3TFYA

Naa50p amino-terminal acetyltransferase bound to substrate peptide fragment and coa
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
155
structure length
155
Chain Sequence
MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Ternary Naa50p (NAT5/SAN) N-terminal Acetyltransferase Complex Reveals the Molecular Basis for Substrate-specific Acetylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-alpha-acetyltransferase 50, NatE catalytic subunit
total genus 42
structure length 155
sequence length 155
chains with identical sequence B, C
ec nomenclature ec 2.3.1.258: N-terminal methionine N(alpha)-acetyltransferase NatE.
pdb deposition date 2011-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3tfyA00
4B5OA 1R57A 4I49A 1S3ZA 4ZBGA 3S6KA 4MI4A 4XNHB 2PRBA 2OB0A 1VKCA 2B5GA 1IIDA 4LUAA 4RS2A 2G3AA 5J8CA 3PGPA 5FVJA 4H6ZA 4R57A 4CAWA 4JD6A 5CNPA 5I0CA 3BJ7A 2CY2A 2VXKA 1K4JA 4KLVA 2GIVA 1S5KA 3H4QA 4UBRA 4CAXA 4KUBA 4M3SA 4KVME 3SXOA 4U9ZA 1IYKA 3DNSA 2OZGA 2A4NA 3GYAA 2O28A 3LODA 4XPKA 3R1KA 3N7ZA 1MJBA 2G0BA 3ZJ0A 3B8GA 2B4DB 1Z4EA 4HNWB 4BMHA 4PSWA 4OLLA 2GANA 3OWCA 5DWNA 5F49A 3JUWA 2B3VA 4IF5A 3JVNA 1L0CA 5KTCA 4AG7A 4KOYA 2Q0YA 5J8FA 1YK3A 2Q44A 4QBJA 4JJXA 4LX9A 2JEVA 1XEBA 1Q2CA 4KOVA 4ONUA 4HNXB 2QECA 1MK4A 3R9FA 4QC6A 4XPDC 4QB9A 1M1DA 2P0WA 2R98A 4KOTA 4NSQA 2EUIA 3WR7A 2FSRA 1YLEA 1NE9A 2BSWA 5F46A 3DDDA 2EVNA 4HKFA 5KTAA 4KUAA 4UWJA 1U6MA 5C88A 1M44A 3K9UA 3ZZIA 2REFA 3MGDA 2Y0MA 3KKWA 1PU9A 4AG9A 4OAEA 5F47A 2FCKA 5EBVA 1QSMA 3V8IA 1RXTA 2REEA 2P6GA 2B3UA 1S60A 4FD6A 4YRHA 2J8MA 4NEXA 1KUVA 3FIXA 1Y9WA 3G8WA 1KUXA 3D8PA 1XIXA 3F0AA 1B6BA 2JLMA 2K5TA 1Y9KA 2OZUA 1MJAA 5EC4A 1OZPA 2X7BA 1YGHA 3CXSA 1CJWA 4E0AA 2CNMA 3FYNA 3D3SA 4PK2A 4CRYB 4JXRA 1J4JA 1QSOA 4KZTA 4MHDA 4DNCA 3R9EA 1Y7RA 5ISVA 4UA3A 3F5BA 3FXTA 3CXQA 2DXQA 2VI7A 5JQ4A 3FRMA 1KZFA 3PP9A 2ZW4A 3GKRA 1Z9UA 4KVXA 1RO5A 4OADA 1XMTA 3EFAA 4XPDB 4FD5A 2HQYA 2GE3A 1V0CA 2B5GB 2PR1A 3EY5A 2PSWA 3SHPA 2Z10A 3R96A 3S6GA 2Q4VA 2P6FA 2ARHA 3IGRA 5HMNA 4EVYA 1S7LA 2IL4A 5C82A 3W6SA 2VQYA 2ZW7A 4RI1A 4AVAA 4U9YA 5IX3A 2I00A 4B5PB 3PZJA 4GS4A 1YR0A 1QSTA 3TOBA 1P4NA 4MJ8A 1XF8A 4CRZB 1B87A 3TO7A 3TFYA 4AVCA 1YVKA 3EXNA 4AB7A 3R9GA 3TO6A 3TOAA 1P0HA 2B4DA 1NMTA 4PV6A 4FD4A 4MBUA 1ON0A 3IWGA 3BJ8A 4QUSA 1CM0A 1S7KA 4JLYA 1Q2YA 2FE7A 4H6UA 4MY0A 4R3LA 2PDOA 4JWPA 2F5IA 1VHSA 2ZW6A 1QSRA 2BEIA 4KOXA 2FL4A 2FIAA 4L8AA 2C27A 2HV2A 1N71A 3I9SA 1YX0A 5DWMA 5H84A 1M4DA 2KCWA 2BUEA 1FY7A 2H5MA 2OU2A 2BL1A 2ZPAA 2Q04A 1S7FA 2D4OA 3D2PA 4NXYA 3G3SA 4KVOE 3NE7A 2PR8A 1WWZA 3R95A 4CS0B 2Q4YA 2Z0ZA 3FB3A 3SXNA 2D4PA 1PUAA 2J8RA 4QVTA 4HNYB 3S6HA 3P2FA 5IV0A 3QB8A 2R8VA 2Z11A 3FBUA 2VBQA 1I12A 4X5KA 3C26A 4UWIA 4F0YA 2R7HA 3DR6A 4R87A 1Q2DA 4XNHC 4H89A 4Y49C 2JDCA 2CNTA 2NMTA 1NSLA 3F8KA 5KTDA 2FT0A 4KOSA 3W6XA 4M85A 3FNCA 1TIQA 2HUZA 1YVOA 2ATRA 3E0KA 4CAVA 1YREA 3TE4A 3DSBA 4AVBA 4IUSA 4YFJA 5H86A 5F48A 4YGOA 1BO4A 1IB1E 2B58A 2FXFA 3I3GA 1WK4A 2QMLA 4FD7A 2ZW5A 3QAHA 5GCNA 4F6AA 4KLWA 5HH1A 2FS5A 4Y49B 2QIRA 3W91A 4L89A 4K30A 4NF1A 2Q7BA 5IB0A 4KOUA 1XE4A 1LRZA 4U5YA 1KUYA 2G3TA 2OZHA 2PC1A 2PQ8A 1GHEA 3S6FA 3VWDA 3T90A 3GY9A 1I21A 3D2MA 4PSXA 1UFHA 2VEZA 4MY3A 1I1DA 2VZYA 4NCZA 2P6EA 4B5PA 4ORFA 4JXQA 3EC4A 4R3KA 2VZZA 3RYOA 4J3GA 2AJ6A 2JDDA 2FIWA 3T9YA 4KOWA 3TT2A 4R9MA 3VWEA 5JPHA 1M4IA 1S7NA 3TTHA 2B4BA 2CNSA 2ZXVA 3LD2A 2WPXA 4II9A 2AE6A 1BOBA 2RC4A 3EO4A 3BLNA 2R1IA 3DR8A 3P2HA 1Z4RA 1SQHA 4KORA 5E96A 3UY5A 1M4GA 2WPWA 2I79A 2J8NA 2OH1A 3TO9A 1IICA 4E2AA 4XPLA 1MJ9A 4E8OA 1IYLA 3CXPA 1QSNA 4PK3A 3TCVA
chains in the Genus database with same CATH superfamily
3MN8A 4NGMA 4B5OA 2C6PA 1R57A 2V8VA 3FH4A 4R7MA 4P4FA 4I49A 1S3ZA 1F2OA 2C1CA 4KSAA 4ZBGA 2GLJA 4MFPA 3S6KA 4MI4A 1JWQA 4XNHB 3D4UA 2I3CA 2PRBA 4UCPA 2POKA 1Y7EA 2OB0A 1Q7LA 1VKCA 2B5GA 1IIDA 2CXAA 4LUAA 3IFEA 4RS2A 2G3AA 5J8CA 2DPTA 3PGPA 5FVJA 4GM5A 4H6ZA 5DS0A 4R57A 2BOAA 4CAWA 2GREA 4JD6A 5K8OA 5CNPA 2O4HA 2AFOA 5I0CA 3FEDA 1AUGA 1Z8TA 3BJ7A 4K3NA 4B11A 2CY2A 3H8GA 2Q51A 4B12A 2AFMA 4C2YA 2PJ0A 1Z5RA 1YW4A 4P4BA 2G9DA 2VXKA 3LMSA 4ONWA 4FWUA 1AYEA 1K4JA 4KLVA 2AFWA 1S5KA 2GIVA 3FJUA 4HPSA 2IJZA 3H4QA 2XEJA 4UBRA 1BPNA 3S9MA 4CAXA 4KUBA 2J9AA 4M3SA 3IU2A 4KVME 3SXOA 4U9ZA 1IYKA 3L2NA 3DNSA 3V38A 3PEIA 2OZGA 4ZGYB 2A4NA 3GYAA 2O28A 3KGQA 3LODA 1F57A 3R1KA 4XPKA 3N7ZA 1TF8A 1MJBA 2G0BA 3ZJ0A 3FVLA 2AFZA 2V8GA 3B3TA 2ANPA 2B4DB 3B8GA 1Z4EA 3H8FA 4HNWB 4BMHA 4PSWA 4MFZA 4EFDA 2PJ3A 4OLLA 4P45A 4PXEA 2O53A 2GANA 1Y0RA 4X3RA 3OWCA 5DWNA 2ZOFA 3RBUA 1VIXA 5F49A 4CYOA 3JUWA 2B3VA 4IF5A 3JVNA 1L0CA 8CPAA 2GFQA 3HUVA 5KTCA 4AG7A 4KOYA 2Q0YA 4GXHA 4CGLA 3LWUA 2Z3PA 1YK3A 4MFQA 3B3VA 2Q44A 5J8FA 4IK2A 4C2XA 4A95A 4P4EA 4JZ0A 1QQ9A 3WC7A 4JJXA 4LX9A 4QBJA 2JEVA 1XEBA 1Q2CA 4KOVA 1VGYA 4KSFA 4ONUA 4HNXB 4UFVA 4CAFA 4Z65A 4OMEA 2QECA 1MK4A 1Y0YA 3RNZA 3R9FA 4QC6A 4XPDC 2HC9A 4QB9A 1RTQA 4P4DA 3QAYA 1M1DA 2P0WA 3D7GA 2R98A 4WWVA 4A37A 4KOTA 2PE3A 2EUIA 4NSQA 2ABZA 2FSRA 2Z3OA 2Z3KA 3WR7A 4F0XA 1YLEA 1NE9A 5AG7A 3SJGA 2V8DA 2BSWA 4MHNA 5JGFA 5F46A 3DDDA 2EVNA 2QYVA 4YWYA 2CIJA 4HKFA 3KHXA 4A32A 5KTAA 2RFHA 4KUAA 4UWJA 4CGNA 5CPAA 1DE4C 2AFSA 1U6MA 4MHZA 5C88A 2ZEGA 1M44A 3K9UA 3ZZIA 4OC0A 2REFA 5JH9A 2AFUA 1OBRA 3MGDA 2Y0MA 2JEWA 3BI0A 3KKWA 1ARMA 1X10A 1PU9A 4AG9A 2C6CA 3IWEA 4OAEA 3V7ZA 3PB6X 2FCKA 5EBVA 1QSMA 5F47A 3V8IA 1RXTA 2REEA 4ZX8A 3TX8A 4UEEA 2P6GA 2B3UA 2ODFA 4AXVA 2ZELA 4YU9A 1S60A 4FD6A 4PQAA 3LACA 3BHXA 4FUUA 4R8FA 2Z3LA 4Q36A 4YRHA 2J8MA 4NEXA 1KUVA 4A38A 3KR4A 3FIXA 3B7IA 3WT4A 3S9LA 1Y9WA 3G8WA 3MRUA 3GB0A 1KUXA 3D8PA 2ZOGA 1XIXA 3F0AA 4UCMA 3KHZA 2JBJA 1XMBA 4F8ZA 1B6BA 2JLMA 3A9LA 4MFJA 2K5TA 1TKHA 1Y9KA 2OZUA 1MJAA 5EC4A 4KS9A 1IU8A 4IHMA 3IC1A 1OZPA 2X7BA 1YGHA 2F7VA 1CJWA 3CXSA 3VARA 4E0AA 3S9NA 2Z3NA 2CNMA 3FYNA 3D3SA 2QJ8A 4PK2A 5A27A 4CRYB 3KQZA 4JXRA 1J4JA 1QSOA 4KZTA 4MHDA 4DNCA 3CDXA 5BWAB 4BBHA 3VH9A 3R9EA 1Y7RA 1ZO0A 4C68A 2CF4A 5ISVA 2FVGA 3SI0A 4UA3A 3F5BA 1LANA 3FXTA 5ELYA 1CPSA 5I4MA 4OC4A 4ZY2A 3IWWA 2DEAA 3CXQA 2DXQA 2PJ1A 2VI7A 5JQ4A 3FRMA 1KZFA 3PP9A 4B13A 1YW6A 3I1UA 4NJQA 5AGEA 3GUXA 2ZW4A 2PJBA 2BO9A 2YNEA 3GKRA 1Z9UA 4KVXA 1RO5A 3D67A 4OADA 4KSIA 1XMTA 3EFAA 3PB7X 4Q7AA 4XPDB 4FD5A 5HVFA 2HQYA 2GE3A 1FNOA 5LRGA 1V0CA 4MCQA 2B5GB 2PR1A 4Q38A 1Z8XA 3EY5A 1HDUA 2PSWA 3SHPA 2Z10A 3KZWA 3R96A 3S6GA 2Q4VA 3CT9A 2P6FA 3WC6A 2ARHA 3NH5A 5G21A 2PJ2A 3D7FA 3IGRA 3KASA 4A30A 5HMNA 4EVYA 4G1PA 3WC5A 1S7LA 2IL4A 1LFWA 5C82A 3W6SA 1M4LA 1IOIA 2BCOA 4UIAA 4UF4A 3BXMA 2VQYA 3B35A 2ZW7A 5K8MA 4RI1A 1AMPA 4AVAA 4U9YA 5IX3A 4DYOA 2VL1A 2I00A 3NE8A 4B5PB 4P4JA 4NGPA 2XEGA 3PZJA 4MRIA 4GS4A 4CPAA 1YR0A 1QSTA 3TOBA 4M6GA 1FT7A 1NSAA 1P4NA 7CPAA 4MJ8A 5K8PA 2Q43A 1XF8A 1BLLE 1XOVA 4P44A 3RAMA 4CRZB 1B87A 3FECA 1YLOA 3TO7A 3TFYA 2PVVA 4AVCA 1HEEA 4TNUA 1YVKA 3EXNA 1ZG8A 4AB7A 3R9GA 4NFRA 1YSJA 3TO6A 3TOAA 1P0HA 2B4DA 1NMTA 4PV6A 1CPXA 4FD4A 4TWEA 4MBUA 4C2ZA 1ON0A 3IWGA 3BJ8A 1XFOA 4QUSA 1CM0A 1ZLIA 4X2TA 1S7KA 4JLYA 1Q2YA 3NFZA 2FE7A 4H6UA 4DUKA 5D29A 1CG2A 4R76A 3GIUA 5HVHA 4BINA 4ZY1A 1LAPA 4MY0A 4R3LA 2PDOA 3QNVA 4JWPA 2WZNA 2F5IA 3PFOA 4P4IA 1XBUA 2EWBA 4IAVA 3IEHA 1PYTB 1VHSA 2ZW6A 3PB9X 2V8HA 1QSRA 3D68A 3SI1A 2BEIA 4KOXA 1CP6A 2FL4A 6CPAA 2FIAA 4L8AA 2C27A 4MCRA 2HV2A 1N71A 3DGVA 3I9SA 1YX0A 5DWMA 4MFKA 1F2PA 3N5FA 3H8EA 4OC5A 1H8LA 5H84A 1M4DA 2WYRA 2KCWA 5EMIA 4F9VA 1BPMA 4BD9A 5A28A 3D7DA 2ZENA 2PJ6A 2BUEA 5HVGA 1FY7A 4WJBA 4UEZA 2H5MA 2OU2A 2BL1A 2ZPAA 2ZEOA 5J1QA 2Q04A 1S7FA 2D4OA 2GU2A 3B2YA 3D2PA 4NJRA 4NXYA 4NGSA 3G3SA 4KVOE 5G22A 2PJ8A 4OP4A 3NE7A 2PIYA 2ZEFA 5AG4A 5LRJA 2PR8A 4CYQA 1WWZA 3R95A 4UIBA 4ZYQA 1IOFA 4CS0B 2Q4YA 2Z0ZA 2CTCA 3FB3A 3SXNA 5THWA 4P10A 2D4PA 2XEIA 2YNCA 1PUAA 2J8RA 4QVTA 2QVPA 4HNYB 3S6HA 4JYWA 2EK8A 4F9UA 4OC3A 3P2FA 3FX6A 5IV0A 4B10A 3QB8A 4MHPA 2YGWA 2R8VA 1HDQA 2Z11A 3FBUA 2VBQA 1I12A 3SJEA 4NGQA 3SJFA 1QMUA 4O23A 4X5KA 4W9YA 1VHOA 4MXUA 2PVWA 3C26A 4UWIA 2F8HA 3PBBA 4CYPA 3IO1A 1ARLA 4F0YA 2R7HA 2OOTA 4MMOA 3PRTA 2Q7SA 3DR6A 1LCPA 4R87A 1Q2DA 4XNHC 4H89A 4Y49C 5D8NA 2JDCA 2CNTA 3JRUA 2NMTA 1NSLA 3F8KA 5JM6A 3KR5A 5KTDA 2PJ9A 2PJCA 1ELMP 2FT0A 4KOSA 3W6XA 2V77A 4M85A 1EE3P 3FNCA 2XEFA 4M6IA 4R6TA 4CGMA 1TIQA 2HUZA 1YVOA 4ZX9A 2ATRA 4PXBA 4A33A 2Z3MA 5LYIA 4EWTA 1BAVA 4B6ZA 3NH8A 3E0KA 4OKOA 4CAVA 1YREA 3TE4A 3IJ3A 1KWMA 4NGTA 3DSBA 4A94A 4AVBA 5LYLA 4IUSA 4YFJA 4MCPA 1R3NA 1TF9A 5H86A 5F48A 4YGOA 4P6YA 1BO4A 3ISZA 1IB1E 2B58A 5LYDA 1TKJA 4X8IA 1X12A 5G1ZA 1LOKA 2FXFA 2PJAA 2ZEMA 4FBEA 3I3GA 4RUHA 1WK4A 3NA6A 4MHYA 4EMEA 5HXDA 5LRKA 2QMLA 4FD7A 2ZW5A 3JTKA 3KQXA 4A2ZA 3CPXA 3QAHA 2AFXA 5GCNA 5G20A 4F6AA 4KLWA 2PRQA 4PPZA 5HH1A 2FS5A 4OC1A 1IY7A 1CBXA 2EO8A 2QIRA 4Y49B 2C6GA 3W91A 2RB7A 3PBEA 4L89A 1TXRA 4K30A 4UCNA 3IU1A 4OC2A 3SI2A 4NF1A 4B14A 4A31A 1XJOA 1Z2LA 2Q7BA 4DJLA 5IB0A 4KOUA 3FF3A 3IIBA 1XE4A 1LRZA 2NYQA 2WUUA 3KI9A 5LYFA 4U5YA 1KUYA 2G3TA 2PC1A 2OZHA 2PQ8A 2ZEPA 1GHEA 3GLJA 4C7HA 2NSMA 4PXCA 1VHEA 2WSAA 4NGRA 3FEEA 3S6FA 2PIZA 3FMCA 2ZEDA 1UWYA 3K9TA 3KL9A 3GY9A 3HLPA 3T90A 3VWDA 5AG6A 1TKFA 1I21A 4RN7A 3D2MA 4PSXA 1LAMA 1UFHA 1IGBA 1ZG7A 2VEZA 1I1DA 2IQ6A 2VZYA 4MY3A 2P6EA 4NCZA 4B5PA 2GLFA 4ORFA 4A39A 4JXQA 3EC4A 3BI1A 3NH4A 4R3KA 1YMEA 2VZZA 3RYOA 4J3GA 2AJ6A 3SJXA 4MCSA 3ISXA 1PCAA 2JDDA 2FIWA 3T9YA 4KOWA 3TT2A 5CBMA 4R9MA 3VWEA 5JPHA 4CAEA 1M4IA 4CYNA 1S7NA 1Z8WA 2PJ5A 3TTHA 2B4BA 2CNSA 2ZXVA 1R43A 3LD2A 1DTDA 2WPXA 3PB8X 3K2KA 2JBKA 3T8WA 1JQGA 4NGNA 2AE6A 4FAIA 2DF5A 1BOBA 4II9A 4UFWA 4C7IA 2RC4A 2CTBA 3EO4A 2YNCC 2HB6A 4CGOA 5F09A 3BLNA 2IMOA 2R1IA 3CPAA 3DR8A 2EK9A 4LQGA 3P2HA 1Z4RA 1SQHA 1ELLP 4OIWA 1Z8LA 3H5ZA 3PB4X 4KORA 1CX8A 4PXDA 5E96A 5IB9A 4H2KA 3UY5A 1M4GA 4ZI6A 2WPWA 2I79A 1CP7A 3PFEA 4MFLA 3B3SA 1XRYA 3D7HA 1A2ZA 2PJ7A 2Q4ZA 2J8NA 2OH1A 3WABA 4ZY0A 3TO9A 3VATA 1IICA 3RO0A 3CZXA 1ZLHA 2YNDA 2EBJA 4M6HA 4E2AA 1YQEA 3D66A 4XPLA 1MJ9A 4UEFA 3B3CA 3DLJA 2PCUA 2OR4A 2DPSA 1GYTA 4OIDA 3TC8A 4CGPA 4E8OA 1IYLA 4UFXA 5K8NA 3CXPA 1QSNA 1ZG9A 2PJ4A 2ZEEA 4LQ6A 2ZEHA 4PK3A 5AG5A 3RZAA 3TCVA 3B3WA
chains in the Genus database with same CATH topology
4B5OA 1R57A 4I49A 1S3ZA 4KSAA 4ZBGA 4MFPA 3S6KA 4MI4A 4XNHB 2PRBA 4UCPA 2OB0A 1VKCA 2B5GA 1IIDA 2CXAA 4LUAA 4RS2A 2G3AA 5J8CA 2DPTA 3PGPA 5FVJA 4H6ZA 4R57A 4CAWA 4JD6A 5CNPA 5I0CA 4B11A 3BJ7A 2CY2A 4B12A 4C2YA 2VXKA 1K4JA 4KLVA 2GIVA 1S5KA 3H4QA 4UBRA 4CAXA 4KUBA 4M3SA 3IU2A 4KVME 3SXOA 4U9ZA 1IYKA 3DNSA 4ZGYB 2OZGA 2A4NA 3GYAA 2O28A 3LODA 4XPKA 3R1KA 3N7ZA 1MJBA 2G0BA 3ZJ0A 3B8GA 2B4DB 1Z4EA 4HNWB 4BMHA 4PSWA 4MFZA 4OLLA 2GANA 3OWCA 5DWNA 5F49A 4CYOA 3JUWA 2B3VA 4IF5A 3JVNA 1L0CA 5KTCA 4AG7A 4KOYA 2Q0YA 4CGLA 5J8FA 2Z3PA 1YK3A 4MFQA 2Q44A 4C2XA 4A95A 4QBJA 4JJXA 4LX9A 2JEVA 1XEBA 1Q2CA 4KOVA 4KSFA 4ONUA 4HNXB 4UFVA 4CAFA 2QECA 1MK4A 3R9FA 4QC6A 4XPDC 4QB9A 1M1DA 2P0WA 2R98A 4KOTA 4NSQA 2EUIA 3WR7A 2FSRA 2Z3OA 2Z3KA 4F0XA 1YLEA 1NE9A 5AG7A 2BSWA 5F46A 3DDDA 2EVNA 4HKFA 4A32A 5KTAA 4KUAA 4UWJA 4CGNA 1U6MA 5C88A 1M44A 3K9UA 3ZZIA 2REFA 3MGDA 2Y0MA 3KKWA 1PU9A 4AG9A 3IWEA 4OAEA 5F47A 2FCKA 5EBVA 1QSMA 3V8IA 1RXTA 2REEA 2P6GA 2B3UA 1S60A 4FD6A 2Z3LA 4Q36A 4YRHA 2J8MA 4NEXA 1KUVA 3FIXA 1Y9WA 3G8WA 1KUXA 3D8PA 1XIXA 3F0AA 4UCMA 1B6BA 2JLMA 3A9LA 4MFJA 2K5TA 1Y9KA 2OZUA 1MJAA 5EC4A 4KS9A 1OZPA 2X7BA 1YGHA 3CXSA 1CJWA 4E0AA 2Z3NA 2CNMA 3FYNA 3D3SA 4PK2A 5A27A 4CRYB 4JXRA 1J4JA 1QSOA 4KZTA 4MHDA 4DNCA 5BWAB 4BBHA 4C68A 3R9EA 1Y7RA 1ZO0A 5ISVA 4UA3A 3F5BA 3FXTA 3CXQA 2DXQA 2VI7A 5JQ4A 3FRMA 1KZFA 3PP9A 4B13A 5AGEA 2ZW4A 2YNEA 3GKRA 1Z9UA 4KVXA 1RO5A 4OADA 1XMTA 3EFAA 4XPDB 4FD5A 2HQYA 2GE3A 1V0CA 2B5GB 2PR1A 4Q38A 3EY5A 2PSWA 3SHPA 2Z10A 3R96A 3S6GA 2Q4VA 2P6FA 2ARHA 5G21A 3IGRA 4A30A 5HMNA 4EVYA 1S7LA 2IL4A 5C82A 3W6SA 2VQYA 2ZW7A 4RI1A 4AVAA 4U9YA 5IX3A 2I00A 4B5PB 3PZJA 4GS4A 1YR0A 1QSTA 3TOBA 1P4NA 4MJ8A 1XF8A 4CRZB 1B87A 3TO7A 3TFYA 4AVCA 1YVKA 3EXNA 4AB7A 3R9GA 3TO6A 3TOAA 1P0HA 2B4DA 1NMTA 4PV6A 4FD4A 4MBUA 4C2ZA 1ON0A 3IWGA 3BJ8A 4QUSA 1CM0A 1S7KA 4JLYA 1Q2YA 2FE7A 4H6UA 4MY0A 4R3LA 2PDOA 4JWPA 2F5IA 1VHSA 2ZW6A 1QSRA 2BEIA 4KOXA 2FL4A 2FIAA 4L8AA 2C27A 2HV2A 1N71A 3I9SA 1YX0A 5DWMA 4MFKA 5H84A 1M4DA 2KCWA 5A28A 2BUEA 1FY7A 2H5MA 2OU2A 2BL1A 2ZPAA 2Q04A 1S7FA 2D4OA 3D2PA 4NXYA 3G3SA 4KVOE 5G22A 3NE7A 5AG4A 2PR8A 4CYQA 1WWZA 3R95A 4CS0B 2Q4YA 2Z0ZA 3FB3A 3SXNA 2D4PA 2YNCA 1PUAA 2J8RA 4QVTA 4HNYB 3S6HA 3P2FA 5IV0A 4B10A 3QB8A 2YGWA 2R8VA 2Z11A 3FBUA 2VBQA 1I12A 4X5KA 3C26A 4UWIA 4CYPA 4F0YA 2R7HA 3DR6A 4R87A 1Q2DA 4XNHC 4H89A 4Y49C 2JDCA 2CNTA 2NMTA 1NSLA 3F8KA 5KTDA 2FT0A 4KOSA 3W6XA 4M85A 3FNCA 4CGMA 1TIQA 2HUZA 1YVOA 4A33A 2ATRA 2Z3MA 3E0KA 4CAVA 1YREA 3TE4A 3DSBA 4AVBA 4IUSA 4YFJA 5H86A 5F48A 4YGOA 1BO4A 1IB1E 2B58A 5G1ZA 2FXFA 3I3GA 1WK4A 2QMLA 4FD7A 2ZW5A 3JTKA 4A2ZA 3QAHA 5GCNA 4F6AA 5G20A 4KLWA 5HH1A 2FS5A 4Y49B 2QIRA 3W91A 4UCNA 4L89A 4K30A 3IU1A 4NF1A 4B14A 4A31A 2Q7BA 5IB0A 4KOUA 1XE4A 1LRZA 2WUUA 4U5YA 1KUYA 2G3TA 2OZHA 2PC1A 2PQ8A 4C7HA 1GHEA 2WSAA 3S6FA 3VWDA 3T90A 3GY9A 5AG6A 1I21A 3D2MA 4PSXA 1UFHA 2VEZA 4MY3A 1I1DA 2VZYA 4NCZA 2P6EA 4B5PA 4ORFA 4JXQA 3EC4A 4R3KA 2VZZA 3RYOA 4J3GA 2AJ6A 2JDDA 2FIWA 3T9YA 4KOWA 3TT2A 4R9MA 3VWEA 5JPHA 4CAEA 1M4IA 4CYNA 1S7NA 3TTHA 2B4BA 2CNSA 2ZXVA 3LD2A 2WPXA 4II9A 2AE6A 1BOBA 4UFWA 4C7IA 2RC4A 3EO4A 2YNCC 4CGOA 3BLNA 2R1IA 3DR8A 3P2HA 1Z4RA 1SQHA 3H5ZA 4KORA 5E96A 3UY5A 1M4GA 2WPWA 2I79A 4MFLA 2J8NA 2OH1A 3TO9A 1IICA 2YNDA 4E2AA 4XPLA 1MJ9A 2DPSA 4E8OA 4CGPA 1IYLA 4UFXA 3CXPA 1QSNA 4PK3A 5AG5A 3TCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B5O A;  1R57 A;  4I49 A;  1S3Z A;  4ZBG A;  3S6K A;  4MI4 A;  4XNH B;  2PRB A;  2OB0 A;  1VKC A;  2B5G A;  1IID A;  4LUA A;  4RS2 A;  2G3A A;  5J8C A;  3PGP A;  5FVJ A;  4H6Z A;  4R57 A;  4CAW A;  4JD6 A;  5CNP A;  5I0C A;  3BJ7 A;  2CY2 A;  2VXK A;  1K4J A;  4KLV A;  2GIV A;  1S5K A;  3H4Q A;  4UBR A;  4CAX A;  4KUB A;  4M3S A;  4KVM E;  3SXO A;  4U9Z A;  1IYK A;  3DNS A;  2OZG A;  2A4N A;  3GYA A;  2O28 A;  3LOD A;  4XPK A;  3R1K A;  3N7Z A;  1MJB A;  2G0B A;  3ZJ0 A;  3B8G A;  2B4D B;  1Z4E A;  4HNW B;  4BMH A;  4PSW A;  4OLL A;  2GAN A;  3OWC A;  5DWN A;  5F49 A;  3JUW A;  2B3V A;  4IF5 A;  3JVN A;  1L0C A;  5KTC A;  4AG7 A;  4KOY A;  2Q0Y A;  5J8F A;  1YK3 A;  2Q44 A;  4QBJ A;  4JJX A;  4LX9 A;  2JEV A;  1XEB A;  1Q2C A;  4KOV A;  4ONU A;  4HNX B;  2QEC A;  1MK4 A;  3R9F A;  4QC6 A;  4XPD C;  4QB9 A;  1M1D A;  2P0W A;  2R98 A;  4KOT A;  4NSQ A;  2EUI A;  3WR7 A;  2FSR A;  1YLE A;  1NE9 A;  2BSW A;  5F46 A;  3DDD A;  2EVN A;  4HKF A;  5KTA A;  4KUA A;  4UWJ A;  1U6M A;  5C88 A;  1M44 A;  3K9U A;  3ZZI A;  2REF A;  3MGD A;  2Y0M A;  3KKW A;  1PU9 A;  4AG9 A;  4OAE A;  5F47 A;  2FCK A;  5EBV A;  1QSM A;  3V8I A;  1RXT A;  2REE A;  2P6G A;  2B3U A;  1S60 A;  4FD6 A;  4YRH A;  2J8M A;  4NEX A;  1KUV A;  3FIX A;  1Y9W A;  3G8W A;  1KUX A;  3D8P A;  1XIX A;  3F0A A;  1B6B A;  2JLM A;  2K5T A;  1Y9K A;  2OZU A;  1MJA A;  5EC4 A;  1OZP A;  2X7B A;  1YGH A;  3CXS A;  1CJW A;  4E0A A;  2CNM A;  3FYN A;  3D3S A;  4PK2 A;  4CRY B;  4JXR A;  1J4J A;  1QSO A;  4KZT A;  4MHD A;  4DNC A;  3R9E A;  1Y7R A;  5ISV A;  4UA3 A;  3F5B A;  3FXT A;  3CXQ A;  2DXQ A;  2VI7 A;  5JQ4 A;  3FRM A;  1KZF A;  3PP9 A;  2ZW4 A;  3GKR A;  1Z9U A;  4KVX A;  1RO5 A;  4OAD A;  1XMT A;  3EFA A;  4XPD B;  4FD5 A;  2HQY A;  2GE3 A;  1V0C A;  2B5G B;  2PR1 A;  3EY5 A;  2PSW A;  3SHP A;  2Z10 A;  3R96 A;  3S6G A;  2Q4V A;  2P6F A;  2ARH A;  3IGR A;  5HMN A;  4EVY A;  1S7L A;  2IL4 A;  5C82 A;  3W6S A;  2VQY A;  2ZW7 A;  4RI1 A;  4AVA A;  4U9Y A;  5IX3 A;  2I00 A;  4B5P B;  3PZJ A;  4GS4 A;  1YR0 A;  1QST A;  3TOB A;  1P4N A;  4MJ8 A;  1XF8 A;  4CRZ B;  1B87 A;  3TO7 A;  3TFY A;  4AVC A;  1YVK A;  3EXN A;  4AB7 A;  3R9G A;  3TO6 A;  3TOA A;  1P0H A;  2B4D A;  1NMT A;  4PV6 A;  4FD4 A;  4MBU A;  1ON0 A;  3IWG A;  3BJ8 A;  4QUS A;  1CM0 A;  1S7K A;  4JLY A;  1Q2Y A;  2FE7 A;  4H6U A;  4MY0 A;  4R3L A;  2PDO A;  4JWP A;  2F5I A;  1VHS A;  2ZW6 A;  1QSR A;  2BEI A;  4KOX A;  2FL4 A;  2FIA A;  4L8A A;  2C27 A;  2HV2 A;  1N71 A;  3I9S A;  1YX0 A;  5DWM A;  5H84 A;  1M4D A;  2KCW A;  2BUE A;  1FY7 A;  2H5M A;  2OU2 A;  2BL1 A;  2ZPA A;  2Q04 A;  1S7F A;  2D4O A;  3D2P A;  4NXY A;  3G3S A;  4KVO E;  3NE7 A;  2PR8 A;  1WWZ A;  3R95 A;  4CS0 B;  2Q4Y A;  2Z0Z A;  3FB3 A;  3SXN A;  2D4P A;  1PUA A;  2J8R A;  4QVT A;  4HNY B;  3S6H A;  3P2F A;  5IV0 A;  3QB8 A;  2R8V A;  2Z11 A;  3FBU A;  2VBQ A;  1I12 A;  4X5K A;  3C26 A;  4UWI A;  4F0Y A;  2R7H A;  3DR6 A;  4R87 A;  1Q2D A;  4XNH C;  4H89 A;  4Y49 C;  2JDC A;  2CNT A;  2NMT A;  1NSL A;  3F8K A;  5KTD A;  2FT0 A;  4KOS A;  3W6X A;  4M85 A;  3FNC A;  1TIQ A;  2HUZ A;  1YVO A;  2ATR A;  3E0K A;  4CAV A;  1YRE A;  3TE4 A;  3DSB A;  4AVB A;  4IUS A;  4YFJ A;  5H86 A;  5F48 A;  4YGO A;  1BO4 A;  1IB1 E;  2B58 A;  2FXF A;  3I3G A;  1WK4 A;  2QML A;  4FD7 A;  2ZW5 A;  3QAH A;  5GCN A;  4F6A A;  4KLW A;  5HH1 A;  2FS5 A;  4Y49 B;  2QIR A;  3W91 A;  4L89 A;  4K30 A;  4NF1 A;  2Q7B A;  5IB0 A;  4KOU A;  1XE4 A;  1LRZ A;  4U5Y A;  1KUY A;  2G3T A;  2OZH A;  2PC1 A;  2PQ8 A;  1GHE A;  3S6F A;  3VWD A;  3T90 A;  3GY9 A;  1I21 A;  3D2M A;  4PSX A;  1UFH A;  2VEZ A;  4MY3 A;  1I1D A;  2VZY A;  4NCZ A;  2P6E A;  4B5P A;  4ORF A;  4JXQ A;  3EC4 A;  4R3K A;  2VZZ A;  3RYO A;  4J3G A;  2AJ6 A;  2JDD A;  2FIW A;  3T9Y A;  4KOW A;  3TT2 A;  4R9M A;  3VWE A;  5JPH A;  1M4I A;  1S7N A;  3TTH A;  2B4B A;  2CNS A;  2ZXV A;  3LD2 A;  2WPX A;  4II9 A;  2AE6 A;  1BOB A;  2RC4 A;  3EO4 A;  3BLN A;  2R1I A;  3DR8 A;  3P2H A;  1Z4R A;  1SQH A;  4KOR A;  5E96 A;  3UY5 A;  1M4G A;  2WPW A;  2I79 A;  2J8N A;  2OH1 A;  3TO9 A;  1IIC A;  4E2A A;  4XPL A;  1MJ9 A;  4E8O A;  1IYL A;  3CXP A;  1QSN A;  4PK3 A;  3TCV A; 
#chains in the Genus database with same CATH topology
 3MN8 A;  4NGM A;  4B5O A;  2C6P A;  1R57 A;  2V8V A;  3FH4 A;  4R7M A;  4P4F A;  4I49 A;  1S3Z A;  1F2O A;  2C1C A;  4KSA A;  4ZBG A;  2GLJ A;  4MFP A;  3S6K A;  4MI4 A;  1JWQ A;  4XNH B;  3D4U A;  2I3C A;  2PRB A;  4UCP A;  2POK A;  1Y7E A;  2OB0 A;  1Q7L A;  1VKC A;  2B5G A;  1IID A;  2CXA A;  4LUA A;  3IFE A;  4RS2 A;  2G3A A;  5J8C A;  2DPT A;  3PGP A;  5FVJ A;  4GM5 A;  4H6Z A;  5DS0 A;  4R57 A;  2BOA A;  4CAW A;  2GRE A;  4JD6 A;  5K8O A;  5CNP A;  2O4H A;  2AFO A;  5I0C A;  3FED A;  1AUG A;  1Z8T A;  3BJ7 A;  4K3N A;  4B11 A;  2CY2 A;  3H8G A;  2Q51 A;  4B12 A;  2AFM A;  4C2Y A;  2PJ0 A;  1Z5R A;  1YW4 A;  4P4B A;  2G9D A;  2VXK A;  3LMS A;  4ONW A;  4FWU A;  1AYE A;  1K4J A;  4KLV A;  2AFW A;  1S5K A;  2GIV A;  3FJU A;  4HPS A;  2IJZ A;  3H4Q A;  2XEJ A;  4UBR A;  1BPN A;  3S9M A;  4CAX A;  4KUB A;  2J9A A;  4M3S A;  3IU2 A;  4KVM E;  3SXO A;  4U9Z A;  1IYK A;  3L2N A;  3DNS A;  3V38 A;  3PEI A;  2OZG A;  4ZGY B;  2A4N A;  3GYA A;  2O28 A;  3KGQ A;  3LOD A;  1F57 A;  3R1K A;  4XPK A;  3N7Z A;  1TF8 A;  1MJB A;  2G0B A;  3ZJ0 A;  3FVL A;  2AFZ A;  2V8G A;  3B3T A;  2ANP A;  2B4D B;  3B8G A;  1Z4E A;  3H8F A;  4HNW B;  4BMH A;  4PSW A;  4MFZ A;  4EFD A;  2PJ3 A;  4OLL A;  4P45 A;  4PXE A;  2O53 A;  2GAN A;  1Y0R A;  4X3R A;  3OWC A;  5DWN A;  2ZOF A;  3RBU A;  1VIX A;  5F49 A;  4CYO A;  3JUW A;  2B3V A;  4IF5 A;  3JVN A;  1L0C A;  8CPA A;  2GFQ A;  3HUV A;  5KTC A;  4AG7 A;  4KOY A;  2Q0Y A;  4GXH A;  4CGL A;  3LWU A;  2Z3P A;  1YK3 A;  4MFQ A;  3B3V A;  2Q44 A;  5J8F A;  4IK2 A;  4C2X A;  4A95 A;  4P4E A;  4JZ0 A;  1QQ9 A;  3WC7 A;  4JJX A;  4LX9 A;  4QBJ A;  2JEV A;  1XEB A;  1Q2C A;  4KOV A;  1VGY A;  4KSF A;  4ONU A;  4HNX B;  4UFV A;  4CAF A;  4Z65 A;  4OME A;  2QEC A;  1MK4 A;  1Y0Y A;  3RNZ A;  3R9F A;  4QC6 A;  4XPD C;  2HC9 A;  4QB9 A;  1RTQ A;  4P4D A;  3QAY A;  1M1D A;  2P0W A;  3D7G A;  2R98 A;  4WWV A;  4A37 A;  4KOT A;  2PE3 A;  2EUI A;  4NSQ A;  2ABZ A;  2FSR A;  2Z3O A;  2Z3K A;  3WR7 A;  4F0X A;  1YLE A;  1NE9 A;  5AG7 A;  3SJG A;  2V8D A;  2BSW A;  4MHN A;  5JGF A;  5F46 A;  3DDD A;  2EVN A;  2QYV A;  4YWY A;  2CIJ A;  4HKF A;  3KHX A;  4A32 A;  5KTA A;  2RFH A;  4KUA A;  4UWJ A;  4CGN A;  5CPA A;  1DE4 C;  2AFS A;  1U6M A;  4MHZ A;  5C88 A;  2ZEG A;  1M44 A;  3K9U A;  3ZZI A;  4OC0 A;  2REF A;  5JH9 A;  2AFU A;  1OBR A;  3MGD A;  2Y0M A;  2JEW A;  3BI0 A;  3KKW A;  1ARM A;  1X10 A;  1PU9 A;  4AG9 A;  2C6C A;  3IWE A;  4OAE A;  3V7Z A;  3PB6 X;  2FCK A;  5EBV A;  1QSM A;  5F47 A;  3V8I A;  1RXT A;  2REE A;  4ZX8 A;  3TX8 A;  4UEE A;  2P6G A;  2B3U A;  2ODF A;  4AXV A;  2ZEL A;  4YU9 A;  1S60 A;  4FD6 A;  4PQA A;  3LAC A;  3BHX A;  4FUU A;  4R8F A;  2Z3L A;  4Q36 A;  4YRH A;  2J8M A;  4NEX A;  1KUV A;  4A38 A;  3KR4 A;  3FIX A;  3B7I A;  3WT4 A;  3S9L A;  1Y9W A;  3G8W A;  3MRU A;  3GB0 A;  1KUX A;  3D8P A;  2ZOG A;  1XIX A;  3F0A A;  4UCM A;  3KHZ A;  2JBJ A;  1XMB A;  4F8Z A;  1B6B A;  2JLM A;  3A9L A;  4MFJ A;  2K5T A;  1TKH A;  1Y9K A;  2OZU A;  1MJA A;  5EC4 A;  4KS9 A;  1IU8 A;  4IHM A;  3IC1 A;  1OZP A;  2X7B A;  1YGH A;  2F7V A;  1CJW A;  3CXS A;  3VAR A;  4E0A A;  3S9N A;  2Z3N A;  2CNM A;  3FYN A;  3D3S A;  2QJ8 A;  4PK2 A;  5A27 A;  4CRY B;  3KQZ A;  4JXR A;  1J4J A;  1QSO A;  4KZT A;  4MHD A;  4DNC A;  3CDX A;  5BWA B;  4BBH A;  3VH9 A;  3R9E A;  1Y7R A;  1ZO0 A;  4C68 A;  2CF4 A;  5ISV A;  2FVG A;  3SI0 A;  4UA3 A;  3F5B A;  1LAN A;  3FXT A;  5ELY A;  1CPS A;  5I4M A;  4OC4 A;  4ZY2 A;  3IWW A;  2DEA A;  3CXQ A;  2DXQ A;  2PJ1 A;  2VI7 A;  5JQ4 A;  3FRM A;  1KZF A;  3PP9 A;  4B13 A;  1YW6 A;  3I1U A;  4NJQ A;  5AGE A;  3GUX A;  2ZW4 A;  2PJB A;  2BO9 A;  2YNE A;  3GKR A;  1Z9U A;  4KVX A;  1RO5 A;  3D67 A;  4OAD A;  4KSI A;  1XMT A;  3EFA A;  3PB7 X;  4Q7A A;  4XPD B;  4FD5 A;  5HVF A;  2HQY A;  2GE3 A;  1FNO A;  5LRG A;  1V0C A;  4MCQ A;  2B5G B;  2PR1 A;  4Q38 A;  1Z8X A;  3EY5 A;  1HDU A;  2PSW A;  3SHP A;  2Z10 A;  3KZW A;  3R96 A;  3S6G A;  2Q4V A;  3CT9 A;  2P6F A;  3WC6 A;  2ARH A;  3NH5 A;  5G21 A;  2PJ2 A;  3D7F A;  3IGR A;  3KAS A;  4A30 A;  5HMN A;  4EVY A;  4G1P A;  3WC5 A;  1S7L A;  2IL4 A;  1LFW A;  5C82 A;  3W6S A;  1M4L A;  1IOI A;  2BCO A;  4UIA A;  4UF4 A;  3BXM A;  2VQY A;  3B35 A;  2ZW7 A;  5K8M A;  4RI1 A;  1AMP A;  4AVA A;  4U9Y A;  5IX3 A;  4DYO A;  2VL1 A;  2I00 A;  3NE8 A;  4B5P B;  4P4J A;  4NGP A;  2XEG A;  3PZJ A;  4MRI A;  4GS4 A;  4CPA A;  1YR0 A;  1QST A;  3TOB A;  4M6G A;  1FT7 A;  1NSA A;  1P4N A;  7CPA A;  4MJ8 A;  5K8P A;  2Q43 A;  1XF8 A;  1BLL E;  1XOV A;  4P44 A;  3RAM A;  4CRZ B;  1B87 A;  3FEC A;  1YLO A;  3TO7 A;  3TFY A;  2PVV A;  4AVC A;  1HEE A;  4TNU A;  1YVK A;  3EXN A;  1ZG8 A;  4AB7 A;  3R9G A;  4NFR A;  1YSJ A;  3TO6 A;  3TOA A;  1P0H A;  2B4D A;  1NMT A;  4PV6 A;  1CPX A;  4FD4 A;  4TWE A;  4MBU A;  4C2Z A;  1ON0 A;  3IWG A;  3BJ8 A;  1XFO A;  4QUS A;  1CM0 A;  1ZLI A;  4X2T A;  1S7K A;  4JLY A;  1Q2Y A;  3NFZ A;  2FE7 A;  4H6U A;  4DUK A;  5D29 A;  1CG2 A;  4R76 A;  3GIU A;  5HVH A;  4BIN A;  4ZY1 A;  1LAP A;  4MY0 A;  4R3L A;  2PDO A;  3QNV A;  4JWP A;  2WZN A;  2F5I A;  3PFO A;  4P4I A;  1XBU A;  2EWB A;  4IAV A;  3IEH A;  1PYT B;  1VHS A;  2ZW6 A;  3PB9 X;  2V8H A;  1QSR A;  3D68 A;  3SI1 A;  2BEI A;  4KOX A;  1CP6 A;  2FL4 A;  6CPA A;  2FIA A;  4L8A A;  2C27 A;  4MCR A;  2HV2 A;  1N71 A;  3DGV A;  3I9S A;  1YX0 A;  5DWM A;  4MFK A;  1F2P A;  3N5F A;  3H8E A;  4OC5 A;  1H8L A;  5H84 A;  1M4D A;  2WYR A;  2KCW A;  5EMI A;  4F9V A;  1BPM A;  4BD9 A;  5A28 A;  3D7D A;  2ZEN A;  2PJ6 A;  2BUE A;  5HVG A;  1FY7 A;  4WJB A;  4UEZ A;  2H5M A;  2OU2 A;  2BL1 A;  2ZPA A;  2ZEO A;  5J1Q A;  2Q04 A;  1S7F A;  2D4O A;  2GU2 A;  3B2Y A;  3D2P A;  4NJR A;  4NXY A;  4NGS A;  3G3S A;  4KVO E;  5G22 A;  2PJ8 A;  4OP4 A;  3NE7 A;  2PIY A;  2ZEF A;  5AG4 A;  5LRJ A;  2PR8 A;  4CYQ A;  1WWZ A;  3R95 A;  4UIB A;  4ZYQ A;  1IOF A;  4CS0 B;  2Q4Y A;  2Z0Z A;  2CTC A;  3FB3 A;  3SXN A;  5THW A;  4P10 A;  2D4P A;  2XEI A;  2YNC A;  1PUA A;  2J8R A;  4QVT A;  2QVP A;  4HNY B;  3S6H A;  4JYW A;  2EK8 A;  4F9U A;  4OC3 A;  3P2F A;  3FX6 A;  5IV0 A;  4B10 A;  3QB8 A;  4MHP A;  2YGW A;  2R8V A;  1HDQ A;  2Z11 A;  3FBU A;  2VBQ A;  1I12 A;  3SJE A;  4NGQ A;  3SJF A;  1QMU A;  4O23 A;  4X5K A;  4W9Y A;  1VHO A;  4MXU A;  2PVW A;  3C26 A;  4UWI A;  2F8H A;  3PBB A;  4CYP A;  3IO1 A;  1ARL A;  4F0Y A;  2R7H A;  2OOT A;  4MMO A;  3PRT A;  2Q7S A;  3DR6 A;  1LCP A;  4R87 A;  1Q2D A;  4XNH C;  4H89 A;  4Y49 C;  5D8N A;  2JDC A;  2CNT A;  3JRU A;  2NMT A;  1NSL A;  3F8K A;  5JM6 A;  3KR5 A;  5KTD A;  2PJ9 A;  2PJC A;  1ELM P;  2FT0 A;  4KOS A;  3W6X A;  2V77 A;  4M85 A;  1EE3 P;  3FNC A;  2XEF A;  4M6I A;  4R6T A;  4CGM A;  1TIQ A;  2HUZ A;  1YVO A;  4ZX9 A;  2ATR A;  4PXB A;  4A33 A;  2Z3M A;  5LYI A;  4EWT A;  1BAV A;  4B6Z A;  3NH8 A;  3E0K A;  4OKO A;  4CAV A;  1YRE A;  3TE4 A;  3IJ3 A;  1KWM A;  4NGT A;  3DSB A;  4A94 A;  4AVB A;  5LYL A;  4IUS A;  4YFJ A;  4MCP A;  1R3N A;  1TF9 A;  5H86 A;  5F48 A;  4YGO A;  4P6Y A;  1BO4 A;  3ISZ A;  1IB1 E;  2B58 A;  5LYD A;  1TKJ A;  4X8I A;  1X12 A;  5G1Z A;  1LOK A;  2FXF A;  2PJA A;  2ZEM A;  4FBE A;  3I3G A;  4RUH A;  1WK4 A;  3NA6 A;  4MHY A;  4EME A;  5HXD A;  5LRK A;  2QML A;  4FD7 A;  2ZW5 A;  3JTK A;  3KQX A;  4A2Z A;  3CPX A;  3QAH A;  2AFX A;  5GCN A;  5G20 A;  4F6A A;  4KLW A;  2PRQ A;  4PPZ A;  5HH1 A;  2FS5 A;  4OC1 A;  1IY7 A;  1CBX A;  2EO8 A;  2QIR A;  4Y49 B;  2C6G A;  3W91 A;  2RB7 A;  3PBE A;  4L89 A;  1TXR A;  4K30 A;  4UCN A;  3IU1 A;  4OC2 A;  3SI2 A;  4NF1 A;  4B14 A;  4A31 A;  1XJO A;  1Z2L A;  2Q7B A;  4DJL A;  5IB0 A;  4KOU A;  3FF3 A;  3IIB A;  1XE4 A;  1LRZ A;  2NYQ A;  2WUU A;  3KI9 A;  5LYF A;  4U5Y A;  1KUY A;  2G3T A;  2PC1 A;  2OZH A;  2PQ8 A;  2ZEP A;  1GHE A;  3GLJ A;  4C7H A;  2NSM A;  4PXC A;  1VHE A;  2WSA A;  4NGR A;  3FEE A;  3S6F A;  2PIZ A;  3FMC A;  2ZED A;  1UWY A;  3K9T A;  3KL9 A;  3GY9 A;  3HLP A;  3T90 A;  3VWD A;  5AG6 A;  1TKF A;  1I21 A;  4RN7 A;  3D2M A;  4PSX A;  1LAM A;  1UFH A;  1IGB A;  1ZG7 A;  2VEZ A;  1I1D A;  2IQ6 A;  2VZY A;  4MY3 A;  2P6E A;  4NCZ A;  4B5P A;  2GLF A;  4ORF A;  4A39 A;  4JXQ A;  3EC4 A;  3BI1 A;  3NH4 A;  4R3K A;  1YME A;  2VZZ A;  3RYO A;  4J3G A;  2AJ6 A;  3SJX A;  4MCS A;  3ISX A;  1PCA A;  2JDD A;  2FIW A;  3T9Y A;  4KOW A;  3TT2 A;  5CBM A;  4R9M A;  3VWE A;  5JPH A;  4CAE A;  1M4I A;  4CYN A;  1S7N A;  1Z8W A;  2PJ5 A;  3TTH A;  2B4B A;  2CNS A;  2ZXV A;  1R43 A;  3LD2 A;  1DTD A;  2WPX A;  3PB8 X;  3K2K A;  2JBK A;  3T8W A;  1JQG A;  4NGN A;  2AE6 A;  4FAI A;  2DF5 A;  1BOB A;  4II9 A;  4UFW A;  4C7I A;  2RC4 A;  2CTB A;  3EO4 A;  2YNC C;  2HB6 A;  4CGO A;  5F09 A;  3BLN A;  2IMO A;  2R1I A;  3CPA A;  3DR8 A;  2EK9 A;  4LQG A;  3P2H A;  1Z4R A;  1SQH A;  1ELL P;  4OIW A;  1Z8L A;  3H5Z A;  3PB4 X;  4KOR A;  1CX8 A;  4PXD A;  5E96 A;  5IB9 A;  4H2K A;  3UY5 A;  1M4G A;  4ZI6 A;  2WPW A;  2I79 A;  1CP7 A;  3PFE A;  4MFL A;  3B3S A;  1XRY A;  3D7H A;  1A2Z A;  2PJ7 A;  2Q4Z A;  2J8N A;  2OH1 A;  3WAB A;  4ZY0 A;  3TO9 A;  3VAT A;  1IIC A;  3RO0 A;  3CZX A;  1ZLH A;  2YND A;  2EBJ A;  4M6H A;  4E2A A;  1YQE A;  3D66 A;  4XPL A;  1MJ9 A;  4UEF A;  3B3C A;  3DLJ A;  2PCU A;  2OR4 A;  2DPS A;  1GYT A;  4OID A;  3TC8 A;  4CGP A;  4E8O A;  1IYL A;  4UFX A;  5K8N A;  3CXP A;  1QSN A;  1ZG9 A;  2PJ4 A;  2ZEE A;  4LQ6 A;  2ZEH A;  4PK3 A;  5AG5 A;  3RZA A;  3TCV A;  3B3W A; 
#chains in the Genus database with same CATH homology
 4B5O A;  1R57 A;  4I49 A;  1S3Z A;  4KSA A;  4ZBG A;  4MFP A;  3S6K A;  4MI4 A;  4XNH B;  2PRB A;  4UCP A;  2OB0 A;  1VKC A;  2B5G A;  1IID A;  2CXA A;  4LUA A;  4RS2 A;  2G3A A;  5J8C A;  2DPT A;  3PGP A;  5FVJ A;  4H6Z A;  4R57 A;  4CAW A;  4JD6 A;  5CNP A;  5I0C A;  4B11 A;  3BJ7 A;  2CY2 A;  4B12 A;  4C2Y A;  2VXK A;  1K4J A;  4KLV A;  2GIV A;  1S5K A;  3H4Q A;  4UBR A;  4CAX A;  4KUB A;  4M3S A;  3IU2 A;  4KVM E;  3SXO A;  4U9Z A;  1IYK A;  3DNS A;  4ZGY B;  2OZG A;  2A4N A;  3GYA A;  2O28 A;  3LOD A;  4XPK A;  3R1K A;  3N7Z A;  1MJB A;  2G0B A;  3ZJ0 A;  3B8G A;  2B4D B;  1Z4E A;  4HNW B;  4BMH A;  4PSW A;  4MFZ A;  4OLL A;  2GAN A;  3OWC A;  5DWN A;  5F49 A;  4CYO A;  3JUW A;  2B3V A;  4IF5 A;  3JVN A;  1L0C A;  5KTC A;  4AG7 A;  4KOY A;  2Q0Y A;  4CGL A;  5J8F A;  2Z3P A;  1YK3 A;  4MFQ A;  2Q44 A;  4C2X A;  4A95 A;  4QBJ A;  4JJX A;  4LX9 A;  2JEV A;  1XEB A;  1Q2C A;  4KOV A;  4KSF A;  4ONU A;  4HNX B;  4UFV A;  4CAF A;  2QEC A;  1MK4 A;  3R9F A;  4QC6 A;  4XPD C;  4QB9 A;  1M1D A;  2P0W A;  2R98 A;  4KOT A;  4NSQ A;  2EUI A;  3WR7 A;  2FSR A;  2Z3O A;  2Z3K A;  4F0X A;  1YLE A;  1NE9 A;  5AG7 A;  2BSW A;  5F46 A;  3DDD A;  2EVN A;  4HKF A;  4A32 A;  5KTA A;  4KUA A;  4UWJ A;  4CGN A;  1U6M A;  5C88 A;  1M44 A;  3K9U A;  3ZZI A;  2REF A;  3MGD A;  2Y0M A;  3KKW A;  1PU9 A;  4AG9 A;  3IWE A;  4OAE A;  5F47 A;  2FCK A;  5EBV A;  1QSM A;  3V8I A;  1RXT A;  2REE A;  2P6G A;  2B3U A;  1S60 A;  4FD6 A;  2Z3L A;  4Q36 A;  4YRH A;  2J8M A;  4NEX A;  1KUV A;  3FIX A;  1Y9W A;  3G8W A;  1KUX A;  3D8P A;  1XIX A;  3F0A A;  4UCM A;  1B6B A;  2JLM A;  3A9L A;  4MFJ A;  2K5T A;  1Y9K A;  2OZU A;  1MJA A;  5EC4 A;  4KS9 A;  1OZP A;  2X7B A;  1YGH A;  3CXS A;  1CJW A;  4E0A A;  2Z3N A;  2CNM A;  3FYN A;  3D3S A;  4PK2 A;  5A27 A;  4CRY B;  4JXR A;  1J4J A;  1QSO A;  4KZT A;  4MHD A;  4DNC A;  5BWA B;  4BBH A;  4C68 A;  3R9E A;  1Y7R A;  1ZO0 A;  5ISV A;  4UA3 A;  3F5B A;  3FXT A;  3CXQ A;  2DXQ A;  2VI7 A;  5JQ4 A;  3FRM A;  1KZF A;  3PP9 A;  4B13 A;  5AGE A;  2ZW4 A;  2YNE A;  3GKR A;  1Z9U A;  4KVX A;  1RO5 A;  4OAD A;  1XMT A;  3EFA A;  4XPD B;  4FD5 A;  2HQY A;  2GE3 A;  1V0C A;  2B5G B;  2PR1 A;  4Q38 A;  3EY5 A;  2PSW A;  3SHP A;  2Z10 A;  3R96 A;  3S6G A;  2Q4V A;  2P6F A;  2ARH A;  5G21 A;  3IGR A;  4A30 A;  5HMN A;  4EVY A;  1S7L A;  2IL4 A;  5C82 A;  3W6S A;  2VQY A;  2ZW7 A;  4RI1 A;  4AVA A;  4U9Y A;  5IX3 A;  2I00 A;  4B5P B;  3PZJ A;  4GS4 A;  1YR0 A;  1QST A;  3TOB A;  1P4N A;  4MJ8 A;  1XF8 A;  4CRZ B;  1B87 A;  3TO7 A;  3TFY A;  4AVC A;  1YVK A;  3EXN A;  4AB7 A;  3R9G A;  3TO6 A;  3TOA A;  1P0H A;  2B4D A;  1NMT A;  4PV6 A;  4FD4 A;  4MBU A;  4C2Z A;  1ON0 A;  3IWG A;  3BJ8 A;  4QUS A;  1CM0 A;  1S7K A;  4JLY A;  1Q2Y A;  2FE7 A;  4H6U A;  4MY0 A;  4R3L A;  2PDO A;  4JWP A;  2F5I A;  1VHS A;  2ZW6 A;  1QSR A;  2BEI A;  4KOX A;  2FL4 A;  2FIA A;  4L8A A;  2C27 A;  2HV2 A;  1N71 A;  3I9S A;  1YX0 A;  5DWM A;  4MFK A;  5H84 A;  1M4D A;  2KCW A;  5A28 A;  2BUE A;  1FY7 A;  2H5M A;  2OU2 A;  2BL1 A;  2ZPA A;  2Q04 A;  1S7F A;  2D4O A;  3D2P A;  4NXY A;  3G3S A;  4KVO E;  5G22 A;  3NE7 A;  5AG4 A;  2PR8 A;  4CYQ A;  1WWZ A;  3R95 A;  4CS0 B;  2Q4Y A;  2Z0Z A;  3FB3 A;  3SXN A;  2D4P A;  2YNC A;  1PUA A;  2J8R A;  4QVT A;  4HNY B;  3S6H A;  3P2F A;  5IV0 A;  4B10 A;  3QB8 A;  2YGW A;  2R8V A;  2Z11 A;  3FBU A;  2VBQ A;  1I12 A;  4X5K A;  3C26 A;  4UWI A;  4CYP A;  4F0Y A;  2R7H A;  3DR6 A;  4R87 A;  1Q2D A;  4XNH C;  4H89 A;  4Y49 C;  2JDC A;  2CNT A;  2NMT A;  1NSL A;  3F8K A;  5KTD A;  2FT0 A;  4KOS A;  3W6X A;  4M85 A;  3FNC A;  4CGM A;  1TIQ A;  2HUZ A;  1YVO A;  4A33 A;  2ATR A;  2Z3M A;  3E0K A;  4CAV A;  1YRE A;  3TE4 A;  3DSB A;  4AVB A;  4IUS A;  4YFJ A;  5H86 A;  5F48 A;  4YGO A;  1BO4 A;  1IB1 E;  2B58 A;  5G1Z A;  2FXF A;  3I3G A;  1WK4 A;  2QML A;  4FD7 A;  2ZW5 A;  3JTK A;  4A2Z A;  3QAH A;  5GCN A;  4F6A A;  5G20 A;  4KLW A;  5HH1 A;  2FS5 A;  4Y49 B;  2QIR A;  3W91 A;  4UCN A;  4L89 A;  4K30 A;  3IU1 A;  4NF1 A;  4B14 A;  4A31 A;  2Q7B A;  5IB0 A;  4KOU A;  1XE4 A;  1LRZ A;  2WUU A;  4U5Y A;  1KUY A;  2G3T A;  2OZH A;  2PC1 A;  2PQ8 A;  4C7H A;  1GHE A;  2WSA A;  3S6F A;  3VWD A;  3T90 A;  3GY9 A;  5AG6 A;  1I21 A;  3D2M A;  4PSX A;  1UFH A;  2VEZ A;  4MY3 A;  1I1D A;  2VZY A;  4NCZ A;  2P6E A;  4B5P A;  4ORF A;  4JXQ A;  3EC4 A;  4R3K A;  2VZZ A;  3RYO A;  4J3G A;  2AJ6 A;  2JDD A;  2FIW A;  3T9Y A;  4KOW A;  3TT2 A;  4R9M A;  3VWE A;  5JPH A;  4CAE A;  1M4I A;  4CYN A;  1S7N A;  3TTH A;  2B4B A;  2CNS A;  2ZXV A;  3LD2 A;  2WPX A;  4II9 A;  2AE6 A;  1BOB A;  4UFW A;  4C7I A;  2RC4 A;  3EO4 A;  2YNC C;  4CGO A;  3BLN A;  2R1I A;  3DR8 A;  3P2H A;  1Z4R A;  1SQH A;  3H5Z A;  4KOR A;  5E96 A;  3UY5 A;  1M4G A;  2WPW A;  2I79 A;  4MFL A;  2J8N A;  2OH1 A;  3TO9 A;  1IIC A;  2YND A;  4E2A A;  4XPL A;  1MJ9 A;  2DPS A;  4E8O A;  4CGP A;  1IYL A;  4UFX A;  3CXP A;  1QSN A;  4PK3 A;  5AG5 A;  3TCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...