3TFQA

Crystal structure of 11b-hsd1 double mutant (l262r, f278e) complexed with 8-{[(2-cyanopyridin-3-yl)methyl]sulfanyl}-6-hydroxy-3,4-dihydro-1h-pyrano[3,4-c]pyridine-5-carbonitrile
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
262
structure length
262
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYNMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Discovery of 3-hydroxy-4-cyano-isoquinolines as novel, potent, and selective inhibitors of human 11beta-hydroxydehydrogenase 1 (11beta-HSD1)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 99
structure length 262
sequence length 262
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2011-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tfqA00
4NBVA 2P4QA 1LLDA 4TWRA 1U3VA 3DXFA 2YQ5A 3JQ9A 5B1YA 1NTOA 3KZVA 4GQAA 4A5OA 4XDYA 2O3RA 3MWEB 1H94A 5DP2A 3LF2A 2W4QA 3RBXA 1W4ZA 1ZMOA 3DZKA 5LDGA 4DPMA 4LCEA 2Y99A 1W0CA 3LT2A 4J2HA 3NTRA 1E3EA 2YZ7A 1F06A 3SJ7A 4B4OA 5JDIC 4FD3A 1ENOA 3K30A 4CM1A 3VH2A 2VT2A 2DBRA 3DZIA 4GMFA 3H5NA 1GYRA 1LRLA 4FOSA 1KEWA 1EZ4A 2VCYA 4XGKA 4D41A 4K6CA 4NR0A 4BO8A 1C0KA 1I5RA 1N7HA 1PGQA 2BHLA 4XYGA 1FDSA 5JCXA 2X86A 1YBAA 1ISJA 1BMDA 3TFQA 1WVGA 4EUFA 1UUFA 4DMMA 4OMUA 3ROPA 1JWAB 4CPDA 3FN4A 5JMWA 1NNUA 4JBIA 3ZWOA 4RLHA 4G81A 1ZMTA 4U0JA 2HMSA 4IXTA 4RZIA 5KVCA 1PS8A 5I7SA 2ZIZA 4J9UE 3CXRA 4GX1A 4AJKA 3C7CB 4DTIA 3U09A 5KNLA 1ULSA 3NDIA 3RVDA 2XAAA 3KYDB 4GVLA 5JFOA 1EDZA 1S6YA 1N1EA 1UJMA 3G1UA 3QY9A 4RGBA 1W6UA 3DBHB 2NU7A 4DC1A 4IDEA 5LC1A 2VRCA 3PHIA 5CPFA 2ZB7A 4BNWA 2ZJ1A 4N54A 3K5PA 4UVEA 3SEFA 2BH9A 4CMEC 5JBIA 5AXCA 2Q4BA 4NIMA 5FI5A 2FR0A 3DZJA 3QRWA 1H9AA 3SX2A 4CMHA 3Q2KA 2I3AA 3EY4A 4CMKA 1GZ4A 3WSWA 5GMOA 5BNTA 1F0YA 4PLTA 3MJSA 3QWAA 5AXAA 4E2ZA 4YRBA 1JN0A 3KYDA 4LMPA 4YJGB 3CUKA 2ZQZA 1WAMA 2VZ8A 1WMAA 1ZK3A 4YT2A 3DMTA 5H83A 1WXDA 3DBHA 2XXBA 1GFSA 3LF1A 3FF4A 1K2WA 5J23A 3D5TA 3WIEA 3D3EA 3MJEA 2GR9A 3O8QB 1KVRA 4MVJI 1ZCJA 1XELA 4A7PA 4BNLA 4JN6B 5IZ4A 1PU2A 1JTVA 1T26A 3WGQA 4BB5A 4YCAA 1FDVA 5HA5A 5DOVA 3WGGA 4CV3A 3KYBA 4J7CA 1R37A 3TOZA 1AN9A 4PZDA 3KHUA 1X13A 3AI1A 2I5PO 4YJGA 3JQCA 4GGOA 4PLVA 4OSPA 5G0TA 3S2GA 4NI5A 2NU9A 4AJ1A 5COAA 3ZV4A 1R4NB 3RC7A 4J9VA 4D7AA 1R0SA 2EEZA 5C7IO 4QXMA 5IDQA 5L4NA 5I7VA 1TEHA 2QX7A 1U5AA 3ASUA 4CR8A 3VPXA 3O8QA 3O4RA 2D1YA 2QHXA 2PZMA 2X58A 3OJEA 5G0SA 4P4GA 1Z74A 1BTOA 3UHAA 3OJFA 2D3TA 1GZ3A 5COBA 1N8KA 2GGSA 4F3YA 4RDIA 4HFJA 4BKUA 4AJEA 1BG6A 3GA0A 4GX0A 1GR0A 3ZU5A 1HZZA 1R4NA 2X0JA 3M6IA 4I1IA 1L1FA 5ES3A 1HKUA 2YUTA 3PRJA 2ZTUA 4KDEA 1FDWA 2G17A 4RF4A 3ZI0A 4RF2A 2D0IA 3G0OA 3GGPA 4CL8A 1HSZA 5JE8A 2ZCUA 5LCXA 5IAAA 1EBUA 1GV0A 5IZCA 4E4YA 2FN7A 3ZWWA 3PQDA 1PL6A 2X0RA 3H5RA 4TMFA 6ADHA 1ZXLA 3CZRA 2VYND 3DAPA 3AUAA 3QQPA 3ZHZA 1Y8QA 1AXEA 2QYTA 4Q9NA 3BMNA 1O0SA 3L0DA 4PG6A 3JQBA 2G82A 1WZIA 1NWCA 4ZD6A 1VPDA 3WJ7A 1RJWA 1EUCA 4KDFA 1E7YA 2IE0A 2PY6A 3NGLA 3WYBA 2NM0A 4ZVVA 4M54A 3UF0A 4OXNA 4MPDA 4BVAA 1E1LA 2EIHA 5ITVA 1ZSYA 3B1FA 1NFRA 4ROSA 4W6ZA 3V1YA 1QRRA 2GN9A 3CSDA 4LVUA 1GCUA 9LDBA 2GLXA 4YACA 2C7GA 1QV7A 2PKQP 2P5YA 1GQQA 2JHGA 2X7HA 2DKNA 4L4XA 4B4UA 3TFOA 2J3HA 1C1XB 5ILOA 3HB5X 1PZGA 2IEBA 4RVDA 4MP3A 4BMSA 2GZ3A 3GPDG 3U4CA 4BNZA 3QIVA 3QWBA 1CQJA 3VAZA 2EKQA 4JNKA 2F1KA 3BTSA 1A71A 2OHXA 4ALKA 2GCGA 3IIEA 1KIFA 4BO3A 1EVJA 2AXQA 3DC2A 1G6KA 1RYEA 3F5QA 1N7GA 4KQXA 1HDCA 4BQPA 1PJCA 1BXGB 1MB4A 5DDIP 4J1QA 1UXIA 1NBOA 1C1XA 4GWKA 4D3SA 3TZCA 5KJFA 3VH1A 3OMLA 4J4BA 3OM9A 3PJFA 2R00C 3ZNOA 5BR7A 4RVUA 1MUUA 2GO1A 3E6AA 3GRKA 1PJSA 3GZNB 1PS0A 2HMVA 3JQ9C 1GEGA 3OETA 5HM8A 3FBTA 4QX6A 2HDHA 3F4LA 4CMBA 4PLWA 2Y0CA 4BNIA 1U8FO 5C37A 3OA0A 1BXGA 3VDRA 1KVUA 2UAGA 1IZ0A 1JW9B 3F1KA 1YGYA 3BZUA 3RASA 4GKVA 5JY1A 2C54A 1I2CA 3RC9A 5HS4A 2Y05A 3PZRA 1V3VA 1HDOA 3UICA 4Y67A 2JCYA 3KSUA 1WWKA 2Y67A 3GZNA 1PJBA 3ZWPA 4BO6A 3I4CA 2GRAA 3VVCA 4BNTA 4CUJA 2X1HA 2IXBA 1YO6A 2Y1FA 5B4UA 3NT5A 2HU2A 3HQ4O 1PJ4A 3KSZO 1OMOA 4K1LA 4LISA 4DUPA 3C1TA 3CMMA 2IEDA 2H63A 1LSSA 2EKLA 4KUEA 4WEQA 4A10A 2I65A 1YKFA 1KETA 1Z45A 4XYLA 5C5IA 1C3VA 1PS9A 5IDXA 3E82A 2I99A 3EZLA 4B4VA 4OQYA 3OJLA 3SVTA 4Y6PA 4NU5A 4R5HA 4R4JA 1E7WA 3UAGA 1CF2O 3UXYA 1WW8A 3UCXA 2UUPA 2FZEA 2QRJA 1DHTA 3GDOA 2E6UX 1U4OA 4PRLA 3PXXA 4NJOA 4A0SA 4GMGA 1VM6A 3TOXA 3NRCA 4UVDA 1Y6JA 5EIOA 5FYDA 3T4EA 4DPKA 2C5EA 1P1JA 3DBRB 1LRJA 1MA0A 2JL1A 4C7JA 3BHMA 3PJGA 4Z9XA 3IUSA 1W8DA 3GHYA 3S2EA 4I5GA 2EXXA 3FBGA 2HMTA 3ONDA 3GG2A 3RFVA 1VKNA 4KTTE 2Z5LA 4EZBA 4R16A 1HL3A 1YDEA 3DMTC 4HBGA 5ENVA 5TJHA 5TX7A 3H9UA 3DHYA 4JJGA 3KEQA 3PYMA 3NDRA 4EBFA 1PJ3A 1H9BA 2IRWA 1ZH8A 2X9GA 4KWHA 4OGWA 4TSKA 4CV0A 3BTVA 3AY3A 3DBRA 5KIAA 1M67A 2JFHA 1EFLA 5AYVA 3RUCA 5L40A 3A28A 1GL3A 4I08A 4ZGWA 1IHYA 1PZFA 3L6DA 3GHHA 3STHA 4OO3A 1IE3A 4M8SA 4TKLA 4BV8A 1HE5A 1DRVA 2XF8A 1IY8A 2V6MA 4YJFB 2I76A 3ZU3A 2J3KA 2R6JA 2UDPA 5B37A 5BNIA 2FPGA 1RKXA 2IYOA 2X8LA 1DIAA 2IZ1A 3GMSA 1A9YA 3K2BA 2O2SA 3T7EA 4KMSA 4BO2A 3JSAA 4YR9A 2AA3A 5JAIA 1TT5B 4NFYA 5CEFA 2GZ1A 2NWQA 3LT0A 2QRLA 5JDCA 2J3JA 4PVDA 2GPTA 1KVTA 5A3JA 1E7RA 2HRZA 1LC0A 2VT3A 3HSKA 4N7RA 4R68A 2ZB3A 2YV3A 2B4TO 2VYNA 4AFNA 1DEHA 1HYHA 1YB1A 1O5IA 4NG5A 4YJFA 2B37A 2PGDA 3E5RA 4MVJP 4ZQEA 1GUZA 1MLDA 3C1AA 2VHVA 3IP3A 3RBVA 1A72A 4JJIA 4O6VA 5I9NA 3M2TA 2C29D 2B4QA 4NBRA 1IUKA 1B7GO 4E13A 1TT5A 1GV1A 4L4SA 2EV9A 1YS4A 3VC7A 1JLLA 3N58A 1G0OA 1H6CA 4Z0TA 1EUDA 2FR8A 1ONNA 1E5LA 3ORFA 3JYLA 4HX5A 1ADCA 4PCVA 1MGOA 2ZYGA 1T4DA 1Y9EA 3RU9A 4ALLA 1GPDG 3DO5A 3S8MA 2H1SA 3H9QA 5T8KA 3WX0A 1I30A 1LJ8A 3HJAA 1XA0A 3E18A 2Y1EA 1ADGA 1I10A 1ID1A 3ZW8A 2Z1MA 4II2A 4BNJA 5TIIA 3H2SA 3JQBC 2I6TA 5THQA 3LLSA 2QQ5A 3ST7A 4NU6A 2NUAA 1VJ1A 3QVXA 3ITKA 4IZHA 4IZIA 4PG4A 4WE3A 1ONPA 4ND3A 5JAZA 2JAPA 1I3LA 7MDHA 2NV6A 4IQ8A 3V2GA 1P1FA 3INRA 5TLSA 4GLOA 4XQCA 1EVZA 1P45A 1QYWA 3JTMA 4K26A 1T1SA 3S2FA 1M75A 5IDWA 1M6WA 3LC1O 1ZZEA 1DO8A 4GBJA 2Q46A 1I2ZA 3ZZNA 4F45A 5JYEA 5FFFA 1J4AA 2O7SA 4PZEA 5G2OA 4EJ0A 3WMWA 4IDFA 3KSDO 3R0IA 4I9UA 4EW6A 4WNCA 4FJ2A 4FBGA 4QUKA 2JHFA 3VPHA 5CDGA 3P19A 3JQ6A 4E5PA 4UEJA 5C7LO 3PFWO 2Y66A 1YRLA 2WD7B 1X0VA 5KVQA 1HEUA 3EAGA 1Q7BA 2X4GA 2QW8A 4HKTA 4BNYA 5A9SB 1NPYA 1BDBA 4PLYA 3GEMA 1QP8A 4OIMA 2PZKA 4XQEA 5ICMA 5IN4A 3TSCA 4RQTA 1NWHA 4KZPA 2JFGA 4QSMA 4YXFA 2AQKA 1VI2A 2WWRA 2Y93A 3WS7A 5CG2A 2PNFA 3PIDA 5IG2A 2V65A 4Z3DA 4DIBA 5DCUA 4UUNA 1KBZA 4F6CA 4IIVA 3EUWA 1E5QA 3DONA 1P74A 1UP6A 4NK5A 4W9NA 4XR9A 4IUYA 1I3MA 4NK4A 3O26A 4L74A 2A94A 3AM4A 5A9SA 5L4LA 3D1LA 1NVTA 4HUJA 1ZEJA 3DL2A 4HNHA 5EPOA 3DAFA 3COSA 4INAA 4E33A 1OI7A 1H2HA 1MV8A 5AXDA 3RU7A 3I4FA 1TB4A 4HFNA 1YDWA 5FEUA 1ML3A 3GH3A 3H9EO 1DSSG 1LQUA 1D7OA 1Y81A 4PN3A 1SAYA 4DXHA 2AQ8A 2POQX 4RF3A 4JP3A 2IYPA 3DZGA 1HDXA 2FHSA 1H0KA 5DF1A 3AUTA 5EERA 3WYCA 3WG9A 3F9IA 5A06A 5CDTA 1BGVA 4K28A 3PHJA 4EEXA 2VWPA 4OXKA 5A02A 1R15A 1YE3A 3AFMA 4BV9A 1B8PA 1DRWA 1R4MB 2C82A 3Q3CA 4YT4A 3R3JA 1PQWA 4KQWA 1ORRA 4EEZA 1JKJA 1K6IA 4R1SA 4ALNA 1C0IA 1A27A 4L73A 4LCJA 3AU8A 2RAFA 2CF6A 3MTGA 3H3FA 3PFFA 1YBMA 5IF3A 3ADPA 3E9NA 2D8AA 2ZCVA 3VOSA 1HLDA 4FPXA 5AXBA 1LSJA 1PSDA 2WYUA 2IODA 5L95A 3A14A 5EQFA 2J6IA 1PTJA 4Q3DA 2HLPA 3GVXA 1DFIA 4CLOB 1LDMA 4DBZA 1MFPA 4EDFA 2VUSA 4U8GA 2W2LD 4MVJH 4D79A 4B4WA 1ISIA 4ZA2A 4O0LA 1BW9B 4E31A 3UUWA 1BRMA 3PVZA 4XWYA 3QWHA 4TRRA 2IZZA 4D3FA 4YJHB 3HB4X 1UAGA 2I67A 5BSFA 1NP3A 3OHSX 1JA9A 3W6UA 4M55A 4Q3NA 4FR5A 4J90A 1IHXA 1LDNA 2X22A 1HE3A 4B7UA 5DBIA 1U9JA 3DHEA 3QP9A 2VZ9A 3G79A 3GLQA 3U5TA 3HDQA 3SJUA 4Z9FA 1YONA 3PLNA 5DZSA 5CAEA 2FP4A 3VKUA 1LA2A 1A7AA 2FSSA 1HXHA 1X14A 1IZ9A 4R54A 2C2XA 2BFAA 3CPSA 3ROQA 4DYVA 1ZKMA 1NAIA 1U5CA 4XRGA 5AOVA 5FWNA 3PJEA 4YQZA 5AQ1A 1ULUA 5L51A 3R3SA 4ALIA 4XZ3A 1TI7A 2TMGA 3WTCA 1KS9A 1YWGO 2X5JO 5CDSA 1PZHA 2ZTVA 3C8MA 2D4AA 3INTA 1HZJA 1UP7A 4MVJM 4RO0A 1LLCA 4R51A 3ANNA 1N1GA 3K2EA 5I7EA 1LXCA 4FSHA 1ISHA 4ZRMA 4IDCA 5JCJD 1M66A 2VWGA 3OBBA 1UDAA 4CM5A 4E32A 3X2FA 5JO0A 2GF2A 4AJJA 1NR1A 1DJQA 1E7MA 4OOFA 1EEHA 2Y1DA 1XWFA 4Q3AA 4ZU3A 3W8DA 3AY6A 5K9ZA 4OJNA 8LDHA 3GVCA 4L9RA 3H4VA 4HP8A 1KC1A 1XKQA 3GK3A 2O3QA 2W98A 4FFRA 4ZRNA 3I23A 5T8KC 3GMDA 3GNSA 1NM5A 2P68A 3D3WB 4RJTA 2Q4EA 1EK6A 2CMDA 4YVFA 1DFGA 2P2SA 4JIGA 3LYLA 3BXXA 1UAYA 1GZ6A 4FB5A 4MDHA 3ZNQA 1MG5A 1ENYA 4Q3BA 4FFLA 1M76A 2HSDA 1V35A 2FR1A 4CJXA 5JW6A 4MVJG 4ND2A 4QQRA 4WASA 3GRPA 1XQ1A 3H2ZA 4XYEA 3NTQA 1KVSA 4CM4B 3W4IA 2C7VA 4ZHSA 3N74A 3D3WA 3JYQA 4GX5A 3GDGA 4RDHA 4ND1A 5G0VA 4ALMA 4PGFA 4YRAA 1JU9A 3S55A 2A4KA 4WCDA 3WFJA 3UW3A 2NVBA 3BHJA 4GGPA 2G1UA 3TN7A 5DOZA 2W8ZA 1OFGA 1VJTA 4XJTA 2NLOA 2EHDA 3VVBA 2O3TA 3DTYA 3FNHA 1XU9A 4D3DA 5TT1A 3BMQB 5GZ3A 2H9IA 3K6JA 5ICSA 4CM4A 2CFCA 3A1NA 3IKVA 3GUCA 1E6WA 1U3UA 2FWMX 3OIFA 2OZPA 3BTUA 4IJUA 3LK7A 3HWRA 1HE4A 3NAQA 1YL5A 3DOJA 1LSUA 3ANLA 2DUWA 2BELA 5KTKA 3DB2A 4DQUA 3BMQA 3ROMA 3LQFA 5L7WA 4GX2A 4M86A 1J5PA 2JD1A 2X6TA 4FFPA 4R1NA 4XYBA 2VWQA 4GVXA 4U7WA 4FFOA 4L0QA 3W1VA 1N2SA 2ZB8A 4MKXA 2NVUB 3SLKA 3WFIA 4CMIB 1NFFA 4G5HA 1U4SA 4Y98A 3SC6A 4P8RA 4OKIA 1E3IA 4XEHA 1F8GA 2NQ8A 3F6YA 5TQVA 1PJTA 4OXYA 3W8EA 3WBFA 4OOEA 3OSUA 5L3ZA 5G0WA 3EMKA 1PWXA 3OJOA 4BNKA 4S1VA 4WUVA 4HY3A 3PWZA 4YRDA 4QTZA 3RWBA 1U7TA 1U3TA 5DN9A 1Y1PA 2NVUA 1PGOA 1S7CA 1UZLA 4CMIA 1IPFA 2WJPA 3MJTA 4PZCA 1DRUA 1E77A 2VQ3A 3GGGA 3HDYA 3TF5A 5A3VA 4RLSA 1O9BA 1SEVA 3VTZA 1OOEA 3H5AA 4XJSA 4K9DA 2EJVA 3KVOA 2LDXA 1E92A 1P0FA 2W2LA 1I0ZA 4BNNA 3OP4A 3MCVA 4MKZA 4R01A 4DPLA 5EQDA 5LDHA 3IJRA 9LDTA 3GGOA 2C07A 3CIFA 2Q49A 3ZV3A 4CLRB 1TLTA 1K89A 2E82A 2Q1TA 3B6ZA 4WCFC 3TZ6A 1SOVA 1LC3A 1E1NA 3FTNA 4D46A 1A5ZA 1BXZA 2NNLD 2QZZA 1Y9AA 2AW5A 2VOJA 2FRDA 3GC6A 1RM0A 3P2OA 4XYMA 2ET6A 1IB6A 2OL4A 3EZYA 5T5QA 4Z3KA 4IDDA 1CIVA 2GZ2A 3GDFA 1U28A 4CLRA 5ILGA 2P9GA 4NJMB 4Q3CA 4ZQFA 2PD6A 1X7GA 1WMBA 2YFHA 4XQ9A 4YT5A 3RSHA 4CV1A 2PA3A 3BIOA 4OH1A 2EW8A 1DJNA 1U7HA 1VSVA 3V8BA 4E5NA 6LDHA 2VNSA 1EUZA 4R3WA 1HYGA 5F5NA 5BQFA 1GCOA 2O2YA 5CG1A 1B15A 2YHIB 5I7FA 3NTOA 4KUGA 2GERA 4BO5A 3MEQA 3WJAA 3E9MA 4IGEA 3TDKA 3TZKA 4ZN6A 1SCUA 2FSVA 2TMDA 3GPIA 1EMDA 4TRNA 4GH5A 3GNTA 3T4XA 1XYGA 4NJMA 5KKAA 5JXWA 3I9LA 1QYDA 3RI3A 4BQRA 5L7TA 4J2OA 5C7OO 1UR5A 4QFDA 4C4OA 4DA9A 2JCVA 2PKQO 1RM3A 2DLDA 2X5KO 4QECA 2EG9A 1I8TA 1MXFA 2YHIA 1U2GA 2C5AA 3QJ5A 2RH8A 2X5OA 3KEOA 3MOIA 1GD1O 2Z1NA 3WIDA 4YYZA 1YQGA 3U4HA 5K6AA 1AHIA 4NQZA 5H82A 1P0CA 3VPGA 5A9TA 4YAEA 1I32A 3DMYA 1U2DA 1D1TA 1JAYA 1TA4A 1QXSA 3DZHA 5GY7A 1LDGA 5L7YA 3W6ZA 1JAXA 3H3JA 1YH3A 1Q0HA 1VL0A 3X2EA 1QLHA 1T4BA 3DHNA 3NJ8A 1U3WA 3QHAA 2VZ0A 4A73A 2EWMA 3FR7A 3CZMA 4XIYA 4B7CA 3E48A 2GN8A 4B7XA 5L53A 3OQ6A 1NQOA 2WM3A 1UXHA 2BGLA 3WB9A 2PH5A 2NQTA 1K3TA 1P1KA 2CY0A 3UGKA 5G4KB 3NDJA 1NPTO 1KYQA 2HMUA 3UVEA 4W4TA 2DT5A 3U4IA 4MO2A 3Q9NA 2V6BA 2NTNA 3ZWBA 3E5MA 2B69A 3QVOA 4Y6SA 1W73A 3RD5A 1NHWA 3INGA 2JKVA 1V3UA 3ZN2A 4KOAA 3PP8A 3VPSA 1F14A 4E12A 1RYDA 2C2YA 1R0KA 3JD3A 1ZO8A 2GN6A 4MVJA 4P4LA 2WE8A 3TL3A 5A5FA 2DQ4A 1ENZA 3L9XA 1DAPA 4CMAA 3PEFA 3GAZA 3QW2A 1T2EA 4RVHA 1LDBA 1X1EA 5G4KA 2X0NA 1N92A 1XEAA 3KETA 1VLLA 1TVEA 5JMPA 2FZWA 3GQVA 1HTBA 2HKIA 2VHXA 3DZBA 1BVRA 3K8ZA 1DXYA 4IGFA 3GFGA 2ZQYA 3I3OA 4IQGA 2XXJA 3I9NA 2JD2A 2RCYA 3EHEA 3I1JA 4RPJA 1GPJA 1NQAO 4AVYA 8ADHA 2O3SA 1ADBA 2HK7A 2VRBA 4PLFA 2C59A 4A26A 3IKTA 1V0JA 3U62A 2CVOA 4EJ6A 1NX6A 3GVHA 2JCXA 2PK3A 3LU1A 4I5EA 2EJWA 1EVYA 2YHUA 4IXWA 2PWZA 4LN1A 4CUKA 4J49A 2BMAA 3Q2IA 1UH5A 3WOHA 4E0BA 1ZEMA 3MJVA 5CFZA 4CQLB 4DQXA 1MXHA 3FCOA 4DIOA 5JYDA 1LSOA 1E1MA 1XGKA 1E3LA 3OA2A 3O9ZA 4BUCA 4EGFA 1IOLA 2UVDA 5IDYA 4HXYA 1LDEA 3PLRA 3C7DB 1E3JA 4EUEA 1XR3A 3QSGA 4FJ0A 4QO7A 1E6EA 2DFVA 5TRTA 3ROKA 3VHRA 4E2YA 2CNBA 4DMLA 4OL9A 5JPIA 3PDUA 4WLFA 4R9SA 3VKVA 4CL3A 5TGDA 4JX8A 4N5MA 1RPNA 3D4NA 3BMOB 2Y0DA 2PZJA 1ZK4A 3ZWNA 2XOXA 4MOWA 2ZKLA 3RUAA 4CQLA 3IAHA 1VSUA 5IN5A 5TT0A 4MKRA 3PYXA 1LUAA 5EINA 1P77A 2PV7A 3V2UA 1CQIA 2G0TA 2Q45A 2GUGA 5TF4A 4Z6KA 2Q99A 1QV6A 2Q2WA 3UCEA 1X1TA 3WGZA 2CVZA 2O48X 5CDYA 4FFMA 1I36A 3I52A 3OECA 3OIDA 5A1TA 2CF5A 3BMOA 4GKBA 3HDJA 3HFGA 1E3WB 1Z73A 2DPGA 1R0LA 3HZZA 3ANMA 5K0ZA 1DFHA 1Q0QA 1CJCA 4I9NA 2VWHA 4WPGA 5IZCC 4MP6A 2DTEA 3ZWXA 2WYVA 4CLXA 1B0AA 5KKCA 3ICPA 1IULA 1ZIDA 1LI4A 1MP0A 4GAEA 4BKRA 1J49A 1Y8RB 2BGKA 4JCOA 3SLGA 3TJRA 3K9QO 3VZRA 3WNQA 4B8ZA 4JK3A 3NEPX 5HS6A 2BKAA 1P31A 3I9OA 1E3WA 2DFDA 3Q9UA 1A9ZA 4CR7A 2AQHA 3P7MA 3ZH2A 3W4KA 3PYLA 1Z7EA 4R1TA 4U6QA 3HADA 4D45A 1R12A 5FI3A 3TL2A 2CDCA 1Y8RA 3I5MA 3CINA 4PG5A 3I6QA 1Y7TA 1JVBA 3ZWVA 4RZHA 4AJ4A 2WTBA 3QVSA 4GL4A 4AL4A 1PL7A 3FNGA 1ENPA 4CMEA 3U3XA 1Z7BA 4IM7A 1FXSA 4E2WA 4ZQHA 4WGGA 5CEJA 4WLUA 4FQ8A 1YJ8A 3LT4A 1DLJA 1H6AA 1D8AA 2O23A 3RCBA 4ZJUA 5C3MA 1FF9A 3I9KA 1DIHA 1LLUA 3EC7A 4A27A 3R6DA 1QYCA 2ZTLA 1XG5A 4J91A 3WNVA 1K6JA 5ADHA 2G5CA 5IXSA 5EESA 2JD0A 2ZK7A 1VRWA 5CHEA 3RC2A 3ZHXA 3WYEA 2HMWA 4J0FA 1JKIA 1PZEA 1ISGA 4D0RA 3WLFA 3M1LA 1YL6A 3AUUA 3HDHA 3KB6A 2BFPA 4JBHA 4XGNA 5EJ2A 2WD7A 4CM9D 2DBVO 4UAGA 1DDOA 1O6ZA 1H6BA 1D1SA 4XCVA 2VUUA 1NVGA 1X7HA 4UVGA 5K6AC 1XHLA 2FPPA 2BI8A 3HFSA 4XA8A 2GASA 5IFLA 1UXJA 3E9QA 4S3MA 2HK8A 3MZ0A 3ZV5A 3CTMA 3RJ5A 3ZCXA 4EJMA 1TT7A 4J1NA 4J4HA 2Q3EA 3OEWA 5I9LA 1GYQA 3KM0A 3QLJA 3E1KA 5U4QA 4XR4A 3P2YA 3FHLA 3NV9A 2HJSA 1B2LA 4FC7A 4UVIA 3PQEA 3ZWCA 4IDBA 1DC4A 3UOGA 3I9JA 3GT0A 1CDOA 1P33A 3D0OA 3GG9A 1GUYA 2JFFA 1XCBA 3R1IA 3LZ6A 2QG4A 1OC4A 2HO5A 4FGWA 3CMCO 4PLZA 4KUHA 4E21A 2YFQA 4AJNA 2B5VA 5IJZA 1DC5A 3KV3O 1JKFA 1GQ2A 1YQDA 4MIOA 3L4BA 3NT4A 3FSRA 3GVIA 3JQ7B 2W90A 2YQ4A 4OSOA 3JD0A 1ZSVA 4OAQA 3RC1A 4FGSA 2H6EA 4H7PA 3DFZA 1MC5A 2RIRA 2OBNA 1HRDA 1T2CA 4U5QA 3ZDFA 1N9GB 2YJZA 3B70A 3NJ4A 5BSEA 5JY6A 3RFXA 1NHGA 2I66A 1NYTA 3JQGB 4LRTB 1R4MA 4DLLA 4RPLA 2HAEA 4K6FA 3U9LA 5BSGA 4X54A 1DLIA 2RHCA 5JC1A 1PIWA 3IOYA 3RUDA 3VTFA 4DRYA 1GYPA 3EGOA 3C85A 4DYDA 3WGIA 3JQ7A 3RQSA 4BNHA 2EP5A 3PWSA 2VTDA 4BNVA 1P1RA 3GEGA 1SZJG 2J5KA 2JJYA 3DZFA 1N9GA 3PHGA 2VHZA 1DAOA 4CLEA 4PLCA 3W4JA 4BS9A 3JQGA 1BXKA 4OQZA 1YB4A 1Z75A 4CLOA 4UVHA 2V6GA 5DNAA 4IDAA 2AG5A 2F00A 3EW7A 1R66A 4IJWA 4O1MA 1XSEA 1DIGA 4R5MA 1QYVA 2AG8A 3GF4A 1QYXA 7ADHA 3E03A 3JD2A 4AJOA 1BW9A 5DBFA 1UXGA 1ZK0A 4EITA 2YDXA 3AI2A 3SC4A 1CRWG 1L7EA 3GAFA 3LLVA 3BA1A 1VJ0A 4YJHA 1NFQA 3ITDA 1P3DA 2E49A 3DWFA 4BO7A 2YDYA 4CMJA 3PQFA 5A05A 1Q1NA 3DTTA 3K92A 4G2NA 4Z0HO 5JDCC 1YQXA 4GSKA 1BSVA 3ETDA 3TPCA 4BL5A 4QFCA 1GADO 1C14A 2WMDA 4C7KA 4D0SA 2AHRA 4JP2A 5BT9A 3JQDA 4KP7A 4CMGA 4BMNA 4ALJA 5F1KA 2J8ZA 3OEYA 4WECA 4WOJA 1ISFA 2OUIA 2GYYA 5JSFA 4TZTA 3NT2A 1UP4A 3FNEA 5F1OA 1OC2A 3DQPA 4M89A 4M1QA 3CE6A 4ZQBA 2DTXA 3LSYA 1DC3A 3BAZA 2Q2VA 3WXBA 4BNXA 3KUXA 5JLAA 3RKUA 1EQ2A 4JGBA 4R3NA 1EBFA 3U4DA 3PDJA 1DBVO 3WGHA 2BRUA 4IS2A 1SB8A 1B26A 4I5FA 3PIIA 3W8FA 4DQVA 5T57A 4YT8A 1WLYA 3L6OO 4YEDA 2A92A 3K96A 4UUOA 1VL8A 3GR6A 3RUHA 1SEPA 2A35A 4AICA 3WDSA 2AEFA 3WGOA 4R41A 3VPFA 3EK2A 4WK6A 4ZQGA 2WEKA 2GN4A 2J5QA 3IS3A 2DM6A 1T1RA 4RV9A 5EN4A 4RORA 1MC4A 3SXPA 1E7SA 3RFTA 1PQPA 1SBYA 4HADA 3EVTA 4BHTA 3DAGA 1XLTA 3WQRA 4B3JA 4CMCA 3CEAA 2J3IA 5TJ9A 1HLPA 1A7KA 2YV2A 3WBBA 4RCVA 1NQTA 3IP1A 3GN2A 5DP1A 3UFXA 3FPCA 3UN1A 4TQGA 1YOVB 2BGMA 3OF2A 1F8FA 2UV8A 3Q11A 4F6LA 1DIBA 1SO8A 1YJQA 4E5MA 4XX0A 3I6IA 1B8VA 4E5KA 3A9WA 5JO9A 1UDBA 1OZAA 3JYOA 2QYSA 1G0NA 4YPOA 1PJ2A 4CR6A 3RAJA 4CUZA 4L75A 2WE7A 3OFSA 3NKLA 3NX4A 1PWZA 2I9PA 1DC6A 3HNPA 1Q7CA 1PQUA 2NTJA 1DIRA 4E6PA 4RVGA 4HFMA 4LVCA 1P9LA 4BGVA 3L9WA 4BKPA 4CM9A 1PL8A 5HWSA 2CUKA 4TRMA 4I8XA 5JS6A 1YOVA 2IDZA 3I9MA 4MJLA 4LGVA 1VL6A 5THKA 3JYNA 2OBYA 2W2KB 3LC7O 1Y5MA 3ZWAA 3L07A 4J1SA 2X23A 1Z6ZA 4UREA 3TNLA 3JCZA 2DC1A 1C0LA 1GDHA 2FPIA 3BYZA 3FD8A 3JQFA 5COQA 5T67A 5U1PA 1D4FA 1ZUD1 3WICA 3DDNA 1QG6A 3HHPA 3VZSA 3U49A 2FY8A 4PFJA 4ILKA 3V1UA 4YAGA 1MFZA 1YVEI 2B5WA 3ONFA 4WKGA 1KEPA 2NVWA 4P38A 3IC5A 5TSDA 1ISMA 3F3SA 3VDQA 4W9NC 3GN1A 5BSHA 3M1AA 3MTJA 4RF5A 2C20A 1IL0A 1AUPA 1PEDA 3H9JA 1I3NA 4L76A 1HSOA 2W2KA 3ASVA 4XRRA 1B16A 4B3HA 4N5LA 4ND4A 2O3UA 1XQ6A 3WWZA 2R2GA 4LMRA 1ZXBA 4TRJA 1CYDA 4AJPA 4NFHA 2Q50A 2O50A 2PLAA 4YJDA 5EL0A 3Q6IA 2GD1O 2ZB4A 5TNXA 4U6SA 4TVBA 4BO1A 3OQBA 2ZATA 2EW2A 3IQDB 5MGBA 1YL7A 4J4TA 4EUHA 3V5NA 3F47A 1ZNQO 2WD8A 1ZFNA 2PGJA 4BIIA 1DPGA 4ONEA 2WYWA 1Y8QB 2HUNA 3BMNB 4MVJE 1JDJA 2OGUA 1U8XX 2B35A 2ZJ0A 4CODB 4CM8B 1J6UA 4IQ0A 3WSVA 4YQYA 5BNFA 3DEYX 4IBOA 1ZJZA 2DTDA 5A03A 4WLEA 1T24A 3CH6A 4DLBA 4QT0A 1B8UA 1NVMB 4DREA 2X0IA 2D5CA 3L4BC 1LNQA 3G49A 4J3FA 5L9AA 1BHSA 3QE3A 3E8XA 2EERA 4P4NA 1WDKA 3KLMX 3QA9A 4AJ2A 4XB1A 1PGNA 2HRBA 1OAAA 5ER6A 1B14A 1PGPA 3AY7A 3UCFA 4J6FA 4B3IA 4HV4A 2YW9A 4CM8A 1GAEO 2I3GA 1KEUA 3LDHA 4D42A 2Y68A 3V2HA 3QWFA 1D3AA 3ENNA 5TC4A 5KVVA 4E5YA 2E37A 5I8WA 3FNFA 3MOGA 1I3KA 4J7UA 1UZNA 1ARZA 3AUSA 3P5SA 1HDGO 4P22A 4CLHA 1Q2XA 1VKOA 2P5UA 4OHUA 1N5DA 2CVQA 4H3VA 3FR8A 4LSWA 5HTOA 4DL9A 4NBUA 2Y1CA 4EI2A 1A4UA 3DBLB 2V6FA 2VHYA 2AMFA 2FOIA 1RWBA 4RVSA 1CEQA 4DGSA 4JQCA 4CM7A 2HK9A 4PLPA 2WSBA 4NHEA 4O59O 2PGLA 4B8WA 4B79A 4BGIA 4R69A 2RHRA 1I01A 5A9RA 3VZQA 2D2IA 1I2BA 1PGJA 5JCJA 1XIVA 1P44A 4URFA 3H65A 3L77A 4JXKA 1LEHA 1FK8A 1WPQA 1YBVA 1KVQA 3WTBA 1L7DA 3PGJA 3TRIA 2Y1OA 2VN8A 4XQGA 3DBLA 1HDYA 1PX0A 1V3TA 4Q3EA 4OYRA 3KOUA 5CP8A 1KOLA 4J7XA 1E7QA 3SBOA 2OORA 3AW9A 5F5LA 1KEVA 1H2BA 2GNAA 4LSMA 4W82A 3RJ9A 2YV1A 1K6XA 2AEMA 3PWKA 2G76A 4GI2A 1E1KA 1QSGA 5A5EA 3ZNNA 5DCYA 1KERA 3QVWA 1T2DA 2GDZA 3U0BA 2C0CA 4MVJF 3IMFA 4XB2A 2DBZA 4JBGA 3ETGA 2FMUA 5KJCA 3LC2O 5DCWA 1ZJYA 3FWNA 1QLJA 3G1TA 2NTVA 3AI3A 2VNAA 2O7QA 1Q0LA 2Q1SA 2UUOA 4GWGA 5KCZA 3WQQA 1EE2A 4LRSB 4D43A 2PD3A 1P1HA 2DVMA 3ADOA 3KXDA 5L4SA 1IPEA 1T25A 3T7CA 2DPHA 1NQ5A 3CKYA 3KBOA 4DWVA 2E48A 4PVCA 1ADFA 2JAHA 3G17A 4LW8A 2RH4A 2DU8A 3S2IA 1PR3A 3IUPA 2EF1A 5B4VA 1HF3A 4ITUA 1SNYA 1WNTA 5EMHA 1BDMA 4FJ1A 2NU8A 2OP1A 4NH4A 1RM4A 4PG7A 1VE9A 2P9EA 3ABIA 4ZICA 3WR5A 4O5OA 3EYWA 3FI9A 1GY8A 2VYVD 3GY0A 4YAKA 1JWBB 3WMXA 1V8BA 4TVOA 5I8ZA 3H6KA 1EDOA 3ZU4A 4WLNA 1HYEA 4BO0A 1NAHA 2HCTA 1M2WA 3HE3A 3D64A 1PJLA 3A06A 5H81A 5CEEA 4W7IA 3HUDA 5B4TA 1FJHA 3AOEA 3AK4A 4M49A 3RUFA 4UULA 3AM5A 4IMRA 1HWYA 1ZK2A 4J1TA 3B1JA 3N7UA 3A4VA 2Q1WA 1HDZA 3JQAD 3ZW9A 5F21A 4IPTA 1H6DA 3IJPA 2CSUA 3K31A 2PZLA 2ZYAA 2QRKA 3HN2A 4UEKA 4HWKA 5I9MA 5DT9A 1QKIA 2AQIA 2WDZA 1EE9A 3IDSA 1LX6A 2O3JA 4YA6A 4YBZA 5DULA 2O4CA 1Y5RA 3GZ4A 3NUGA 4CM6A 4TKMA 4PRKA 4TZKA 5G0UA 4CQMD 2J5RA 4IDGA 4YWJA 5IXYA 3RUIA 3UH1A 1TXGA 2LDBA 2NACA 2EP7A 5L45A 4PLHA 1O89A 1YXMA 4J16A 4KTVE 3JQFC 4M87A 2OXIA 5ENDA 1EFKA 3ON5A 3F5SA 1XU7A 2EGGA 4QEDA 4E30A 4NNJA 2VHWA 1HE2A 3JYPA 1K5HA 4PIVA 4YDRA 2ZTMA 3O38A 2DAPA 1AE1A 2SCUA 4NPCA 3C3XA 2D5AA 1T2FA 2YY7A 5AVOA 3ENKA 3WGYA 3D5QA 3M2PA 2B0JA 5HBRA 2ILTA 1ONOA 1EQUA 1OBFO 1O95A 3C7AA 2Y0EA 2UYYA 1LDYA 5B12A 2X9VA 4BB6A 1AXGA 1GEEA 3B1KA 4L4RA 1EK5A 3PGXA 2HJRA 3GOHA 3ZWMA 5CPBA 1JQBA 1M6HA 3AJRA 3QVTA 4FW8A 4MP8A 4IJKA 2OFPA 5JDIA 2BFMA 3PTZA 4LK3A 5JNLA 4CM3A 3FRJA 2H5LA 1E0DA 4CV2A 1ZSNA 3VH4A 1GTMA 3ULKA 4A2CA 3H8VA 5KJ6A 4IS3A 4MVJD 3KYCB 4YAJA 4XKJA 1NR7A 5ITWA 3OICA 1HT0A 3OIGA 4FFNA 2B4RO 4XIJA 1H5QA 1R16A 1XDWA 1FMCA 5GZ1A 1DOHA 5CDUA 2E4AA 4HNGA 3D4PA 1VC2A 2B83A 2EKPA 1LLQA 1YB5A 4NDNE 2O4UX 1ZW1A 4OKNA 4RPHA 4BNUA 3HG7A 1FDTA 1SOWA 3JQ8B 1H93A 3ZV6A 3GEDA 4Y9DA 3UKOA 2NSDA 3FTPA 4R9RA 4AJLA 5JAMA 1B3RA 4N18A 3RBZA 4JLWA 3OQ1A 2BLLA 4QO8A 3ZWYA 2EGHA 5ER9A 1LTHR 3EDMA 5KJ1A 4MIYA 4Y8VA 2X9NA 1RM5A 2PH3A 4BKQA 3G3EA 3D4OA 3KYCA 3GFBA 1CERA 3QV1A 2OOSA 3ETEA 3Q0EA 1EVIA 4A03A 3AU9A 3H7AA 4U0KA 3ICCA 3OH8A 2BF7A 1CWUA 1LBEA 1A4IA 3MJCA 3S1LA 1LRKA 5T64A 1GU7A 3JQ8A 3TWOA 2V7PA 2P91A 3FPLA 3L4SO 4UUPA 3JD1A 4BO4A 1CETA 4BO9A 4IINA 4WEOA 3AOGA 4YTEA 4XGIA 1G1AA 4XDZA 4ID9A 3EVNA 5A4DA 4GPD1 4WJZA 5GZ6A 4BNMA 3ZHYA 4BNGA 1GUFA 1WDLA 4AG3A 4R1UA 1NXQA 2BD0A 1SMKA 3PZBA 4YAIA 3KO8A 2VTEA 4EYEA 5U9CA 3F1LA 3GUYA 5JAQA 4DBVO 2OP0A 4J43A 1C1DB 1PR9A 1QR6A 1GQYA 2PR2A 1E6UA 3WQSB 4E2XA 1Z82A 2B36A 3TZQA 1UZMA 2P4HX 2VRCD 1R6DA 1J0XO 1I33A 3K73O 3WLEA 4D44A 3JQEA 4IJVA 3PK0A 4L8VA 4CLDA 4II3A 1HDRA 4DVJA 5F1PA 3KRTA 3ZHBA 3ZNPA 4WNIA 1ZK1A 3D7LA 3H9GA 4RVFA 5JC8A 4TROA 4FOOA 1X15A 2Z95A 3NYWA 3NGXA 4NBWA 4Z0PA 3BHIA 2VOEA 2PFGA 1AHHA 4AJHA 1NPDA 1O8CA 2DUUA 4FS3A 1C1DA 4UEOA 1WZEA 4NBTA 4BMVA 5A04A 1QMGA 4GLLA 4F46A 4OM8A 4DC0A 1BVUA 2DBQA 3GVPA 4NMHA 3PI7A 3DBVO 4Z9YA 3F4BA 1UDCA 5F3RA 3ZGYA 4RPGA 3O03A 4PLGA 4H16A 4AJIA 1X7DA 4N5NA 4W7HA 4JJFA 1SC6A 3C24A 4RL6A 1KC3A 4BGUA 1Q7GA 4HFRA 1MG0A 4IY1A 2P9CA 3FWZA 4E3ZA 3HN7A 4FN4A 3JQAB 1PJQA 1MX3A 2VYVA 2Y1GA 2OO5A 3OJ0A 1I24A 1NASA 3MJ4A 4O63O 2NADA 2PD4A 1LU9A 1SB9A 1HETA 4BOYA 1DHRA 4PG8A 3TZHA 1V9LA 3C1OA 2RBEA 5T6BA 5DBGA 1SPXA 4CQMB 4ESOA 3TQHA 3JV7A 4IIUA 2PKRA 2BFOA 4G65A 1K0UA 4WCFB 2XPCA 3DFUA 3DOOA 3ONEA 2HQ1A 4Q39A 4BKOA 4J0EA 1ZBQA 4UUMA 5HRUA 5KJEA 1KY5A 4IMPA 3JQAA 4Y6RA 3V1TC 3IL2A 3F46A 1QORA 3BTOA 3GNQA 4KWIA 1AGNA 3RROA 1E3SA 4FDAA 3ZU2A 4MIEA 1F17A 4W99A 3WGTA 3DR3A 2CDAA 1P1IA 3BMCB 4NFSA 4CQMA 1F12A 2QIOA 4FIZA 1B3BA 5TS3A 4WCFA 2NU6A 4JROA 5G4LA 3L6EA 1KY4A 4WLOA 3PHLA 1UXKA 3PHHA 3AOEC 3PJDA 2CD9A 1U1IA 4WLVA 4MINA 4I5DA 3LVFO 2AE1A 4BNFA 2AEJA 2Q2QA 1O94A 4NZ9A 3PPIA 2Q1UA 1IYZA 4XD2A 2PTGA 5KVSA 3QWIA 1V6AA 2GSDA 2CZCA 1LQTA 2IZ0A 2VUTA 3KTDA 3BMCA 2AE2A 4I9HA 1FDUA 1C0PA 2BI7A 1ZVMA 4GSLA 3RUEA 2OMEA 3MWDB 3VZPA 2CDBA 1X0XA 1DB3A 2YYYA 3RIHA 5FF9A 4BGEA 2IXAA 2A9FA 3WWYA 5KWEA 3JD4A 1JVSA 3KLPX 5KOIA 3VH3A 1WP4A 2D59A 2QZ9A 4FCCA 4YB8A 4H15A 4RPKA 4FC6A 3AWDA 1WDMA 3AFNA 3AM3A 3B20A 5MDHA 1BWSA 3Q1LA 4ND5A 1T2AA 3DOCA 4RQUA 4DIFA 2ZYDA 3RKRA 4DLAA 2R00A 3LT1A 4WOKA 3I83A
chains in the Genus database with same CATH superfamily
1RI3A 1YCDA 4UMEA 4NBVA 2P4QA 1NRJB 1LLDA 4P81A 3FMFA 2IWRA 4DY6A 5B64A 4YUYA 2FQ1A 2ZKIA 5KSYA 2IH2A 5M7EA 2WD9A 4YLGA 1P2TA 3A1WA 2UUAB 2F3PA 3ICOA 3GJ5A 4X94A 4TTSA 3OQOA 1ZCFA 4A5OA 5CNJA 3ES9A 2H31A 4NAHA 4OXXA 5DP2A 3YASA 5EYPA 2WFLB 4TUYA 3RBXA 1W4ZA 5T3YA 2D3WA 2QZJA 3R9XB 1A2QA 4MHSA 1II0A 4LCEA 1R8YA 2CLOB 2Y99A 3UANA 4PANA 5JU6A 4C2TA 5SY9A 4JU9A 1C9NA 1YQUA 4MCAA 3I2KA 3UJBA 4UNRA 4ER7A 4QBGB 5JDIC 1QS0A 4F5DA 4RK7A 2EWWA 2PHZA 4CM1A 4EY8A 3RYCA 1ZUHA 2JGRA 2VT2A 4ZYXA 5CH8A 1ONSA 4F5WA 2CVPA 3GJRA 3H5NA 3ZY2A 3CU5A 3RT9A 4CQJA 4RLFA 4FGJA 3NPMA 4B75A 1GFZA 1EZ4A 1E69A 1W25A 2OHHA 4N9QA 2MIIA 2MU1A 4D41A 1S02A 3KSBC 3DYIA 3MWEA 1PGQA 4JX9A 4B2LA 3S4YA 4KODA 3RYFA 1ZOIA 2VNJA 5EJ7A 5JCXA 1H4SA 3AERB 4Q21A 3D6NB 3CUWA 4HLUC 1BMDA 3G8DA 5JQGF 4FYHA 1HK7A 2RGBA 1RKQA 4A2WA 3O5AA 2DH6A 2C4TA 3SZGA 4OMUA 1D0VA 2HI0A 4TSFD 4DMMA 5DN6D 2XB2A 1UC8A 1JR3A 1JWAB 1K8YB 2CL5A 2FMXA 2I2BA 3K5WA 5ANRB 5C3UA 2A0FA 1GSAA 4ZXFA 4JBIA 5FBVB 1AB6A 1R50A 4G81A 1IQRA 4UD2A 5FTKA 4C03A 2HMSA 3MMSA 3NOOA 4ZCLA 4Q19A 4DTIA 5I7SA 4C4RA 5KNLA 3IDZA 5B1IA 3B48A 3NDIA 3KYDB 2HLDD 2BFWA 4N7BA 3RHZA 2MSCB 1EDZA 2QLBA 2V7WA 1AGRA 4HCJA 3O8CA 4G0YA 4TZ0A 5KQGA 2QSZA 4FEEA 4DC1A 4D99A 5LC1A 1JE1A 2C57A 2HLNA 3PHIA 3TLBA 4LOAA 3V8VA 1CUEA 2YXEA 4QNRA 4CL2A 5JBIA 1CUXA 3HLTA 4E5VA 4PNEA 1K5DA 2P3OA 3VOTA 2F59A 2AN1A 2VBIA 3U0VA 4M7WA 1Q16A 3SX2A 3X44A 3Q2KA 1OVGA 1OUMA 3WE7A 4CMKA 4HWTA 4K6HA 2X3YA 4PQFA 4ZCMA 1QHIA 1D07A 3IAS6 5I9TA 2G83A 1Y0BA 5D5QA 5AXAA 2D2EA 5HTKA 4YJGB 5E2IA 1YR7A 2ZQZA 2FJ0A 5F64A 1ZRHA 1AS3A 1OYWA 3EQ8A 3LF1A 3U44A 5HRAA 3FF4A 1K2WA 5J23A 3ELYA 3JQQA 4DR1B 4DBLC 3GX1A 2GR9A 1U2ZA 1Z2EA 4MVJI 4QUIA 3T95A 4JFAA 3WWDA 1HX7A 5BN5A 2QUBA 3UMCA 1DEKA 1H2WA 1QTRA 2YUIA 1KJJA 3WGQA 4RK6A 4JIMA 1IY1A 3TMYA 1PQYA 1INLA 2P6UA 3L7MA 4LFAB 2BJVA 1R37A 5EE0A 3ZC3A 3AXTA 3KHUA 2F3QA 2ODQA 2DFPA 1Z7GA 4PLVA 3ORYA 4XOIA 2BFCB 4NI5A 3SOZA 3TW8A 2VJOA 1VSQA 1SUCA 2HHAA 1R4NB 5COAA 1VI5A 3ZV4A 3SG0A 1R0SA 1YFKA 4R8MA 5C7IO 1WABA 5KREA 1NOIA 1TEHA 3U6KA 3SDZA 1VBKA 1F51E 1U5AA 3ASUA 5CVDA 3HYRA 1M1ZA 2IIQA 2GHQA 3O8QA 1L6IA 2IYYA 3DE0X 3TW0A 4JR1A 1MO5A 1CRZA 1O2DA 5D3QA 3LCMA 4P4GA 4QXPA 3F8SA 3TQTA 3ZI7A 4EL0A 2IYAA 3QE2A 3O2QB 4O8CA 3FRIA 1WCXA 1WHTA 2ZUWA 1E62A 5FWDA 3VR3D 1N8KA 2GGSA 2VXBA 4F3YA 2KI5A 2XAUA 5HGXA 3LQ1A 1QCDA 1GQFA 3I04M 2GAOA 1BG6A 2BGTA 1M6VB 4GLFA 4M7PA 2I87A 3FDFA 4TM8A 4P4TA 1P2GA 1X77A 5DYTA 2UXCB 4LV8B 1AY0A 1B4DA 3QX3A 3M6IA 4JMLA 1L1FA 1LK5A 1E2UA 5JMOA 4OX9B 2YUTA 4EB0A 2ZTUA 3IMGA 4FGUA 4KR7A 2G17A 2OO5C 2W71A 1ZM3A 2XKJE 2VSQA 4UPEA 3OQNA 3GGPA 4LKOA 1ODSA 4JUAA 3D2LA 4PYKA 4CL8A 4A2QA 2XUHA 3ESQA 4TV8F 2ZCUA 3WKAA 3LYHA 4ND7A 4F9GA 1EBUA 1X1BA 5IAAA 1YZYA 1JB9A 4E4YA 2FN7A 1WXFA 3LAWA 3LUAA 1M0TA 1PL6A 1SUWA 3DJYA 2X0RA 3PQDA 3UGQA 3MNFA 1XZPA 2QAGA 6ADHA 1DXQA 3G9TA 1OA1A 5TGTA 3CZRA 2PGIA 3QNWA 2C8KA 5G41A 3DAPA 1JE0A 4IJ6A 3U7HB 3DVAA 3AUAA 3QQPA 5CA0B 1P3Y1 1ODTC 4M0PA 1XA3A 4Q9NA 1OAKA 1O0SA 2OT3B 3BMNA 3JQBA 1JT2A 3EBPA 3L0DA 2QQFA 2G82A 1N2HA 1NWCA 1F2VA 1JB1A 1RD4A 3CRW1 3EGCA 3AL2A 3IMEA 4EHNA 2NXEA 2QX8A 4IV5A 1E7YA 2JFWA 1AUVA 1QPBA 2PY6A 4QM7A 5FPTA 3RODA 2CW5A 5TPWA 4OHCA 4WI1A 5BT8A 4UJ3A 5H4HA 3EXHA 5I3CA 3DQZA 2QS9A 2FW6A 5CYGA 4AKGA 1J09A 4ARVA 3FH0A 4BVAA 1WEKA 1C7IA 1JH8A 5D84A 1ZSYA 1NFRA 3B13B 2WIJA 5FNVA 1SD5A 3D2BA 5D2CA 3BWXA 1QRRA 5DM70 2X40A 1WSBA 1I4WA 2V7QD 4KVGA 2CJXA 1Z33A 2RBKA 2WW8A 3E4CA 3L0SA 5DYWA 5K01A 1QV7A 2PKQP 3KQUA 2GXQA 4FR0A 4JI3B 3IMCA 4MIKA 1MOSA 1V7PC 3F8WA 2FA9A 2X7HA 2ZIXA 4IG9A 2DKNA 3KCQA 4IP0A 3TFOA 4JC5A 2J3HA 1C1XB 3BF7A 4V3CA 4DLNA 4PYRA 4X1IB 2BEVA 3AESA 3DL4A 4I3HA 5JWRA 1Q3HA 2QKYA 1OZ0A 4LMAA 2GZ3A 2XDYA 3IAXA 3L41A 3ZCQA 1DX4A 4TS1A 4CNBA 1TQ6A 4D9BA 4CI9A 1IEXA 2PT7A 2WJGA 2HXSA 3H2HA 1A71A 4ALKA 2GCGA 4QDJA 521PA 3Q12A 1N6KA 1RWMA 1E5TA 1TMKA 4AWXA 2VQSA 2I1QA 2AGVA 3DT9A 4TM7A 4V0MA 5KDLA 1Q1AA 3RVNA 4D9IA 4A92A 3F5QA 3TLJA 1IY2A 5BW6B 3LUHA 5DB4A 2OM6A 5DXFA 1KIAA 3SC3A 1MB4A 4G23A 3TRKA 3VO8A 1H4QA 1K4MA 1U7PA 3G0HA 5KJFA 1WZ2A 5FBZA 3KB2A 1HG1A 4JUCA 5J4HA 2WT4A 2Y6UA 1FX0A 5KSOA 5BR7A 1SXIA 1MUUA 1GSIA 2QN9A 3I01A 4UAVA 5IARA 2XCOA 5IC6A 5JJCA 2FCAA 1HNWB 2HMVA 3JQ9C 3DSRA 4Q93A 1RWWA 1LPPA 3FZYA 3FBTA 2G63A 2FYTA 3CLTC 4HN2A 4L8FA 4MQEB 4PLWA 4ZOLB 1KI1A 1U8FO 4JWTA 3OA0A 1BXGA 3A1VA 4LZZA 3PDIA 3KQNA 3HJTA 3QU9A 1UQRA 1OPRA 5C1IA 4A4DA 2X4DA 4GKVA 3DULA 3A1CA 1ZDMA 4EW1A 1F3OA 5KTRA 5JY1A 2B1RA 2BRUC 2YY6A 3B6IA 3R3ZA 5HS4A 1JSCA 3PZRA 1QO0D 1M1YB 3ZGZA 1T3HA 3B7WA 4LF8B 3NC4A 4PGHA 1SIOA 4V0OA 5ALNA 4ENWA 3H8WA 4BO6A 2M1XA 3KVVA 1TEZA 2JLWA 3VVCA 4BNTA 4CUJA 1AQNA 1W49A 5B2EA 3SAJA 3CGWA 4N3AA 4TS9A 3TSZA 4WT7A 2IUEA 4TTQA 3X0DA 3WISA 1V11B 2V1XA 4RK5A 2H4XA 3EXFA 4FLFA 4K1LA 4QJ5A 4B76A 1XHFA 1JA0A 2P9JA 4DLPA 3T1TA 4X66B 3CMMA 3MWGA 3KOWA 3P2KA 2IEDA 2Q62A 4OQMA 4PXAA 1QQ7A 2H63A 2OMKA 1LSSA 2EKLA 3RAPR 3ZTYA 4B34A 4LDPA 5EE3A 1OXXK 3CT4A 4WEQA 3NWBA 4GDFA 2IS1A 3OTGA 1N2XA 4JGIA 5AVUA 5PNTA 1C3VA 1PS9A 1XLTC 1PW7A 3A6JA 4TQ9A 3FVRA 3STXA 1EJBA 2ECFA 4EGSA 3S27A 3EZLA 4AY3A 4MVWA 2HA4A 3OJLA 4I5IA 3SVTA 1VE3A 2AWNA 5DEOA 3N8NA 4R4JA 3UAGA 3DPUA 1ZNZA 4XTRA 4EI9A 3K1YA 2DOKA 4WVFA 3ZXSA 3RSSA 2QRJA 5D51S 1ZH0A 1IMOA 3AF0A 1U4OA 3COWA 4NJOA 4R2IA 2H1CA 2BWJA 2BM8A 4BFCA 3TW6A 1PSWA 5K8UA 4UVDA 1JFSA 3LDFA 4IDHA 3T4EA 5EIOA 3DV9A 5FYDA 4LXTA 3A27A 3O1IC 5K8VA 1RKBA 4Z51A 4C7JA 5FJIA 3RFCA 3CBQA 2OAGA 3IUSA 1MD9A 3S2EA 4DN6A 3JAWB 2EXXA 3OLYA 3QMVA 4DV7B 3BHNA 3ONDA 3IALA 3IE0A 2JHCA 2IX3A 3TLKA 1HG0A 1UEXC 2FLKA 4JZKA 4TN1A 3ESAA 4Q4HA 2BMWA 3TZEA 1EUQA 4B0OA 3VRHA 2RIPA 1E1RD 4GRAA 1Z36A 1CR2A 5K0BA 2NAPA 1HL3A 1QB7A 1U8EA 3CKLA 3DM5A 4KMRA 1XWWA 2NO5A 5TJHA 3W2TA 2ZIWB 2XUZA 1W9MA 2ZRCA 1UBUS 3H9UA 4BJ5A 3KEQA 3PYMA 3NDRA 3CRVA 2RGDA 5HX7A 1E4EB 1ZH8A 3Q8MA 3EQ9A 3D6TB 3NEJA 3G89A 3NVMB 1M67A 2D7CA 1EFLA 1VIAA 4HGQA 5L40A 2OB1A 3RYHA 3HCNA 1GL3A 2GLUA 3KT3A 1RQNA 1CP3A 3EWIA 2PFSA 5AJTA 3WO0A 1IE3A 2RHBA 4M8SA 5AOAA 3GQBA 4RX1A 1JI0A 3QW4B 3PT9A 1USVA 5NLLA 2V6MA 2O8EA 3HXKA 5B37A 5DWDA 3NH6A 2JZCA 3JZDA 2VQ6A 1Y1RA 1XRSB 2PXCA 4P34A 1PVOA 4AYTA 1CCWA 3GMSA 3W9SA 8MHTA 2JHPA 1S2GA 2WF9A 3KKPA 4MR7A 5D7BA 2ZSIA 4NFYA 5LD2C 2QBYB 2NWQA 3LT0A 3T3OA 2V45A 5LLTA 2FSUA 5JDCA 1CPYA 3TB6A 5JNTA 3R3UA 1E7RA 2IGBA 1XAGA 2SECE 3FOBA 3NB0A 4JA2A 1RT9A 1FYEA 1KBQA 1CSEE 2VT3A 3Q6MA 2OD7A 1PR4A 4N7RA 1JJFA 1KI2A 1VYVA 2YTZA 3OHMA 1XPUA 3O3NB 3MAAC 3A9RA 3IP6A 3O3CA 4MQ6A 4O2RA 3DC7A 1GZ5A 1O5IA 4YJFA 1WP9A 4MYHA 1GUZA 3L7AA 3V55A 1MLDA 2DFKB 1ISRA 2LKCA 2NXNA 3C1AA 2AMVA 3D8SA 3RBVA 3NHJA 3STYA 1A76A 5FTWA 1A72A 3VSBA 1E3MA 5C8XA 5FLXA 5F9HA 1GGMA 2C29D 2B4QA 2Y8EA 2YCLA 3PRKE 1B7GO 4EYOA 2HA2A 4QU0A 2NZYA 5BWBA 1A7UA 1J9EA 3AVWA 3NV7A 4A5SA 3VC7A 3N58A 4MW7A 3KAQA 4GDMA 1SIUA 2UVPB 3JYLA 4I2NA 3ROXA 5BWMA 1U0EA 4MW2A 1V95A 4HSEA 1KBOA 1P2BA 4HEJA 5E2BA 5I51A 2ZYGA 2APJA 1Y9EA 3RU9A 5KQSA 1ZHFA 4LHWA 5BY2A 4Y2GA 3MQFA 3GELA 3S8MA 3BD6A 3B36A 3QKSB 3H9QA 4TXMA 3WX0A 1I30A 1WIWA 3DPSA 1LJ8A 1GZSA 1SXJE 2ZYTX 1DTSA 3FLAA 3KFVA 4IWNA 2I7XA 5HMLA 4GXRA 1NLFA 1I10A 2XWPA 1JJIA 1PI3A 1L7PA 3HH8A 4IHQA 1VDZA 4OHMA 2O5EA 3IURA 3H2SA 3WGJA 2FMKA 3SYKA 3ZDDA 2A9QA 3LLSA 2QQ5A 4HLNA 1T8PA 3NXSA 2XT0A 3KE8A 4NU6A 3UJNA 4D4HA 2ZSFA 1A0OA 2NUAA 3RANA 2Y1KA 1WQ3A 3GJ6A 1KAEA 3ITKA 5E7IA 4PG4A 2PE5A 3W5HA 1ONPA 1QGOA 4ND3A 3PHCA 1I3LA 2NV6A 2ZJBA 1KI9A 4XM2A 1WMFA 3V2GA 3U3JA 3DM9B 4CW7A 2JBAA 4K26A 5IDWA 1M75A 3LD9A 2YY5A 1M6WA 3FROA 2LRHA 3LC1O 1KRHA 1ZZEA 4EI8A 1QOQB 1VE1A 3ESZA 2X5XA 4GBJA 5E7JA 5KQLA 1I2ZA 4QOIA 4F45A 4IXNA 1V8DA 1J4AA 3QPCA 5CNMA 1L6RA 1AD2A 1Q0UA 3P9XA 4O4LB 4WNCA 4NCIA 1NRXA 1BYUA 1A98A 2CNOA 4LV5B 2ZBEA 5BW8A 2X4LA 4RTNA 2AV6A 2ZI5A 3OOEA 3GB9A 3VPHA 2GEJA 1KDYA 1IVYA 2ASVA 4E1AA 5HUJA 1E0KA 1HUQA 2EJCA 1Z0SA 3P19A 4G86A 1G21A 3SSNA 3GGCA 4LECA 4EFMA 2A0KA 3LMKA 1PR5A 2YJNA 5KYYA 1XZGA 2FW1A 2PSJA 2C3PA 3OEHD 3PFWO 3C3WA 3M5WA 2CLIB 4ZT2A 3P0IA 5HQTA 2ZVJA 2W43A 1HEUA 1RE0A 3CJQA 1VHLA 3P0RA 4LTNA 4BNYA 2Z9CA 1NPYA 3T3NA 1QP8A 1DXHA 2PZKA 4XQEA 4KR2A 1JHUA 3L4EA 3V8PA 3TSCA 1YTLA 1CDZA 3DMFA 3EVEA 4KZPA 4QSMA 3JWGA 1UBKS 4AC9A 3AEQB 2FNAA 4MR9B 5ALIA 3CF2A 2WWRA 4WQMA 5CFRA 2Y93A 2XB9A 2PNFA 2WU4A 2AFHA 1B6RA 2CNLA 4ZYUA 3WB0A 2V65A 3P45A 3CURA 2RGCA 4IIVA 2OBMA 3EUWA 3KJNA 5SYAA 1MABB 2C94A 3BL6A 1K6MA 4AP9A 4HWOA 1N6RA 1P74A 2I03A 3I6YA 4URZR 4W9NA 1AKYA 1FQKA 1UF9A 4LNUB 4GZMA 1I3MA 2Q6OA 4ZGGA 3EB9A 4QU9A 2I6QA 2DX7A 3JRNA 1N2IA 4FXPA 3T3PB 3VM6A 4ER3A 4HUJA 1ZEJA 4HNHA 3UWOA 4BBPA 4W5JA 2ZRLA 1G3UA 2BBWA 5FEUA 3I4FA 1TB4A 4HFNA 1YDWA 2FWBA 2IJGX 3GH3A 1E0AA 2QM8A 1DSSG 4ER6A 1R0ZA 4B83A 4G8BA 1SAYA 3HLYA 4M0MA 2WA2A 2ODTX 4H3SA 1ZHHA 1H66A 3I2GA 5DXJA 4XVUA 4EPXA 3RHFA 2QWXA 1CUSA 3TD2A 1Z37A 1R2QA 1SCKA 2FHSA 5DWQA 1H0KA 4B87A 1WS6A 3DNFA 3WYCA 5C53B 4KNYA 1KFCB 1E3QA 1YTUA 3VDMA 2VHQA 1HQCA 2EFJA 3PHJA 1S2MA 1Y5LA 4INJA 2ONJA 3OX4A 1OPXA 1R15A 2H52A 5IAJA 1OGJA 1O57A 1R4MB 3WLKX 2ZAIA 1PFYA 1VSBA 3W5JA 3WGKA 1XALA 3OT5A 3OKPA 1SN7A 1KK3A 2EFDB 3BB1A 4QPCA 1O9HA 4TYPA 3WHIA 4H4EA 4CYMA 4EEZA 4ZDKA 4O4IA 1NYRA 1K6IA 2GA9A 4R1SA 5IM4F 2E85A 1UEJA 1RAHA 1ZITA 1SXQA 2V7TA 5DCLA 3RT7A 3DMDA 4N03A 4YK7A 1RAGA 3AU8A 1HY3A 1MO3A 2CF6A 4YDSA 3VR0A 1WG8A 3AHCA 2Q3CA 1CYEA 2RH5A 2VCEA 4IOMA 4BLPA 2D8AA 2R6AA 2HOQA 3S2UA 4FPXA 5AXBA 2WAYA 1YD7A 3A9CA 1TMOA 2R8YA 3W5SA 1OXVA 2YXNA 1WBJB 2ZJZA 1WV0A 2P27A 4Y2YA 3F67A 4P4SB 4Q3DA 2IVZA 3EIFA 2HLPA 3GVXA 5EI5A 4ARIA 5EPEA 3K9CA 5DYYA 3W8NA 1MFPA 4U8GA 4R8SA 2O54A 2KWIA 2W2LD 1UC5B 4MVJH 4Q1EA 1QE0A 5TR9A 4BVGA 1EXVA 3K6KA 1BW9B 4I55F 2ZWIA 3UUWA 4DEYA 1TUIA 3QWHA 4TRRA 5HHTA 4Q5IA 5KPJA 4UD6A 3G0DA 3DP7A 1EHIA 4C3ZA 2FKNA 2XIQA 1H85A 1UWVA 4FUTA 3A4LA 3TZBA 2QRZA 4HDSA 1VGRA 3RLIA 1NP3A 2ZPUA 3O7MA 1JA9A 1C3XA 2PUTA 2ZE5A 1S4QA 3UMRA 4LJ8A 1L4GA 2ZLBA 4QAJA 3NXKA 4Z1MD 4JP8A 4LZAA 4AI6A 1LDNA 3H5IA 3VU0A 4M0DA 4EAAA 4R71A 1P0MA 5HJ2A 4LXGA 1Q5PA 2JLAA 5K0SA 3GLQA 5DV9A 2IHUA 3U5TA 1KI8A 2YVUA 3PKZA 4E5SA 2RG7A 4O3MA 4KYUA 3JQRA 1JZQA 1O7JA 1UBJS 3PLNA 1XVIA 2PUVA 3NGMA 4YCCA 1M1NB 2WUVA 3LH5A 2H2IA 1LA2A 4YP9A 3IP5A 3BH6A 2FSSA 3H0CA 1OLUB 3SR3A 4CEIB 3I6BA 1YT5A 1EWTA 2HDOA 4G24A 1FUEA 4EMBA 2BFAA 5KTNA 3OZTA 2PRIA 3CPSA 3HJBA 3PQ3A 5BN4B 3T3IA 4BJ6A 1NAIA 2A7XA 4XRGA 2C3UA 5AOVA 3BERA 4L3VA 2PZFA 3O4HA 1TI7A 4V1CA 1KS9A 1VHTA 1Z2PX 3MD0A 3HA7A 3OFVA 3UKDA 3WO1A 4ETNA 5CDSA 4RO0A 4R51A 3ANNA 2IH5A 5I7EA 1ZAKA 3P20A 3WGMA 1HDEA 2REXB 4Q66C 4B47A 4OQXA 1KJNA 3THXB 1FSGA 1VZ2A 2O1EA 5ALUA 2VWGA 3OBBA 2ONCA 4QYMA 1UDAA 1KPHA 3CSSA 3BC1A 3N05A 2YASA 1YB6A 1EU1A 3P0HA 4U2DA 4E32A 5HZHA 2P4UA 4OBBA 4X7RA 3K6SA 4I19A 5TPZA 1NR1A 1A96A 2WFLA 4RS3A 1FTQA 4OOFA 1GVHA 4ZU3A 3VR6D 3R9XA 4Q4AB 1WXXA 1LKZA 4FX2A 3AY6A 1ZC3A 3WSTA 4AN4A 5K9ZA 1MB9A 4XDHA 3GVCA 5A5DA 1G9SA 2X0FA 1RAEA 4OQEA 4HP8A 5A2QA 2JAOA 1M34E 2O3QA 1EP2B 3OZFA 2W98A 3QXSA 4FFRA 5T8KC 3I23A 3RGWS 2QD4A 3TLGB 4C7BA 3TAXA 3EZFA 1JGTA 3GNSA 1NM5A 4C14A 1D2RA 3D3WB 4FSDA 2KQUA 5KSZA 3EW9A 1X87A 4J0GA 2PKEA 4R9UC 1S3FA 1R8QA 3ZXIA 3HP4A 4JIGA 1PKEA 4BE4A 1BZYA 2OWDA 4OGLA 4GKJB 3AVTA 3QH4A 1E4VA 2IV7A 2GPWA 1FOEB 3HY3A 3P9IA 1T3SA 1XTQA 1TQ2A 5KNDA 1SA0A 1DKLA 3GEHA 1DG1G 1KAHA 2XGJA 4Q03A 2FR1A 2Z5FA 1ORDA 4AZSA 4X3OA 2XNDA 4MVJG 3FWYA 4OQ4A 3PB3A 4WASA 4FKBA 1F1BA 2H54A 3H2ZA 3RKSA 4EUFA 1Z07A 4F4HA 1E64A 1PRYA 1ZIOA 4LOIA 2AOXA 1KVSA 2DWOA 3W4IA 4O2BA 2LE0A 5CFPA 2H65A 2XZLA 1O6GA 3N74A 2YV5A 3OTIA 1SBCA 4OQPA 4OSEA 4UCQA 2H0RA 5G0VA 5AW5A 3ADKA 3WC4A 3OT1B 3W5UA 3KXIA 1WBDA 2A4KA 1S1CA 2XEXA 1ZD5A 3UW3A 1VOTA 2HEGA 1XWIA 2NVBA 2HF7A 1FU4A 1LI5A 3TN7A 3K53A 2GRJA 5DOZA 3HVUA 1HYBA 2F9LA 2DP4E 3CZ4A 3VVBA 5JJKA 4YRRA 5A1JA 1RQPA 2D8MA 1MRNA 3W5CA 5IH3A 4D3DA 1MAAA 2IKQA 3LVRE 2VDMB 1UMKA 3BMQB 4F6RB 3ZCSA 2HJ9A 4BX2A 2PN1A 1A2KC 1SVUA 2Y9PB 3K6JA 2G70A 3G2QA 3Q87B 4CM4A 3UJ3X 2FEAA 3A1NA 1EXWA 4G6ZA 3VZDA 3INYA 4GICA 3IB6A 3L3BA 5JJIA 2OKGA 2XRMA 2FWMX 4UU8A 5LLDA 3STUA 3FJ1A 4RHFA 4XPIB 3HWRA 1DU4A 1YVRA 3MB8A 2FXVA 1YL5A 5FBHA 1NXSA 2HN9A 2VYFA 1LSUA 1BXRB 1NN3A 5GM2A 3ZIDA 4HJXA 1VBFA 5KTKA 5TQ0A 2JG3A 2Q3FA 3W2EA 3SMQA 4LI0A 3DB2A 3E7XA 5K0LA 3MLAA 3ZX5A 1K9SA 2C61A 1J07A 4L85A 1BCRA 4XYBA 5LLSA 1ESNA 1YACA 3V4SA 2VP6A 3D6FA 3U1BA 3W1VA 5CYFA 2ZB8A 3OAAD 4TMXA 3QEJA 2NVUB 5K6TA 3QUBA 1H3FA 3AHFA 2BE7A 3WFIA 4UHJA 1WKVA 4G5HA 2WHPB 2O52A 2BVNA 1E3IA 3K1TA 4OKIA 4OQLA 3DKPA 3LXMA 1KQFA 3P2EA 1RJFA 3ZZTA 5A4IS 5BOSA 4QD3A 1ZVQA 4DZZA 2YWXA 3WK5A 1LJUA 1H8HA 5CDFA 1GFIA 5CBPA 3AP1A 1IZZA 4QBFA 1MKYA 4KSCA 1BVHA 2B8WA 2WVHA 2C97A 4B6QA 1O03A 5ICEA 5FL3A 3GGJA 3BGIA 4U9UA 2JRCA 5E0OA 4AK9A 5EIXA 3V97A 1JILA 4PC2A 1LTKA 2QTAA 1AQ6A 2XMPA 2G9NA 4A1OA 3GUHA 1ZUNB 1EBBA 3IQZA 4XXHA 1TGYA 3AR3A 1M2VB 4KE6A 3R9IA 4C9BA 4BCBA 4DOMA 2I2FA 4PGGA 5DN9A 3KQTA 1WUKS 2AYYA 1Y1PA 1OFUX 1M7HA 2G8NA 1F0PA 4AN0A 4N3NA 3G2JA 4HWGA 4M88A 4YV7A 2OG1A 3NAGA 1E77A 4YPFA 1EFVB 4K2AA 3IUEA 1Z63A 3PIRA 2BI4A 3VGJA 1SFRA 2CNWA 3KVOA 3R7SA 3WBKA 1P0FA 3QE0A 3IUNA 2JLVA 1UPCA 3GMTA 3EAQA 4D2IA 5EQDA 4H1WA 5JSQA 5G1OA 1FSPA 2GWHA 2NYUA 4P35A 1G2PA 1NVDA 5F77A 3ZV3A 2FJPA 4WBSA 4MZDA 5G02A 4PW0A 3JAMA 2E82A 2Q1TA 3R3VA 2Y1XA 3UPDA 1SRRA 2ZRMA 3RC3A 1SOMA 4AN1A 3P71T 1ZBDA 4IFEA 2CHVA 3HP1A 4K9RA 2P9YA 3HKDB 3MBIA 4LMBA 4QRHA 4LNAA 2ZPAA 1N5MA 4S0ZA 4D46A 5JARA 2F9FA 4N9WA 1BXZA 1CZHA 1ZA1A 4I6JA 2IYRA 3VX4A 2YHSA 4F11A 4BCDA 1BE0A 4FFDA 2HTEA 2FN9A 4P08A 2F62A 5E7MA 1OLOA 2I33A 1UOEA 1NQUA 3PUZA 1NATA 4N0MA 3Q3EA 3UH0A 1JTEA 2ET6A 4DNFA 3T7TA 4Z3KA 1EAMA 1AU9A 2GZ2A 3DE6X 5BV1A 1KFKB 2JKYA 3EDQA 3IKMB 4MI6A 3RRFA 2H17A 1KK1A 5ILGA 1Q0RA 1HNNA 3E0XA 4ZQFA 4F71A 1Y1TA 2FSFA 4J7AA 3IHWA 5A7HA 1WMBA 3RPEA 3A0UA 4CV1A 3IQXA 5EVJA 4JI1B 4EI7A 1RP1A 2UYQA 5JAHA 1DJNA 1IAQA 5ECDA 3TZLA 3V8BA 3U13A 2VNSA 1EUZA 1B00A 3HU1A 3PNQA 2ISCA 2VKTA 5F5NA 5BQFA 2D7JA 3VNUA 2UZ1B 2QT0A 4P2GA 1Z06A 3M4YA 3RG8A 2H8GA 1CDDA 3N76A 3NTOA 3QYJA 1OTYA 4FMCF 4OA5A 5I7FA 1AHPA 4I4LA 4NCAA 3WJAA 3VV2A 2PVPA 1H0RA 4ND8A 3TZKA 2FSVA 3N2EA 4OU4A 4ZN6A 2ZM6B 2YZKA 4WOPA 1SXJB 2H1IA 1EMDA 5FI0B 4AUKA 2YHBA 1CK4A 4HTAA 7ABPA 5K0EA 1IZ8A 1PE0A 3GNTA 3SEQA 3GLKA 4N5IX 5KKAA 1LPOA 5FBKA 1JBQA 3A32A 3W78A 5L7TA 3Q85A 2J0QA 4QBTA 2G9QA 3R9KA 3AVPA 4EFDA 5LFAA 1UR5A 4DA9A 2EL7A 1L3BA 4X8OA 4P7JA 2FEOA 2Q6LA 2QPLA 4DSAA 3AKDA 3VGPA 3SDBA 2YHIA 1IOZA 1U2GA 3WZ2A 2ZRBA 3C3EA 1KS2A 1Y5IA 2IP4A 4UMDA 2X5OA 1XROA 4TXHA 4DIUA 1NKVA 3MJHA 2EZ9A 1NBME 3DZDA 3E35A 4H3KB 3VPGA 1NUAA 1KQOA 2AOUA 1KMHB 1I32A 4QREA 3DMYA 1U2DA 4MGEA 5LWHA 3AF5A 1D2GA 4PCAA 1TA4A 1QXSA 3T5DA 1JAXA 1XFDA 3H3JA 1VL0A 3D4IA 1GCGA 4XGQA 1QLHA 2EX0A 4KIWA 1EM8B 3R6WA 4WDQA 1T4BA 5DI3A 3WLNA 2O0KA 3ZTTA 2WIGA 1U3WA 5FORA 1G55A 4EG7A 3LUBA 3WHLA 3E48A 3ED5A 3P9PA 5DHTA 2FEKA 4KLNA 3OQ6A 4NZOA 4MQEA 4U6NA 1NQOA 3D02A 4ZJPA 1ZM4A 5KQPA 3TD9A 1Z08A 1UZUA 1JXMA 1HLFA 5FNZA 3ROEA 2CY0A 3KFLA 3UGKA 3W7BA 2AI1A 1A9TA 2JAQA 2Q3HA 4FINA 1Q1EA 1YS7A 3UVEA 3RTBA 4W4TA 3IILA 4I36A 3O2NA 2D1QA 2DT5A 2QU7A 4X24A 5EQJB 4MEBA 2OYRA 3I30X 1WUYA 3UMYA 1M1YA 2V6BA 3L0BA 3ZWBA 5IFKA 3I5XA 3MRVA 4Y6SA 4V2UA 2QAJA 3RD5A 4MWGA 1KJ8A 1JWLA 1USGA 3I37X 1J21A 1V3UA 4AO6A 1EX7A 5FOSA 5SZHB 3NIFB 3FCUB 4E12A 5LXTA 1RYDA 1DCMA 3JD3A 4KMMA 3T61A 1ZO8A 2FFJA 5KU1A 4BEJA 5BR8B 3ZYCA 3VVLA 1Z6YA 2NTEA 3FA2A 3L9XA 4CMAA 3PEFA 3QW2A 2WHYA 3EX7C 1AO3A 1Z0FA 1LDBA 4RVHA 5G4KA 1KQ3A 1VLLA 1P7WA 1V1MB 1KZHA 4FXOA 3TMAA 4EKYA 1S0UA 3GQVA 3H2JA 4F93B 2XWQA 1KQPA 4V0RA 1MT0A 5DTQA 4OFBA 5L6MB 1QOZA 4IQGA 2XXJA 3BXGA 2YW2A 2ZBFA 3C2QA 4AY5A 2RCYA 3I1JA 5FPQA 2CMHA 3IVRA 8ADHA 3PTLA 1ADBA 4P84A 1Q7RA 4TQAA 3SLRA 4FYMA 4PLFA 5BP7A 2L42A 1FNBA 2G4LA 3W3AA 3LA6A 1ZRMA 2CVOA 1NX6A 1OBOA 3KD2A 3PXBA 4I5EA 2EJWA 1EVYA 2H4ZA 3COYA 4IXWA 3QEMB 1RJ9B 3OZBA 4OXIA 1M8JA 2W6IA 2BMAA 1YGPA 3ENVA 4MQLA 3UV3A 3WOHA 1JLRA 2G07A 1PFUA 4F5YA 4FI3C 4NE9A 3ND6A 1MXHA 2BFEA 4Q7LA 1XGKA 4Z4HA 1ZLXA 3O9ZA 1QHNA 1IOLA 2UVDA 3AZQA 5IDYA 1U1EA 1KDOA 1UM8A 3PLRA 5AMXA 5BUZA 5FHQA 4M76B 2CL6X 3C7DB 3RHTA 3STVA 2ODPA 1CDEA 4BTLA 3VHRA 5A4KA 2H8KA 5JCZA 1UOPA 4H7KA 5EOVA 5JPIA 4WLFA 4AMBA 4D8UA 2H00A 4AZ3A 2PQ0A 5TMDA 1GILA 4CL3A 3I09A 3UBMA 4WTOA 5FPSA 3TG8A 5AHKA 1L5GB 3BMOB 2CCJA 1L5WA 3OQVA 3ILYA 3GUUA 1L5MA 3RK1A 5F98A 4ZI7A 3L8CA 3OJWA 2ZETA 3W2HA 2ZKLA 1CP2A 4FKZA 2V5UA 2PFKA 2OB2A 3G6KA 5EIWA 3SMVA 2YYAA 5IN5A 5IT5A 2P6PA 2UZIR 2ZJFA 3P2MA 4AY6A 2G0TA 1ND6A 3N39C 4RY0A 3SJBA 2XCRB 1RIFA 1E4OA 2HA5A 5CJPA 4DA7A 5HQ3A 3I1IA 4Z6KA 4RHYA 2GF0A 3NW9A 5EMKA 1G4UR 1P7CA 2YFYA 5CW1A 1RXUA 5LQCA 4M98A 1Z2CA 1G38A 1I36A 1L4YA 1E61A 2CF5A 2F1OA 4HEQA 4MUEA 1HEIA 1Q95A 1X38A 2I54A 4BN5A 1B1CA 4ZV9A 3HDJA 1EFAA 3H1AA 1PFWA 1E3WB 1Z73A 2DPGA 1R0LA 2Y4OA 1NVXQ 1CJCA 1OE0A 2VWHA 4WPGA 4QDXA 3L40A 1LPSA 3GNLA 2DHRA 3SEZA 7AT1A 2PA0A 1F9AA 4EABA 4JP1A 4CLXA 3K0AA 1EDDA 5FWYA 1ACMA 2ZS8A 4JOSA 3ICPA 4HGOA 5BORA 3SSMA 1ITZA 3OOHA 1T8WA 2VATA 1TPZA 3F9RA 3LXUX 4OD0A 4HQNA 1MP0A 2GBPA 1Y8RB 3LCVB 1B2RA 1U0RA 1Z4LA 5HCUA 3T38A 3TJRA 4XCXA 4OJQA 3H1FA 3SSOA 1QH8B 2AC4A 3HYNA 1FTSA 1SK8A 2G5PA 4P5EA 1UJ6A 2DT8A 4JYBA 3LHFA 1JG6A 3ZVLA 2W2PA 3QYAA 4ZI2A 3P9RA 3Q9UA 4CR7A 1VB5A 3HNOA 3P7MA 3W4KA 2AT1A 4XARA 1QAMA 3LTEA 3PYLA 4A9AA 1K7SN 4R1TA 1Q6YA 3HADA 3LHDA 1KE1A 3QKSA 4YECA 2R97A 4BMOB 4B2IA 2AI3A 4A1FA 3HNRA 4KYVA 1KEEB 3EODA 4YJ2A 5FI3A 1WZCA 1I0IA 2CDCA 3AFOA 1ANKA 3F0TA 3QKRA 3R2JA 5L3RA 1XMQB 5TVGA 1MMFB 4FMPA 1VLJA 5DX8A 3TIXB 3CLUD 4P3OA 2NN3C 2PEZA 3S81A 1KYXA 3OVMA 1M8KA 1OJ7A 3QVSA 4AL4A 4RYDA 1IBLB 2C5LA 3ZHRA 1ENPA 4N5DA 1W36B 2Z83A 4DQDA 1CG6A 1HA3A 2JEYA 4BYGA 2C0PA 4IM7A 1ML4A 3D3KA 4CGYA 2YIDA 5BYAA 5IX8A 4KQCA 2B4YA 1QZ3A 3LT4A 3CF6R 1DLJA 1WB5A 3PQ8A 2AUTA 1JEAA 2G4CA 2IQIA 1ZJ6A 1KORA 1HYQA 3U6BA 3EC7A 5KOHB 2ZTLA 1XG5A 2ICAA 4FDLA 3KKKA 2VJBA 4J91A 4B43A 5ADHA 3K4QA 3C3BA 2E55A 2AW3A 4GECA 5ED4A 1QH9A 2NPIA 3TS1A 4B82A 1X9GA 5KYTA 1M34B 3ZDEA 3KQKA 4EY7A 3KJIA 5LYJF 4QKQA 4NOKA 4A8JB 1PZEA 3S7ZA 1ISGA 2FPPB 2QL5A 4X8MA 2XUAA 4R8KA 5AW7A 3RVKA 2AJ8A 3FPHA 3PQ5A 3M1LA 1CJBA 3AUUA 3KQMA 4A91A 3VJMA 2WZCA 2GFHA 2MSWA 3FFTA 3ET4A 2GZRA 4KO2S 5E7QA 3ZTWA 4DS3A 4XGNA 5EIFA 3CVVA 4MGZR 2HBQA 4NBSA 4CGZA 2CD7A 3PA8A 4ENUA 4FD2A 1QDEA 1RPTA 1RWVA 3VISA 2G09A 1NF3A 2NGRA 4JYMA 3G2KA 1U7ZA 1O6ZA 2XB4A 4JLKA 3K1JA 4MV3A 4D82A 2C1EA 2K7FA 4BDSA 1NVGA 1H9CA 5AR1A 3OMWA 1XMVA 3OZDA 3JWJA 1QH0A 4C06A 1DX6A 1M73E 1NUSA 3DCYA 5K6AC 2VP4A 5F7ZA 3KJXA 5IABA 1MC1A 1KP9A 2V7XA 4XA8A 1QKJA 5AIBA 1OROA 3BA6A 4NMWA 4S2UA 3C0KA 2F7SA 1XZLA 1YAHA 3LCJA 2LW7A 1NXPA 4JBLA 3WLSA 1QPGA 1YZKA 3DBOB 5TMPA 4PAGA 3OEWA 5AQEA 4Z7JA 1IQUA 3NHZA 1R0WA 1GYQA 3HKCB 4PHCA 5LZ5A 3P2YA 2GPBA 3FHLA 3NV9A 4IFIA 2D54A 4N8EA 4EF6A 4Z49A 2IHZA 3AILA 2F1IA 1W5SA 2Z5VA 3TIIA 1P33A 2ZJ3A 1LV7A 3D0OA 4ZYZA 2OVBA 5JVDB 1XCBA 4Y2TA 3R7AA 2DFLA 2ZBVA 3S8YA 1NBWB 2HO5A 1T4CB 2PX4A 3B9BA 1W4CA 3GAAA 1II8A 2ZI6A 3HXTA 2JGFA 4PLZA 4YO7A 4LQDA 5AW9A 4E21A 5AI9A 3GT3A 2JFXA 1HNZB 4ZAFA 3CX4A 1FEZA 5IJZA 1MX9A 3KV3O 2HBYA 1SCQA 1YQDA 2POCA 1JLSA 2V0NA 3L4BA 3LXRA 3NT4A 5DK6A 2FVYA 2AOWA 2WSYB 3GWGA 6GPBA 1OHHD 2W90A 3B38A 1ZSVA 4FNMA 3EIOA 5JCOC 1XNQB 3DFZA 2EL9A 2RIRA 3VR5D 1UL1X 2FUG1 4U5QA 2OE2A 5M29A 4YAOA 3ZDFA 2BGWA 3MSCA 2B82A