H 2DLGA 3PV6A 4ORZC 3S3JA 3U0PB 3W11C 3BPOC 2IPUK 4M8VA 3U46B 4RAVA 3HAEB 3MZTA 5DMGD 4BSVA 1MCSA 1NAMH 1BECA 3GMPA 3U7YH 3HC3L 1AQDB 1T89C 3MV7D 5BW7C 5MEQB 4JEGB 1RZJH 1T21B 1U95B 3HE6C 1RULH 1UFUA 2GJ6E 5GXBB 2R8SL 2ZUSA 4KZDL 1UACL 3RWDB 4K3JH 2AJVL 1CDCA 3KLHC 4OIIL 1NMBH 4WNQA 5GJSH 2X4PA 4PJBE 3SKNB 3FB8A 1U3HA 3IU3B 4POYA 1DP0A 4GW4B 2HVKA 2P5EA 4AQOA 4RA0C 4DKDC 1MCNA 1NDGA 2H32H 5L2JA 5I74B 3BE1L 3ARTA 4F7TA 2PCPB 1ZT1B 1VFBA 2NY1D 1K5NB 4WFGD 4Z7QF 2R2EA 4Z7WE 4FQXD 1UM6L 3CXHJ 4NM4H 4OT1L 4GRLA 3UX9B 1A9BA 2F54B 5KVDH 2NMSA 4NUGL 2XNAA 5C0AA 5C0IB 3QR2A 5CSBA 5KG9B 2FR4A 1BVKB 3PNWA 5J1SC 1FNSH 2NZIA 2Y4SA 3WIHH 3U83A 1IMHC 5EBMB 4GG8A 3BGMA 5EORH 5FM5O 5SX5H 1FL5B 1I3GL 1MHEA