3TF3A

Crystal structure of metal-free human arginase i
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
314
structure length
314
Chain Sequence
RTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase-1
publication title Crystal structures of complexes with cobalt-reconstituted human arginase I.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 115
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2011-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 3tf3A00
1HQFA 4FCIA 3E6VA 4ITYA 1HQ5A 3TH7A 3SL1A 3SL0A 4G3HA 4Q3RA 4RHJA 1ZPGA 4FCKA 2PHAA 1T4TA 3F80A 3THHA 3MMRA 4DZ4A 4IU4A 4GSZA 4GWCA 4CEVA 1T5GA 4I06A 1P8MA 4RLAA 3E8ZA 3E8QA 2EF5A 1TBJA 4GWDA 3PZLA 4Q40A 1RLAA 1D3VA 3MJLA 1HQGA 4MYFA 1HQHA 4HWWA 1TBHA 4IXUA 5HJ9A 4Q3QA 2RLAA 3M1RA 4Q42A 3DJ8A 4HXQA 2AEBA 3GN0A 1WOIA 4IE2A 3LP7A 4IU0A 2EF4A 3TF3A 4IE3A 1TBLA 1WOHA 1ZPEA 3E6KA 1WVAA 4IU5A 4RHLA 5RLAA 1WOGA 1P8QA 4MYLA 1HQXA 4Q41A 1P8SA 3THJA 4RHMA 4Q3PA 1XFKA 4IXVA 3NIOA 3LP4A 3E9BA 1CEVA 4RHQA 1WVBA 1P8PA 1T4PA 1T5FA 4Q3SA 4GSVA 2CEVA 4MYNA 2A0MA 3THEA 3LHLA 3CEVA 1T4RA 3NIQA 4RHKA 3SJTA 4MXRA 1R1OA 4RHIA 5CEVA 3RLAA 1P8OA 3KV2A 3MFVA 3SKKA 4IU1A 1T4SA 1TA1A 4GSMA 2PLLA 4Q3UA 4Q3VA 4IE1A 2PHOA 5HJAA 4Q3RC 2ZAVA 4MYKA 1PQ3A 3GMZA 3MFWA 1P8RA 1GQ6A 2EIVA 3NIPA 4HZEA 4Q3TA 1P8NA 1GQ7A
chains in the Genus database with same CATH superfamily
3EZPA 5G1BA 5G10A 1HQFA 4FCIA 3E6VA 4ITYA 1HQ5A 4LY1A 5G17A 1ZZ0A 5G13A 5THVA 5G0GA 5THTA 3SL1A 3SL0A 4G3HA 5EFKB 5G11A 4Q3RA 5THSA 4RHJA 5A2SA 1ZPGA 4FCKA 3Q9FA 5D1CA 4ZUMA 2PHAA 1T4TA 1ZZ3A 3EW8A 5G0YA 3F80A 4ZUNA 2VQMA 5G1AA 3THHA 4QA2A 5IWGA 5EFJD 1C3RA 3F06A 4QA5A 3MMRA 4DZ4A 4IU4A 1C3PA 4GSZA 4GWCA 5G3WA 4QA7A 5BWZA 4QA4A 4CEVA 1T5GA 5LI3A 4I06A 1P8MA 4RLAA 3E8ZA 3E8QA 4QA1A 5EFHA 1TBJA 2EF5A 3F0RA 5FUEA 4GWDA 4ZUPA 3PZLA 4Q40A 5G0HA 1RLAA 3ZNSA 4BZ8A 4BKXB 1D3VA 3MJLA 1HQGA 4MYFA 5EEIA 3MZ4A 4BZ5A 1HQHA 4HWWA 1TBHA 4IXUA 5HJ9A 4Q3QA 2RLAA 3M1RA 4LXZA 4Q42A 3DJ8A 4ZUQA 3MAXA 3MENA 4HXQA 5EFNA 5EEFA 5EF8A 2AEBA 4CBYA 3GN0A 1WOIA 3SFFA 4IE2A 5EEKA 3C0YA 3LP7A 4IU0A 2VQWG 4RN2A 2EF4A 3TF3A 3TH7A 4IE3A 1TBLA 1WOHA 5EF7A 5JI5A 3Q9CA 1ZPEA 3E6KA 1WVAA 4IU5A 2VQQA 3EWFA 2V5XA 4RHLA 5RLAA 3SFHA 1WOGA 1P8QA 4MYLA 5ICNB 2VQOA 1C3SA 1HQXA 4Q41A 1P8SA 2VQVA 5DC5A 3THJA 2V5WA 5DC6A 4RHMA 4Q3PA 4CQFA 4QA3A 1XFKA 4IXVA 3NIOA 5DC8A 3LP4A 3E9BA 1CEVA 3MZ6A 4RHQA 1WVBA 5DC7A 2VQJA 1P8PA 1T4PA 1W22A 1T5FA 2GH6A 4Q3SA 4ZUOA 4BZ7A 4GSVA 2CEVA 4MYNA 2A0MA 3MZ7A 3THEA 5THUA 5EFGA 3LHLA 5G1CA 3CEVA 1T4RA 3NIQA 4RHKA 3SJTA 3EZTA 4MXRA 1R1OA 4BZ6A 4RHIA 5CEVA 1T67A 5G0XA 5D1DA 3RLAA 3C10A 3Q9BA 1P8OA 3KV2A 3MFVA 4QA0A 3MZ3A 3SKKA 4IU1A 1ZZ1A 5IX0A 1T4SA 5G0JA 1TA1A 4GSMA 5FCWA 3Q9EA 5G12A 4QA6A 3RQDA 5G0IA 1T69A 2PLLA 4Q3UA 4Q3VA 4IE1A 3ZNRA 2PHOA 5HJAA 4A69A 4Q3RC 2ZAVA 4CBTA 4MYKA 5EENA 1PQ3A 3GMZA 3MFWA 1P8RA 1VKGA 5EEMA 1GQ6A 3F07A 1T64A 4RN0A 2EIVA 3NIPA 4HZEA 4Q3TA 1P8NA 5D1BA 2VCGA 4RN1A 4ZURA 1GQ7A 4BZ9A 5EFBD 3C0ZA
chains in the Genus database with same CATH topology
1HQFA 4FCIA 3E6VA 4ITYA 1HQ5A 3TH7A 3SL1A 3SL0A 4G3HA 4Q3RA 4RHJA 1ZPGA 4FCKA 2PHAA 1T4TA 3F80A 3THHA 3MMRA 4DZ4A 4IU4A 4GSZA 4GWCA 4CEVA 1T5GA 4I06A 1P8MA 4RLAA 3E8ZA 3E8QA 2EF5A 1TBJA 4GWDA 3PZLA 4Q40A 1RLAA 1D3VA 3MJLA 1HQGA 4MYFA 1HQHA 4HWWA 1TBHA 4IXUA 5HJ9A 4Q3QA 2RLAA 3M1RA 4Q42A 3DJ8A 4HXQA 2AEBA 3GN0A 1WOIA 4IE2A 3LP7A 4IU0A 2EF4A 3TF3A 4IE3A 1TBLA 1WOHA 1ZPEA 3E6KA 1WVAA 4IU5A 4RHLA 5RLAA 1WOGA 1P8QA 4MYLA 1HQXA 4Q41A 1P8SA 3THJA 4RHMA 4Q3PA 1XFKA 4IXVA 3NIOA 3LP4A 3E9BA 1CEVA 4RHQA 1WVBA 1P8PA 1T4PA 1T5FA 4Q3SA 4GSVA 2CEVA 4MYNA 2A0MA 3THEA 3LHLA 3CEVA 1T4RA 3NIQA 4RHKA 3SJTA 4MXRA 1R1OA 4RHIA 5CEVA 3RLAA 1P8OA 3KV2A 3MFVA 3SKKA 4IU1A 1T4SA 1TA1A 4GSMA 2PLLA 4Q3UA 4Q3VA 4IE1A 2PHOA 5HJAA 4Q3RC 2ZAVA 4MYKA 1PQ3A 3GMZA 3MFWA 1P8RA 1GQ6A 2EIVA 3NIPA 4HZEA 4Q3TA 1P8NA 1GQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQF A;  4FCI A;  3E6V A;  4ITY A;  1HQ5 A;  3TH7 A;  3SL1 A;  3SL0 A;  4G3H A;  4Q3R A;  4RHJ A;  1ZPG A;  4FCK A;  2PHA A;  1T4T A;  3F80 A;  3THH A;  3MMR A;  4DZ4 A;  4IU4 A;  4GSZ A;  4GWC A;  4CEV A;  1T5G A;  4I06 A;  1P8M A;  4RLA A;  3E8Z A;  3E8Q A;  2EF5 A;  1TBJ A;  4GWD A;  3PZL A;  4Q40 A;  1RLA A;  1D3V A;  3MJL A;  1HQG A;  4MYF A;  1HQH A;  4HWW A;  1TBH A;  4IXU A;  5HJ9 A;  4Q3Q A;  2RLA A;  3M1R A;  4Q42 A;  3DJ8 A;  4HXQ A;  2AEB A;  3GN0 A;  1WOI A;  4IE2 A;  3LP7 A;  4IU0 A;  2EF4 A;  3TF3 A;  4IE3 A;  1TBL A;  1WOH A;  1ZPE A;  3E6K A;  1WVA A;  4IU5 A;  4RHL A;  5RLA A;  1WOG A;  1P8Q A;  4MYL A;  1HQX A;  4Q41 A;  1P8S A;  3THJ A;  4RHM A;  4Q3P A;  1XFK A;  4IXV A;  3NIO A;  3LP4 A;  3E9B A;  1CEV A;  4RHQ A;  1WVB A;  1P8P A;  1T4P A;  1T5F A;  4Q3S A;  4GSV A;  2CEV A;  4MYN A;  2A0M A;  3THE A;  3LHL A;  3CEV A;  1T4R A;  3NIQ A;  4RHK A;  3SJT A;  4MXR A;  1R1O A;  4RHI A;  5CEV A;  3RLA A;  1P8O A;  3KV2 A;  3MFV A;  3SKK A;  4IU1 A;  1T4S A;  1TA1 A;  4GSM A;  2PLL A;  4Q3U A;  4Q3V A;  4IE1 A;  2PHO A;  5HJA A;  4Q3R C;  2ZAV A;  4MYK A;  1PQ3 A;  3GMZ A;  3MFW A;  1P8R A;  1GQ6 A;  2EIV A;  3NIP A;  4HZE A;  4Q3T A;  1P8N A;  1GQ7 A; 
#chains in the Genus database with same CATH topology
 3EZP A;  5G1B A;  5G10 A;  1HQF A;  4FCI A;  3E6V A;  4ITY A;  1HQ5 A;  4LY1 A;  5G17 A;  1ZZ0 A;  5G13 A;  5THV A;  5G0G A;  5THT A;  3SL1 A;  3SL0 A;  4G3H A;  5EFK B;  5G11 A;  4Q3R A;  5THS A;  4RHJ A;  5A2S A;  1ZPG A;  4FCK A;  3Q9F A;  5D1C A;  4ZUM A;  2PHA A;  1T4T A;  1ZZ3 A;  3EW8 A;  5G0Y A;  3F80 A;  4ZUN A;  2VQM A;  5G1A A;  3THH A;  4QA2 A;  5IWG A;  5EFJ D;  1C3R A;  3F06 A;  4QA5 A;  3MMR A;  4DZ4 A;  4IU4 A;  1C3P A;  4GSZ A;  4GWC A;  5G3W A;  4QA7 A;  5BWZ A;  4QA4 A;  4CEV A;  1T5G A;  5LI3 A;  4I06 A;  1P8M A;  4RLA A;  3E8Z A;  3E8Q A;  4QA1 A;  5EFH A;  1TBJ A;  2EF5 A;  3F0R A;  5FUE A;  4GWD A;  4ZUP A;  3PZL A;  4Q40 A;  5G0H A;  1RLA A;  3ZNS A;  4BZ8 A;  4BKX B;  1D3V A;  3MJL A;  1HQG A;  4MYF A;  5EEI A;  3MZ4 A;  4BZ5 A;  1HQH A;  4HWW A;  1TBH A;  4IXU A;  5HJ9 A;  4Q3Q A;  2RLA A;  3M1R A;  4LXZ A;  4Q42 A;  3DJ8 A;  4ZUQ A;  3MAX A;  3MEN A;  4HXQ A;  5EFN A;  5EEF A;  5EF8 A;  2AEB A;  4CBY A;  3GN0 A;  1WOI A;  3SFF A;  4IE2 A;  5EEK A;  3C0Y A;  3LP7 A;  4IU0 A;  2VQW G;  4RN2 A;  2EF4 A;  3TF3 A;  3TH7 A;  4IE3 A;  1TBL A;  1WOH A;  5EF7 A;  5JI5 A;  3Q9C A;  1ZPE A;  3E6K A;  1WVA A;  4IU5 A;  2VQQ A;  3EWF A;  2V5X A;  4RHL A;  5RLA A;  3SFH A;  1WOG A;  1P8Q A;  4MYL A;  5ICN B;  2VQO A;  1C3S A;  1HQX A;  4Q41 A;  1P8S A;  2VQV A;  5DC5 A;  3THJ A;  2V5W A;  5DC6 A;  4RHM A;  4Q3P A;  4CQF A;  4QA3 A;  1XFK A;  4IXV A;  3NIO A;  5DC8 A;  3LP4 A;  3E9B A;  1CEV A;  3MZ6 A;  4RHQ A;  1WVB A;  5DC7 A;  2VQJ A;  1P8P A;  1T4P A;  1W22 A;  1T5F A;  2GH6 A;  4Q3S A;  4ZUO A;  4BZ7 A;  4GSV A;  2CEV A;  4MYN A;  2A0M A;  3MZ7 A;  3THE A;  5THU A;  5EFG A;  3LHL A;  5G1C A;  3CEV A;  1T4R A;  3NIQ A;  4RHK A;  3SJT A;  3EZT A;  4MXR A;  1R1O A;  4BZ6 A;  4RHI A;  5CEV A;  1T67 A;  5G0X A;  5D1D A;  3RLA A;  3C10 A;  3Q9B A;  1P8O A;  3KV2 A;  3MFV A;  4QA0 A;  3MZ3 A;  3SKK A;  4IU1 A;  1ZZ1 A;  5IX0 A;  1T4S A;  5G0J A;  1TA1 A;  4GSM A;  5FCW A;  3Q9E A;  5G12 A;  4QA6 A;  3RQD A;  5G0I A;  1T69 A;  2PLL A;  4Q3U A;  4Q3V A;  4IE1 A;  3ZNR A;  2PHO A;  5HJA A;  4A69 A;  4Q3R C;  2ZAV A;  4CBT A;  4MYK A;  5EEN A;  1PQ3 A;  3GMZ A;  3MFW A;  1P8R A;  1VKG A;  5EEM A;  1GQ6 A;  3F07 A;  1T64 A;  4RN0 A;  2EIV A;  3NIP A;  4HZE A;  4Q3T A;  1P8N A;  5D1B A;  2VCG A;  4RN1 A;  4ZUR A;  1GQ7 A;  4BZ9 A;  5EFB D;  3C0Z A; 
#chains in the Genus database with same CATH homology
 1HQF A;  4FCI A;  3E6V A;  4ITY A;  1HQ5 A;  3TH7 A;  3SL1 A;  3SL0 A;  4G3H A;  4Q3R A;  4RHJ A;  1ZPG A;  4FCK A;  2PHA A;  1T4T A;  3F80 A;  3THH A;  3MMR A;  4DZ4 A;  4IU4 A;  4GSZ A;  4GWC A;  4CEV A;  1T5G A;  4I06 A;  1P8M A;  4RLA A;  3E8Z A;  3E8Q A;  2EF5 A;  1TBJ A;  4GWD A;  3PZL A;  4Q40 A;  1RLA A;  1D3V A;  3MJL A;  1HQG A;  4MYF A;  1HQH A;  4HWW A;  1TBH A;  4IXU A;  5HJ9 A;  4Q3Q A;  2RLA A;  3M1R A;  4Q42 A;  3DJ8 A;  4HXQ A;  2AEB A;  3GN0 A;  1WOI A;  4IE2 A;  3LP7 A;  4IU0 A;  2EF4 A;  3TF3 A;  4IE3 A;  1TBL A;  1WOH A;  1ZPE A;  3E6K A;  1WVA A;  4IU5 A;  4RHL A;  5RLA A;  1WOG A;  1P8Q A;  4MYL A;  1HQX A;  4Q41 A;  1P8S A;  3THJ A;  4RHM A;  4Q3P A;  1XFK A;  4IXV A;  3NIO A;  3LP4 A;  3E9B A;  1CEV A;  4RHQ A;  1WVB A;  1P8P A;  1T4P A;  1T5F A;  4Q3S A;  4GSV A;  2CEV A;  4MYN A;  2A0M A;  3THE A;  3LHL A;  3CEV A;  1T4R A;  3NIQ A;  4RHK A;  3SJT A;  4MXR A;  1R1O A;  4RHI A;  5CEV A;  3RLA A;  1P8O A;  3KV2 A;  3MFV A;  3SKK A;  4IU1 A;  1T4S A;  1TA1 A;  4GSM A;  2PLL A;  4Q3U A;  4Q3V A;  4IE1 A;  2PHO A;  5HJA A;  4Q3R C;  2ZAV A;  4MYK A;  1PQ3 A;  3GMZ A;  3MFW A;  1P8R A;  1GQ6 A;  2EIV A;  3NIP A;  4HZE A;  4Q3T A;  1P8N A;  1GQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...