3TFQA

Crystal structure of 11b-hsd1 double mutant (l262r, f278e) complexed with 8-{[(2-cyanopyridin-3-yl)methyl]sulfanyl}-6-hydroxy-3,4-dihydro-1h-pyrano[3,4-c]pyridine-5-carbonitrile
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
262
structure length
262
Chain Sequence
EFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSRWTTLLIRNPCRKILEELYSTSYNMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of 3-hydroxy-4-cyano-isoquinolines as novel, potent, and selective inhibitors of human 11beta-hydroxydehydrogenase 1 (11beta-HSD1)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
total genus 99
structure length 262
sequence length 262
chains with identical sequence B, D, E
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2011-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tfqA00
1X0VA 1JQBA 3D3WA 4CUZA 4O59O 4UUPA 1N8KA 2OOSA 2ZB8A 2G17A 4YAKA 4YCAA 1KEWA 1EVZA 1Y9AA 4BO0A 3H9EO 1GD1O 1N9GA 3F9IA 3OP4A 1SMKA 4QO8A 4J2HA 3GH3A 3ZV3A 4DLBA 5ITVA 4ND1A 1Y5MA 1EDZA 3IDSA 3PHLA 2PZMA 3AWDA 1IL0A 4WOJA 4B79A 1XKQA 3A4VA 2O3SA 4TVBA 4WNIA 4BHTA 4EGFA 3TZQA 4RF2A 2Q2QA 4KMSA 3AM3A 4UVHA 2YHIA 2FPIA 4RPJA 2C5EA 2BH9A 3ZWBA 4E5NA 4RF3A 2Q4BA 4FCCA 1E6EA 4UREA 4DMLA 3FPCA 3PHHA 5COBA 5F1PA 3LF2A 3JD1A 4D45A 3IUPA 5KIAA 3JQ6A 4BKUA 4CR8A 4MDHA 1WDLA 5JY6A 3KRTA 2O7SA 2IYPA 2DTDA 2NQ8A 4Q3AA 4XKJA 5L45A 3QIVA 2O3TA 1JWBB 1SPXA 3DBLA 1KS9A 1YE3A 2O23A 4J91A 2JAPA 4KTTE 3H65A 5A02A 2C20A 3SX2A 2BFMA 2NACA 3ANMA 5TNXA 4J9UE 2VNAA 1T26A 2R00A 3PTZA 3GVPA 3WX0A 4PN3A 1BXZA 3NT5A 3UHAA 5JDCA 3PQDA 5K6AA 5B4UA 4ND2A 4ND4A 2X86A 5HS4A 2Y99A 1KIFA 1J6UA 1LDEA 5CDGA 1LQUA 3BMCA 4RVSA 4DA9A 1OI7A 2UV8A 3PK0A 2ZTMA 2VOJA 5TGDA 4IJUA 3AI2A 3AOEA 3WGYA 3C1OA 3GEMA 4BNZA 5A03A 3S2FA 2FMUA 5JE8A 4DPLA 3QHAA 4CLDA 1V3TA 5KKCA 1D4FA 1DIRA 5JDIA 4UEOA 3HFSA 2O4CA 3DOCA 1I3NA 4YT4A 4YJHB 1J49A 2DBZA 2EJWA 3DBLB 2O7QA 3BHJA 4XGNA 3FNGA 2Y68A 2ZQYA 4IDAA 3DBRB 5BSHA 3KLMX 3GEGA 1NVTA 4P8RA 3WNQA 1HDCA 2J3JA 2GSDA 4HFNA 1K6IA 4PLGA 4F3YA 1QSGA 5KJFA 1DC6A 3G1UA 2NVUB 1NQAO 2W4QA 2VRCD 4B3HA 1X0XA 3SC4A 2BI7A 2WD8A 5AVOA 1GYRA 3C7AA 2AEMA 4AJHA 3QQPA 3L4BC 7ADHA 3GZNB 1VKNA 2PGLA 3D7LA 4OQYA 1WLYA 4NZ9A 3WXBA 3LLSA 4DIBA 4YRDA 4PG8A 2Y93A 4IQ0A 4IGFA 3RUFA 2XPCA 5KVCA 2GASA 3K92A 3JQGA 4EITA 1IULA 3X2FA 3DXFA 4MVJA 2DQ4A 4OAQA 2Z95A 4JJFA 1JDJA 3LC1O 2AEFA 2Y67A 5JCJD 1LRLA 4AJOA 2HMSA 3TFOA 4OOFA 1HLPA 3OF2A 1IZ9A 1CETA 2OL4A 1CYDA 2GCGA 3AUUA 5K9ZA 2NADA 5DNAA 3N74A 4JN6B 3RUHA 2YQ5A 4A73A 1A72A 4CUKA 1K89A 5KJCA 1DRWA 1ZH8A 2Q46A 3F3SA 3O8QA 4GL4A 4AJKA 3MOGA 1IZ0A 3C1AA 4U6QA 1X15A 3RJ5A 3EK2A 4BQPA 2JFFA 2IRWA 4UEKA 4WJZA 3EAGA 1E7MA 3U4DA 4XDYA 1Y8QA 2AHRA 1C0IA 1I2BA 4JCOA 3ZU3A 3I1JA 5JNLA 3E5MA 4D46A 3ZHYA 4L4XA 4CLOB 3GN2A 2NU9A 4IIUA 1HETA 1A27A 1H6AA 3RKRA 1NR1A 1E1MA 3T4EA 5L4LA 1ZZEA 1U9JA 1OOEA 2YV2A 5G0TA 1TVEA 2OO5A 1A5ZA 3NX4A 4BO7A 2BMAA 4L75A 1B15A 2O2YA 5F1KA 3U4CA 4BV9A 4CV3A 1TB4A 1B26A 4B8WA 1O0SA 1UP7A 1X7GA 3DMTA 3KM0A 4AJ2A 1PZHA 1PQPA 2AA3A 5T6BA 4DC0A 1YDWA 4DL9A 2FZWA 1GFSA 3NT4A 4J0EA 2X7HA 1VL6A 4IM7A 1I3MA 1HDRA 1PL8A 2NV6A 2VQ3A 3PHJA 2PZLA 4GGOA 3ZWOA 4NU6A 3ICPA 4R4JA 4M49A 2LDXA 1RM3A 1WXDA 4F46A 2QX7A 4CQLB 4ID9A 5A5EA 1ZXBA 4U5QA 3ROQA 1BXKA 2EP5A 4NK5A 4BQRA 4Q9NA 2Q49A 2O2SA 1ZJZA 1NPTO 4B7XA 5HRUA 1EDOA 3UGKA 3JD3A 1E92A 1ZSYA 3DAGA 4XIYA 2WEKA 1PU2A 3GN1A 4DQXA 3OQ6A 3RC2A 1R12A 4CLXA 3WJAA 4BUCA 4A2CA 4DTIA 5CDSA 2YY7A 3LSYA 4Q3CA 1LQTA 2VYVA 4XCVA 1QXSA 1LLDA 3DAFA 4MP6A 2VWGA 2EG9A 3G17A 3CPSA 5FWNA 3QVXA 2VUSA 4O6VA 1ZUD1 1CQIA 3QRWA 3ZV5A 3M1AA 3EZLA 1IHYA 4DVJA 1DRVA 1ZK4A 2BGLA 4DREA 2ZCUA 3HWRA 3SBOA 3JQCA 2WM3A 3PEFA 1JVSA 5EJ2A 4YT2A 4NFHA 4FB5A 2FZEA 2VTDA 2X6TA 3OFSA 4FD3A 4R1NA 2GR9A 3CSDA 3FBGA 2BFPA 5DN9A 1F12A 3GGOA 4TZKA 3B1JA 1VM6A 1I32A 4YQYA 1NFQA 1LRKA 5A06A 4S1VA 4AJEA 1H6BA 1YOVB 5GZ6A 1SOWA 1ISGA 2YV3A 3MWDB 4MVJF 5FFFA 1MGOA 3I9OA 1N7GA 2I76A 2P4QA 4E30A 3RBVA 4TRMA 5KJ1A 3R1IA 1LEHA 2GLXA 3UCEA 5L95A 3INTA 2VT3A 1GEGA 2TMDA 1QYDA 1U1IA 5IZCA 3UXYA 3OJFA 4PVCA 1I36A 3E9MA 4YJFA 1F8FA 3RBXA 5HTOA 3LU1A 5BSGA 3GFBA 4MKXA 1H94A 5AXCA 1QV6A 3CXRA 5T67A 2PK3A 3K8ZA 4KZPA 3VDQA 4IXWA 3G3EA 4IJKA 4UUOA 1UXIA 2G1UA 4BMNA 3P2OA 4ZICA 1R37A 1GPJA 3PFFA 3OSUA 1PIWA 2GN4A 4YAGA 5G4LA 5L4SA 1UDBA 1I8TA 3IC5A 4CM6A 3DBRA 4BL5A 4M1QA 3OA0A 4B7CA 8LDHA 3CE6A 3I6QA 2CSUA 2AG8A 2PD6A 1I2CA 2IE0A 4MVJI 4N54A 4YACA 5DOZA 5GMOA 1QG6A 1QP8A 1BGVA 5TQVA 4GLOA 4CMKA 1I10A 4I5DA 1ZEMA 3BTSA 2VYNA 3T4XA 5TSDA 3DHNA 4U0JA 4GI2A 2JD1A 3PGJA 1NQOA 4Z3DA 4J0FA 3RIHA 1L7DA 2X9GA 3D4NA 4MKZA 1E3WB 1XCBA 2QZZA 2AQKA 5AXAA 3PLNA 1C3VA 3P5SA 3E03A 3GVHA 3PHIA 4J4BA 1B8UA 3VH1A 3ZWXA 1XELA 4DQVA 4TKLA 3WR5A 2PA3A 4OO3A 2ZB3A 1YL6A 1R6DA 1BTOA 4NBRA 3VPHA 3GNSA 1PZFA 2Z1NA 3KV3O 2V6BA 4Q3BA 3NDIA 1KEVA 3GMSA 3K5PA 3IKVA 3AM5A 4YBZA 1DC5A 1HWYA 4MPDA 1Z7BA 4RORA 1V0JA 2H6EA 3GAFA 3D64A 4QFDA 1E5QA 4RF4A 3AFNA 5ILOA 1FXSA 1Z7EA 2P9GA 3MCVA 4NDNE 3RFTA 4CMCA 1JU9A 3WB9A 3OEWA 4O1MA 4PFJA 4IQGA 3RBZA 3VZRA 3W8EA 5ICSA 1OFGA 3INGA 4I5EA 4EW6A 4KUEA 3WNVA 3OMLA 4JBGA 5BNIA 3JV7A 1QRRA 3OA2A 5DBGA 3WQQA 4IZIA 4BO8A 2I67A 1EQUA 2DBRA 2WYUA 3PQFA 3NTOA 5IZ4A 2I99A 4M86A 5A3VA 1T4BA 1NHWA 3WIDA 3JQ7A 4D0SA 3WYEA 1E7YA 2JJYA 5TT0A 5I7EA 5F5NA 2BELA 2CY0A 1MG0A 5I8WA 2OGUA 3K6JA 2O3UA 3ZHZA 4YTEA 3ZNQA 5BR7A 1LSOA 1RPNA 3PZRA 1W0CA 3WWYA 4MIYA 2WYWA 3KB6A 2EGGA 1D8AA 3ROMA 1NQ5A 4R3NA 4M55A 1K6JA 2VHWA 2HJSA 3ITKA 4C7KA 5LDGA 3DB2A 5GZ3A 1GUZA 7MDHA 1IPEA 2RIRA 4CMIA 1P31A 3V2HA 2GN6A 2FSVA 4CLHA 2R2GA 2X23A 1WDMA 5F3RA 3TOZA 1U4OA 3VH3A 4BO5A 3PYXA 3GY0A 3QVSA 4XA8A 4HWKA 5F21A 1E7WA 5CDYA 2OBYA 4IUYA 1U4SA 2PKQO 3RUAA 3IIEA 5EQFA 1GQ2A 1P1JA 3E9QA 3CZMA 2X58A 3PFWO 3JQAD 4JIGA 5BNFA 4BKOA 2RH8A 2W90A 3MJCA 1X1EA 3DZGA 2VHZA 1DOHA 2VTEA 1YO6A 1DJNA 2P4HX 4IIVA 3ZWAA 4L9RA 2Q1WA 3L6OO 3JYNA 4JGBA 4RQUA 3HB5X 2IEDA 4XJSA 3PP8A 5KCZA 4H7PA 4J4TA 3WWZA 3RC9A 2DTXA 2ZIZA 4GVXA 4L74A 1DIHA 4PZCA 4NHEA 1B14A 1KVRA 3SEFA 1VSVA 2EKQA 3N58A 1PJ4A 4XGIA 4CMJA 3H2ZA 5CEEA 4XGKA 3B70A 1LLUA 3DHYA 5IDYA 4PRKA 2VWQA 1QV7A 4BNIA 1P1RA 3D3WB 1PQUA 1N9GB 4L4SA 1ISJA 2DBQA 2GD1O 2J5QA 1RKXA 4ZHSA 1DBVO 3FCOA 1C0KA 1NVMB 1B0AA 3I9KA 4OM8A 2ZB4A 4YT5A 2Y1EA 4W4TA 4E21A 3FRJA 5JBIA 3WQSB 3OJEA 1BXGB 1M6HA 2Y1DA 4LW8A 3PWSA 2FR1A 1NASA 3U0BA 2D4AA 3DZHA 4PG6A 4CM8A 2ET6A 1QYVA 4IDCA 2NU7A 2HDHA 4M89A 2TMGA 3TF5A 1NBOA 1HYHA 3HN7A 5JXWA 1DFHA 1R0LA 1ZK3A 4GWGA 4DLAA 5L40A 3GMDA 3MEQA 3UN1A 4RLHA 1QLHA 1YKFA 4GPD1 3COSA 1XWFA 4OH1A 4P38A 1UJMA 4R1SA 1YGYA 4U7WA 1MG5A 2XAAA 3JYPA 4FGWA 3TNLA 2IXBA 3BXXA 3JD0A 4J9VA 3Q3CA 4TMFA 4HKTA 1YQXA 4M87A 3GT0A 3OIFA 4XYGA 5AQ1A 1WAMA 2NVWA 3L4SO 1NWCA 3UW3A 4E3ZA 1FDTA 2CZCA 3GUCA 1ZBQA 4CQMD 4NBUA 4FGSA 3H9QA 4YXFA 4L73A 4AJ4A 5JCXA 4LCEA 3GAZA 4D0RA 4JP3A 3VDRA 4MVJH 5ILGA 2HK7A 4XYMA 3UH1A 3HDJA 3FWNA 1AHHA 2C5AA 2PGJA 2ZJ1A 4UVEA 2C0CA 4TRNA 4PG5A 1CJCA 3DL2A 2GGSA 1EFLA 3D4PA 3GGGA 5L7YA 1R15A 2B36A 2QHXA 3CUKA 5JCJA 4R5HA 5I7VA 3JYQA 3IJRA 4E31A 4WLUA 3TZ6A 4Z0PA 4WUVA 1EQ2A 1WNTA 3HSKA 4I5GA 2CF6A 1B3BA 5DBFA 3CZRA 1V9LA 2X0IA 2DFDA 3D4OA 1ORRA 2EERA 3E5RA 4YYZA 2B35A 4IINA 4I1IA 4CMGA 3GGPA 3C8MA 1M6WA 1RM4A 2QRLA 3WBBA 4GWKA 1EBFA 2YQ4A 4I5FA 2IODA 3LT1A 5IDQA 3RD5A 3IQDB 1IY8A 3PQEA 2GO1A 3S55A 3G79A 2Y1GA 1M67A 1YB1A 4EUEA 2J6IA 1PR3A 1RYDA 4LSWA 3R3JA 3U49A 4JBHA 1PQWA 4ZD6A 1RJWA 1X14A 2ZYAA 1LA2A 1ADGA 3DR3A 3IKTA 3MWEB 4FSHA 4EI2A 1KETA 3B1FA 4FFMA 4BNHA 5C7IO 3JCZA 1I3KA 3IP1A 1Y8QB 4NU5A 4WLEA 2VWHA 1XDWA 3ZHXA 3EMKA 2Q2VA 1U7HA 4J90A 4A7PA 2ZK7A 5ER9A 3AY3A 5T8KA 5IDXA 1Q0LA 3VTFA 2RAFA 3L6DA 3SC6A 3JQ9A 4MOWA 1GPDG 3ENNA 3RC7A 3TL2A 2Q1UA 4DYVA 3LC2O 4P4LA 1Y5RA 5DP2A 1GAEO 4OL9A 4AJPA 1HDGO 4IXTA 4A0SA 1E3IA 2VUUA 4A26A 5BT9A 1JWAB 5JMPA 4MIOA 2J3HA 1ADBA 5EPOA 4NFSA 1B7GO 5CG2A 3FR8A 2AW5A 3RC1A 1HKUA 4BOYA 4YAIA 1PX0A 3HQ4O 4KUGA 1RYEA 2GN9A 5CG1A 4BGVA 1Z74A 5FI5A 4DUPA 3AOEC 1T4DA 1P74A 2J5KA 2JL1A 3OQ1A 1X1TA 2ZCVA 3GPDG 3FNFA 2B4QA 3FD8A 5L51A 4N18A 2I66A 4GKBA 4RVHA 1IB6A 4CR7A 2B4RO 5TJ9A 3HG7A 3W4IA 4CL8A 3L9WA 3JQ7B 4YAEA 3NJ8A 3H8VA 4YJGA 4OKIA 1K0UA 3F1KA 5CP8A 5G2OA 3H5AA 2ILTA 2OMEA 3EC7A 3GRKA 3W4KA 9LDBA 2QRJA 1MC4A 2VWPA 3OIDA 4XB1A 4RJTA 2GPTA 1U2DA 3KYCA 5THQA 3ETGA 3OJLA 4EDFA 4TKMA 4UAGA 4B4UA 5IJZA 3BHMA 1K3TA 2YHIB 3QSGA 3I5MA 1NTOA 4BKRA 3ZI0A 1ZVMA 3BTUA 1LDYA 3NV9A 3DHEA 1EMDA 1O8CA 4QEDA 3ROKA 5HM8A 3M1LA 4NPCA 4DC1A 1SEPA 5EESA 5CEJA 1ISIA 3DBHB 1VC2A 1I24A 2FWMX 2NM0A 3E6AA 4EBFA 2CVZA 4ZU3A 3I23A 3I52A 1Q7CA 1XQ1A 4D43A 1J0XO 5EERA 2I65A 3GA0A 4CLRB 3A1NA 5ITWA 3VZPA 2B83A 3MJ4A 1C14A 3BIOA 4R69A 2AEJA 2DM6A 2H1SA 4R1TA 2HCTA 4NMHA 4LGVA 1ULSA 3P7MA 3GQVA 1ENZA 3RKUA 3WOHA 1GCUA 2WWRA 2VN8A 4A03A 1MFPA 1MFZA 3BYZA 4R01A 1PJ2A 3LC7O 1AXGA 1W4ZA 5H82A 2FHSA 3RU9A 2B4TO 5JC8A 4MO2A 3FHLA 1O9BA 1LC3A 1YXMA 2VHVA 1V35A 2WYVA 3DFZA 4AJNA 4N5MA 3NT2A 1P44A 1IUKA 4IDDA 4QTZA 4QO7A 1TEHA 4YRBA 2Y0DA 2OXIA 1BRMA 1HXHA 3R3SA 3WGIA 4EEZA 4GX2A 2EXXA 2BI8A 3JQFA 3KZVA 5DCWA 2C82A 3O03A 4WK6A 5DT9A 3Q11A 2PV7A 3CIFA 1PJQA 3WGTA 2BFAA 5ES3A 1ADCA 3F5QA 2PWZA 2OP1A 4Y6RA 3DONA 2XXJA 4OJNA 4BIIA 5I7SA 4FC6A 3DBHA 1JAXA 3HNPA 1DXYA 4KOAA 4LVUA 4FFLA 3F5SA 5ENDA 2P9EA 4A10A 4P22A 5CPFA 5EQDA 1L7EA 2I3AA 3F4BA 3LLVA 5DBIA 3WGQA 3NGLA 4FJ1A 4AJ1A 3D5TA 3ONFA 2HJRA 4G2NA 3LF1A 4NJOA 5JYDA 3QP9A 3E9NA 4ESOA 1WZIA 4UUMA 1VLLA 2Q1TA 4ZRNA 1R16A 1PZEA 4XX0A 2CDAA 3Q2IA 3VPSA 1Y7TA 4DYDA 1YQDA 4UVGA 3EYWA 3I6IA 1YRLA 1P1HA 3MJEA 4L0QA 2ZATA 1EUCA 3K96A 3QA9A 4RL6A 3V5NA 3ZWVA 2IZ0A 3NTQA 4J1NA 5EN4A 2CVQA 4R51A 2BGMA 4MVJP 1VRWA 1YBMA 3AW9A 4E33A 1YBVA 3ZNOA 1ZKMA 1E1NA 1PJCA 2VYVD 1C1XB 1JKFA 4KQWA 4WCDA 3VAZA 4Y8VA 3AOGA 2Q4EA 2UVDA 3FTNA 5A5FA 1LNQA 3WIEA 4ALNA 2O3JA 3IAHA 3UKOA 4BGEA 1T2FA 3PJDA 2E37A 4HNHA 4BNVA 1H2HA 4PLFA 2NTNA 4Z3KA 1B3RA 4BNNA 4E2WA 3DZJA 2RBEA 1ZEJA 3ZV4A 5G0UA 4GBJA 4WKGA 5A9SA 2HMVA 3HDQA 1J4AA 2CFCA 3TWOA 3HHPA 2AQIA 4GMGA 3DZBA 2E48A 3ZU4A 3GVXA 2O48X 3IJPA 5IF3A 5DP1A 1SBYA 2JFHA 4X54A 2D1YA 3MJVA 5JAMA 4CM8B 4WASA 3I9JA 4HBGA 4PLHA 3CINA 3RASA 4NG5A 3C7DB 1E0DA 4G65A 3UFXA 2I5PO 4ND3A 2EHDA 2EW8A 1BXGA 1U2GA 5IDWA 4FJ2A 3M2PA 5EMHA 1ZK2A 4E5KA 2ZYGA 1ZMTA 3JYOA 5LDHA 5TC4A 4W82A 1A7KA 1GL3A 3EY4A 3ETEA 1MV8A 4IJVA 3HN2A 4RPKA 1Z75A 3K73O 1GQYA 1PZGA 1Z73A 4OYRA 3DWFA 3ZZNA 2Q2WA 3A9WA 3QW2A 4DBVO 1E1KA 1BW9A 1JN0A 3A28A 4CM1A 1EFKA 2FR0A 1QYXA 3KOUA 2WD7B 3QVOA 5KJEA 3RI3A 3LZ6A 2POQX 1PJSA 1UP4A 4KUHA 3UF0A 1UUFA 3F46A 1IHXA 3KHUA 2X9VA 4FQ8A 3GDGA 2YYYA 4MP8A 5A05A 2QIOA 4R3WA 3S2EA 1H2BA 4Y67A 3OM9A 1R4MA 1BVRA 3QE3A 1WP4A 3W1VA 3PDJA 5BSFA 4IMRA 4XQ9A 3WLEA 2FPGA 3PJFA 4D41A 4QX6A 5U4QA 5IAAA 1ONPA 2HRBA 3ULKA 3GG9A 1Q1NA 4IMPA 1VSUA 4CL3A 2HKIA 1ZO8A 1DFGA 4CM9D 2D5AA 2CDCA 2OBNA 4BS9A 1QYWA 4D3DA 3GF4A 3DC2A 1W73A 3U3XA 4II2A 4RGBA 2W2LD 4LN1A 5T57A 1AGNA 2DTEA 5A9SB 1XU9A 1N1EA 4LCJA 1DAPA 2O3QA 2X0NA 3L6EA 2EV9A 5TT1A 3CEAA 3FR7A 1HDYA 2ZJ0A 3IP3A 3F4LA 4IDFA 4QSMA 3FTPA 4FN4A 4FJ0A 4H16A 1EVIA 3ZGYA 5J23A 3W8FA 3ZDFA 1DC4A 2VRCA 1O89A 1KVUA 1SEVA 1XA0A 2W2KA 2W98A 5CHEA 3KEQA 1Q0HA 3RQSA 4AJIA 5IZCC 1EE2A 5BNTA 3UICA 1DIBA 2J8ZA 4J7UA 3STHA 4BNLA 3Q1LA 4D7AA 3PIIA 2PR2A 1XR3A 4HFJA 1VE9A 1YVEI 3RCBA 4I08A 3VKUA 4BO6A 3AI3A 2JCXA 3C24A 4MINA 4RCVA 2UDPA 4RLSA 3I4CA 3D0OA 4E4YA 3KSDO 1H5QA 2NVUA 2FSSA 1E7RA 1D7OA 4RQTA 3KYDB 3ZWYA 3GRPA 3H5NA 1LDBA 3ITDA 3FBTA 4BNGA 1I5RA 1FK8A 3DO5A 1LXCA 4RF5A 4ZQGA 4XZ3A 3QY9A 3NGXA 3DEYX 3O9ZA 5C7OO 2Y1OA 4BNMA 4YPOA 4FFPA 1ISFA 3TDKA 1XSEA 4YAJA 2JD2A 3TPCA 2VHYA 4KWHA 4URFA 4XQCA 1KBZA 4PLYA 4RO0A 1LBEA 1QMGA 3OIGA 2PKRA 4PG4A 3UVEA 3UOGA 3SLKA 3L77A 1EVYA 2P2SA 1KOLA 4A5OA 4BMSA 2O4UX 2WE7A 4E32A 3VTZA 1ONNA 3UCXA 4LMPA 1IPFA 4OQZA 3H4VA 5TS3A 2UYYA 5FI3A 4IJWA 3WGOA 4C7JA 3V1YA 4P4NA 1Y8RA 2X5OA 5JS6A 1WPQA 1C0PA 4AL4A 4RV9A 3KSZO 3HFGA 1Y81A 1RWBA 1Y1PA 3DTYA 1E3EA 4RZIA 2DBVO 1TI7A 2IEBA 2IDZA 5MGBA 3BAZA 3K31A 4G5HA 1LX6A 1OMOA 1YL5A 2VHXA 3V1UA 3BZUA 3QWIA 3NRCA 2OHXA 2W2LA 3O4RA 4IZHA 4TWRA 4XRRA 4RVUA 1PWZA 3JYLA 1ML3A 2YW9A 4BKPA 4WCFB 4BNFA 3AUTA 2BKAA 3NTRA 5A9TA 1EEHA 3SXPA 1ZSVA 5JFOA 2YDYA 1YWGO 2CDBA 3B6ZA 2Q99A 4KQXA 4B4VA 4IDBA 2BF7A 5C7LO 4J3FA 2FN7A 3KYBA 1PJTA 1V6AA 4WGGA 4IQ8A 2J3IA 4BO9A 2V7PA 4PVDA 2DAPA 2QYTA 2JAHA 3C3XA 1K2WA 1H6CA 4WLFA 3EHEA 5THKA 3SJ7A 1DRUA 3JQGB 5AXDA 3EW7A 3H3JA 3OECA 2Z5LA 1I33A 2X8LA 3RSHA 4Q3EA 4U6SA 1YL7A 3ADOA 4P4GA 4CLRA 4KP7A 3S8MA 3QVWA 1Q2XA 3WYCA 2EW2A 1F06A 3U09A 4B8ZA 4FOOA 5KVQA 5JO0A 1GDHA 4FC7A 1FDSA 2BHLA 4IPTA 2GZ3A 3OEYA 4QXMA 5TX7A 3UCFA 2AXQA 4II3A 3CKYA 3O38A 2DU8A 3H9JA 2PZJA 2YV1A 1OAAA 3TZHA 3GZ4A 4E5PA 1SCUA 2B37A 5COQA 5BQFA 4TRJA 1YB4A 4OXYA 3V1TC 1DIGA 2VZ0A 4GMFA 1SNYA 1TLTA 1UZNA 3GEDA 1DJQA 4WNCA 3W6UA 1WW8A 4XR9A 1OZAA 3SLGA 2GYYA 3DBVO 3H3FA 4DLLA 2X5KO 4CR6A 1M66A 2VOEA 2HAEA 2NU6A 5I9MA 2NTJA 3ZHBA 4R9SA 2PH3A 2C7GA 2DC1A 1ENYA 2IXAA 2PH5A 4GSLA 4LK3A 4B4OA 4CMIB 1DDOA 2RH4A 1NP3A 2ZQZA 1BMDA 3BA1A 2QZ9A 5L7TA 1VJ1A 3OJOA 5GZ1A 1VJTA 9LDTA 4GLLA 3DQPA 1DC3A 1KERA 1G6KA 4CQMB 5IN4A 3P19A 4XYEA 3SJUA 2HSDA 2PY6A 4B3IA 1HT0A 2FPPA 3BMQA 4N5NA 4AFNA 3GPIA 3TQHA 1F14A 1UXJA 3INRA 4CM7A 3GUYA 1I2ZA 2EGHA 1D3AA 4Z0HO 3OHSX 3PI7A 1YJ8A 2CD9A 3Q9UA 2AG5A 2I9PA 3I9NA 3ICCA 4OKNA 3Q6IA 4DPMA 1Y9EA 1GQQA 4NJMB 5L7WA 1IYZA 2JHGA 1I0ZA 4HUJA 5HWSA 3S1LA 1VL0A 2X1HA 2Z1MA 4A27A 3TJRA 2R6JA 1MX3A 1AE1A 2B0JA 4MIEA 3HE3A 1LRJA 3ZWPA 1DAOA 1LTHR 1GZ3A 3LQFA 3QJ5A 4J49A 5CDUA 4LRTB 3ANLA 3C1TA 3UAGA 3V2UA 1H93A 3H6KA 1ZSNA 4YA6A 1C1DA 1HDXA 1BSVA 1NWHA 4L8VA 2Y0EA 4J4HA 2V6GA 5IFLA 4ND5A 1P0CA 4NBVA 1UP6A 4O63O 5DCYA 1M2WA 3VVCA 4EJMA 4EEXA 3VC7A 3R0IA 1ARZA 3W6ZA 5MDHA 3MTGA 3VPFA 2A92A 4YVFA 1U3VA 2P91A 1BW9B 3AUAA 1DEHA 4KTVE 4CLEA 1MXFA 1G0OA 2AE2A 2IZ1A 3W8DA 3KTDA 3JQ8B 3WGGA 5DULA 1P9LA 4TRRA 3EGOA 5K0ZA 4FFRA 1PTJA 4WLNA 3KVOA 1HE5A 1P77A 5IN5A 1U3UA 4ZGWA 3I83A 4BV8A 1MUUA 2NUAA 1ZCJA 1DLJA 4RVGA 1CQJA 1LJ8A 5KKAA 4YJDA 2VT2A 1NXQA 3MJTA 4J2OA 4JQCA 4WCFC 3UUWA 1U7TA 1U3TA 3WTCA 5JC1A 4MVJD 3PIDA 1NQTA 5JDCC 4O5OA 3U4IA 1EBUA 1E3SA 1P1KA 1WDKA 2OUIA 5U9CA 4J1TA 4DIOA 1BWSA 1NPDA 3OICA 3Q0EA 3TOXA 1TXGA 2A4KA 2Y1CA 4OGWA 5JYEA 4WLVA 3AUSA 4RPLA 1KVTA 4IBOA 4JX8A 1NM5A 4BMVA 4FR5A 4CQMA 1X7HA 4FOSA 2G82A 2GF2A 3H9UA 5FEUA 1F8GA 1PJBA 1R4NA 2V65A 4GH5A 1E3LA 3JQFC 2GRAA 4R41A 4WOKA 1YJQA 4WEOA 5B1YA 1NR7A 2EWMA 2QQ5A 3DDNA 5B4TA 1Z82A 3QVTA 1MB4A 4WECA 3WS7A 1GUFA 4F6CA 4Y9DA 4NI5A 4E2XA 5IG2A 1JA9A 5JY1A 1CWUA 1C1XA 3NDRA 1CIVA 4YB8A 1JLLA 3TFQA 4GX1A 1C0LA 2BRUA 4Y98A 1NHGA 3VH4A 4XIJA 4ILKA 3K9QO 3DZKA 2ZYDA 2ZKLA 4Z0TA 4NNJA 3GZNA 1LSJA 1YQGA 4IS3A 5DDIP 1V3VA 2C07A 5JAQA 4CQLA 3C85A 3N7UA 4PCVA 4F6LA 1M76A 1Q7BA 3I9MA 4TROA 4BGUA 4YDRA 3MZ0A 3QV1A 4EJ0A 5EL0A 4JJGA 4I8XA 3JQ9C 4WEQA 3FF4A 5F1OA 1EK5A 3DFUA 1XG5A 4NJMA 3TZCA 1HE4A 4MVJE 1DHRA 4OOEA 3PGXA 2P68A 4E0BA 2AQHA 3WG9A 2D3TA 4DIFA 3DTTA 2W8ZA 3VVBA 1ZMOA 1HDZA 3AFMA 2NNLD 3KO8A 4CM4B 3H5RA 1PR9A 2GNAA 2X4GA 1MP0A 3RUEA 4MVJG 1PS0A 1S6YA 2A94A 1ID1A 4NBTA 4N7RA 4NFYA 4XEHA 2F00A 1O94A 2C54A 1HSZA 1NYTA 3BMNA 1BG6A 3WLFA 1V3UA 1BDMA 2YZ7A 5KOIA 4R54A 1GV1A 2D2IA 3VOSA 3ZNPA 1PGJA 3DOJA 4XQEA 5C5IA 1I30A 1P3DA 5I9LA 4Z9FA 3EDMA 4BB5A 4R68A 2YFHA 5TLSA 1T2DA 2H5LA 2YJZA 1O95A 3KXDA 5KWEA 1XU7A 1KVQA 1KVSA 4OSPA 4G81A 2ZTVA 1GY8A 4I9UA 4OIMA 1X13A 4JXKA 2B5WA 1LDMA 3L4BA 5U1PA 5I9NA 2G76A 1CRWG 1Q0QA 1Y8RB 1T24A 4PZEA 1HTBA 1NX6A 2OFPA 3TZKA 4CM4A 4XD2A 3PZBA 2E82A 5DCUA 4GX5A 1HL3A 1JKJA 4PIVA 2P5YA 5T64A 3GOHA 4K9DA 3ZN2A 1I3LA 2V6MA 4H15A 1N2SA 6LDHA 2UUPA 1JAYA 3RVDA 2DUWA 4LSMA 3JQBA 1A7AA 3KBOA 1TA4A 4OXKA 3QWHA 5G0WA 2D8AA 3L0DA 3K2EA 4QECA 4CLOA 1N7HA 3GHYA 3KYCB 3K2BA 1E7SA 1HYGA 4RPHA 4EZBA 1MLDA 3JQAB 3L07A 2NWQA 2JCVA 4ROSA 5GY7A 4B4WA 4EYEA 2EIHA 3RAJA 4OSOA 3MOIA 4YJGB 4DBZA 4GX0A 4EUFA 2A35A 3AJRA 1E5LA 3NUGA 5ICMA 4KDFA 4XYBA 1LC0A 2GN8A 3JD2A 5LCXA 2R00C 1Y6JA 1HZZA 3GDFA 5A04A 4HFMA 1SOVA 4FFNA 2CMDA 3NKLA 4WPGA 2OZPA 4E5YA 2D0IA 1K6XA 2OP0A 4UVDA 4I9HA 2ZB7A 3RUDA 3ZV6A 3ZNNA 4D3FA 2CNBA 1GADO 1UDAA 4NBWA 4YR9A 3NEPX 2IYOA 4BVAA 3ZCXA 1GYQA 5F5LA 1OBFO 3ABIA 3Q2KA 4JROA 1DPGA 4AJLA 4BGIA 1E3WA 4HX5A 4UVIA 1LSSA 4E5MA 3ZWCA 1T2EA 1DIAA 3DMYA 5KNLA 1FF9A 1JW9B 1P1FA 1WMAA 2VNSA 4HV4A 4L4RA 1TT5B 4JBIA 3U4HA 4BNWA 2HK9A 3FPLA 1Z6ZA 1G1AA 1YS4A 3U5TA 1YONA 2Y0CA 5HS6A 4AJJA 2VYND 5ER6A 1B2LA 2ZTLA 2SCUA 5B12A 4HXYA 4ZQFA 4K28A 4I9NA 4XR4A 1BHSA 4XRGA 1R66A 3A14A 4UULA 2P9CA 4Y6PA 4Q39A 1DB3A 4FBGA 2NSDA 1UZMA 3DMTC 3GHHA 4W7IA 4E13A 2B69A 5L4NA 1K5HA 2FOIA 1ZJYA 3BTVA 4BNJA 1T25A 5B37A 1CERA 3DAPA 3FSRA 3JSAA 3JQ8A 2C2YA 1J5PA 3RJ9A 4CMEA 3FNHA 2WD7A 5HA5A 3AU8A 4BNXA 4M8SA 1PGPA 3LT0A 5CAEA 3G0OA 3EVNA 2DT5A 4PLZA 3WMXA 1VPDA 2GZ2A 3CTMA 3T7EA 1UH5A 1ADFA 1JKIA 3ANNA 1NNUA 1MXHA 1WZEA 1JVBA 3AK4A 3IS3A 5T8KC 3RROA 3S2IA 4AG3A 5KVVA 1KY5A 1ONOA 3OETA 1R4NB 3EZYA 4L76A 4BNTA 3ADPA 3ZWMA 4R9RA 2PNFA 1EUZA 3D1LA 3IUSA 3GFGA 2HO5A 1NAIA 5C37A 3CMMA 5JAZA 2FRDA 3T7CA 1NFFA 4GVLA 5EIOA 3ZU5A 2WTBA 1LDGA 2H9IA 4U0KA 5JO9A 5ENVA 1O6ZA 1VKOA 1U5AA 1QKIA 1U5CA 4Y6SA 4BNKA 4IDGA 5IXSA 5H81A 5TJHA 1HDOA 2HK8A 1SAYA 5CEFA 4PLWA 1TT7A 2FP4A 2GZ1A 3P2YA 2HU2A 1KEUA 3O26A 4MVJM 1VI2A 4BB6A 1PL6A 1HLDA 2RCYA 4DMMA 3IMFA 3FN4A 3AM4A 1E77A 4E12A 3HZZA 1WMBA 2Y1FA 4RPGA 4PGFA 3ZU2A 4IS2A 4NK4A 3RFVA 3LVFO 3ZW8A 5H83A 5LC1A 4CM5A 1QYCA 3IL2A 4JP2A 4Z6KA 2X22A 2FR8A 3DZIA 3E18A 3EUWA 2EF1A 1ZK1A 2D59A 4YJFB 4RDHA 4J6FA 1CDOA 3ROPA 2Q45A 3G1TA 4CMHA 1E6UA 2B5VA 2DPHA 1H6DA 1PJ3A 2HMUA 1GZ4A 4Z9XA 1ZXLA 1GU7A 4CV1A 8ADHA 2HRZA 1HRDA 4LISA 1FDVA 2I6TA 5CDTA 1Z45A 4CM9A 5JSFA 1X7DA 2QW8A 1ZK0A 2GUGA 1HEUA 3ON5A 3NDJA 4FIZA 5L3ZA 4CM3A 1DLIA 3PJGA 1XEAA 2XXBA 3ENKA 3VH2A 3D3EA 4EJ6A 1M75A 3H2SA 3WBFA 3V8BA 4N5LA 1YH3A 1ZIDA 3RFXA 3OBBA 3FI9A 5A9RA 5G0VA 4ZQBA 2JD0A 1KEPA 1YDEA 1GYPA 3ONEA 4K26A 3ASVA 1XYGA 3GNTA 1O5IA 4D3SA 4AICA 2VUTA 3L9XA 1UXGA 1OC2A 2AE1A 1PGOA 3JTMA 1TT5A 1ISMA 5I8ZA 3BMQB 1D1TA 3PRJA 4YWJA 1P0FA 1KC3A 4INAA 2AMFA 1HYEA 2C29D 3RUCA 3GVIA 5AXBA 3A06A 3PYMA 2D5CA 4WLOA 3HDHA 1E3JA 3KSUA 1GCOA 2NLOA 4LRSB 1P1IA 4BO1A 4LVCA 3E1KA 2P5UA 3PJEA 1DSSG 4TZTA 1JTVA 5DZSA 2XF8A 1A9ZA 1IOLA 4D44A 4TVOA 4FPXA 1QORA 1A4IA 4NH4A 2BD0A 4GSKA 5FF9A 3DZFA 2UAGA 2DKNA 3F47A 4R1UA 4ZVVA 5I7FA 1KC1A 3PWKA 2BFOA 4BO3A 3PLRA 2VCYA 2PTGA 4ZJUA 3ZH2A 1F0YA 3W4JA 2I3GA 2NVBA 1U28A 3BMNB 1HSOA 3ST7A 5A1TA 5A4DA 5T5QA 3QLJA 3WSWA 4PLPA 5FYDA 3BMOA 1LDNA 1PS8A 1MA0A 4F45A 4E2ZA 1S7CA 3VKVA 1OC4A 3ORFA 3E82A 4OXNA 3M2TA 3HB4X 2PD4A 3PYLA 4CMAA 4ALMA 4D79A 1SB8A 1SO8A 4CMEC 3WJ7A 4FW8A 3GNQA 2HMTA 2JHFA 2BLLA 3B20A 3GG2A 4ZRMA 1SZJG 4PLCA 4BNYA 5JPIA 3K30A 4HADA 3JQDA 1EVJA 4E2YA 1T1SA 2RHCA 4ZQHA 4RZHA 2X0RA 1NVGA 2HMWA 4Q3NA 3OJ0A 3V2GA 1AXEA 3GVCA 4MP3A 3KLPX 1PSDA 5G4KB 5JMWA 2ZTUA 3PHGA 5CPBA 2FY8A 3KYDA 3KEOA 4W99A 4ALKA 1EE9A 3WTBA 2YHUA 3BMOB 4FDAA 4QUKA 3JQBC 4QQRA 4U8GA 1B8PA 1EK6A 1GUYA 1N1GA 1UXKA 4PRLA 5K6AC 4ONEA 3QWFA 2Q1SA 1SB9A 3F1LA 1ZW1A 4J7CA 1MC5A 2VRBA 4GKVA 1UDCA 1HE2A 2WJPA 1G0NA 3WICA 1HF3A 4ALJA 4ZN6A 4DXHA 1B16A 1FJHA 2O3RA 3WDSA 3MJSA 3AI1A 1XIVA 4ITUA 3S2GA 4TSKA 4EUHA 5BSEA 3AU9A 1GEEA 1NFRA 2NU8A 4B7UA 3WFJA 3HDYA 1BDBA 1KYQA 1UAGA 3ONDA 3BMCB 3LT4A 4BKQA 1RM0A 3C7CB 2BGKA 2RHRA 2PFGA 3KUXA 1CEQA 3DOOA 1LUAA 3D5QA 4RVFA 2WSBA 3KETA 3X2EA 4PLVA 2X5JO 2UUOA 3PDUA 4JNKA 1GZ6A 1V8BA 3RUIA 4CV0A 3ASUA 4HY3A 4XJTA 1T1RA 3OH8A 2EKLA 4TQGA 3ETDA 1LLQA 5L9AA 2YDXA 3OQBA 4HNGA 2DPGA 3JQAA 1QR6A 2Q50A 3QWAA 3SVTA 1R0SA 4ALLA 1IE3A 4LMRA 4DRYA 1KY4A 1A71A 3NYWA 5G4KA 4XYLA 4JK3A 3VZQA 2YUTA 1R4MB 4XDZA 1E6WA 1HE3A 1YBAA 4J43A 4MKRA 4MJLA 4DGSA 4YJHA 2EP7A 4JJIA 1ENPA 1U8XX 3GK3A 3U62A 2PLAA 2Y05A 3I3OA 4YT8A 5KVSA 1A4UA 5ADHA 4RVDA 2NQTA 4Z9YA 5EINA 2J3KA 2LDBA 4YEDA 2O50A 1ENOA 4HFRA 4CMBA 2XOXA 2W2KB 3I9LA 3EVTA 4PZDA 1VL8A 3WGHA 3Q9NA 4CV2A 1H9AA 4QFCA 4OMUA 4NIMA 4CJXA 1AHIA 1N92A 1SC6A 2JCYA 1WVGA 3U9LA 3ZWNA 5C3MA 2HQ1A 5DF1A 4D42A 2YFQA 1YB5A 5IXYA 3TSCA 3VPXA 1ZNQO 1P45A 3PXXA 1NAHA 3TL3A 1DHTA 1YOVA 4J1SA 3TN7A 5TIIA 1W8DA 4IDEA 3GR6A 3VPGA 3VZSA 3ZWWA 4YRAA 3IOYA 4Q3DA 4J16A 3G49A 2WDZA 1LLCA 1P33A 4DPKA 1W6UA 5L53A 1T2CA 1ISHA 5JLAA 3H9GA 4NQZA 2WE8A 5JW6A 2E6UX 3TRIA 3CMCO 1UAYA 4H3VA 2HUNA 1PWXA 1PS9A 2A9FA 2EEZA 2DFVA 2IZZA 2JFGA 1VJ0A 1QLJA 4J1QA 3MTJA 2F1KA 1GR0A 1U3WA 3AY6A 1E7QA 4DQUA 3HADA 5TF4A 5KJ6A 3CH6A 4BNUA 2C59A 4ZQEA 1PL7A 1A9YA 1PGQA 2EJVA 3HJAA 2GDZA 2X0JA 4W9NA 3WGZA 2C7VA 3PPIA 4ZA2A 4PG7A 2J5RA 1WWKA 3I4FA 3PWZA 5G0SA 3HUDA 5JAIA 2VZ9A 1NPYA 4FS3A 4UEJA 1PEDA 4B3JA 3BHIA 1RM5A 1XLTA 1PGNA 4O0LA 2JKVA 4XB2A 4CODB 2X9NA 5AOVA 1B8VA 1FDUA 4K6FA 2PD3A 4R16A 2QG4A 3PVZA 2QYSA 2AQ8A 4WE3A 4KWIA 3JQEA 2Y66A 1LSUA 1XHLA 1BVUA 4BO2A 1N5DA 1ZFNA 3JD4A 4FFOA 1UXHA 3VHRA 3WFIA 1CF2O 4ALIA 5JDIC 1L1FA 2H63A 5CFZA 4J7XA 2CF5A 2HLPA 4HP8A 4CUJA 1C1DB 4BO4A 1HZJA 2Q3EA 4GAEA 1UR5A 4NR0A 3LK7A 4DWVA 3FNEA 4QT0A 4W6ZA 1H9BA 1ULUA 2VZ8A 5TRTA 2G0TA 5B4VA 1GTMA 3E48A 3LYLA 4IY1A 1DFIA 1GV0A 2DLDA 2OORA 1H0KA 3GDOA 1R0KA 1LI4A 1UZLA 5COAA 2GERA 1FMCA 3RU7A 2NTVA 2PKQP 1FDWA 3GLQA 4PLTA 1Q7GA 2QRKA 2EKPA 3B1KA 4XWYA 4YQZA 2CUKA 3NAQA 2DUUA 4S3MA 4E6PA 4UUNA 1T2AA 3FWZA 3NJ4A 4JLWA 2DVMA 1EUDA 3H7AA 4GGPA 1LU9A 1U8FO 1XGKA 3E8XA 3LT2A 4OHUA 4K1LA 5KTKA 1PJLA 4XQGA 3GC6A 5A3JA 2E49A 3ZW9A 3RWBA 1AN9A 2PGDA 4RDIA 1EZ4A 1XQ6A 3O8QB 4K6CA 2PZKA 3WYBA 5AYVA 1E1LA 3WSVA 3BTOA 3WQRA 5HBRA 3F6YA 5DOVA 4GQAA 4WCFA 1DO8A 4W7HA 1F17A 3AY7A 6ADHA 3M6IA 4C4OA 1I01A 4R5MA 4CPDA 2V6FA 3QWBA 3R6DA 2CVOA 1AUPA 4W9NC 3LDHA 4AVYA 2WMDA 4M54A 2C2XA 2G5CA 4IGEA 3WMWA 1D1SA 2E4AA 4KDEA
chains in the Genus database with same CATH superfamily
5LQSA 2GZHA 1AK1A 1NY5A 1WUTA 3IEXA 3HBLA 1QGYA 1NQUA 1N8KA 3ECAA 1Q50A 4C4SA 3WJ1A 1QAMA 3F3YA 4B32A 4DSNA 4ZYVA 5AHWA 5JH7A 2HY7A 1KEWA 1EVZA 3H9EO 3N8IA 3THSA 5AW2A 4QARA 3D6JA 4QZVA 3LT5A 1FY2A 2FPRA 3HRHA 2QUZA 4I7EA 4MUFA 4BZPA 1M6VB 3BFJA 4N0DA 3SOPA 3ZV3A 2BTEA 2HSEA 4HQRA 1ZG3A 2XMSA 5ITVA 5C1PA 2F9LA 3SJZA 3WKEA 4NS1A 4BVHA 2QNRA 4LBWA 4TMYA 3IDSA 3PHLA 4Q66C 2GLUA 2CK3D 2XB2A 3U3ZA 4RJIA 4B79A 3FTQA 2WHYA 3A4VA 3OLZA 3DFKA 3WLQA 2FB9A 4B46A 3O4IA 4UD2A 2DZDA 1RKBA 3DL7A 3GCWA 4RF2A 4X84A 3AVYA 4AW9A 1NC3A 2HRRA 2GJKA 3DVSX 3I01A 1ZMRA 2FPIA 2OZKA 3WE7A 3H2BA 4IYRA 3N0WA 4LI3X 3H9BA 4DCGA 2C5EA 7MHTA 2AUNA 2NTYC 5DBHX 1E6EA 2X13A 4P0PB 5DTMA 5J4KA 2AI3A 3S81A 2HZ7A 4N9WA 4PS0A 3LF2A 3JD1A 2MT9A 2PRYA 3IUPA 3MCTA 1M8GA 2XOEA 4REQA 4BKUA 2WWWA 1T8SA 2QXYA 4EB8A 5CCBA 3KRTA 2IYPA 4QUDA 1RHMA 3O83A 5KKAA 3G0HA 1QOQB 3RGGA 1MRNA 1SPXA 1E1CB 5GV7A 4EHIA 2PU5A 2ZVQX 3P0IA 5LOVA 1JJFA 1C5KA 1KS9A 3QNWA 4J91A 4YJ3A 3H65A 2CKDA 5TNXA 2W8BA 4B80A 1T26A 2R00A 3LK6A 3PTZA 3E2MA 3W7VA 4CGZA 4PN3A 5K6AA 3AEUA 1NE7A 3S1AA 3FLAA 2XE8A 2VP9A 1JLKA 3KOXA 3O8NA 4ND2A 5E6RA 4BX3A 3T15A 5K8UA 2BYTA 4D8YA 4CDMA 3GLFE 2OHFA 3NRJA 1KIFA 2BFBA 1NURA 1J6UA 3HSYA 3UV3A 1LQUA 1I9GA 1JU4A 1J70A 1QGUA 2FLWA 3BMCA 3MRVA 4RKQA 4DA9A 1KR2A 1N2BA 1XZQA 4HO1X 2J41A 1O97C 3N3BC 4QU0A 5LBIA 5ICGA 1OVGA 2R65A 1PYGA 2OD9A 5JYCA 3GEMA 1LW7A 3GJ3A 4BNZA 5A03A 2G9RA 3ELBA 3T3PB 3MAGA 1N32B 2OV2A 4FYPA 4NDZA 2PLFA 4QBTA 4YROA 4DPLA 1Z56C 1NQXA 1OFUA 1LJUA 2W2OA 1R00A 1DIRA 4Y0VA 5CM2Z 5EUCA 4UEOA 4YRSA 3ZEAA 1KORA 3COYA 4IF6A 3HJFA 2LUOA 2P2GA 3DOCA 3WRXA 4ER7A 4AY6A 1CQXA 4F8YA 2PJUA 2JJ1A 1CZHA 2JVJA 2P2CA 2BPOA 2DBZA 2EJWA 3EZFA 3PA6A 4ZVSA 3VR6D 3FNGA 4MTLA 4DAEA 2Y68A 4DQDA 1CY6A 3GLKA 4IDAA 1GXSB 1AGRA 1CP2A 1EGAA 1GPYA 4S2EA 3GEIA 5LZ5A 4EHHA 3KLMX 4W5RA 3GEGA 4P8RA 5LMZA 2NNWB 4P34A 1GCGA 2NW6A 3L6BA 1AZWA 3NIFB 4AYWA 1K6IA 4EATA 1RHUA 1QSGA 1XL0A 1YA8A 1DC6A 2HPAA 4QPZA 2BJWA 2FRVA 2DSNA 1NQAO 2W4QA 3AF1A 5J5VA 1X0XA 2OKGA 1JEYB 1DU4A 2QGZA 3QGMA 1CZUA 2Z8XA 4AJHA 4PBTA 2C31A 2J9FB 3HL0A 3RSSA 7ADHA 3GZNB 2CNKA 4O2AB 4RY9A 5F2EA 3W2TA 4ARUA 3FGNA 1R0BA 4JB3A 1FC0A 2B8TA 1MX5A 3A25A 3ILXA 1MIHA 3DEZA 3DNPA 3K9HA 1S96A 1P9OA 2PKWA 3E0XA 4DIBA 4C0AC 2FLVA 2XPCA 1LTKA 1I7DA 3IIKA 3OKPA 3DXFA 1K88A 4HK4A 4MVJA 4OAQA 2Z95A 1ZM4A 4JJFA 1JDJA 2AN9A 4M83A 5EJIA 4DUZB 1KTIA 2Y67A 2Y0PA 3KZNA 2JGLA 4BGEA 1UKVY 1Z47A 1KWKA 4J0HA 2YZMA 1E9CA 2V7GA 3A4TA 1CETA 3WIOA 4W5NA 2GCGA 4M9SA 5K9ZA 2HIHA 2IPLA 3D6UA 5GJBA 1U0BB 1ZIXA 2WJHA 2V98A 2WWXA 2QAJA 4XFDA 1UBCA 1B2RA 2ATCA 3SK0A 4CKCA 5IKOA 4YONB 4RK0A 3TIXB 6NULA 4JN6B 3LCCA 3RRFA 2Z8YA 1X86B 2DLNA 1K89A 2PE5A 2R6HA 3HCEA 3EMVA 3U5ZB 1MJGM 4F8EA 1J8QA 3E23A 4DCOA 2OG2A 2FFQA 1RPJA 1GZSA 3I3SR 2W6ID 3IODA 4HLNA 5EGSA 3RJ5A 3KTAB 4U7HA 4BQPA 1PJ8A 2XTAA 4GR9A 4Q7EA 5AKZA 4ZHQF 3KFXA 2IRWA 4UEKA 5B7NA 4F4CA 2HQBA 3LY7A 4J29A 1Y3HA 5K99A 1E7MA 1THTA 2HWUA 4REQB 3HFRA 3FOFC 1H05A 1MQAA 3WDLA 2VQ6A 4JT4A 5DYTA 1LW6E 4JHLA 4ZHQB 5C5CA 4CLOB 2AR0A 3QHQA 1UZUA 1WX1A 1OROA 2H2DA 3R23A 2RKWA 1SUWA 1F2VA 2EZ9A 2MJLA 3KQTA 2VJBA 2X0DA 5BW5A 2O19A 1YHYA 3EVGA 4KIUA 1OOEA 1A7JA 1LWNA 1A5ZA 1M1YA 4BO7A 1N6KA 4EJSC 1Y6FA 3NDBB 1U7OA 1B15A 5F1KA 1DBSA 3C16C 4ZAFA 4BV9A 4CV3A 2CWWA 2X3YA 4KR9A 3D6AA 3G0IA 3AETA 1KDVA 4HVLA 1AJEA 4ZOLF 1U99A 1X7GA 1T9GR 1S8OA 4YUYA 4AJ2A 1NBMA 1KXZA 3AH8A 4TWZA 3CZAA 5C51B 2I2CA 4DC0A 4XDHA 5CW2A 1GFSA 2B94A 3NT4A 2IYAA 4HAUA 4QNMA 4RVCA 2J4FA 1JQJC 1N2ZA 3UWDA 2VQ3A 2NV6A 1R5NA 2IUSA 2PJDA 3PHJA 5HIKA 1Z4KA 2E85A 4NU6A 1WSBA 1LTQA 2OHJA 4BMZA 4LHWA 4HMPA 4CQLB 1SD5A 4JUDX 5A5EA 3SE7A 3ROQA 4EH1A 1Y89A 4JR2A 5BSWA 4G0MA 2EP5A 1THZA 1ZRSA 2BP7B 1HK7A 2EX4A 1G2PA 2WMYA 2C4TA 2DFNA 2GXSA 4WZBA 1OT5A 4FU0A 3LOUA 4WDQA 2EYQA 5KAMA 5EWLB 4Q9NA 3N0TA 2R5WA 3MSXA 3AVWA 1NNSA 4AKEA 1ZSYA 2CLCX 4YAFA 1C7ZA 4OB8A 3AGQA 1J2RA 1W5BA 3GN1A 4Q4HA 4QUJA 3RC2A 4KQ9A 3G5UA 4KIWA 1CUAA 4CCAA 1XPUA 4D6XA 5T6MA 2AFRA 1V2HE 4HWGA 1JFLA 2A33A 1ODLA 2MSKA 4FFVA 3HXTA 2FWBA 1ZJ4A 3RK0A 5HVNA 2ERYA 2QN6A 4Q3CA 2CUTA 3Q8WA 2VWGA 3ECCA 1X9GA 2IPAB 3A3YA 4QD3A 5FWNA 3E7PA 2VUSA 3LG2A 2RHWA 1GGHA 1CQIA 1V7CA 3KCNA 4PWYA 1D0SA 4AROA 4C7VA 4QG3A 3EZLA 4R8KA 1ZUHA 3TVTA 4F3RA 5ICFA 1ZK4A 4BE9A 2LKCA 4QLBA 1F9EA 2RGGA 1V1MA 1BIFA 1J21A 4IGAA 2CMGA 3JQCA 4LSGA 2WM3A 3OU7A 3AR7A 1JVSA 3Q3GE 4PO8A 2JLWA 2DY1A 1DOAA 4ZCIA 2CJFA 1P5FA 4WI1A 4G23A 5DMXA 4NFHA 4HD8A 2XQJA 1TK9A 1H4SA 4EFKA 4B3FX 1SGWA 4PFSA 3G8CA 2VTDA 3I2HA 3OFSA 1MRSA 2NAFA 1PNTA 2E9SA 2VHUA 4LE2A 4R1NA 1L8LA 3W1EA 3G2JA 4HN2A 3H1PA 4CNBA 3ROZA 4EL5A 3O8CA 2HL6A 1GTJ1 3KNZA 5HDBB 1W48A 3NUZA 1XEFA 1ZRHA 1RLJA 4HXGA 3K9LA 1XRSB 2UXBB 3OZCA 4D9KA 1SH7A 3MWYW 3OT4A 2ISSD 4TZKA 4XFJA 3AZQA 4DT1B 1G8MA 3PX3A 4UPEA 3T7JA 1CQZA 1RXSA 1EAMA 4YQYA 3EAFA 2VF5X 4WXEA 4ZVRA 2XNSA 4NC9A 2GCEA 1IM5A 1RZ3A 1JHRA 4ARVA 2QPOA 3EOAI 2FQWA 1AMOA 5A0TA 1MN6A 2R7MA 1Y4SA 4AP6A 1UQUA 2DLCX 1RRVA 2BTQA 3PIRA 3RBVA 3T94A 4X3PA 3R1IA 5KHLB 4DCVA 4XE5A 1LEHA 3BXFA 3NIDB 1GNTA 3UCEA 5EWMB 3ZD9A 2WU4A 3OF5A 3DULA 1QYDA 1EK2A 4TGLA 4C01A 1O54A 3M49A 1QZXA 4MR9B 1I36A 5DNCA 1WIWA 5KYUB 5AT1A 5K8LA 4MS1A 1SY7A 2ONYA 1FNBA 1KO5A 2H4FA 3ASYA 3STUA 4KPUB 2ERCA 3K8ZA 1P7WA 4KZPA 2AMLA 4MQEB 1AZSC 1IIBA 5IHXA 1UXIA 1UMDA 2PH7A 3SX4A 2VP2A 3TDMA 4FWTA 3EDOA 1GPJA 2RARA 3OSUA 1VJ5A 3RYCA 4OFBA 2GN4A 3GEHA 3L7DA 2Q5LA 4N0EA 4YAGA 3E7DA 5JHHB 3W3AA 2X0KA 1AUXA 4BP8A 5HK9A 3DBRA 3NBXX 3LXXA 3OA0A 2V8BA 2QVYX 1XMVA 1JL3A 4M9RA 1QJ4A 2P3QA 3WL3A 1WXEA 2CSUA 3KKKA 4FOLA 2H7VA 3UMRA 1CC1S 1OBOA 3QMPA 3TNYA 2FRDC 5DOZA 1LBTA 4CEHB 1G3IA 1EWKA 2P40A 2QAGC 4NHOA 3D43A 3IVCA 4Q4AA 3CH7A 1VXOA 4OK5A 5TQVA 4R2JA 3T0IA 4CMKA 4RV4A 2C5BA 1PTKA 2D1QA 2XA1A 2VYNA 2XI4A 4PSKA 5A0VA 1Y6ZA 3VX4A 5TSDA 5BN3B 1SVUA 2F4VB 4MS4B 4GI2A 1FMLA 3PGJA 2MWMA 4KFSA 4J0FA 4B3MB 2Q9AA 3LUHA 2X9GA 3D4NA 4MKZA 1E3WB 3A11A 3IKJA 4M0KA 2RI6A 1UDWA 2O7RA 1SVWA 4BN5A 1IZZA 3P5SA 3ZE6A 2PUGA 2JKZA 5KOJA 3FJOA 3QFSA 4B3GA 4C07A 2QE6A 1XZPA 3E03A 2IHZA 2IS4A 3VYTB 3C3CA 2WW8A 4LVCA 2UZIR 1AF7A 2QRGA 1TD1A 1XELA 3BXGA 1W75A 4TKLA 3HWX1 3VISA 1IQ0A 4H6WA 4OO3A 1E4VA 4ENQA 4UCFA 2WTUA 1GUDA 2HTEA 3PD0A 3CVYA 4QOEA 5E6UB 1OIVA 5C8DA 2C4VA 4I1YA 4KFCA 3A9UA 2Z1NA 5CM8B 3S68A 3AT1A 4Q3BA 3NDIA 3DGFC 3GMSA 3K5PA 4OGGA 4QDTA 1GO2A 4QOSA 5FNZA 1TK2A 3O9VA 4EMTA 4YBZA 5GV8A 2IX3A 3I61A 1B0PA 4PPNA 3E3AA 4GMDA 3S27A 4CN8A 3ZCSA 1NU8A 1XD8A 2JFYA 3GAFA 4I50F 3WHPA 4QFDA 1E5QA 3NBQA 3EQ9A 1JSXA 1FXSA 1QVZA 1KP9A 2P9GA 3ZK9A 2DGDA 4A8JB 3UAYA 2KX7A 2R8YA 3WB9A 4CMCA 4O1MA 4U2KA 3SIRA 4M2LA 3D3QA 5EHZA 4MA4A 1H9CA 4AZ0A 2IYLD 2MSEB 3E84A 2ECFA 4I5EA 3GMTA 4OVKA 4F38A 1P2DA 3L0OA 3RRZA 3FKSA 1OB2A 3IOMA 4X94A 2A84A 4BCDA 3OA2A 4K9RA 3AV3A 5LWHA 2V7WA 4ZI5A 3DFMA 4LJ5A 1NF3A 3I6YA 5A3VA 4EYSA 2VATA 3LZCA 4P3PA 4J0KA 1J06A 5KS2A 3WYEA 2AS0A 5TT0A 3CZ9A 5F5NA 1TOAA 3Q8MA 5HUHA 1CR4A 2OGUA 1O6FA 1E2LA 2PZFA 3HI6A 1FCJA 5I8WA 2Z58A 2O2IA 1I4TD 2ZRPA 4OY3A 2GBCA 5IFKA 2J67A 1SBCA 1ZYUA 2G28A 1RPNA 4I19A 1C9NA 4BTVA 3PZRA 3WWYA 2CD7A 2VH5R 1QZ3A 2GTHA 2PM8A 2QA5A 1RYFA 3GYGA 2EGGA 3R5HA 1D8AA 2K7ZA 5IVDA 1EG7A 3F6EX 3RWOA 2PX0A 4AF8A 4D0LB 1JQAA 3DB2A 2O8DA 3HA2A 4UNNA 3TRHA 5GVRA 3L8MA 1X39A 3CSSA 4CLHA 2BM8A 2X23A 1ZNZA 5F3RA 3CIOA 5KBYA 2JLYA 5B55A 3IMCA 3PYXA 4BO5A 4JYBA 2OV8A 4DV2B 3E70C 3GY0A 4UHBA 2MSWA 1UBHS 5TMEA 3FYUC 5P8WA 5IKEA 3OLVA 2HR1A 4JJAA 1TDJA 3DPIA 4AN1A 3ZCTA 3BPSA 2GBFA 3ND6A 1SHUX 2OBYA 2WTMA 4IDOA 4ESEA 3GRZA 3NAZA 5PGMA 3R7FA 3EISA 5I48A 1R7RA 5FV4A 2FSFA 5EQFA 1P1JA 3UAZA 3E9QA 2I3BA 4CVNA 1B4DA 1UAAA 3CZMA 4AMBA 2CXPA 1FLNA 1CZLA 3BF8A 3JQAD 3R7WA 3REQB 3H84A 4B4DA 4BKOA 2H92A 1L5RA 4BLOA 2PKXA 1Z6TA 3MGKA 5HPYB 1IXZA 2I29A 4MI9A 1YO6A 5KTNA 4XAQA 1N75A 2QD2A 3ZC3A 4V2UA 2RGNC 1SM4A 1WSWA 2Q1WA 2ZRCA 3OC0A 4Q7JB 3UWOA 4EY3A 1O7JA 1G6HA 1XB2A 3GBSA 1D04A 3CNLA 4J4TA 1P7VA 4LQ4A 4X1YB 3WWZA 3ZJ5A 1JT2A 4GVXA 2BEWB 1DIHA 2W0MA 3IPRA 3CE9A 3LBNA 4IOJA 1TW2A 3HU3A 5F4ZA 5B1DA 1KVRA 1NM5C 2EKQA 2PR7A 3AV0B 3CNOA 5GONB 2AFIE 2F67A 3DE5X 4XGIA 2DR2A 2EL7A 3H2ZA 3LA6A 1BVYF 3LPMA 3FYHA 4FFBA 4GNRA 5IDYA 4Q4JB 5HIMA 4Y6GB 2YBDA 2XNKA 2VWQA 3VI3B 2I6SA 1HY3A 3GT4A 1ISJA 1ACMA 1X7YA 4IDNA 4LDQA 4EG8A 1RKXA 5GIOE 4JXZA 2HCFA 1UWKA 3EG9B 3FCOA 1KFEB 4WZBB 1B0AA 4EELA 5AKHA 4A23A 4RDCA 2PT5A 5K2OA 1H8EA 5BPFA 4MXDA 4EY7A 1SXJD 1X1RA 2KB0A 4QDXA 5EZQA 3MCZA 3CN7A 2IZ5A 2XGJA 4L6CA 1IZYA 3L43A 1X77A 3L7BA 3IHLA 3VR4D 1AOXA 3G0CA 5KMGB 2BH2A 2D4AA 5I4BA 4HTFB 3KQPA 3QE9Y 4O08A 2Q0HA 3M89A 5KTTA 3EH1A 4W5OA 1PR6A 1UJ4A 4F9TA 5JS1A 1NBOA 5JXWA 2YCLA 2HNKA 3WZMA 1M7HA 1MB3A 3PEWA 5JCOC 3ZU6A 3UN1A 2FPMA 3RSCA 3CS3A 5I4IA 1QLHA 1V1RB 1MORA 4DB2A 4BXOA 4GOMD 3E7WA 4I4CA 5CHYA 4AF7A 1ZC4A 2AZTA 4FYJA 4WERA 1YGYA 2OTCA 1DC8A 2XAAA 3K0AB 5T4FA 2HK6A 2R2AA 3FDFA 4QYWA 3TNLA 2I55A 2IXBA 3BXXA 3FX2A 4J9VA 3Q3CA 2ADFA 1FDIA 3MIIA 2B4YA 1NVVQ 3MTDA 3QF4A 1PYOA 4M87A 4NATA 3EDCA 2VPZA 4PC2A 3D1JA 3K05A 3TKLA 4E3ZA 3COWA 2JFOA 1FDTA 2A5FA 3GUCA 3GP8A 1A1VA 4MUHA 1W5TA 1V5FA 3ZIAA 4CQMD 4P1ZA 1JKXA 1AK2A 1LS6A 3H9QA 3BB1A 4Y1GA 4D4GA 3OTQA 2CT8A 3Q8LA 4MVJH 4BFCA 3O4GA 1A3CA 2XUHA 4LHYA 3F90A 4KPFC 1U1GA 2D1FA 2HA4A 1AHHA 4MUMA 4PWZA 4MYRA 4N48A 1E6CA 2BC9A 2DG2A 3MQ2A 2G70A 4K3UA 4B84A 5DNVA 1N6RA 4JDUA 2GGSA 3D4PA 4UE6A 4EFNA 1IN8A 2Y4OA 2B6NA 3GGGA 1GFWA 1GITA 2B36A 1NJ1A 3DBOB 3L93A 5L7YA 1SXGA 3I01M 2ZIUB 3ZE9A 2JFBA 5I7VA 3L7JA 3ZCPA 5DGDA 2XYGA 2XVYA 1DXQA 3LSTA 4PYKA 4ABYA 5LVAA 2F48A 3DWIA 2R6FA 5KTYA 3CZRA 4BJHB 4GC5A 1BGXT 2R8ZA 5HF9A 2MU1A 1ORRA 5A3SA 1WMSA 4MAAA 4LI0A 1JH8A 4U2GA 5AJTA 1JQKA 4G4IA 2BFEB 4I1IA 4NF2A 1HDIA 2R4QA 2P3OA 4JJ6A 2NZYA 2WHQA 1CU1A 3AIOA 2BEVB 1PF7E 2QRLA 3AO0B 4J03A 4LV6A 4LZAA 1EBFA 2YQ4A 1VE3A 1MO5A 2G1JA 1U9YA 1PFVA 3QV2A 4B2PA 1YZQA 2IODA 3KUKA 1DVRA 1IY8A 3LUAA 2AI1A 4KI7A 4C4YA 5CH3A 1M67A 2LBPA 4X24A 1TMYA 2J6IA 4O2AA 1OBCA 3NC4A 4ZMSA 4JI2B 2NQ2C 2PS1A 4ON9A 3B8HA 3C3MA 4UNPA 1LA2A 3IXMA 5BQPA 3EGDB 3KOZA 4XUGB 3MWEB 1W49A 2VR1A 3P0RA 2CLLB 3DM5A 3EE6A 1VECA 1ZONA 1I3KA 5AK0A 2WD9A 4IIDA 1NZDA 3CVOA 3OZTA 9GPBA 2VWHA 1XMXA 4UD6A 1TA9A 3Q8XB 3CEMA 3AY3A 5T8KA 4HGOA 1MF7A 3SOZA 1G20E 4N76A 2VYCA 1Q0LA 3K09C 5F3DA 4QWMA 3JQ9A 3TL2A 1TUBB 2Q1UA 4TLDA 4DYVA 2NO9A 1TYDE 3I8OA 13PKA 1EWRA 4BRZA 5DP2A 2WFLA 2BV3A 1MAAA 3BUSA 1T9KA 3OPYB 1XDSA 4KQGA 2AK2A 5I7OA 3R4VA 2BDEA 2IP2A 4BN0A 3CZPA 4IH4A 1G4UR 1JZSA 3M6LA 4JOSA 4MIOA 2HF9A 4Y1FA 5JMPA 4M36A 5EPOA 5LNK1 1L5MA 1EA7A 5K4GA 2AW5A 3JY6A 1PX0A 1SVMA 2Q2OA 1C29B 4QDKA 5LLTA 3KKMA 3SHQA 2HSZA 2AVDA 2GN9A 2Y1LA 4K88A 4DLXA 1HPLA 2YXLA 4BGVA 5KYXA 3TEJA 3HXOA 3A58B 5IKMA 4U7GA 5EZ6B 3ZVRA 4B40A 4FCVA 3ODPA 3L40A 4X91A 4N6GA 3FDIA 3JAWB 4C3ZA 3GPDG 1Z5NA 4CG0A 4FTWA 5CB4A 4YFVA 2RGYA 2B4QA 2Y8EA 4BX8A 1IXRC 1RC0A 1WXGA 5L51A 3BQNB 4RVHA 4EMUA 3SNKA 2B4RO 2PQMA 3U37A 3ZX4A 1TVCA 1ZRNA 3W4IA 3KG2A 3L9WA 2AMJA 4X0EA 5KOYA 4J7AA 3L8CA 1L7OA 1K0UA 1P2FA 5K0TA 4IFTA 1KJ9A 3MCWA 4TVKA 1CUZA 1WQ1R 2CLSA 9LDBA 1IUPA 1ICIA 3WLLA 3OIDA 2OE2A 4XB1A 3T1YB 1P62B 3OO0A 3F8WA 1ZC3A 3QE0A 3KYCA 4WFJA 2JGEA 5EKTA 3TB6A 3OJLA 4EDFA 2MINA 5IJZA 1DBPA 3UAVA 1NN0A 1K3TA 4N40A 2CNWD 1J25A 3KOOA 3ZI0A 2XVMA 3BTUA 2XCSB 2B8EA 1K92A 1EMDA 5CTJA 3J81k 1XTRA 4ZMRA 3M1LA 4NPCA 4DC1A 3UG7A 5CEJA 3DBHB 3LYAA 4FR0A 4QUEA 4DLSA 3U6BA 1DT3A 1NBAA 1VC2A 3E6AA 1GOTA 2NM0A 4HDQB 1FBTA 2Y9MB 221PA 5KYGA 2X8JA 1K86A 3GEBA 3I52A 1XQ1A 3IUNA 4H18A 4OJKA 4D43A 1W2GA 2DKOA 3SSMA 4YCCA 3VI4B 2WG1A 4PYLA 2VP0A 1TNDA 4Z99A 4C89A 2XQKA 3AHDA 4RPCA 3VZPA 1L5HB 5EUQB 4K0RA 2PMEA 4BEJA 4C0KA 3VKHA 2WHRA 2HRCA 3LDGA 3EQ8A 3FUCA 4CI0B 2HGZA 3EVFA 1O94C 1NDQA 4N7BA 1AKWA 2HCTA 3TRJA 2VNKA 4GPBA 4AKIA 4NNPA 5T4HA 4QBHA 3P7MA 2O0JA 3UPDA 4ENWA 5J43A 1DWUA 4KEAA 1S3GA 2WINI 3RKUA 5EIXA 3LCVB 1M72A 2WWRA 3G2MA 2B1GA 3DE6X 1RLMA 4OAOA 1RIFA 4QYIB 3RNLA 3MJHA 2ZLBA 1MFZA 1U9IC 2Z30A 3H4MA 3GLIE 4LY9A 5EA2A 3I45A 3SKXA 4DV1B 4R01A 1K5DA 3GBPA 1QTRA 2FHSA 1XRPA 1KU0A 4MO2A 4EI9A 1E98A 4OMCA 1C30B 5ALNA 1U8AA 1SWWA 4HWRA 1WMFA 1BH6A 1OILA 2E4ZA 2OCLA 1YS1X 2OCAA 1V35A 1RACA 4Q7KA 1T9CA 4N5MA 5ARBA 1I4DD 1IUKA 1TVMA 1ZD9A 1YTLA 3Q0IA 5IKPA 1TKCA 2NUTA 2HYIC 5DE3A 1W0KA 1KK1A 2H7CA 1N2CA 1JIQA 2Y0DA 3EXEB 3D7KA 3OT1B 3KZCA 3PC6A 4MJ7A 4EEZA 3WGIA 3GJZA 2ZJ5A 3PNVA 2BBTA 1Q0TA 3CZ5A 1RYZA 2C82A 2JKYA 3FOWA 3OSZA 4UTXA 1L5HA 3OC6A 3PDCA 3F78A 2PCLA 2JJ1D 4K87A 2BFAA 1XBTA 5ES3A 1ADCA 3ZHOA 1TADA 1ADYA 4C05A 4L51A 1NMQA 4GEKA 1QM5A 4BIIA 3UAWA 2GA9A 3E8MA 2L42A 3DBHA 4GRAA 2B8NA 1FP2A 2BZ0A 3G0DA 2WKPA 2A1TR 3UV7A 1J2UA 1F8UA 2ATIA 4FDVA 4FFLA 3AMVA 1CX9B 3F5SA 3NH6A 1YIAA 3QF7A 3SAJA 2Q29A 3FCUB 4N7JA 4P22A 5CPFA 5EQDA 4P3YA 2OR3A 1L7EA 4XUCA 1M33A 3CNNA 4FJ1A 5C31A 1QAQA 3AVQA 4KO8A 5JYDA 4ESOA 4CF5A 3MT8A 1XZLA 2V7TA 1N3IA 4GR4A 3UJNA 1CJVC 1MV5A 2CDAA 1I2MA 4W1RA 4XSGA 2ZI6A 4D3YA 1IRXA 3B6EA 4DYDA 1RLUA 2YWRA 2OWDA 3P94A 3MNFA 1TTPB 3ZCQA 3K96A 1EUCA 4K3VA 3ZQ4A 1WTCA 2R1UA 3NTQA 3F98A 5EN4A 2CVQA 3RTDA 1S2LA 1ZU4A 3LO5A 5EPUA 4JI5B 2FW9A 3NP9A 1ZM9A 2G5TA 1HO3A 3BEOA 1VRWA 2VT6A 3UGTA 1I5OA 1SXJA 1H1LB 2AC2A 1KJNA 4AS3A 1RXUA 1YBVA 3AQ4A 1SUDA 4MGYR 1VP3A 5EIFA 4E1VA 3W78A 1S0UA 5CDFA 1H5NA 4MEBA 3AOGA 4Y8VA 1TLLA 1UFOA 2UVDA 2OKCA 3IMEA 3L0BA 4WK2B 3WIEA 1YR6A 3ZHVA 4DMKA 3W7BA 1T2FA 1O5OA 4O8CA 4R71A 3AF0A 4IIFA 4BNVA 3PLAE 2B2CA 1H2HA 3RIXA 1RWQA 2NTNA 4Z3KA 4A10A 3Q88A 4ZYUA 4C5AA 4FHGA 1G7RA 2OGSA 2D1TA 2OK8A 3AINA 2YNMD 3QOWA 4H35A 4UARA 5DSXA 2GETA 3UK7A 3VGJA 2PL5A 3AKYA 3DZJA 2OUKA 1R4AA 1V1JA 3EXHA 3EIFA 3H5LA 4FYYA 4KAXA 2RGWA 3ZV4A 5B3LA 1YAJA 1AHNA 5ALXA 1ZHFA 4GBJA 1DMSA 3TJMA 3K0HA 1TUGA 1AUQA 2HMVA 5FOQA 3AP2A 1H0SA 3G7UA 4P7JA 2QJFA 3HDQA 1S8AA 2A0YA 3HHPA 4DM3A 4L08A 2IXGA 3DPUA 5IFLA 3AFGA 2V3VA 1HT2E 1H8HA 3K9WA 1FSPA 4ZYXA 1VMAA 5GONF 3QPVA 3IUMA 1Y34E 2OVBA 4NARA 3NCTA 3NHMA 3DVRX 4MWZA 1N9ZA 1FP6A 3CINA 3KZMA 4TLBA 1K66A 3WL5A 4XGRA 5EJ5A 3QFRA 3MD9A 4UW9A 2EHDA 5SY9A 1DCKA 1GZ7A 4O4JA 1BXGA 4GT1A 1W94A 4FJ2A 3M2PA 5HDQA 5J3JA 3X1JA 2C7RA 2PMCA 2VJLA 2ZYGA 2GXUA 4JZKA 4ZANA 1Y1TA 2HPHA 4EHNA 3LGSA 5TC4A 4WY2A 1A7KA 5CYOA 3EY4A 1T5SA 1YK1A 4DUYB 1MV8A 4HEHA 4IJVA 4ZVMA 4F5ZA 5HF8A 2D1RA 3K73O 1GQYA 1OXSC 2HQRA 4S1NA 1J0DA 2WQ6A 4KMMA 1T13A 3W5JA 1Z73A 4HEA6 3IFSA 3A9WA 3MD0A 4LWZA 5FH9A 3BFKA 1E1KA 4KO3S 3UXHA 3A37A 3R3WA 5CX4A 1QYXA 2BGUA 1VHTA 3SZUA 1DEKA 1OKKD 4BJ3A 1PKEA 1ESNA 1PJSA 1U3CA 4KUHA 1UUFA 3IVAA 3RTGA 3C48A 4DY4A 1Z15A 2X9VA 3I04A 5KYYA 4TYNA 4QVKA 4KFRA 4PE5B 3KDPA 2YYYA 4RFVA 4MP8A 2W6OA 4ISCA 5FBRB 3RS8A 4R3WA 3L4KA 1G60A 1QCDA 3BWYA 3FLEA 3OM9A 2JZCA 1BVRA 2HA0A 3LE8A 4Y67A 3TLKA 2RI1A 4PCAA 1X1BA 4M98A 3T7AA 3OTOB 5CURA 4ESVA 2LR0A 1Q92A 3ILVA 3WLEA 4F12A 3LI2A 2J3EA 3QKSB 1AO0A 2X1LA 1JEAA 2AEEA 3JWEA 3KPYA 3TG8A 3H2JA 2D00A 4X3OA 3VAAA 2QJOA 4XPIA 1JEQB 2VBCA 1RLOA 4G5FA 3TYXA 5FWYA 1WETA 4C21A 1KY2A 1WLSA 2CDCA 2OBNA 1D5CA 1QYWA 4ENUA 3GF4A 3QX9A 1W73A 3U3XA 2NV0A 4II2A 2F3SA 2W2LD 3BE8A 4RGBA 4ZK2A 3IE2A 3MUFA 5A9SB 1DAPA 1OLOA 2VBIA 5F76A 3N5CA 1T0IA 1OZ0A 1UMKA 3CEAA 3FR7A 1DCMA 3QF4B 4IUCS 4ARZA 4MHSA 1T5LA 3IV7A 2CN1A 3AR5A 2CVPA 1YKGA 2LZ0A 3E8SA 4E51A 1E9FA 4JBNA 3THYB 4TYWA 1YI1A 4FN4A 3AR4A 3DG9A 3FIJA 3OJCA 4H16A 1H3NA 2JFNA 1FJ2A 2G4CA 4ZAGA 3KZOA 3NHUA 3ZGYA 5J23A 3VDXA 1I9CA 2HF8A 1XP8A 5UKDA 4UFOA 4J3JA 3ZDFA 2Z2YA 1GJRA 3SYTA 1KVUA 1YAHA 3I8XA 2H7YA 1FE8A 3KFLA 5E4FA 1PT9A 1X7ZA 1NJ8A 3KEQA 2XQGA 4RXTA 2AK3A 4M1EA 3CGGA 1DIBA 4JDPA 1QF7A 2O2CA 3B6MA 3GUHA 3Q1LA 5I5EA 5JCPA 1PSWA 4MPPA 4KHZA 1T1IA 1RXCA 4IL5A 2B6HA 3RCBA 2BVNA 4I08A 3T3HA 4ZYZA 3TCNA 1VZ3A 5M7EA 3SSOA 1YR9A 3MRXA 4DLNA 4MINA 3ZX5A 1ZJ5A 4RCVA 1WY5A 3PNPA 5DYWA 5H9WA 3A1VA 4C2TA 3HKCB 3KVNA 1H5QA 2CDRA 3SE0A 1QDLB 4RZUA 5JS2A 1I2AA 2I2AA 2OCIA 2F4NA 2XOKA 3P9QA 3R6TA 4RQTA 1C2YA 1LDBA 1TQ4A 1I5RA 2HB6A 2WIBA 4M1YA 4QDUA 4A0RA 3K0CA 1L5QA 3WISA 1EM8B 3DO5A 5EJ8A 5K05A 4X8LA 4A3SA 3JARB 3QY9A 5C7OO 4YPOA 3GFQA 2JFQA 1OJLA 4FFBB 2IP1A 2ZB2A 3DO8A 3L82B 4KWHA 1TA0A 4HN9A 4RO0A 3O0DA 1OH8A 2W00A 1ZOSA 4LJAA 1DWPA 1W36B 2I8CA 1K06A 2MMGA 3BHNA 4BMSA 3GLSA 2ZANA 4EG1A 3P9KA 4JOBA 3V1MA 3V4ZA 1N6NA 3K0EA 3ZZUA 4TS3A 1Z38A 2F8TA 4PAWA 4QXAA 4URXR 4LC0A 1EI9A 1T35A 4Y6QA 2G7ZA 3UTCA 1XQXA 4AU1A 3V1YA 4EARA 4EJ2A 2IHKA 2X5OA 1W5FA 1GLGA 2KE5A 1G8GA 4U00A 1EFVA 4UHCA 4JWKA 1C0PA 1DZ3A 3CF4G 4RV9A 4AL4A 3VO2A 1FNMA 3KQSA 3QX7A 1RWBA 4MW9A 3DTYA 5KX5A 4KJZA 3VSAA 3DQZA 3QH4A 2IEBA 5D3MB 5MGBA 1CF9A 1DUSA 1O4WA 1QS0B 2EFYA 3GFPA 1NF8A 2FW8A 2WLSA 4R8RA 5DK4A 2AC7A 1K3UB 3K31A 4UQOA 1FFAA 4PTYA 4YV1A 2ZBQA 1KNQA 1YL5A 4JEHA 5J1SB 3BZUA 3PDWA 3QWIA 4RVUA 1F4VA 2H65A 3LY9A 3WLKX 1RRGA 3MFQA 4BNFA 1SBHA 5A9TA 4YUVA 1EEHA 4TXNA 4BVGA 2G77B 5FPHA 3E9EA 4N41A 3DMRA 4DIDA 2YDYA 5DLYA 2ZZMA 2CDBA 4FT4A 3CF4A 1OBVA 1WEKA 1HQKA 1M7GA 1OASA 3PC8A 3C6YA 3D6TB 4O2RA 1Z7GA 2GD0A 4YJKA 2B8WA 2G1KA 4ZAWA 2YWFA 1XQYA 4R2XA 5EC8A 5B1SA 1NVFA 1PG2A 1OJ7A 3NOVA 4N3GA 4Y2SA 2J3IA 4MGIR 4Y2UA 2V7PA 5C1BA 1E1QA 2Q41A 2VH1A 4QELA 3YASA 3KHSA 5AVQA 3EHEA 3ZDZB 4IFEA 1DRUA 2XD9A 4L72A 3GLRA 4ARSA 4BMXA 3DC7A 3OECA 4Z2AA 3AF3A 2GEUA 2W58A 3ETLA 4Q7LA 4TYPA 3ZTWA 3RSHA 3Q9LA 3ADOA 3IILA 4YUWA 5ITZB 2I1WA 3TNDA 3UKJA 1RAHA 3E58A 4EG6A 1Q1QA 5IF9A 1W30A 4KE8A 4BFZA 3PQ7A 3WYCA 2HDNB 2JI8A 4LF4B 5JYBA 1GZVA 3IDZA 3U09A 3V8NA 3MW8A 4B8ZA 5KVQA 4EVQA 2FV8A 4C04A 2C57A 2VVTA 3OEYA 2A3NA 2HUPA 5TX7A 2AXQA 2E89A 3IMGA 4II3A 4M1OA 3CKYA 4DJDC 5KDDA 3O38A 2DU8A 4JQSA 2PZJA 2YV1A 3BJEA 5F1YA 1C1HA 1K63A 1OXBB 5COQA 5BQFA 1BXRB 4TRJA 4OXYA 2YCBA 2YY6A 1XNHA 4X61A 1IG3A 5EI5A 2GJSA 7YASA 2XQIA 3ZZMA 1LK5A 4EECA 2NYAA 3LIPA 1UZNA 1SNYA 1H1DA 1M2NA 1TLTA 2Q5HA 2VJMA 1DJQA 4D9JA 2FK7A 3AONB 1WW8A 3UANA 3R2JA 3FLBA 4H1WA 1OZAA 3H3FA 4RK4A 4ZCLA 3HY3A 1TLFA 5I47A 4CR6A 1YZVA 5HKKD 2YIVX 3F7NA 3LY8A 4HDOB 1UKYA 4HZIA 4R9SA 5E6UA 2PH3A 5REQA 2IXAA 2PH5A 4MVWA 3PT5A 1Y8ZA 3VU1A 3WIVA 1M2KA 2NX2A 2C4NA 3BE6A 1UDRA 1P91A 1WE2A 4KRGA 4UUBA 3PV0A 1L4HA 2H2AA 4QXOA 2A78A 1U98A 2N42A 1FVFA 4BNDA 2HBQA 3TGLA 3ESZA 4Z4EA 5WRFA 4NENB 1AH2A 1IPHA 2WPDD 3W9BA 5AR1A 2VYFA 3B13B 1Y9JA 1QG0A 4XTCS 1UOEA 1OAKA 2YVKA 5IN4A 4XYEA 3SJUA 5MGNA 2R25B 4YCDA 1KEZA 4OREX 4B3IA 2H54A 2FPPA 3KU1A 3P2JA 3TS1A 3WWDA 5KSZA 4RTKA 3GELA 4MDEA 1F14A 1Y1LA 1GT6A 1II9A 3CF2A 2G08A 2XGSA 3GUYA 5JZVA 5LZ9A 1PEYA 3SPXA 1JDUA 2RAVA 3OHSX 4P4SB 3Q9UA 4Z86A 4B76A 3LX5A 4V0MA 2OYCA 1FUKA 5BUQA 3AVUA 4PCUA 3QVUA 1D4AA 4FHDA 4NJMB 4RSRA 1N7IA 5AVUA 2WAXA 3TSWA 8AT1A 5L7WA 4U1RA 1COZA 4DA7A 4O4HB 3N9IA 3C5CA 3TZBA 2O2GA 3P20A 1LNSA 2G9ZA 3PUZA 3FNRA 4A2PA 2NO6A 5JSUA 1TKAA 4TYMA 1QH1A 2BCGY 1MEJA 2ZE5A 1MX3A 2B0JA 1JRLA 3VPCA 4EHKA 2O8VA 2ZJ3A 1XRJA 3L1HA 3JTEA 3VU9B 4J49A 2AOTA 2ZWPA 3SJBA 5CVUA 1ZAYA 5CBPB 2I4NA 3ANLA 1HG0A 1E2QA 3WRXC 1ZSNA 4YC7A 2F1RA 5IC6A 1GNVA 1BSVA 4XUDA 3W1WA 4C4PA 2ZPTX 5C1IA 2XT6A 1ESZA 3NONA 2Y0EA 3O0TA 4JI3B 3V8PA 5I8PA 2FQ1A 4J4HA 1MT3A 2CXUA 1N8SA 1JLSA 3HXKA 3NAMA 1B8OA 4NBVA 4PM4A 1LFDB 1UP6A 4XWTA 5DIZA 1Y98A 1P80A 4YIKA 3TD9A 3W6ZA 5MDHA 3MTGA 2FTKE 2BSXA 3T34A 4F85A 1BW9B 4G5OA 2DHDA 1EB9A 5D86A 5JCOA 4ED9A 3OLWA 4IWYA 3HPQA 4LWPA 4CLEA 2AYXA 4G86A 3W8DA 3FPEA 2R79A 4BU1A 3TLBA 5IPFA 1P9LA 1VLHA 2C0PA 1ZESA 3ZQKA 1GZUA 3EGOA 3OPMA 4MICA 2ON