3TFQA

Crystal structure of 11b-hsd1 double mutant (l262r, f278e) complexed with 8-{[(2-cyanopyridin-3-yl)methyl]sulfanyl}-6-hydroxy-3,4-dihydro-1h-pyrano[3,4-c]pyridine-5-carbonitrile
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
262
structure length
262
Chain Sequence
b'EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYNMD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title Discovery of 3-hydroxy-4-cyano-isoquinolines as novel, potent, and selective inhibitors of human 11beta-hydroxydehydrogenase 1 (11beta-HSD1)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 99
structure length 262
sequence length 262
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2011-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tfqA00
3EHEA 3PHIA 1PGJA 3SC4A 3QWIA 3HUDA 1VC2A 2Y93A 4RF5A 3RJ5A 2A9FA 4NBVA 2W90A 3ZI0A 1UR5A 2BRUA 3HE3A 3H2SA 3DBRA 5LC1A 3JQ8B 2DTDA 3RU7A 1SOVA 1TLTA 3JQ9C 5AOVA 2BLLA 3GLQA 3FTNA 1EVJA 1Q2XA 1Q7CA 3DZBA 4FS3A 4QX6A 5EL0A 2FMUA 3VZSA 1WXDA 2WD7B 3CTMA 1N5DA 2FWMX 3MJEA 4YJFB 3RUDA 3VAZA 4DMLA 2ET6A 3RC9A 3HJAA 4NG5A 5DBFA 2DC1A 2ZB8A 2GZ3A 4JP2A 3ZU3A 1NVMB 3H2ZA 3GR6A 3ANNA 4YJGB 1VLLA 5JAIA 2AEJA 4FQ8A 1Q7GA 1WMBA 2DAPA 2C2XA 5CDSA 2Q50A 3ZW8A 1EUCA 4DVJA 1YWGO 2OOSA 2BD0A 2WWRA 3AY3A 1GU7A 4ONEA 1ZSVA 3DXFA 3ETGA 3VZQA 3GN2A 3GFBA 3GF4A 1J4AA 1E7SA 3H6KA 3U49A 3WGHA 1CWUA 1DB3A 4M8SA 1F06A 5G4LA 3T4XA 1GY8A 5KKCA 3BMOA 4BNLA 4DIOA 4QEDA 1T24A 5BNTA 4XGKA 3TZQA 5L4SA 3GMDA 4Z3KA 3E5RA 1ENPA 3TZHA 2IZZA 3PQDA 5F1KA 1UXHA 1R0SA 3ONDA 5BNIA 1M76A 4W6ZA 1ONOA 4PVCA 4ZA2A 5EINA 3NEPX 4DPMA 1NWHA 2VRCD 5K0ZA 2AQKA 4DBVO 1JAYA 3WYBA 4M86A 4WLOA 2EWMA 1FDUA 1EVIA 4Z3DA 2CSUA 4WGGA 4R1UA 1G0NA 2GLXA 1X14A 3JQDA 3L77A 1FK8A 1LBEA 3M2TA 4NR0A 4S1VA 4TVBA 3NT2A 1VSUA 4OXNA 1JVBA 3ZNNA 4GX2A 4J16A 3KBOA 1VE9A 1HDZA 1ZCJA 2QIOA 2XOXA 2X9NA 4GWGA 1JKFA 5IDXA 2Q1SA 4GGOA 1I8TA 4E5PA 4XWYA 5KIAA 5ICSA 3EZYA 2QQ5A 2EKPA 4WCFB 4TMFA 4IGEA 4I5DA 1NNUA 4DIBA 3OA0A 1P77A 2AW5A 5J23A 1AN9A 1P1IA 1S7CA 4R68A 4RORA 1V3VA 3UH1A 1I2BA 4I5FA 2EEZA 2I3GA 1M75A 3GEGA 1PJ2A 2VOJA 3H8VA 5KVVA 2GN4A 2DU8A 2YQ5A 1DC6A 1T2CA 4YR9A 1KVUA 3JQ8A 2B4TO 1GZ6A 4CM5A 2PZMA 1CERA 3QJ5A 1GADO 5COQA 1ZK4A 1O94A 1N7HA 3WFIA 5BSEA 1QXSA 4WEOA 4JNKA 1LUAA 4Y98A 5AXBA 4UVDA 2WD7A 1E1MA 4B8ZA 3R6DA 4YJFA 1QV6A 4BKPA 1KS9A 1VI2A 2PFGA 2Q45A 2NM0A 5CDGA 3JYNA 4E4YA 1MB4A 4G81A 4XZ3A 1RM5A 1U5CA 2DT5A 3G0OA 5DN9A 3N74A 4YJGA 1LC0A 3MEQA 3M1AA 1Q0HA 2W2LA 2SCUA 1T2AA 1Y5MA 3QP9A 1B8PA 4H3VA 4XQGA 2WM3A 3W4JA 2AEMA 4NNJA 4D0RA 3DAPA 4CUJA 3BHIA 4ND3A 1T26A 3KV3O 4IJUA 4QO8A 4ZU3A 3O03A 4E5MA 2CDAA 1Q0LA 4Q3EA 3UFXA 3C8MA 2ZCVA 4TROA 3KUXA 4OGWA 1PQWA 2PGJA 6ADHA 3NJ4A 4CR8A 3CINA 4CQMB 5BR7A 1F0YA 4AJ4A 3DMTA 4OL9A 1AHIA 5EJ2A 4L9RA 2EHDA 4CL8A 3HDHA 3IJPA 5EQFA 1E3WB 1MP0A 4YT8A 4NU5A 4J2OA 1VRWA 4J43A 4FGWA 4P38A 5T5QA 2AHRA 4Q9NA 3GMSA 3GUYA 4ZGWA 2A92A 4I5GA 5A9TA 3H3FA 1ZVMA 2O7SA 1NPYA 3E9QA 3RAJA 3DR3A 4M54A 5FEUA 3K31A 4ALLA 2ZYDA 1A27A 3WGYA 3GHYA 1GPDG 2WEKA 4ALMA 1PZHA 3PYXA 1O9BA 5KOIA 3TDKA 1XQ6A 3C1AA 3TSCA 1PS9A 4LRSB 4WCFA 2LDBA 5AXCA 2WTBA 4BO5A 3RC1A 5ITWA 2B4RO 3WMXA 1GQYA 3BTUA 4AJNA 2VCYA 4EEXA 3WJ7A 4L75A 5A04A 4Z9XA 3K73O 1ZK2A 2G76A 1E7RA 3UXYA 3UVEA 3E48A 4I9HA 4RVFA 1DFHA 4KUHA 3ZNPA 3WTCA 2EW8A 1HYEA 2W8ZA 2YHUA 4G65A 4A5OA 3DWFA 4BNFA 3L9WA 2ZTUA 3GY0A 4NMHA 3K8ZA 3WG9A 3INTA 1AXEA 1XEAA 3OETA 3EUWA 1IB6A 3T7EA 4YCAA 1EK5A 5JYDA 1Z7BA 4D3FA 3V5NA 1GQ2A 3EY4A 1NVTA 7MDHA 4F3YA 4J90A 2P91A 1VJ0A 4ZQEA 4TKMA 3VPFA 4HV4A 1HRDA 4B7XA 1PWZA 1DLIA 4Y6SA 4MINA 4CM4B 2ZK7A 4C4OA 1BVUA 1V9LA 1UZMA 3KLMX 5AXAA 3CUKA 4CMBA 3FRJA 4IXTA 4J4BA 3STHA 4D45A 4BQRA 3RSHA 1RM3A 3PEFA 5HM8A 5C37A 4OSOA 1A9YA 2WE8A 2POQX 4J9VA 1O8CA 3U4IA 5I7VA 3U5TA 1BHSA 1SB8A 2QW8A 4KUGA 3ZV3A 2PKQO 5JNLA 3CEAA 4BNXA 1I01A 4IQ0A 3VZRA 3K92A 1P0CA 5JLAA 4RO0A 3SC6A 4LW8A 4ZVVA 4FFOA 2BFAA 1GYQA 3AOEC 4MVJM 4CPDA 4CQMA 1LLDA 3GGOA 1H2BA 2DBRA 3CE6A 4YT4A 3BXXA 4NU6A 4R5HA 3GVPA 1E3WA 1I3MA 1YL5A 2GN8A 4RF3A 5CP8A 5G0TA 4W4TA 4D0SA 3DHYA 1K0UA 4FB5A 4JN6B 4JIGA 3D0OA 1Z7EA 2BI8A 2PLAA 1T25A 2RH8A 2UV8A 4H7PA 4UEOA 3NTOA 4AL4A 4AJEA 2EP5A 1PJ4A 4E3ZA 1B26A 4CMIA 4PG4A 3LSYA 4GSLA 2JJYA 3WLFA 3OEYA 2AE2A 2NU6A 1EEHA 3KYDB 1H94A 1D1TA 3JQ7B 1R15A 3AY7A 5ENVA 4CLHA 4Z0TA 4BO8A 5DBGA 3TN7A 2VWPA 2GUGA 3DZKA 1PL8A 4QSMA 3A9WA 5CG2A 3GVXA 3ROMA 4TQGA 3QVTA 4W7HA 3TL2A 1ISMA 3ONFA 2X5KO 2CVOA 4W9NC 3OA2A 4CLEA 1LSSA 3IL2A 2YV3A 4FD3A 1U8XX 2VRBA 3BTSA 1EMDA 4GX5A 4FDAA 4HP8A 4I9NA 3PLNA 4RZIA 1M2WA 3IIEA 4P8RA 3Q2KA 3OP4A 4IDEA 3VH2A 1U7HA 3AI2A 3DBLB 3W1VA 5IFLA 3DONA 4OH1A 2DTXA 4CMHA 3PHHA 1SBYA 2UDPA 3DZIA 3PLRA 3AU9A 2GERA 4FIZA 5B4UA 3GA0A 1QRRA 4E5KA 4DBZA 3ZW9A 5DF1A 3JQFC 3EAGA 1N8KA 5KVQA 1ZZEA 2H6EA 1ISIA 5L40A 3VC7A 3GNTA 3GNQA 3QIVA 3H65A 3S55A 3H7AA 1C0IA 3IQDB 5IXSA 4OXYA 1X13A 5TQVA 3RVDA 4MKRA 2Q4BA 3ZV4A 4Q3DA 2XXJA 4FPXA 3K9QO 4Y9DA 3W4IA 3OQ1A 4P22A 1NFRA 5ENDA 5CEEA 5CG1A 3COSA 2E4AA 1DAOA 3HHPA 3AJRA 5I7SA 4RVSA 1ZEJA 4R1TA 3L9XA 2D5AA 3B20A 4XIJA 1T1SA 1IYZA 1GUZA 1QYXA 3F9IA 4IQGA 3UAGA 1LLQA 3PQFA 4P4NA 4J1TA 2PK3A 2Y0CA 2GASA 4G2NA 4OOEA 3ZNQA 4BKRA 1NPDA 2G5CA 4CV1A 1UZNA 3GG2A 1A71A 2NQ8A 3SJUA 1SB9A 2BFMA 1XKQA 3OEWA 1MX3A 4GKVA 4YJHB 2Y1DA 3PQEA 1HLPA 3MOGA 1HDYA 4JJFA 2A4KA 4TSKA 2Z5LA 1A9ZA 4GGPA 1XYGA 1LDBA 5CHEA 2W2LD 1OMOA 2ZB3A 2R6JA 4HFNA 2WD8A 4GL4A 1PL7A 4TRNA 2B83A 4GX0A 3VKUA 2PY6A 1SNYA 4DGSA 2DBZA 2VNAA 3PRJA 4PFJA 4MVJI 2VYNA 2BI7A 1IZ9A 3QVOA 2HQ1A 2X5OA 4E13A 2D3TA 3G1TA 1GD1O 4ZHSA 3B1KA 4B3HA 2JD1A 1PR3A 5IDQA 1XELA 4BUCA 4K1LA 1HTBA 2CDBA 2W4QA 1E1LA 3HFGA 4ID9A 3KYDA 3FCOA 5DOVA 3ANLA 3JQAA 1ZSYA 3W8DA 1M66A 2I5PO 2RCYA 1ZUD1 3JYOA 4Q3AA 1X0VA 3UW3A 2GR9A 4WNCA 1OOEA 2WYWA 4GPD1 3ZWCA 1KIFA 1N2SA 2PH3A 4YA6A 4RPHA 3D1LA 4PN3A 1DIBA 1WDKA 3U9LA 5TJHA 2Q1UA 1VL0A 3D7LA 5CDUA 1EFKA 3R1IA 4N54A 2H9IA 4LN1A 1TVEA 4XQ9A 3DBLA 5H83A 2CUKA 1SOWA 3A06A 2UVDA 1NQOA 1EFLA 2OORA 3ZZNA 3DAGA 1R0LA 3PJDA 3UGKA 3ZWBA 1U1IA 3E5MA 4GLLA 1C1DB 4ITUA 3I9KA 1LDGA 3RD5A 4Y6RA 1ISHA 1ADGA 3MJ4A 1RYDA 3K2BA 3NGXA 4M55A 3I3OA 4LSMA 1WLYA 5JSFA 2O23A 1RWBA 3MCVA 4HFJA 1T4BA 3JQBA 4HFRA 3RQSA 5FFFA 4L76A 4L4RA 1T2DA 2C0CA 5T6BA 1A7AA 2Z1NA 5DDIP 3TZKA 2I6TA 3ENKA 3DTTA 3GEMA 4CMCA 4Y8VA 4XYBA 3QY9A 2D8AA 1HT0A 3CPSA 3ZWMA 4CLRB 1HEUA 1UAGA 2RAFA 2I65A 4E12A 3UCEA 1P31A 4AJLA 2PZJA 4YJHA 3L6EA 5I8ZA 1K3TA 3P19A 4XIYA 1V8BA 4ALNA 1E5LA 4DC0A 1MXHA 3UF0A 3HDYA 2X7HA 2P5UA 4J1NA 5IN4A 3BZUA 1EDZA 4BO1A 2EP7A 2J3IA 1WZIA 5C3MA 3NDRA 3C85A 3WNQA 4ND4A 1ZK1A 1YH3A 1BXZA 3GEDA 4OIMA 3KVOA 4BNYA 3WS7A 4ZQHA 4BNZA 1GV1A 5JDCA 1KY4A 3KYCB 1YE3A 4N5MA 2P9GA 3WNVA 4B79A 1XA0A 5JMWA 4ZICA 4IM7A 4EI2A 3FPLA 4RV9A 2YV1A 4BNTA 4CLOB 4TKLA 4D42A 3PDJA 1V35A 1JW9B 2DPGA 3GOHA 4M49A 3ZHZA 4XGIA 1GEEA 1X0XA 2WSBA 3TWOA 3P5SA 3I6QA 1GV0A 1XU9A 2OGUA 3OSUA 5A9RA 5EESA 5JCJA 3DZFA 3SEFA 2CF6A 1A4UA 5L45A 4RVDA 1IUKA 4KOAA 4WLVA 3GK3A 3H3JA 3S8MA 3PJEA 1S6YA 1DJNA 1KC3A 1GYRA 4ND2A 2FRDA 2HMTA 2YYYA 1B16A 3GDOA 4CM9A 3IJRA 2ZB4A 4HKTA 5GZ3A 3L4BC 8LDHA 5DCYA 5IXYA 3R3SA 3WGZA 4TZTA 1VM6A 4WLFA 4L4XA 5JW6A 5A03A 2DKNA 1XGKA 2CVQA 5ER6A 1RKXA 4OO3A 1NXQA 1BXGB 4EJMA 3WBFA 2BF7A 3QW2A 2HLPA 3L6DA 5ICMA 4KWHA 2XPCA 1SEVA 1SZJG 4FSHA 4XRRA 4C7JA 3WSVA 1GL3A 4R41A 3RUHA 3WGTA 4EEZA 1OZAA 3DZHA 3EZLA 3ORFA 3M2PA 1A7KA 5EERA 5FYDA 1HDXA 2PKRA 4XJTA 2ZTVA 1WDMA 1BRMA 4BMSA 5I7EA 4XB2A 2EGGA 4ND1A 1B15A 1DAPA 1LQTA 1DHTA 4HADA 5IN5A 4BMVA 3B70A 3NAQA 1I0ZA 3C3XA 3QQPA 3CSDA 2HMVA 1C14A 3I5MA 4Z0PA 4OM8A 1K5HA 4AJPA 3ZN2A 2EW2A 3DOOA 3LK7A 4FJ1A 1U3UA 1RJWA 5L7TA 1SPXA 3AFNA 4CV2A 3H9JA 2PGDA 4E30A 5G0VA 4XQCA 4CLRA 1GEGA 2G0TA 2V65A 5L4LA 2D2IA 4BNIA 4WEQA 1I5RA 3PHGA 1ZSNA 1L1FA 3VH1A 3NTRA 2H5LA 4YTEA 4TVOA 1F12A 4ZJUA 4I5EA 5C7OO 3SX2A 4S3MA 1OC4A 2AG5A 2I9PA 4FOSA 3WWZA 2IXAA 1KVQA 2UAGA 3LT2A 4R4JA 3A1NA 5AVOA 5JAQA 5TSDA 3NGLA 5I7FA 5CEFA 5FI3A 2VHVA 2NUAA 3KYCA 4PLFA 2PTGA 1E77A 1P45A 3IMFA 4ZRMA 3N7UA 4TWRA 1F8GA 1I3KA 1PX0A 4PLYA 5COAA 2PV7A 4J7UA 1VSVA 1VL8A 4JGBA 3S2IA 4CLOA 4CM7A 3RJ9A 1HXHA 3DZGA 3VHRA 3ZWXA 1UP4A 5CDYA 3DEYX 4BO9A 3A4VA 4WJZA 3CZRA 2B5WA 1UZLA 2V6FA 1X15A 4IZIA 5ILOA 1QR6A 2VTEA 5G0WA 4PZDA 2GN9A 1DO8A 3K30A 1W0CA 2VYND 3IOYA 2JL1A 3OICA 4UREA 3S1LA 2PGLA 2VHYA 1P1JA 2OBYA 4HFMA 3Q0EA 4YB8A 4IIUA 2VTDA 3HB5X 4W7IA 4YAEA 4RGBA 1I2CA 1U4SA 4WCDA 3LC2O 3RCBA 4E31A 1HSZA 2Y0DA 2P68A 4UVIA 3JQAD 1GCOA 2Q4EA 4BB6A 5KVCA 4WPGA 4PLPA 3OECA 5JC1A 3ZWAA 1GUFA 1Z73A 3OBBA 4DMMA 1I24A 3FF4A 1IY8A 3JD3A 4NJOA 4IBOA 2A35A 4RF4A 1ML3A 4F6LA 1LI4A 1HDOA 2DUWA 2IEBA 1CYDA 1MUUA 2DUUA 5G4KB 1T4DA 4D7AA 1KEWA 1LQUA 3I23A 1QP8A 1ENOA 2XXBA 3ICPA 4FCCA 4WECA 4B4VA 4FJ2A 4JBHA 2CDCA 3I9JA 1WDLA 1Y9AA 3VPXA 2JD0A 1HE3A 2R00A 3WIEA 1NFFA 4XKJA 2Z95A 1H93A 4H16A 4FFRA 1OFGA 4J0EA 1PJLA 7ADHA 1LSUA 5A1TA 4NBUA 4IS2A 2W2KA 1M67A 2DM6A 5JC8A 3P2YA 4A0SA 2JCXA 2ZYAA 3ZGYA 3JYPA 1VJTA 1KERA 4FFNA 4LK3A 2FY8A 3LC1O 3B1JA 4D43A 3PXXA 1UDBA 2P9CA 3LC7O 5DNAA 2G82A 4M87A 1O95A 1M6WA 4Z0HO 3MWEB 3U3XA 4QUKA 3PI7A 5T8KC 1ZKMA 4NIMA 4QFDA 1UXJA 4K6CA 3WGOA 5F5NA 4BL5A 2NACA 2D1YA 1E7QA 2VZ0A 2HK8A 2VZ9A 4EITA 1DIRA 2UUOA 3TNLA 4B4UA 3P7MA 4GH5A 2G1UA 3FSRA 3WXBA 1MLDA 1J5PA 3TRIA 3TZCA 5A3VA 2C2YA 4DIFA 4B4WA 2PD4A 3DHNA 1NVGA 4O59O 5A5FA 2BHLA 2X58A 4J3FA 4MO2A 1R4MB 1IHYA 3IKTA 2PKQP 2BKAA 4UVEA 1X7GA 3WOHA 2FZWA 5I9LA 3I6IA 2D59A 1LU9A 4P4GA 2YDYA 1EZ4A 4D3SA 2IXBA 2O3TA 5DCUA 4UVHA 2HRBA 4PZCA 4YDRA 3E1KA 2UYYA 3QWBA 4J0FA 3GVIA 2GZ1A 2C54A 2VWHA 1TEHA 2DTEA 2Y1FA 3DTYA 3QWAA 3B1FA 2QYTA 1TB4A 4CLXA 4BO4A 2V6GA 2FPIA 1W4ZA 5JCJD 3GUCA 3VVCA 1VPDA 1QYCA 4HBGA 4B3JA 1PGNA 4O0LA 4Y67A 3H5NA 5H82A 1HL3A 4W82A 1DIHA 5JMPA 1YGYA 4RVGA 2I66A 2WYUA 4U0JA 3ABIA 5JXWA 1EK6A 2JKVA 3JYLA 5G4KA 1T2EA 2Q49A 2NU7A 4AICA 4XJSA 4RQTA 1U3WA 3F1LA 4JJGA 4E33A 3K96A 5ADHA 4FJ0A 2BELA 1ZW1A 2P9EA 3T7CA 2NSDA 4WOKA 1PGOA 3VPHA 2J3HA 1FDWA 1I3NA 4AJJA 4BNJA 5ITVA 1JQBA 3FI9A 4KDEA 5BSGA 4II3A 3WTBA 5A4DA 4O6VA 4GLOA 4Q3CA 3IP1A 4MIEA 4CM6A 3EVNA 3NUGA 4MP3A 1PJCA 1MFPA 1IOLA 4R51A 3ZWYA 1YO6A 4II2A 3ZWWA 1MC5A 3QVWA 1G0OA 1O0SA 1OI7A 3ZU4A 1P9LA 1NYTA 3GT0A 5KCZA 4A2CA 1G6KA 4GAEA 4GQAA 2X1HA 3AOEA 3RFXA 1B2LA 3AW9A 3PJGA 2LDXA 1V3TA 5TGDA 4QO7A 2JHGA 4CMJA 4D41A 4IJVA 1PSDA 4EUFA 2BFPA 3L07A 4Y6PA 2JFGA 3F4LA 3NT5A 5A05A 3BMCB 4D44A 3IS3A 2AMFA 2NU9A 1IHXA 3U09A 2AEFA 1FDSA 4QXMA 1N7GA 1YOVB 1ZMTA 3VH4A 1JU9A 4NBTA 4XA8A 1R4MA 2ZJ0A 2VHWA 1F17A 3WSWA 2VT3A 4NHEA 5BT9A 3RFVA 5CPFA 1E6UA 5ILGA 3TF5A 1C0KA 3OIGA 2EXXA 4HX5A 2J3KA 1PR9A 2UUPA 2ZTLA 2O3SA 4B4OA 5KTKA 2X4GA 3Q9NA 1Y8RB 2HJRA 3F1KA 3OH8A 1HDGO 4E0BA 3I1JA 1UUFA 2EKQA 3JD0A 1U28A 3C24A 3ETDA 3JQCA 3RBZA 4BHTA 1ADBA 4IDAA 1LDEA 2Y0EA 3LQFA 1EDOA 4WASA 1N92A 1HDRA 3F5QA 4BO3A 5GMOA 4BNKA 3HDJA 2X9VA 4GKBA 3H9EO 1YKFA 1W73A 2Y67A 2QZZA 4IS3A 2ZATA 3ZV5A 4ESOA 1ONNA 4WCFC 5EMHA 3B6ZA 1LC3A 1PGPA 4IDFA 1D1SA 3KHUA 1AXGA 4O5OA 4HY3A 1PJBA 3O8QB 4NBRA 1PU2A 3EMKA 4XYMA 2YJZA 3QA9A 2X6TA 2DBQA 3NKLA 5IZCC 1YVEI 1UP6A 2WDZA 3VPGA 1JKIA 1FDTA 1X7DA 1GFSA 4IIVA 3H5AA 3WFJA 1YDEA 5KJFA 1QYWA 2VUTA 2X0RA 2Z1MA 5L3ZA 3ZDFA 3DAFA 2VWGA 4B7CA 4CV3A 1DPGA 4LVCA 3IUPA 3R0IA 5HBRA 2D5CA 3HN2A 2EV9A 1ZXLA 3ANMA 2J8ZA 2ZYGA 1HDCA 3ST7A 4CM1A 5H81A 1N1GA 4YAIA 4A73A 1SCUA 1RM0A 2J5QA 1IE3A 3VOSA 6LDHA 1E1KA 3DO5A 1TT5B 4Z9YA 4ZQGA 1YS4A 1MG5A 4DREA 4KQXA 4J1SA 1OAAA 4K26A 5A02A 1Z82A 3O38A 3QHAA 1KVRA 4BNNA 2BFOA 1P1KA 3PFFA 4IDCA 4F45A 2WJPA 3E9NA 1ZFNA 2Y1OA 1PEDA 3NDIA 3GAFA 3G1UA 2YDXA 1YBVA 2GZ2A 3BMCA 1E3JA 2O2SA 4NFYA 4BKOA 1UXKA 2VHXA 1MGOA 1YOVA 2X23A 4RPLA 5IDYA 1ONPA 4NFSA 5MGBA 2B36A 2G17A 4I08A 2HMWA 1EVZA 3FNEA 2FPGA 4Q3BA 1PJTA 3NJ8A 4XYGA 2QRJA 1JVSA 4CM4A 3RUFA 2I76A 2VT2A 3KO8A 5IF3A 3W4KA 2JAHA 1HZZA 2D0IA 4X54A 3WBBA 3C7CB 1GUYA 2OUIA 4IJKA 5JO0A 1AGNA 3E03A 4H15A 4PLWA 1R0KA 1HYHA 1Y8RA 1NQTA 3FTPA 4DPKA 5C5IA 1GCUA 5HA5A 1KYQA 3FBTA 1EQ2A 3D5TA 3G3EA 1J0XO 3K2EA 1DFGA 4IINA 2CF5A 3SLKA 1EE2A 2O50A 3BAZA 1BGVA 1O6ZA 3V1YA 2GSDA 3JD1A 3L4SO 5CFZA 1J49A 2J5RA 1G1AA 4KWIA 4DQXA 5KKAA 5DZSA 4JROA 4MIYA 4I9UA 1EUZA 2O3JA 5KJEA 4BIIA 4AJHA 3OFSA 5L95A 2IYPA 4K9DA 3VPSA 3O8QA 4IGFA 5K6AA 4MP8A 4Q3NA 3T4EA 4XRGA 5U1PA 5F1PA 3QV1A 4NH4A 3AUAA 4NBWA 3GG9A 4R3WA 5COBA 3U4HA 3UKOA 4RPJA 3D4NA 4BGEA 4YAKA 2NU8A 2HCTA 2OMEA 3QWFA 1E0DA 5BQFA 4ALIA 4OQZA 3JQ7A 1HLDA 4J7CA 1LX6A 2NVBA 3AM5A 3CMMA 1FXSA 2Q3EA 2CMDA 3GDFA 2GRAA 3TJRA 1IPEA 1DSSG 1GPJA 2R2GA 3PDUA 2O4CA 2AA3A 4TRMA 2FPPA 3PTZA 1HSOA 3ITDA 1KC1A 3FBGA 1HETA 4PCVA 1ZBQA 3PHJA 3CMCO 4FFPA 1NQAO 4LCJA 4PRLA 1JWAB 4CR6A 4YEDA 1H6AA 4PGFA 3WJAA 2B69A 2QHXA 3JV7A 4IDBA 4CODB 4D79A 1ISGA 4DLLA 3TOZA 2E82A 5U9CA 4RDHA 1OC2A 4R1NA 2IYOA 2HK9A 1PGQA 3OIDA 3WQQA 2VYVA 2C07A 1ORRA 4EDFA 4DLBA 1N1EA 5JBIA 2XF8A 4DLAA 1JDJA 3BIOA 2IE0A 4E5YA 2O2YA 4OXKA 3RBVA 2E49A 1KETA 1NFQA 1VL6A 1YJ8A 1TI7A 3ZNOA 1PJQA 1UXGA 4JX8A 1LEHA 1GTMA 4DQVA 2Q1WA 3Q3CA 1HF3A 4MOWA 1YONA 5TF4A 5IZ4A 1QV7A 2FP4A 4MP6A 4DYVA 3C7AA 1WNTA 2VWQA 2B35A 3HB4X 5G2OA 3GPDG 3S2FA 3TPCA 4CM8B 2GO1A 2O3UA 3WGQA 4IZHA 3WICA 1R66A 3TOXA 5JDIA 3H9UA 1MC4A 3FNGA 2X0JA 4ALKA 4YQZA 3GVHA 1H6CA 1NR7A 4IDDA 1UH5A 1B7GO 1U5AA 3HG7A 4YBZA 5DULA 3U62A 4NQZA 3RUIA 3LF1A 3QSGA 1F8FA 2GPTA 3W8FA 1PIWA 4WNIA 1DC4A 2DFDA 2GCGA 4XYLA 3CZMA 3HSKA 5GZ6A 1N9GB 3MJCA 5B4VA 3I9OA 2OO5A 2FR1A 4Q39A 5B1YA 1WMAA 1JAXA 1V3UA 2HKIA 1EBUA 3C1OA 1IL0A 2C29D 3GRKA 5KJ6A 1NAIA 4YACA 5FF9A 4OHUA 4R54A 3V8BA 2YZ7A 2VHZA 4N18A 1DC3A 4XD2A 3JQGB 5B37A 4D46A 4L74A 2X0IA 3CIFA 1Z74A 1DRUA 1LRKA 3PVZA 3PYLA 2JHFA 3PHLA 1B14A 1E3IA 5JY6A 1NWCA 3GN1A 8ADHA 1D7OA 1U4OA 2C7VA 4CQMD 1QLHA 1XG5A 3D3WB 5BSHA 1PS0A 9LDBA 1XQ1A 4N5LA 4IUYA 1HE4A 2BGLA 3FNHA 1DIAA 2Y68A 4E5NA 1T1RA 4U7WA 2Q46A 2B4QA 3KSUA 4U6QA 3RROA 3KRTA 3HNPA 4YRAA 3PZRA 3MTGA 5K9ZA 1DBVO 1PQUA 4HXYA 1D8AA 2PD6A 4AG3A 1LDMA 3FNFA 3GDGA 1SMKA 3JQBC 3FN4A 3ZH2A 1IPFA 2NWQA 3FHLA 3M6IA 2WE7A 4MVJF 4PRKA 5DT9A 1V0JA 2EJVA 4OQYA 2B37A 3MJSA 5L7YA 5I9NA 2EKLA 3ZV6A 1C1DA 4IMPA 3GHHA 3KZVA 3ONEA 4PG5A 4CMGA 4PG8A 3JQ9A 1K6XA 1XHLA 4R5MA 1CDOA 3PWKA 5TRTA 3BHMA 4U8GA 3LVFO 4A7PA 2BGKA 1GYPA 2Q2VA 4FC6A 1R16A 3KEOA 1ISJA 1NAHA 4CM8A 3BTOA 4BKQA 2P5YA 1TXGA 1LDYA 2EG9A 4GX1A 1W6UA 1HYGA 5L7WA 1YBMA 3VDQA 1JKJA 4KZPA 4O63O 4RQUA 1DOHA 4GVXA 1P3DA 1KEVA 3BHJA 3AM4A 5C7IO 2ZIZA 3UCXA 3PWZA 4R3NA 4BNHA 1ZH8A 1Y7TA 1MG0A 3INGA 3IUSA 1Q7BA 3DFZA 2ILTA 3DOJA 4LRTB 3RIHA 4GWKA 3E18A 4PLHA 3RI3A 3LLSA 3RC2A 1R4NB 3KSDO 1N9GA 2P4QA 2PR2A 4FBGA 4KDFA 1PJ3A 4IMRA 1QKIA 2J6IA 4AVYA 3OJOA 5LCXA 1O5IA 4WOJA 5B12A 4DUPA 2DBVO 4PG6A 1MFZA 1YL6A 1ZJYA 1A4IA 2OHXA 3AK4A 2A94A 2HK7A 1DHRA 1E3EA 3GH3A 4UEKA 5DOZA 4J7XA 5GY7A 3RUCA 1E6WA 1RYEA 5L53A 4BGUA 2GF2A 4UUMA 2EJWA 4FFMA 1L7DA 3KOUA 4YT5A 4GMGA 5JPIA 3D3WA 3V1TC 4BO7A 1CRWG 2O7QA 4LVUA 5IDWA 1P1FA 4XYEA 2YFQA 5JCXA 4N7RA 3Q9UA 1AHHA 2ZJ1A 3KXDA 4E21A 2P4HX 2DFVA 4J6FA 4CR7A 1WWKA 4BNUA 4OKNA 5ER9A 4PIVA 4NPCA 4P4LA 3QE3A 3BYZA 5A5EA 4PLVA 4YQYA 2NVUB 3S2EA 4XR9A 2GYYA 4XR4A 1XR3A 2QRKA 1ENYA 3IDSA 3RBXA 1ZXBA 2OZPA 3JSAA 4QFCA 4WUVA 4W99A 5EPOA 5I8WA 1YB4A 3PPIA 1PZEA 2EF1A 2V6BA 4RZHA 2Q99A 4U0KA 1U9JA 3GNSA 4ZQBA 2BH9A 5F1OA 4RVHA 1ULSA 3WQSB 5L4NA 2HJSA 5JFOA 4L4SA 1FF9A 4YYZA 2HRZA 2TMDA 1PS8A 1BXGA 4LMPA 5LDHA 2VQ3A 5T8KA 2OXIA 5TC4A 2Y66A 2Q1TA 2XAAA 1D3AA 1BW9B 4CMEC 4HWKA 3M1LA 4NDNE 2AQIA 2BMAA 3DOCA 1JWBB 4ZD6A 5LDGA 3UOGA 2VZ8A 5DBIA 4BVAA 2C82A 2YY7A 4NZ9A 1U8FO 3FD8A 5TNXA 4BOYA 1KVTA 3EK2A 3VVBA 4RLHA 4UULA 3I9LA 3LT4A 3FR8A 1OBFO 3RWBA 3GZ4A 3LU1A 2VYVD 4EUEA 1YB5A 3ULKA 4DWVA 2CZCA 1UDCA 5CEJA 3D4OA 3LLVA 5CDTA 1HKUA 3P2OA 3PIIA 1LNQA 1PJSA 3BA1A 1X7HA 1H6DA 2PD3A 1R37A 4MPDA 1LXCA 3DZJA 4YPOA 3QLJA 1NR1A 2OP0A 1CETA 3ZCXA 4NK4A 3ROQA 4IJWA 1R4NA 1BXKA 3NT4A 5HTOA 3X2EA 1PTJA 3O9ZA 5DCWA 5CPBA 4JQCA 5AXDA 4A03A 3O4RA 3ICCA 3QWHA 4J9UE 3ROKA 3GPIA 4DC1A 1CJCA 3EYWA 1QYVA 1H9BA 4RDIA 5JE8A 4E2WA 1Q1NA 2HDHA 3H9QA 5TT0A 3Q11A 3NYWA 3LT0A 2HMUA 2QRLA 3V2UA 3VKVA 1LSOA 2FSSA 3RUAA 1GDHA 4R16A 3KB6A 2QG4A 4BO2A 2VUSA 5A3JA 3JD2A 1MV8A 1U2DA 3RASA 4CMAA 3UCFA 3RC7A 4WLUA 1B0AA 2QYSA 3MWDB 2E48A 3ZHBA 3F46A 4MIOA 3HFSA 1T2FA 3L6OO 5JYEA 1E7WA 4O1MA 3KEQA 5KJCA 4DXHA 4YJDA 2JAPA 3BMNB 2NVUA 2W98A 1ID1A 4DYDA 5AQ1A 5TIIA 1P74A 3QVSA 2FR0A 3WQRA 4TRJA 5JAMA 2NTVA 1YQDA 1B8UA 3AY6A 3AFMA 5EQDA 1K6IA 3GFGA 1PQPA 1R12A 1E3SA 1V6AA 4J2HA 4KUEA 1QG6A 4G5HA 2R00C 4QECA 3ROPA 3AI3A 3UICA 3KETA 2O3RA 3Q1LA 2GD1O 3S2GA 1XWFA 4E2XA 4UAGA 4UUNA 1R6DA 1XSEA 3DFUA 3UHAA 3PWSA 2IDZA 2GGSA 3TFQA 2IZ0A 5I9MA 4JJIA 5U4QA 2OP1A 1BW9A 2RHRA 3HZZA 4CM9D 1Q0QA 3WB9A 4BNVA 1MA0A 1KVSA 1HE5A 4IQ8A 3PZBA 1E7MA 1BWSA 1E7YA 1DIGA 1H2HA 1XLTA 3CH6A 4IDGA 5KWEA 4OKIA 3QRWA 4XDYA 2H1SA 3ZU2A 1C1XB 3FR7A 3ON5A 5FI5A 1YDWA 1DJQA 5T67A 3V1UA 4A27A 5THQA 4U5QA 9LDTA 2C20A 4PZEA 4E2YA 4J4TA 4KTTE 2HAEA 2YFHA 2NQTA 4R9SA 3RU9A 3WX0A 2PNFA 4XX0A 4CUKA 5JS6A 2IODA 5L9AA 1Z6ZA 4J4HA 1ZMOA 4NFHA 2HU2A 4A10A 1E1NA 2RHCA 4XQEA 2X86A 3CXRA 4EUHA 4EZBA 1MXFA 4HNGA 2PA3A 1E6EA 1U3VA 5BSFA 1YB1A 1Z45A 5HWSA 2GNAA 4GVLA 2ZQZA 1Y8QB 4CMIB 4TZKA 4CUZA 3U4CA 1BTOA 1GAEO 2C5AA 2VOEA 2E37A 4FGSA 3ZWPA 2YW9A 1GR0A 3F4BA 5F3RA 4BGIA 3WLEA 3NDJA 4E6PA 4OAQA 3KTDA 4JK3A 4AJKA 1Y1PA 4LGVA 4K6FA 2NADA 3U4DA 4KQWA 1BG6A 2GN6A 4YAGA 3WWYA 5JAZA 1ENZA 3G49A 5IZCA 5BNFA 4RPGA 3LYLA 1XCBA 3SXPA 3DB2A 4A26A 4NI5A 5THKA 4L73A 3DMTC 1DXYA 1QYDA 3TQHA 5HRUA 1ISFA 1YRLA 4NK5A 3PIDA 2Q2QA 1KEPA 2BGMA 3AOGA 3NTQA 5IG2A 3BMNA 3SJ7A 3G79A 2TMGA 1UJMA 3W6UA 4BNMA 3SLGA 3EC7A 3OHSX 1ZEMA 4MDHA 2RIRA 3MOIA 1TA4A 1FMCA 2HSDA 3GRPA 3EDMA 2X0NA 1BDBA 4UVGA 5JO9A 2JFFA 4RVUA 4URFA 4YVFA 1U2GA 4F46A 5JY1A 4YT2A 1YL7A 4W9NA 1YQXA 3JCZA 4MVJE 1RPNA 4GI2A 2IRWA 1EUDA 4PG7A 4CLDA 3SBOA 3W8EA 1XIVA 2DQ4A 4NJMB 4AJ2A 2C59A 2QX7A 2PWZA 4JCOA 1H6BA 1NQ5A 2NVWA 3IKVA 2O3QA 4AJOA 1IZ0A 4E32A 4FN4A 1B3BA 5AYVA 5TX7A 3LT1A 4CL3A 1X1EA 1JLLA 4RPKA 4OMUA 3JQFA 2VNSA 2OFPA 1C1XA 2ZKLA 5EIOA 5B4TA 2CY0A 1B8VA 4MVJA 1E3LA 3ZWNA 4GBJA 1DRWA 4EBFA 4BQPA 3TL3A 3ASUA 4JLWA 4PLZA 2YV2A 3E6AA 1LJ8A 1ULUA 1I32A 4HNHA 1LA2A 4CQLB 1K89A 1P1RA 1LLCA 5FWNA 3UUWA 5KVSA 4IY1A 5ES3A 1VKOA 4ND5A 2IEDA 2CFCA 2DLDA 4PLTA 1Y81A 1Y8QA 4DRYA 4MVJH 3R3JA 3E82A 4M1QA 2FOIA 2D4AA 4R9RA 4WLEA 3FPCA 4EJ0A 4BNWA 1I36A 2X9GA 5HS4A 3JQAB 1CQIA 1AE1A 2H63A 3DL2A 5L51A 3X2FA 5TS3A 2NLOA 1I3LA 3HADA 1KOLA 3OJLA 1SEPA 1EVYA 4INAA 3HWRA 3D5QA 1TT7A 3IP3A 3Q2IA 1HE2A 3F3SA 3DDNA 2NNLD 4EYEA 2F1KA 3WIDA 1LSJA 1LRJA 2NV6A 3E9MA 2RBEA 3C7DB 1I10A 1M6HA 3DBVO 3VTFA 1NX6A 3GZNB 5G0UA 3TFOA 4PLCA 2DVMA 4XEHA 4RLSA 3WYCA 1KY5A 3MJVA 4BV9A 4J49A 4FW8A 5TJ9A 3MJTA 1QORA 4DA9A 3A28A 3DMYA 4FC7A 2EIHA 3MTJA 4B8WA 3PYMA 4OOFA 3VTZA 4KP7A 1YBAA 4R1SA 3OJFA 2DPHA 2ZTMA 4WE3A 3K5PA 1NHGA 3PGXA 1WVGA 3WMWA 4B7UA 1LTHR 3I4CA 3JQ6A 4LMRA 4Z9FA 1PL6A 3GVCA 2Y05A 2O4UX 2FN7A 1LLUA 1CEQA 1YQGA 3ZWOA 3WGIA 2ZQYA 3D4PA 4NJMA 1DC5A 4MKXA 2ZB7A 3DBHB 3WR5A 3PGJA 5IJZA 2FSVA 2JD2A 2X22A 2WYVA 4R01A 4RCVA 3EW7A 1QLJA 4DL9A 4CV0A 1I30A 1I33A 3OJ0A 3AUSA 4ZQFA 3I9NA 3VZPA 1FDVA 3L0DA 2PZKA 1O89A 4I1IA 3H4VA 4YRDA 1JA9A 3AWDA 3F47A 4J1QA 1PZGA 1WAMA 4KTVE 1DEHA 4IXWA 3HDQA 4PVDA 2QZ9A 3GC6A 1SAYA 1H9AA 1P33A 4M89A 4ZRNA 4AJ1A 4CQLA 4LSWA 5DP1A 3INRA 4CM3A 5A9SB 1A5ZA 1BSVA 1Y9EA 2CVZA 4BO6A 2YQ4A 3OF2A 5TT1A 2J3JA 1XDWA 4RF2A 3NV9A 4RL6A 3HN7A 3ZHYA 1UXIA 4B3IA 3D64A 4TRRA 3OJEA 3QVXA 4OJNA 3VH3A 4EGFA 4LCEA 3WYEA 1TT5A 2Y99A 5F5LA 2X5JO 5KNLA 4QQRA 2FR8A 3RKRA 5GZ1A 2AE1A 3DQPA 2CD9A 4BGVA 4BMNA 4GSKA 1EBFA 2FZEA 3AUUA 4MVJG 4BV8A 1AUPA 1WP4A 3FWZA 3LF2A 2VUUA 4L0QA 3HQ4O 1NM5A 3V2GA 2NTJA 3EGOA 3GGPA 1ZK3A 3GAZA 5C7LO 2VRCA 3K6JA 2HMSA 2O48X 3GZNA 2F00A 2I99A 3ZWVA 4Z6KA 1SO8A 4EW6A 4BO0A 3JD4A 1WW8A 1X1TA 3RFTA 1QSGA 2AXQA 3JQEA 1P0FA 3EVTA 3KSZO 3AM3A 4JBGA 3I52A 3ITKA 1D4FA 1XU7A 3OIFA 3PP8A 4U6SA 2CNBA 1H5QA 2JFHA 4KMSA 5K6AC 1JN0A 1Y6JA 1GZ3A 1DLJA 3CKYA 1NPTO 1NP3A 2EGHA 4BB5A 3F5SA 4OYRA 1Y5RA 2B5VA 4K28A 1P1HA 1B3RA 1CIVA 1PZFA 2NTNA 2Y1GA 3E8XA 3F6YA 4HUJA 5DP2A 1EQUA 1BDMA 1CQJA 3BMQB 4IPTA 4FR5A 3L4BA 5F21A 5HS6A 5T64A 3Q6IA 1BMDA 4J91A 3ETEA 4AJIA 1ZJZA 2AG8A 1ADCA 3SVTA 1DRVA 3ENNA 3KYBA 3DBHA 3OQ6A 1K2WA 4MJLA 3DC2A 2HO5A 4ALJA 2HUNA 5TLSA 4WKGA 1UP7A 1E92A 1ZIDA 4FFLA 4OSPA 1UAYA 3AI1A 4FOOA 2I3AA 2OL4A 2C7GA 2JCYA 2YHIB 4DQUA 4UUOA 3H9GA 3NX4A 2Q2WA 4YWJA 3WGGA 3WDSA 3NRCA 1DDOA 2YUTA 4DPLA 1K6JA 3PJFA 2PH5A 1VKNA 2J5KA 1ZO8A 3I4FA 4R69A 5A9SA 4ZN6A 3JTMA 1HZJA 3DBRB 3OM9A 3PFWO 1I2ZA 1ARZA 3W6ZA 5EN4A 2AQ8A 4ILKA 4ROSA 1QMGA 3V2HA 3C1TA 4MVJD 4I8XA 2Y1EA 4LISA 3AU8A 1GZ4A 2IZ1A 4CJXA 1CF2O 4YAJA 3GQVA 4JBIA 4BS9A 3UN1A 4C7KA 5JDIC 4XDZA 4XGNA 5IAAA 3ZU5A 4JP3A 4QT0A 3VDRA 4AFNA 4E2ZA 1NBOA 4MVJP 4MKZA 1JTVA 1U7TA 1KEUA 3IC5A 3KLPX 1C3VA 1DFIA 1GQQA 4UEJA 3U0BA 2I67A 4RJTA 1KBZA 3RUEA 4L8VA 2E6UX 3OQBA 3ZHXA 1ADFA 3GGGA 1PWXA 4WLNA 4N5NA 4JXKA 1HWYA 1BVRA 1LRLA 2OBNA 2P2SA 1YJQA 3KM0A 3IAHA 2EERA 3BMOB 3DHEA 4BNGA 1U3TA 2B0JA 2C5EA 1SC6A 1P44A 3H5RA 3MZ0A 3RKUA 1YXMA 1J6UA 1A72A 2VN8A 1W8DA 4GMFA 1C0PA 4QTZA 5JDCC 4F6CA 5A06A 4BKUA 4YRBA 1NTOA 2V6MA 1IULA 1Z75A 3LDHA 3N58A 1RM4A 4WK6A 3JYQA 2RH4A 1F14A 1VJ1A 4DTIA 1E5QA 3FWNA 1ZNQO 3ADPA 3BMQA 3G17A 3ASVA 3ADOA 2WMDA 2PZLA 1FJHA 2X8LA 4EJ6A 3AUTA 3I83A 1NASA 2FHSA 1LDNA 1EE9A 1UDAA 4XCVA 2ZCUA 4XB1A 4PLGA 1ZK0A 3BTVA 3LZ6A 3PK0A 5T57A 4YXFA 2Y1CA 3OMLA 5G0SA 1L7EA 1H0KA 3I9MA 4UUPA 3A14A 4D3DA 3D3EA 1C0LA 1WPQA 5CAEA 5MDHA 5KJ1A 1NHWA 2V7PA 2GDZA 2W2KB 3JQGA 4CMKA 4CMEA 3TZ6A 2JCVA 2YHIA 2AQHA 1WZEA 3O26A
chains in the Genus database with same CATH superfamily
3PV0A 3U61B 2Q6IA 4LZNA 4WERA 3SC4A 1H4QA 3BE6A 3OG9A 4N82A 2CFOA 1MB9A 3IO3A 2VAPA 1VC2A 5ELLA 5LQKA 1WCYA 4YAOA 1ZN8A 4RF5A 3T95A 4MQ5A 1ZH4A 4OXQA 4BQSA 2A9FA 2GEBA 4K88A 4LDAA 5CBKA 1UR5A 1W5EA 1M6NA 3DFFA 4OQMA 4YJKA 5IJXA 4Z7OB 4RLFA 4BJHB 5CM8B 1G20E 3Q4GA 5LC1A 4Q66C 2FZKA 3UGTA 2DTDA 2CYCA 2EX1A 2OHVA 4GPEA 5ALJA 1TLTA 3TZLA 4B6OA 4D9IA 4QG3A 5BV1A 3O4VA 1ZGGA 3IAFA 3HPQA 4NNOA 3FTNA 4L4UA 4L02A 4S12A 2QTHA 2V5UA 4QX6A 2Z57A 4CTKA 1IRXA 2OHJA 3O9VA 1QU3A 1XP5A 2G04A 2M32A 4DMLA 2FX3A 2MSWA 3NBZC 3QMWA 4HEJA 3F5DA 4N6OA 3RC9A 2ZJ2A 5TS2A 4ZYLA 2OQ2A 1NNEA 2FFHA 2LKCA 3TRFA 1TW2A 4F38A 3CT6A 4JGIA 3GR6A 3TXYA 3KP1A 3ANNA 3VXKA 4CCSA 2QUHA 4DT1A 4RD3A 2EL7A 4F12A 1OH5A 1Q7GA 2DAPA 4RFLA 4P98A 3U4QA 1KYZA 3DYBA 3EZ9A 3ZW8A 5LOVA 1F3OA 2I29A 3P9QA 1BKDR 1VE7A 2SCUB 3A4NA 3U4MA 4OLJA 2A1UA 4ONEA 3DXFA 4D9KA 4YFYA 3V34A 1JYFA 5IKOA 2JRLA 1QRTA 3H6KA 2J0UB 2OB1A 2P8SA 4MGYR 4JNCA 1PT6A 2I4LA 1K63A 4M8SA 1F06A 2PWPA 3RLFA 3UEOA 1UL1X 4XTRA 2DJ5A 3PDCA 4QEDA 3JPWA 4LAFA 4Q93A 3RPEA 2IYNA 2RJ3A 4P7JA 3GT7A 3RVJA 2ZVPX 3K1YA 1AKVA 2XNJA 1ENPA 3CRQA 4WXYB 3VHXA 4AS2A 1VIDA 5TVGA 3PQDA 5KNDA 3I6BA 1R0SA 4ZAVA 4EG7A 4LDZA 3LFHA 5BVHB 1GG2A 1UBMS 4ZA2A 5EINA 3RSLA 3TVTA 4BBZA 3I5UA 5I3ZA 3OCVA 5DNEA 1JFVA 3FPAA 2GK7A 4YP6A 2N9UA 2VRCD 1U7UA 5KX5A 1PV4A 4KN5A 3RIYA 2P65A 3NFRA 5AVXA 5FHRA 3E4DA 4WZZA 1FFDA 1Y6ZA 1FDUA 3R3ZA 4E5VA 1PFGA 1UJNA 5DU2A 5HMLA 1X14A 2VLBA 3M2TA 1FK8A 3HCBA 3ZHOA 5K4HA 2RGAA 1ODLA 3M9LA 1LF0A 3E58A 1NU6A 1SBHA 3HUTA 3ECCA 5EXXA 3RJMA 4ABYA 4I46A 4MS1A 4TLMB 4CKCA 3HU2A 4RTSA 1KI7A 4EHFA 3P27A 3IT2A 1E2JA 3MMPA 3VPBA 3PICA 5JXGA 1EFAA 1ZNWA 4YV1A 2WHPB 2WLSA 5GTDA 7AT1A 3EZYA 1U7ZA 4I3HA 3F6RA 3QV2A 1Z06A 3F96A 3PBKA 4NCAA 3VHLB 1NMEA 4I5DA 3RM3A 2HXGA 1JGTA 1KYVA 4R9NA 4DM7A 1LW7A 4C0WA 2IIQA 2AW5A 2XB4A 4LXXA 1WW3A 2LIPA 4R2XA 3RHZA 4FE4A 1CUBA 1Z5NA 1YZTA 4IIJB 1SCKA 1PJ2A 2PUVA 3RYFB 4Z1OA 1JHUA 1R74A 4MI1A 1AKQA 1VE1A 5FNVB 5AW6A 1L4KA 1T2CA 4QPNA 3I5XA 4KVZA 3T1HB 4GT1A 3KFVA 4IG4A 1RZRA 3GJ4A 4Y6LA 3LSTA 3QJ5A 3NBFA 2CEAA 3DO8A 5CA0A 1AKEA 2IYFA 4J0QA 5J2TB 3TZEA 3WFIA 2QLBA 1SQSA 1JG1A 2I4NA 5WRFA 2GPSA 4Y98A 5GP1A 5AXBA 4B43A 2OAGA 2MR5A 3LNTA 2C3YA 4B8ZA 4YJFA 1QV6A 4BKPA 5FQOA 1W88A 3BRQA 1FXWF 1VI2A 4W8GA 4UHBA 4ZO8A 3EUFA 5F35A 5CDGA 2EU8A 2NO1A 1M2JA 1N57A 5FWXB 4QUIA 2QL5A 5KWIA 3Q3VA 4FSXA 4XZ3A 1UFQA 1RM5A 3G0OA 4G9GA 3N74A 3NC0C 4YJGA 2FE1A 3MEQA 2PT9A 2B92A 3LX5A 3F5FA 2H4XA 3M1AA 5BMVF 5I9IA 2IXTA 1ZM7A 3KVRA 4H3HB 2EIXA 3PD7A 1JDZA 5DI3A 3V80A 4AECA 5K51A 4V24A 1T2AA 2Y1KA 1JEOA 1WHTB 4RY8A 2GJ9A 3ZU6A 3QIAA 3ISVA 2E5LB 2OZVA 2WM3A 2IV2X 2G25A 1E60A 2FPMA 3U3MA 3CRW1 1S96A 2V6JA 5JJ5A 2I7VA 3TAXA 5JANA 3CCFA 2GLTA 4YQFA 5DNDA 3DAPA 1HDEA 1KJJA 3Q2OA 3TPFA 4CUJA 2QR5A 4DE5A 4ZU3A 4EGQA 4KFCA 2QN6A 3GDHA 3O03A 2V58A 4WKOA 1UPCA 4A82A 1Q0LA 4J0GA 4DWOA 1ABBA 1NT2A 3PXUA 3CB2A 3IAEA 3TQTA 5KSOA 5EPUA 3NB0A 1XZHA 1FRZA 1PNQA 4IIFA 4L0MA 3WZ2A 5DJ5A 4BTLA 2ASVA 2YQZA 5KYYA 5BR7A 1FSFA 1X8KA 1F5NA 5DXFA 2CHEA 1OROA 3BGWA 5F9FA 3MYYA 5EJ2A 1EFHA 4MTCA 1GNSA 1UT5A 2IE8A 1E3WB 3EUEA 1IOWA 2G4VA 2VNKA 3ICWA 2AFRA 4NARA 4NU5A 4E4TA 5M5BA 2OWDA 3L0ZA 5IX8A 2VFAA 3ETJA 3O75A 4J43A 4FGWA 1T43A 3QBJA 3QUTA 4EQ6A 4BFVA 5DWVA 4K46A 3BL8A 3DCNA 4LK3A 4ZGWA 2A92A 4I5GA 3BJRA 2FFRA 4TMKA 3ICEA 5HCUA 1EWYA 4ZU1X 3NHLA 3RAJA 3DKVA 3H0EA 4M54A 3CO0S 1KMQA 1KH1A 2WIAA 5CT5A 4NP6A 4ALLA 2ZYDA 4DMGA 5EIXA 2CT8A 1LWOA 2G9VA 4Y2XA 3FPGA 1SIUA 6NULA 4G8DA 1WXFA 2O52A 3H9BA 4KACA 3TDKA 4A16A 1U3DA 4ZEMA 1VLZA 1TOAA 5JMOA 3C70A 1JLRA 2CJYA 5FV4A 2RG7A 1PDOA 5ITWA 2AZTA 2B4RO 1ZRMA 4X7RA 3R76A 3SX4A 3O3MB 4UXIA 2VCYA 9ABPA 1N2GA 3TLKA 2OZEA 3BD7A 3WJ7A 4RD0A 4UUQA 5BQ5A 4DLRA 3FDZB 3K73O 2FJPA 4EB3A 2VPWA 3UXYA 4E51A 2WNHA 1VE6A 3CU5A 3UZUA 4KUHA 1PDVA 3M6VA 1SCBA 2EW8A 1HYEA 4TS4A 2UXCB 3I28A 4NG4A 3CWZA 1E1CA 1GG5A 3BWEA 3DWFA 3UANA 2P2CA 2PO5A 2ZTUA 2EQBA 3G6KA 1E2HA 2YFYA 4ILEA 3HGTA 4FZ5A 4NMHA 3WHPA 4AYTA 521PA 2C77A 5FUXA 3WG9A 3ZY4A 1AH2A 4QYTA 3OETA 3QE2A 3KPVA 3W1EA 4D02A 4OX9Y 1G5QA 4C0XA 4YV2A 2IPLA 3Q6NA 1DBQA 4MQ4A 1SZDA 3UKJA 2KWIA 3FMPB 3TTXA 2HB6A 4GXNA 4S0ZA 4QOHA 1RPJA 3JZAA 4FHEA 1GGFA 4K05A 4ZPXA 5FBHA 2IP2A 3V5NA 1CXZA 4C76A 3S1SA 4TLBA 2P91A 1C8VB 2OAQ1 1JQ5A 2CK3D 3DQZA 4TKMA 1FVOA 4HV4A 5JCPA 1MAHA 4B7XA 1TKRA 3FA2A 4U5XA 3S5UA 1PWZA 4LWZA 5B3KA 2IOFK 1CUGA 3EA5A 2YUIA 4MINA 1HNZB 3H1FA 4CM4B 5JSYA 1B2RA 4Q7QA 1EFCA 4DW8A 4P7BA 1BVUA 1GNRA 1L1EA 5IDVA 4C4OA 3CUKA 1SOUA 4E5SA 2UYCA 1H3FA 3IEUA 2EZ8A 5C0OE 5K5EA 2BTQA 5D3ZA 4R05A 3RSHA 1RM3A 3PEFA 2AVNA 2X14A 3SNHA 1TU0A 5BN3B 5HM8A 3EIWA 2C31A 2A0WA 1W46A 2WE8A 3TQQA 3U5TA 3FDJA 3U4IA 5I7VA 2RC6A 1A8QA 1T9AA 1XYVA 2WUDA 3M89A 5JZSA 3L5KA 3T5BA 3C5VA 1NMQA 4RK0A 2QE7A 4X20A 2H52A 2KBEA 4IQ0A 4BNXA 3HVUA 1PR4A 1IXRC 3U4AA 1UBKS 1P4RA 3N75A 4G5QA 4A8HA 4FFOA 4CPDA 5KQMA 1KMHB 1XAIA 3GGOA 1UMCA 4YT4A 1WXHA 4D81A 4R5HA 3GFSA 4PGMA 4CE6A 3C3CA 3V7YA 1I3MA 3WV5A 4LQ4A 4RF3A 3LXUX 4D0SA 4W4TA 5FIUA 1W5BA 1K7YA 4GBGA 4FB5A 5J4LA 2GF0A 3LBYA 1DAIA 3G88A 4R98A 1QG4A 4UASA 1SULA 3CVUA 1MTOA 1N77A 2BI8A 4MJXA 3EVEA 3U7FB 2ORED 4G5SA 2PLAA 1T25A 2RH8A 3M6WA 4UEOA 1E18A 5CX1B 5SZIA 1KI6A 1OU4A 3CLTD 4G8JA 4UNNA 4AL4A 1U6JA 1E79D 3P2KA 3KL4A 4AJEA 2EP5A 3A4MA 5K99A 2I7XA 1DOAA 1JEEA 1D5WA 2I62A 2OV2A 2V8BA 2YMPA 3GH1A 4PG4A 3LSYA 4AI6A 1HNWB 5F9MA 5LKRA 1WOMA 4PX3A 1CR4A 4NJEB 3WK9A 3FB1A 2ZS8A 4M1OA 4N7JA 5H9VA 1R8YA 2D7CA 2MDTA 3IBGA 4ZP1A 5ALFA 4BFLA 4EI8A 2Q3LA 4L5CA 1VKJA 2GUGA 1IONA 2FMFA 4QSMA 3MC1A 3P2MA 4IF4A 1UPBA 1Q20A 4UZEA 3WC4A 5FPTA 4O2AB 4Q4HA 3ROMA 1TCVA 4GQIA 4RGQA 3CNBA 2HA6A 2XMDA 4TQGA 3TL2A 4DDHA 1U2GC 4ZYVA 3NWBA 2IUSA 2CVOA 3CURA 3PQCA 3USCS 4DSTA 5IH3A 3F2VA 4TUYF 2V7EA 4CLEA 3IL2A 3R7NA 1Q77A 1Z4QA 2C96A 2OVBA 5FUVA 1BNCA 1EMDA 4J07A 4FDAA 1TA0A 2WWVD 1NW3A 3IV9A 4P8RA 2OTCA 4IDEA 4D80A 1JJAA 3DONA 1R7RA 3PHHA 3HY4A 1T6NA 3U19A 1QPZA 5JQGB 3A10A 2GERA 1CD5A 3G68A 3LKDA 1IAVA 4DBZA 4BMCA 2RB4A 3CJTA 1U11A 1W85B 3EAGA 3DDUA 5DF1A 4YJ2A 2I8AA 1ZZEA 1EHYA 1ZJ4A 3FWPA 4ENRA 2AZ4A 3V42A 2O2XA 4N65A 3H65A 2ZBVA 3K15A 3IQDB 5IXSA 3H5TA 1Z26A 1GN8A 4OXYA 5TQVA 3ZV4A 4AD8A 3D81A 4Q3DA 5BN5B 2RFLA 4CL2A 1FBNA 1P81A 3K9QO 5EP2A 2WUWE 1L4UA 2DBYA 1ZH0A 3CF4G 1HT1E 4W5NA 1ECPA 5CG1A 3LMKA 1Z37A 1Z33A 2DMRA 1DAOA 2Z9CA 3C3KA 3EDQA 2FWBA 3NP7A 1SQ5A 2QR2A 4FS8A 3ZUGA 1C7RA 4R1TA 1JMKC 3B20A 4XIJA 2ISQA 5C81A 4O4IF 3F9IA 4ED9A 4X84A 3CLVA 3UAGA 3H97A 3HACA 4NBLA 4DSUA 2PK3A 2Y0CA 4KO4S 4IFIA 3ZNQA 1NPDA 4OU5A 3X1JA 1UZNA 3F2IA 3N8HA 3NOOA 4JJZA 1P2VA 5ESXA 2FVYA 4YJHB 1C50A 1KQPA 5BR1A 2R6FA 4MRAA 1FFEA 2ODAA 5FBVB 2YHSA 1YVPA 3QOFA 4RIHA 1V4BA 3U2QA 2QUJA 4TSKA 1XYGA 4A9AA 1LDBA 2C8JA 5CHEA 4OQEA 2R6JA 2WD8A 4ZGBA 3Q7SA 4GL4A 1A8IA 1PL7A 4PAWA 3OT4A 1I4DD 3BWMA 4GX0A 1QQ5A 5LQRA 2WINI 2PY6A 4DGSA 2A5JA 1Y5IA 2VNAA 5IS2A 2A9QA 3EVAA 4MVJI 2BI7A 2C58A 1IZ9A 4GYJA 5EFOA 3QVOA 4DDMA 3ABOB 1FUEA 3VR3A 1V8FA 3EXFB 4FFDA 4IV5A 3QX9A 3KB2A 4A0SA 1KZ7B 1PR3A 4TXJA 2WB4A 2D13A 4JD5A 4D56A 4MPRA 4BUCA 1SHZA 2P2GA 1HTBA 1NVVR 3BL5A 2CDBA 2W4QA 1E1LA 4KLRA 4WA7A 3EPLA 4Y9TA 5CA1B 1OI3A 3FCOA 4OJYA 5DOVA 1BS1A 1G59A 3RC3A 2P30A 1MOSA 1K3UB 5DO9A 1ZY2A 2PGOA 4M9SA 4COKA 3MOSA 3REGA 1X0VA 1QO7A 1EXMA 2G4LA 2OECA 4X1KB 2GR9A 2VTBB 3PC3A 2DJIA 4KE9A 1OOEA 5TPZA 1KK3A 2WYWA 3G7UA 1KIAA 4Q1FA 1BWQA 3WLHA 4AXXA 5C5EA 1GFIA 1JR4A 4XLTA 5CGQB 3ZWCA 3V46A 4ZGGA 3HKEB 4YA6A 4B7ZA 5CXSA 1WDKA 5FPPA 5CYOA 2D6FA 4UHCA 1KKLA 1JDPA 2K4MA 3U9LA 4LBWA 1UINA 2HC9A 3WFZA 3D2CA 4YIHA 4N54A 2H9IA 1FJXA 2G9ZA 2CJPA 4D9HA 3OPXA 4XDGA 4LEIA 3DBLA 3NHBA 2IY8A 3SS7X 4AIIA 4LDRA 5KOHA 2UXBB 1SC3A 2ZM5A 2OORA 3URKA 3P5BA 3ZZNA 1R0LA 3PJDA 4P81A 1Y7LA 3G0DA 4PX5A 1NVXQ 1WIWA 2FCRA 4MQBA 5GQSA 3SYRA 1M1NB 3LKZA 1QWOA 3ELYA 1OXKB 2MMGA 3L1IA 5EZSA 3WDMA 2F3QA 1LD3A 1ADGA 2YWFA 3MJ4A 3QPBA 4MK4A 1RYDA 3DMPA 1WKBA 4M55A 5JATA 3V7NA 3ZWQA 1H66A 1NVWQ 4QGSA 4LSMA 2WFLB 4DKJA 3ETNA 3AXTA 2O23A 3P4YA 5G1OA 5JSFA 4INOA 3MCVA 1C80A 1QG0A 3PFHA 4FFBA 4R31A 4HFRA 3RQSA 2G88A 4CL0A 4MW6A 5EIBC 1QHNA 1D0IA 1TMOA 1P3Y1 1A7AA 1PV1A 5T6BA 3TPZA 5HCIA 4C5CA 5ECYA 3GLGA 1CUJA 2HU5A 2ZWVA 4I9GA 3OAAD 4BWGA 1XROA 3DTTA 1VIAA 3GEMA 3VJLA 2W2MA 1P1CA 2FLKA 4IFTA 3UWSA 1D2CA 1HT0A 3CPSA 3KSAC 3CX7A 2QVLA 1M2OA 5I7AA 4LWPA 1ILWA 2BHTA 2RAFA 2IBSA 1DDGA 3TW4A 3D7KA 3UCEA 2FKAA 4A8JC 3AF5A 4LF4B 1UEIA 2LWIA 3FM9A 3KCQA 1K3TA 4E22A 2FR8C 4M36A 1V8BA 1DTSA 3D4BA 2BGRA 3ZW7A 3FMGA 2VPXA 3UF0A 2ZPUA 2FHPA 2X7HA 4EY4A 3RIGA 2YY5A 5B3LA 4BO1A 1ZU4A 2EP7A 1A77A 2YYAA 2Q3MA 1SU7A 4Y30A 1CTQA 1SBNE 3DNPA 5GPBA 4TTIA 4UTPA 2NOAA 2OOKA 1ZK1A 1W1UA 1YH3A 1HC7A 4OIMA 5BVGA 4P3XA 1GV1A 4N3GA 2NUAB 3IP7A 4MCHA 3G2LA 2RE8A 4BU0A 1XA0A 3AIKA 2JIQA 1IN8A 5JMWA 1MZPA 5KSPA 3GEEA 5LMNB 1SU8A 3VBCA 2OSVA 1N5LA 1X7YB 1V35A 3OQIB 1D2GA 1Q83A 3QVLA 3JAKA 1GEEA 2FEMA 1X0XA 3KKKA 1EX9A 4KX3A 2ZG6A 3I6QA 1XU9A 3H9CA 2MSEB 3LOUA 5JCJA 1N6IA 4NCNA 2C4WA 5B1IA 5ADWA 3PC8C 4O5AA 2CF6A 3UHFA 3ISJA 1L3CA 1OPXA 2VF5X 5REQB 1NG9A 1W4RA 3QUBA 4JDUA 4FIDA 3DEIA 1J2RA 2UUAB 4F3TA 3PCTA 3KXKA 1BA3A 3G6WA 1KMNA 3WY9A 2DERA 1GYRA 2HMTA 4MYCA 3N8IA 1B16A 4BQEA 3IJRA 4KIGA 4PHGA 5BW4A 2VF4X 8LDHA 3TNFA 2A5DA 4TL8A 3NRJA 4JKOA 1NDUA 4MV1A 5I4KA 2GCPA 1F5SA 4L4XA 2I2CA 1DXOA 3AL2A 2XQKA 2JFNA 2WVJA 3AIMA 2XQVA 1UXOA 4W1SA 1AXRA 2GT1A 3BK1A 1RKXA 5ER6A 4PRZA 1XPUA 2J6HA 2IU0A 4JLNA 3MUFA 1KI9A 4R84A 1NXQA 4UDYX 1BXGB 3HO8A 3WBFA 5C4GB 3CONA 2HLPA 1VXRA 2PQMA 1IXSB 1ST2A 1TQ6A 3BKXA 5KCMA 1P0PA 4X24A 2B8JA 2WJZB 4HH0A 1T2NA 1HPLA 1FUIA 2LIVA 3O3OB 1GL3A 2RKWA 3FHOA 1RJGA 2ZSJA 3RYTC 3SYMA 1X92A 3WSVA 4DV3B 1Z18A 4OSEA 3M2PA 4W5WA 4ZOLF 3C5CA 1A7KA 1COWD 4PZZA 1JTFA 4A6PA 3PUVA 2DB3A 2A84A 1PLJA 2YMMA 1B15A 3HEMA 3LHDA 1AGPA 4W9MC 1DAPA 1I1NA 1DHTA 1OVMA 2ZBFA 2HRRA 3B70A 3NAQA 1I0ZA 3L4KA 3GZTB 3AI7A 1N1DA 2HMVA 3O1JC 1C14A 3FKQA 4RETA 4DJ5X 3I5MA 2ZRPA 3Q7IA 4LHZA 5AW3A 5FFMA 5C8XA 4RKYA 3OEEA 5DPMA 1WSAA 3OOWA 1EVLA 1U3UA 3H2YA 2GJ4A 1QVWA 1SBCA 1UPAA 4L57A 1GNVA 2B2NA 2XIJA 3HI4A 4XQCA 3X43A 4R0MA 4Q9DA 2V65A 3BFPA 1RBMA 1E4YA 4G25A 4F3KA 4BNIA 2PE5A 3UPUA 4V39A 2C83A 2EX4A 2MYUA 3A26A 3AEQB 1VLMA 2ZPAA 3NTRA 3PHGA 4XLZA 5BSTA 5BXQC 4CNQA 1TJ5A 4TV9B 4F2WA 1F12A 2OKCA 4ZJUA 4Q4LA 5HR5A 1GGMA 1OC4A 1C4OA 4OQNA 3RHSA 4FOSA 2IXAA 3Q6MA 1XZBA 5HUJA 5KNCH 2WWFA 1ODTC 2DECA 5AVOA 5C52B 3NTLA 4JLPA 2DWCA 2K87A 4TT3A 3OX3A 4RIIA 3T06B 5I7FA 3CPJB 1SCIA 4G37A 4GPAA 5FI3A 1E62A 1JJBA 3LLCA 4PLFA 2PTGA 1E77A 1RJ9B 2GEJA 2JGLA 1EBBA 4AKIA 5K0SA 3TGWA 5LLSA 4I1UA 3I4LA 3SS9X 2PT5A 2RAPA 1H4TA 1TAUA 4PIPA 1JF8A 3S2IA 1B6TA 2ZZMA 3NDPA 5F4ZA 1N6LA 2H7XA 1TKBA 1XWIA 2AN1A 4G0MA 4NMXB 4HDNA 4S1OA 5CDYA 1RRMA 1FNDA 3JASB 4GZ6A 2C95A 1S4QA 2OESA 3OZUA 1SELA 2HA5A 4IZIA 4XE5A 1OYWA 4E1AA 5HVNA 3CF6R 3REOA 1MAVA 2B4YA 2GN9A 3ITEA 3RYCA 2V96A 2K7FA 4D4LA 1KXZA 3JR7A 3RRYA 2VYND 4F7WA 5K6TA 4DVGA 4J03A 1XMIA 2DSNA 4LJ6A 3OICA 1MT0A 1QANA 1G2IA 3LZDA 3PC7A 2OBYA 3UAYA 1EFTA 1NVEA 2JH9A 2VHCA 4IIUA 4TYPA 3HB5X 3JZIA 3C6MA 1KDTA 4UAJA 5EP4A 2FQ1A 3AF1A 4HPXB 1OW3B 1S8FA 4IUDS 2CDNA 5SZKB 3U1BA 4WCDA 4YN3A 3RCBA 3QPCA 2ODTX 1HSZA 2VAMA 1X1CA 2P68A 3KS9A 2MIIA 4UVIA 4NULA 2JHPA 4M8IA 3DE2X 1OUMA 4TWIA 3ND5A 2JLUA 2C94A 2D0DA 1YCGA 3MFYA 1ZU5A 5K09A 3OBBA 4IIYA 3A58B 4EPVA 1IY8A 2X6RA 1EA7A 4NJOA 4Q6BA 1QC5A 4D8WA 1HQYE 2Y77A 4QA9A 3PE6A 5F4BA 3C7TA 3RRJA 4A3SA 1AUVA 2ZIGA 2N47A 4NCHA 3LQ2A 3V1LA 5B6PA 4IVRA 4O4JA 3A9SA 2N3ZA 3NHZA 2E5WA 4UU1A 4CW7A 5K0GA 5TR9A 3HL0A 2WYOA 3EIEA 3I23A 4FCCA 4UDOA 3ICPA 4C7VA 3IILA 1CC1S 2ZAIA 4FJ2A 4NESA 1Y48E 3ZEAA 1AN0A 2VRNA 1XF1A 2MJLA 4PTYA 5A6VA 3AHJA 2JD0A 2JJ1D 3NGMA 1HNXB 2OFXA 2R00A 1GZVA 3BXHA 3MAJA 1S8OA 4L0DA 3WIEA 1OWOA 4XKJA 2G8NA 3L5OA 4X8OA 1H93A 1O6CA 2ODBA 4JP1A 3VNQA 2J9ZB 5E3JA 4FFRA 3N86A 1LKZA 1OFGA 2Y2UA 1E2MA 2OMKA 1P5ZB 4BECA 2XD9A 3HCPA 5DLPA 4L3OA 3OD1A 3O7WA 3PUJA 4KLNA 5ALHA 4DIEA 1BXRB 3A9UA 2DM6A 1P4SA 3BQNB 4ZDKA 3PUZA 5FBRB 3ETCA 4B76A 5KQRA 3ZGYA 1CY0A 4H7KA 3OX2A 3B36A 3J7TA 4YLYA 3NIGB 4WKNA 2PRIA 4WQMA 2QMYA 2A2ZA 1Y42X 1L7OA 4RMNA 3W7BA 3AUYA 3AVUA 3LGXA 5CLHA 3SS8A 4M87A 3AG5A 4ZZIA 2I2DA 4IV8A 3MWEB 1MRSA 1PX2A 5BSWA 4ERXA 4CHTA 3EEBA 4KQ1A 3G9ZA 4NIMA 4P4UA 1YCDA 4QFDA 4XFDA 2QRVB 1I5OA 2YCBA 4LYAA 4F71A 5EWJA 2WU4A 2PSHA 4RSRA 2VZ9A 1RWNA 3GEIA 1T6ZA 2UUOA 7REQB 4MI9A 4HGQA 1KZGB 2NXWA 2VDRB 4PO9A 2NYVA 3O2QB 1D6NA 1DKNA 2B4AA 3QXHA 4Z7JA 4WACA 2BEUB 3LECA 1NYLA 5LJIA 1KTIA 3WXBA 2LVBA 2P2ZA 2ZYVX 4MS4A 4RTOA 3HYCA 1YULA 2NU9B 3P32A 2FA9A 3BB1A 3BAFA 1Y1TA 4EF6A 2QN9A 2HHJA 3V4VB 2YJ6A 2FGKA 2X58A 4HYYA 4J3FA 3NWOA 3TI9A 2PKQP 3AEKB 3QOYA 1X7GA 4Q9KA 3L4JA 4K7JA 3FNIA 4L7VA 1MGPA 2GNOA 4FGLA 4ISCA 5JMTA 3SE0A 1EZ4A 2BFEA 4IDOA 4D3SA 1ZD8A 3EQ2A 4W1RA 5C8YA 3UTCA 1TPZA 3RLIA 3TUJC 5LIRA 4Y0VA 1FUUA 3GPBA 5DCUA 1SCAA 3E1KA 4HNSA 5AKIA 1ZC3A 2B9VA 1Y1LA 2ERXA 1PWYE 4WX2B 1ST3A 3TRHA 1SD5A 5ALEA 4QAQA 2M6KA 3ZE8A 1TEHA 2FETA 2Y1FA 4QDJA 2QYHA 5IYZF 3QEKA 4CLXA 4YMVA 3P0FA 2P3LA 3KK0A 2JF0A 1H1LB 4I6GA 4AN4A 1RR6A 3BSWA 1Z4JA 3SI7A 5FLXA 4HBGA 1ESEA 4B3JA 1PGNA 3LS2A 4LYYA 4O0LA 4C08A 4PXYA 1P75A 1CLEA 1Z4OA 3WE7A 3WRVA 1LQ2A 5H82A 5AK0A 2JBHA 3E9DA 5AW9A 2DR2A 2IP4A 4MV8A 2AC2A 3A2NA 4DJDC 4XSVA 2XT9A 2A88A 3EEYA 4OA8A 5JXWA 5JWRA 2JKVA 3CE9A 3KR0A 5G4KA 1OBHA 3OF3A 1XEFA 2YZ2A 2NU7A 4AICA 1IG3A 1D0VA 4XJSA 4RQTA 1WULS 2FPWA 1A69A 3R3UA 3K96A 4P0PB 4BVFA 1W8IA 1RCUA 1T3ZA 4AROA 4JFRA 5I9BA 2GPYA 3MGAA 1ACLA 2NSDA 4JBXA 1PGOA 2QKYA 3EGWA 2I54A 1TAGA 3P9PA 3VPHA 1AZWA 3I53A 5EXTA 1Z5OA 3Q7QA 1I3NA 1YKGA 1JQBA 5FUWA 4F60A 2E0IA 3EXIB 3C4JA 3WTBA 2IS6A 2ZZKA 4GLOA 3P96A 3QFCA 1E2UA 4WZBB 4KR2A 3T3IA 3GJ8A 5BQ3A 4ZYXA 2JIDA 3SM3A 1PJCA 2DY0A 1PKEA 2E3JA 5D7NA 3TLJA 1SCUB 2XI4A 4C0AC 2R6HA 3FZGA 4GOJA 4R51A 4DCUA 2ZIAA 1ISSA 3ZWYA 1YI0A 1WU8A 1MC5A 5BSMA 4PAQA 3GLSA 4DMKA 3HYTA 3MD9A 1Z6YA 1NYTA 3GFQA 5ES4B 2TS1A 4TQ9A 3OZCA 4A2CA 3O84A 4PGGA 3AOEA 3AW9A 5D7BA 2V8OA 3IVRA 2BM9A 4XARA 1DWQA 4PYIA 3BM5A 5HG0A 1WUTA 3BJMA 4PFQA 1RXUA 1SVWA 3G2QA 5A05A 3F4LA 1KFJB 2DH5A 1ECGA 3BMCB 4LVNA 3VNAA 4D44A 2ZUTA 3U09A 1R00A 1U0GA 2E4WA 2AEFA 4URYR 3Q41A 4OAPA 4D5GA 4XVCA 4M38A 4R2JA 3PCRB 4HCJA 1MPXA 1QTRA 3DF7A 3ZUPA 5EYPB 2AFIB 2VHWA 4TSFD 1F17A 4B6FA 5EP3A 4NHEA 5TGTA 1VSTA 1NMYA 4JC8A 3TF5A 4V0LA 4FFSA 4XEUA 3ENQA 2Q27A 4MV7A 1QQ7A 3OIGA 3EDRA 1FMTA 3D4IA 4OYLA 5K2OA 4HX5A 2ZTLA 4EG4A 3CT4A 1MAAA 2FUCA 5JD5A 5IU6A 1MNQA 1NBMD 1G291 1D6MA 3I45A 4L2IB 2C78A 4M1YA 1Y8RB 4AUEA 3F1KA 3OH8A 1DIOB 4D92A 5IH7A 4AZ0B 1UUFA 2EKQA 2J6BA 1KJIA 1U28A 3C24A 3NU1A 3ETDA 4PICA 3JQCA 4QUJA 3UGQA 5A5VA 4BHTA 4Z0NA 1AKUA 5LYYA 3RSCA 4FFVA 3DFKA 3W1WA 3WLJA 3F5QA 3S2UA 1U99A 5GMOA 1E9RA 2OBFA 3VBEA 4BVLA 1VMEA 4U6NA 5JCOC 3AV3A 2WTXA 3I9FA 1Z4KA 4RJJA 5DLDA 4E94A 4HUTA 2PUFA 4HEQA 5CB4F 1YVDA 3G9UA 4NCXA 1ONNA 4JLDA 4TQUS 1Q1QA 4UE6A 4WCFC 3ZV5A 4H9GA 3BPSA 3H13A 2VI5A 4IDFA 3KHUA 1AIPA 1OI4A 1ZOLA 2WMYA 4G01B 2EZ4A 3EAFA 4JUDX 4NBRA 1T6XA 3DXXA 4XYMA 4A0GA 10MHA 4ZFNA 2EOAA 2EFYA 1U90A 4IV0A 2DBQA 4WZBE 2BCJQ 1A9RA 4DG8A 1YVEI 3FMVA 2YKGA 1UDRA 4PPYA 3VPGA 1JQ3A 1JKIA 1XCOA 3LBNA 1X7DA 1MT3A 3QX8A 1FMFA 2NZVG 3H5AA 4I4TA 4QVKA 3WFJA 1YDEA 5ARBA 1UFKA 5LP6C 1GTZA 3LIIA 3O9MA 2O0LA 4W63A 3AEYA 2Z2XA 3DAFA 1SXIA 1KO4A 1XLVA 3UT6A 3IUPA 3R0IA 2B3TA 2GESA 2QMHA 4I81A 1Q74A 5BN1A 3SEQA 1Z5PA 2J8ZA 3L1VA 3PXDA 1OT3A 4Q15A 2AN5A 2PN1A 4CM1A 5H81A 4YAIA 3WP0A 5B2FA 1Y4AE 5JCZA 1F60A 3WAKA 1RWQA 2ONJA 1RHRA 3R5FA 3L6RA 3U7HB 1PZMA 3R3VA 1W2GA 1V25A 4X63A 2G1AA 3OPYB 4JYBA 3PG5A 4PSDA 1RACA 3VOSA 4BFTA 5MHTA 3JX9A 2FUG6 1SCJA 3Q7EA 4HTAA 1TT5B 2J4FA 4A8JB 1MG5A 2WU1A 1QFYA 4MV4A 3TI7A 3R4CA 1GGJA 4FHDA 5DN6A 2ZUCA 1M2VA 3O38A 4B48A 4H31A 4BFZA 1U02A 4N0DA 2AFIE 1M34B 1H5UA 3PEEA 4FGKA 4ERNA 1RJDA 4DZRA 3PFFA 5FCDA 2WJPA 4HZGA 4PZPA 5IC4A 2XB6A 2J9YB 2BMDA 2Y1OA 2HLDD 3GAFA 4BYMA 4CG3A 5BWOA 3GXOA 2J46A 2WTMA 1V11A 2Z4SA 3G1UA 4YGYA 4ZDWA 3LUDA 1WPGA 1J2JA 1PE0A 1FY2A 1Y4ZA 2WZDA 1G8PA 3AVQA 4AWBA 1G8FA 2VHXA 2X23A 3JRWA 3K94A 4HTFA 4JJ7A 5IKEA 3F9RA 1WMFA 3O94A 4MSUA 4QBTA 5LU8A 2FDRA 1JIXA 2VHTA 2WA1A 4RZUA 4LVOA 4KJXA 4BX2A 1VIMA 3ZD9A 2OCDA 2AEEA 2FPGA 2HSEA 2QRJA 2EAUA 1JVSA 3RUFA 1NZJA 4QGHA 1KK0A 5K3OA 4HNAA 2HV8A 4B35A 2PSJA 1HZZA 1JILA 4B44A 1GUYA 1AA6A 4DUGD 4JT2A 4M8LA 5JJIA 1I4TD 2BN4A 3OZXA 4GNKA 4HGZA 4MO9A 3K16A 3V4ZA 5AHXA 3E03A 4H15A 4PLWA 5KQPA 1NQTA 2OVFA 5KNBH 5ECWA 5C5IA 2EFDB 4HGPA 2YRXA 3JATA 1DEXA 1KYQA 2WUVA 3MSCA 3IGFA 1NN1A 2ZJZA 5A0TA 4IINA 1TNDA 2XITA 3L6CA 4IDPA 3WYNA 5HHTA 2BMWA 2GVZC 2BEVB 3A6EA 4P4SB 4F4IA 1FIUA 4BAZA 2OEPA 1QE3A 1KRWA 4KO1S 4REQA 2J5RA 1G1AA 1YZKA 3V8RA 4LUCA 2PS9A 4N0EA 2PRJA 5B1EA 4I9UA 1EUZA 4BIIA 3BIXA 1WXQA 1XMOB 3OFSA 4Q7KA 2VT7A 4PHHA 2IYPA 1Z2EA 4MRRA 3N2GA 4LYGA 1I94B 4EJSA 4IUBS 5AKKA 3M4XA 3FOFC 2A1IA 1UF9A 5K6AA 5E3IA 5GAJA 4KXVA 1FFBA 4C88A 1Z2AA 3DKRA 2JANA 4NABA 3T4EA 4ZEOA 4AO6A 3ESCA 1JV2B 1LS6A 4DDUA 4XRGA 5U1PA 4U7GA 1WUKS 3ZQUA 4NH4A 5ALPA 1FJGB 2ATXA 5COBA 1Q3KA 3LGSA 4BGEA 2VDMB 2NU8A 5M34A 1SK9A 2HCTA 2OMEA 2ZI4A 4CIDA 4EDFA 3IHKA 1G18A 4G0ZA 2G06A 4ARVA 3GPLA 2QI9F 5CT4A 1HLDA 1XI2A 2H1IA 3EXHC 5AP9A 4J7CA 2HREA 4OJTA 3WI7A 4ZJYA 4JI2B 3AM5A 3SXUA 1M34E 4XM0A 2W6JA 4C4YA 2CMDA 3WQBA 1IPEA 4AP9A 1O1YA 3OKFA 2R2GA 1EZ1A 2O4CA 1YFLA 3K9HA 2AA3A 2VF8A 3B2NA 1QNFA 3VKFA 1HSOA 4WI1A 1KC1A 3IALA 1P7CA 3K9CA 4WMLA 3IUNA 1AY0A 5E7QA 2PBRA 3CZQA 1T0HB 3QJGA 2PX0A 2CLKB 2JJ2A 2HR1A 2P8JA 4CR6A 4HB2A 2OV4A 3DC7A 5HNKA 1KRXA 1UK9A 3IPLA 3L0CA 1IN5A 1UOQA 2JHCA 3TOZA 1E1YA 3GIWA 2UZAA 4RDHA 3RSSA 2WZCA 4EBBA 2HHHB 1Z5UA 2BVNA 1Z8DA 7ABPA 3OIDA 3NHJA 5JH7F 2VYVA 1YZFA 4KOEC 1NMSA 1DVRA 1AF7A 2PS3A 3HYSA 3HWX1 3QE0A 4WZAB 3SEAA 2GXUA 4RWEA 1JDJA 1W4AA 3BIOA 3NVKI 2IE0A 4OP2A 1E6KA 3A1SA 2XNHA 1GA1A 4KKVA 4OXKA 1VCOA 3UWDA 3I5YA 4BXOA 2E49A 1VHTA 3B89A 3ZNOA 1TI7A 3VR2A 2QRUA 1JU4A 3KAKA 4BRWA 3KETA 2Q1WA 2AF4C 4ETMA 1X9GA 4MOWA 1XMPA 4RLQA 2GXQA 5IZ4A 5KMGA 1YRYE 3C98A 1KJQA 3H1BA 4OM7A 1WNTA 2IYRA 2B35A 2VWQA 3ESZA 1VPEA 5CTAA 2JRCA 5CW1A 3W2EA 3S27A 2Y92A 3W6NA 3ZYZA 3K4HA 1QFMA 1WVMA 4EHJA 4IZHA 2XTNA 3EBOA 3WICA 3K0EA 4K9RA 3FCYA 3SYNA 2O5EA 3FNGA 2KHZA 3OCXA 3U9SA 1VG0B 3CH5A 3G2IA 5EXPA 5SYNA 2CV0A 1J7KA 4X95A 1JHDA 5EMLA 5JZ9A 4LF7B 3CRNA 1UH5A 2OHGA 1QFJA 3PSHA 1IBKB 2FQQA 1ILEA 1B7GO 2Z9DA 3WL5A 1FXWA 4A4DA 1E69A 1FTWA 4NQZA 3MRXA 2ZIXB 2J0EA 4JVSB 3RUIA 3V4RA 4GOXA 3PFCA 3IH5A 3KR1A 4X8MA 2BE7A 1WDTA 3I0MA 3RGWS 4C0QC 2G63A 4JAVC 1PIWA 2VBGA 1U2PA 1KQOA 2ZUUA 3TIFA 3ZLBA 4MUMA 2PL3A 5KS2A 2ZAYA 3VAAA 2R8XA 3HSKA 5GZ6A 3MJCA 2HIAA 2FR1A 4Q39A 4BLOA 2EFCB 2ZEJA 4F5YA 3SIWA 5A1JA 1H22A 5CYFA 1QU2A 3GRKA 1Y1RA 2C29D 1WLSA 1Z6XA 4YACA 4JI5B 4CIXA 2O0KA 4F4CA 3TGLA 5EJ8A 4JHLA 1OX6A 3T7TA 1A4RA 3BWDD 1OH6A 4LI0A 2QMOA 1MEEA 1MOPA 4E6EA 2FW7A 2NSLA 3WIBA 3PGMA 4LKRA 2WJJA 1DRUA 3KUKA 3PKZA 4QIHA 1T4CA 4M2LA 4OB8A 3KOOA 1J39A 4CM9D 2BCGY 2C7VA 4L6CA 5BYBA 4CQMD 1QLHA 2OYRA 2BW0A 2UZ1A 2XUKA 2PRKA 4Z4IA 9LDBA 1ITZA 1T5TA 1WF3A 2OKGA 2QAGC 5DK4A 5KYXA 1UDXA 2BGLA 1YNOA 2QWXA 3BRCA 3FNHA 1RADA 1TEVA 1YUNA 1AS3A 2GM3A 1DIAA 2JIOA 2YS6A 2HFJA 3C2QA 3T35A 1DKQA 4KHZA 1XAGA 2X13A 3F6PA 4AY4A 2HL6A 3LA8A 4MMZB 3UBTA 4U6QA 2P5SA 4LOKA 3OZRA 1TL7C 4WZAE