3TG2A

Crystal structure of the isc domain of vibb in complex with isochorismate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
205
structure length
205
Chain Sequence
AIPKIASYPLPVSLPTNKVDWRIDASRAVLLIHNMQEYFVHYFDSQAEPIPSLIKHIQQLKAHAKQAGIPVVYTAQPANQDPAERALLSDFWGPGLSEETAIIAPLAPESGDVQLTKWRYSAFKKSPLLDWLRETGRDQLIITGVYAHIGILSTALDAFMFDIQPFVIGDGVADFSLSDHEFSLRYISGRTGAVKSTQQACLEIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the ISC domain of VibB from Vibrio cholerae at atomic resolution: a snapshot just before the enzymatic reaction
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Hydrolase
molecule keywords Vibriobactin-specific isochorismatase
total genus 72
structure length 205
sequence length 205
ec nomenclature ec 3.3.2.1: Isochorismatase.
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3tg2A00
1YZVA 1XN4A 3MCWA 3KL2A 3OQPA 3OT4A 4H17A 3O94A 1NF8A 3O92A 3TB4A 3V8EA 1J2RA 3IRVA 2WTAA 3HU5A 1IM5A 1ILWA 4WGFA 3EEFA 3PL1A 3TG2A 2FQ1A 1NF9A 4L07A 3HB7A 3O93A 2B34A 1YACA 3TXYA 1NBAA 3R77A 1X9GA 3LQYA 3O91A 2H0RA 4WH0A 3O90A 2WT9A 3UAOA 2A67A 3S2SA 4L08A 3R2JA
chains in the Genus database with same CATH superfamily
3N86A 1NI4B 4C03A 2M32A 4RLFA 5F51A 2QRMA 1JBQA 3K0AB 4PE5B 4AY5A 5EJ5A 5K6RA 4MA4A 2B9EA 4LXIA 4WK0B 1LX7A 4EF4A 1R4MA 3DHNA 1IM5A 3T06B 2AI1A 2OQIA 5LZ9A 1T8RA 1IVSA 1LPOA 2P9TA 4C0SA 4JBHA 1CQPA 4H31A 2UXDB 3EXG2 2EOAA 2Y0PA 1B00A 1UBCA 1ZZGA 4P3PA 4RAQA 2NQ2C 4R2WA 1RWXA 3JAKA 1IRXA 2IK8A 4K9SA 4Q4HB 4BFVA 1TAHA 2QZ9A 3IP5A 5F77A 3AIKA 3HJUA 4NATA 3AP2A 1QFXA 5H83A 3U9LA 2PBRA 2VTVA 3BXXA 1IWOA 3WRXC 3EXEB 5DM60 5GZ3A 1HE5A 1GIAA 2JLUA 3HNOA 2QYSA 2QN8A 1EGVB 2DSNA 4YLGA 4HAIA 1N3YA 3JRWA 2AMFA 4RH0A 5K3SA 5JSZA 4RBNA 3OP4A 4MTCA 4Q1VA 1AQYA 1TPYA 1GHTA 3IELA 1ODTC 3I9LA 4INZA 3CVJA 3PIRA 4MQ4A 1IUOA 4GQBA 1MX1A 5BNZA 5L3QB 1Z18A 1B0PA 2GB4A 2YJ4A 1GSHA 1M34E 2PKQP 3BKWA 4RE5A 3IMGA 4ZHQA 4B33A 5DYWA 4D81A 1H6BA 5FOUA 3PYXA 1D2NA 3EF0A 1NW7A 5DO9A 5B3AA 5ALGA 2ALJA 1C41A 3O03A 5KTSA 3LNCA 1USIA 4IQ4A 2BM8A 4BTEA 2EWMA 3TZQA 8LDHA 1GNLA 1RJFA 4W63A 2VHTA 4KUHA 4PZYA 4FGSA 4ESHA 5FJIA 1EDZA 3NYIA 2HWXA 3BWYA 1KJQA 3ZHCA 4OG2A 4IFBA 4AZ3A 5ADUS 1Y1RA 3LWDA 4NTZA 1GQSA 4C0HA 1NA5A 1W0KA 1YDWA 3PJEA 1F17A 1U11A 3H5TA 1E64A 3N7UA 1HZJA 3NH6A 3WGQA 1E6WA 4YRNA 3RS4A 2OK7A 1PK9A 3HCWA 1E59A 3W5CA 3G5UA 2HPAA 1CIJA 3LCRA 5F9MA 4TWRA 3OPYB 1Z6TA 4ZA2A 4BVHA 4YRGA 4BKMA 4ZJPA 5C51B 3O38A 1QZTA 1WQ3A 1GQYA 1AA9A 1TO2E 3IDSA 4X41A 1CEXA 3V1NA 4EYKA 5JI3E 5EVCA 3N0XA 2OGZA 4NMMA 3AF2A 4GOXA 4BGUA 1H42A 5F1PA 1YQGA 1C1XA 2H00A 4CEIA 5DHTA 2NX2A 1TT7A 2QT0A 4PSVA 3O8BA 2LIVA 1BXRB 1Z2DA 2ZJZA 3AJRA 4FGJA 4H6VA 2WQ6A 1H05A 1ZD5A 1LSOA 5HUHA 1XYGA 4NRDA 4MWCA 2AMVA 5JIBA 3B6IA 3KHTA 4Y2QA 1ABEA 1GG8A 3ZWWA 4U8HA 5BMVB 2O5CA 1GFWA 2YVAA 2ZXEA 4HJRA 4LRSB 3B3AA 4PN7A 2F1RA 4UBNA 4WPGA 1SUSA 1V35A 3QVTA 3ROFA 3NBFA 4MRAA 4X3CA 2C5GA 4UBMA 4FT4A 2DFPA 3JWPA 3WYEA 5D5PA 1QHYA 1SBCA 1R00A 1YD7A 3NNNA 4DAOA 2FHPA 1GGJA 1NN5A 4RMHA 1T5LA 4ZYUA 3KR9A 4W5HA 5C8DA 2IPMA 2Y1OA 3L0ZA 4R6XA 1SOAA 2G08A 2QTFA 3C7TA 4LS3A 4FMPA 5A3QA 5CBPB 3ZVLA 2PLRA 1E60A 2XDAA 1QSGA 1TD9A 5FUYA 3WSTA 1U94A 2IUTA 1PUXA 4BP3A 3M34A 1QMPA 2QRJA 4CF4A 4KFRA 2AK3A 5LNK1 3AHIA 4C3OB 5J2UB 1SUEA 2WD7A 4FI3C 4BPRA 2FOIA 1JYEA 3PQ7A 3OZAA 4QYTA 4FFSA 4UU8A 4CTMA 1ZK3A 4L85A 4TUYA 3RAGA 1JS1X 2ZZMA 5JSFA 4I1UA 3CUUA 5ADVA 3B2QA 2PR7A 2OGWA 1LBSA 1QCCA 1XEXA 2ZJBA 4N8SA 5IMSA 1EFRA 5FH9A 1V7QA 4AY3A 3VHQA 4EQZA 3K70B 4UEOA 4B3GA 1VA5A 1YA8A 4UDOA 2HEIA 1PJTA 1Z6AA 5C7OO 3D6VA 2O7RA 2IRWA 1B2LA 3L07A 1VM6A 1FP6A 1VP3A 5FEMA 4B6RA 3EZ6A 2HLHA 2FR8C 1OT3A 1WZ2A 2QNIA 4GMDA 3R4CA 5AHXA 4ZK2A 1V8OA 4ARIA 3U81A 1Y6QA 2X0EA 3VU9A 4YJGB 1FIUA 3IUNA 3NEPX 2H8KA 4HXFB 4Q03A 1AHPA 3M3PA 2OENG 1E0DA 1W581 2I6FA 3CIOA 3HSSA 3ES9A 4AECA 1X77A 1F5SA 3B7WA 1Y63A 2W2XA 1RKUA 3V32A 3UWDA 2IHYA 4JV5B 4WE3A 4B3HA 3V8NA 4YHHB 4OMUA 3PXXA 3J80A 3C14C 5CFRA 1X7HA 3AH8A 5KYVA 4UNPA 5J59A 4PO1A 4WZBA 7GPBA 2O8NA 2VNSA 3R0JA 3VMMA 5FUVA 3OFVA 1Z5PA 3AK4A 2ZM6B 1KDPA 3P2IA 5T64A 1TF5A 3UJNA 1DBQA 4NJEB 3SCZA 3P5SA 3H3FA 4LAFA 1VIMA 4KPYA 1ADBA 5TLSA 2PS0A 2YY6A 3E2MA 1Y9JA 3N1UA 4UHBA 4HWTA 3D5QA 3UMBA 3AFIA 3WYCA 3TSCA 1AF4A 4E7PA 2C95A 4Q5IA 2HSWA 4AP6A 1GL6A 2J3DA 3DDHA 4DMCA 4X1YA 2AC7A 4P2BA 5CAEB 1LF0A 4JYZA 2F3QA 4QUEA 3KLOA 1NASA 4IO0A 3SS9X 4D46A 2ZJ1A 3DWFA 3R0QA 5JD3A 5HM8A 2DC1A 2F55A 5REQB 1XKXA 2F9MA 1GVNB 1I10A 1MF7A 3EODA 2CB9A 1LBTA 2QV0A 1CZNA 1Y1SA 3AXSA 3ZS8A 4BMYA 3DHYA 3FTQA 1NTRA 5BSKA 1AXRA 3O95A 4G5RA 4JJIA 3FSRA 2IODA 4JBYA 3EG5A 3OCWA 2UUPA 4MJ7A 3DVQX 1TDJA 2V4UA 3CB2A 5EP4A 3TBHA 2AYYA 4YUXA 1ZOIA 5CH3A 3T7JA 1KEUA 3S5JA 3M6VA 1EHYA 3CEJA 1K7EB 3FNRA 1NYRA 5T6BA 3W6UA 1TVCA 1IIBA 1T1SA 3WL5A 3B8EA 3SQNA 1LNSA 4OYHA 3WLEA 2O0KA 1C3JA 2DQKA 1OW3B 2DPLA 1J2RA 4FUTA 2Z0MA 4K88A 3HYSA 4CEIB 4ZT5A 1ZQ9A 1CUXA 2EL7A 1NRXA 2H3HA 2WYWA 1KOJA 2FSFA 4XOIA 1NGSA 2EDCA 2PFSA 3C2QA 3CNBA 3J7TA 3N53A 4RFSB 4QICA 2P40A 5ARCA 3ZV3A 3O2NA 4LSZA 3KWJA 1U2GA 2BM0A 2G28A 5JEEA 5HXAA 2VYVD 1LK7A 1OASA 2PN1A 3KLPX 3U40A 1CT9A 4H2DA 2J3KA 5JR3A 3EH2A 4BIMA 2C2HA 5K8VA 3WGIA 5C81A 4JLKA 2NM0A 4BB5A 2I7CA 1IXSB 1GKLA 5ALKA 2AMJA 4JLMA 5ALFA 2O2GA 5J9FA 4IX1A 3O1HB 1GGEA 1DEAA 1E63A 2EJCA 2ORIA 3LBIA 2NZUG 4PCVA 2MOKA 1NNSA 1GPH1 1ZQ1A 2CLHB 3HVIA 2NQTA 4BC0A 2ZYDA 1CC1S 2O23A 4E70A 1EJ2A 5C37A 2QMQA 5KNCA 1OROA 2AYXA 3NNSA 4IZOA 3STHA 5IUNC 3QYJA 2JGEA 1R0BA 3SQWA 3M9WA 2W11A 2NYVA 2X2OA 3FNFA 1U8UA 2XTAA 1QAOA 3KO8A 2X8JB 4IOKA 1NWCA 1ZJ6A 2PH1A 2W8BB 2V1UA 5EP1A 4CCSA 5ABPA 4W6ZA 4KQEA 4ENSA 2QP9X 1BD3A 3FTCA 3IOCA 3WV4A 1J49A 5CM2Z 4BQSA 1IE3A 4Q4LA 3DC2A 3IVRA 3GY0A 3PI7A 4BGVA 3BFVA 3SJCA 4FHFA 4D8WA 1K92A 6NULA 3BD6A 1DX4A 4U7WA 2D1YA 7ABPA 1GU7A 2J48A 2XF8A 3HMKA 3ZH2A 3V4ZA 2QAGA 3BCSA 3VR6H 1UC8A 5IBRA 2YW2A 3I4FA 3DMNA 1ZX1A 4IHJF 5GV8A 4YALA 1UMCA 4CQMD 7MHTA 1F2DA 1OX6A 1RTKA 3DZBA 3S2YA 2BMDA 4AUMA 1CY4A 1EFAA 1Z4NA 3E3NA 1BSVA 3A6EA 4XDGA 4IEEA 4B2YA 1NVWQ 1PD1A 5DISB 2QJOA 1ZK1A 1BS9A 2GBLA 1L4UA 2WF7A 4FHGA 4HQRA 4Y2VA 5CX1B 1RRFA 1BCRA 2HHAA 5B6PA 2C7BA 2ZM5A 2IYTA 4TVSA 2B7BA 1HETA 4KJZA 1GV0A 3JQ8A 2AW5A 4BZZA 2QTTA 1CX9B 3ZDAA 3KZVA 4H7IA 3L4KA 3TBFA 3R3VA 4MUNA 4MI9A 3VH2A 3RANA 4EX7A 2JCYA 4W99A 1QQBA 2CK3D 5EZQA 5J5AA 4X90A 4E88A 4DSNA 4GX0A 3KV1A 3QVMA 3KPYA 4ARZA 3GELA 2C8JA 5KWIA 2LRHA 1RLUA 4GOMD 1P4JA 4JLOA 4IIGA 5EHIA 2FSVA 4ND8A 1MO2A 3GRAA 4DXDA 5JZSA 4KYVA 5D7NA 4ZJZA 4F5DA 5BQ3A 4CN9A 1VJRA 2OCGA 4JFAA 5J4VA 1IUNA 3ABIA 4QPNA 1NQOA 1F1JA 4GPEA 5ICCA 2B8EA 2EHDA 5AP9A 2R2GA 2W6ID 1W9HA 1Y7HA 2MSEB 3M6MD 2YNMC 5K5EA 3DE7X 2ACVA 2YXNA 3CKLA 3JD1A 1E2UA 1SIBE 1K6JA 4S05A 2OAQ1 1GUDA 1YMVA 1WB4A 3RKRA 4K9PA 3P8ZA 4DLZA 3DTVD 3KTAB 4ND7A 2R1VB 4M49A 1GKYA 1N9KA 1RNLA 1KNQA 2GN6A 1CSEE 4MUMA 4AULA 4PO9A 1I80A 1J7KA 3KZKA 1RRPA 3ADBA 2ZYVX 1QCDA 1F2TB 1U1IA 3TMYA 4KQ6A 3ZI4A 4B81A 1IUPA 2VTBB 3CX3A 3OLQA 1VJTA 3FKSA 1HSZA 1LX6A 1BE0A 4RGBA 3ZIDA 1G8GA 4NDAA 2GF2A 3HKCB 3NHLA 2BBOA 3WLQA 1IZ0A 3AHGA 3E8SA 3Q3EA 2PRKA 1UBUS 1RZ3A 2CNNA 2Y1LA 5IKPA 2GA8A 3PC7A 1K3FA 1N6RA 3AEQB 3UZUA 4A6EA 2ODPA 2DEUA 3DL7A 2WZCA 3TRKA 1NW3A 4IDPA 4FNOA 4NVRA 2ONZA 4MVJM 5E38A 1Q16A 3PPYA 2O7QA 3C8HA 3D3KA 4G5SA 3T4UA 4GOKA 4C76A 5TJ9A 3IBCA 3LQRA 4BNZA 3LPNA 4KIGA 4BNFA 1XC7A 2W2QA 5ICEA 1DKNA 1FYEA 1CHDA 1GTVA 1U9IC 2JEZA 5D3KA 3RV3A 3ZQKA 1ZPDA 1N36B 1YQ9A 2YY7A 4UPDA 5B58T 4JX9A 4GLLA 1H4TA 5I9SA 3N7AA 4JEHA 3MJ4A 3DDOA 2XNCA 2I80A 2BEKA 5CFPA 4KQCA 4HO1X 1X8KA 3H8VA 2JARA 1I3NA 2ZB8A 4X3PA 5EZYF 3NHZA 1M9NA 4PS0A 3ZV4A 3A2KA 5JU6A 3ORYA 4NH4A 4FD3A 1ZO8A 2A1IA 1BH6A 4TLMB 2UZIR 3AI3A 4HWKA 1B76A 4Q7JB 4QU8A 2WP8J 4U2CA 3ZDFA 4ER3A 3GG9A 4UBIA 5EIFA 3BK7A 3I04A 4UUNA 1LJ8A 3JRNA 4FNMA 4D8YA 1NSYA 4AG5A 3GBPA 3B3GA 4IVRA 5HJEA 3MRVA 1Z82A 2DLCX 3DYIA 1EP1B 3P2OA 1TOAA 1NQUA 3R0VA 1H2BA 4EG6A 2FQQA 3EC2A 3EHEA 2ZYWX 1CE8A 1A72A 1V1MB 2DU8A 2R7AA 3EBLA 3NM5A 2DTDA 5AICA 2GBCA 1HTTA 4RAOA 3SXPA 3ADOA 2MSCB 5DM2A 4ZCMA 5BN1A 3WGZA 1E2IA 5D3QA 2VP4A 4PINA 3UK2A 1MC1A 4BVLA 3A32A 1JHQA 4MLPA 4KITB 2ZT6A 4HDOB 4LDAA 5FPPA 1I2DA 5AOVA 3WJAA 5CB4F 2P0AA 3UVEA 1NUTA 2PGOA 4ZQCB 2A5FA 2VP6A 4XM0A 1QIMA 5ALDA 3BK2A 1X7ZA 3ZQ6A 1E2JA 4LQ4A 4BU1A 4KRFA 1WTCA 1PR5A 5A3JA 3SX0A 2XMDA 4HB2A 1OX5A 1HG1A 2GUGA 2GUWA 2OFPA 2ZIXB 3HR8A 5KJ6A 2V6FA 4YYZA 5HFNA 1FF9A 1K8YB 1EK0A 1LGYA 4BFTA 1NVBA 1SHUX 2EWVA 3DT9A 1EDBA 3F3SA 3JQAD 5ECGC 1X1AA 4D4IA 3C87A 3NASA 4IS2A 3TE7A 1R16A 3URKA 4Q6BA 2XYHA 4GP6A 3FCCA 5FOSA 3R6LA 4NXNB 5F3WB 1T2FA 3B1VA 4HLUA 4M60A 2ZRPA 3ZWYA 4MGZR 4N3GA 1NUAA 1AN9A 3KZCA 2WMYA 5FCDA 2B9VA 2IGBA 2YC4C 3LT5A 3H04A 3F1LA 5FLXA 4DADA 1JQJC 4P31A 5SYMA 4II2A 1IYZA 1K97A 3ABQB 1FP2A 3HZHA 3NNDA 4L28A 3J81k 2ICAA 2DWQA 3H5WA 1M7BA 1ICIA 5EE9A 5EWLB 5IN5A 3W5BA 3RKSA 1X1BA 1Y4SA 1M6EX 3I0ZA 5G41A 5IDVA 4P54A 1X7YB 1BOFA 1JWAB 4ZZIA 3O8OB 1KAQA 1X8XA 5EJIA 3R76A 2RAUA 1PZXA 3ZWNA 4Q9KA 4DWJA 4TXJA 5EE0A 3IV7A 1YH3A 3MLBA 2GKOA 1TU3A 2A7QA 2AOXA 2HFKA 2IS1A 2QWXA 1TJNA 1G20B 4G0MA 1E5TA 4HNSA 2JLAA 4I6JA 4XUEA 4DUGD 2MDTA 5FPQA 5I9BA 1VBNA 2XNSA 3NM6B 3OQBA 4EYOA 1C4KA 1PI3A 1NP6A 2VT6A 4HZGA 1CTQA 2E4UA 3TEMA 4OX9B 1YULA 3B6JA 2OMEA 1P31A 3EVDA 3UT0A 3D3JA 1FXWA 3B1FA 3KHUA 2J08A 2ZYSA 3KHKA 3TUIC 4YMHA 1IB6A 3CJRA 3M4NA 2R96A 5LP6B 1IMJA 1DINA 3PQCA 3H9BA 2IHBA 5AH0A 3GGCA 1RPZA 2P3OA 3U7HB 4TLDA 4XVCA 2QN1A 1CRWG 4LE1A 2VHEA 3FB1A 4MX8A 3WNBA 3W2EA 3M70A 2O8EA 2HV9A 1GXSB 1IAVA 1N3LA 1VHDA 1WAMA 2JCSA 3NI2A 3S2ZA 4ZVSA 3RRFA 3OPXA 4HQNA 1G9XA 2PRYA 4G0OA 5AUOB 4FFLA 2V98A 4OX9Y 4WOJA 2BGGA 3FAZA 3HDGA 4MWOA 4AMGA 3UJPA 1FP1D 1OXTA 5F64A 5JANA 4E5UA 4EFDA 5CB0A 3DVRX 4EHFA 3S6JA 5K8TA 1KAHA 5EUCA 1K7FB 3TD2A 4E6EA 3DE4X 1TPZA 2ODNA 5BQPA 4KPGA 2WWYA 4C0AC 1A8QA 1EX9A 3FMIA 1VL0A 6GPBA 2DECA 3X1WA 4PZUA 4DQ0A 2UXBB 4ZOEA 5TY0A 1E9EA 1PDVA 2REQB 3M6XA 2WJGA 3RVLA 3IULA 3PU6A 2Q5HA 2UUCB 3K9CA 1YL6A 2WAYA 2VDLB 4TVKA 4MPJA 3K1YA 1ESZA 1Z0DA 3GJ6A 4HXEB 4JR1A 4LXTA 4PLHA 2HHCA 2IEAA 3TD6A 2RAFA 2G3YA 2GJKA 2RBKA 4K9DA 1ZM2A 4IOMA 1IJEA 1YUNA 5JHHB 2PVSA 3DTYA 3LKBA 3MLEA 2FGJA 3ND6A 1A69A 2P6PA 3N3BC 1THZA 4QUKA 4RH3A 2FA9A 3QEMB 5FKJA 4Q12A 5JCPA 3ZE8A 3UV3A 2W6JD 1JYSA 2H92A 4D0LB 5KINB 1AZLA 2Z9CA 1T9BA 2GD1O 5B4VA 1U9JA 3L0BA 5DBEX 1EXWA 3A31A 3OETA 2EZUA 1J21A 4PVCA 1CJMA 1YB4A 1C81A 2D1QA 2W93A 3OWOA 5GJVC 2JIOA 3E35A 4PVDA 4WJKB 5ELMA 1CEYA 1PE0A 2HMWA 3OECA 1CZUA 1XRPA 1I94B 1MTOA 1N7HA 5CNKA 3U3DA 4F1WA 5I9LA 2CUTA 3ETCA 1DARA 2MYPA 3PQ2A 4L73A 2NXCA 4K9QA 3IIMA 1K89A 2EYQA 2B1IA 2E85A 1OJLA 2GCPA 4X5OA 4YJHB 4MS4B 1HMYA 3RIYA 4KQMA 2QX6A 4XA8A 4PONA 1N33B 5IT9A 1VJ0A 4BLOA 2BDTA 4R4JA 4B87A 4OAPA 1QDLB 1JDVA 1L5NA 1XCMA 1JHOA 3MUNA 4RKRA 3FHOA 3ZQ4A 5K1ZA 4MW7A 3DDCA 4XX0A 2I91A 2HXGA 2V5VA 5K3DA 2FUEA 1A3CA 2WJWA 3INRA 4H7FA 2GEBA 4C7OA 1NTOA 1RYNA 2Q46A 4LWZA 1KPHA 4R3WA 3KAPA 4X9XA 3MQFA 4RA9A 1WY5A 2YWDA 5IH7A 4FOTA 4DKJA 1D1PA 1OBVA 2VQSA 4YUZA 3T1TA 2FDCA 1JP7A 1RAGA 4I4LA 4KQKA 4J0JA 3IPCA 1QG6A 4RK6A 1UR5A 4JC8A 4HX2A 1RM5A 3E9YA 1DG9A 2VDMB 1OU4A 2APJA 2V55B 2ZQZA 4YMLA 2AC2A 3FBTA 2C4MA 3HBNA 3QVKA 4Q82A 2G63A 1SXGA 3IAAA 3RYFA 4A26A 3Q11A 4XQ0A 2H5EA 2ZI5A 3N8KA 3P4YA 4MPTA 1W5FA 5CUQA 3L1VA 4FSXA 4BBAA 2VWQA 3AY3A 3AFMA 2RGBA 3HJRA 1MUUA 4K40A 5JS7A 4V24A 5KMGB 1QRAA 1B3RA 5LDGA 1QO0D 5CVTA 4PFSA 4Q9IA 1E1RD 1LQTA 2R4TA 2XB4A 1X70A 1QF7A 3F5QA 1DJOA 2BL4A 2KJQA 3S0JA 1EFCA 2YXPX 5B55A 4XWTA 4X8MA 4XFJA 5H68A 5IT4A 3WLFA 5LBUA 1SXJE 4OHYA 4MMZB 1BW9A 4F8EA 1MG5A 3D8BA 4QWWA 4BQFA 1GNQA 2QT9A 1ORHA 4MLZA 1F0PA 3F8SA 2ZRJA 3DV0A 4LY9A 1HF3A 1HFEL 5B7PA 2XSZD 2Y3IA 3TLEA 1AZWA 2N9UA 3NCHA 3NAZA 4R9UC 3T1OA 4DLWA 2RFLA 2G1AA 3C6BA 4FW8A 3LAWA 3RF6A 1Y98A 3WRVA 4YROA 3K5HA 2GR9A 1OZFA 3LH5A 1EVJA 3QKIA 3MJRA 1WSDA 5EWMA 3SIPA 2OP0A 5AM0A 2BKXA 2XCIA 2QMUA 1OHHA 3ANXA 3RT1A 1VKJA 3BXOA 5AM4A 3AU9A 2H63A 1IWPB 3ETJA 4KWTA 1D09A 4WK6A 4QXMA 1R18A 3JQ9C 1YJ5A 1T0JB 5ERYA 2Z1NA 3DP9A 1I0ZA 4ZVRA 1YONA 4DMUB 3KWFA 4XVHA 1YKFA 2NVUB 3VO9A 4LKRA 1K2WA 3VOSA 3REQB 1CBUA 1FRVA 4DBVO 1YS9A 1SU8A 3OH8A 4BCBA 5FT9A 3LQYA 3PQ3A 1YHZA 4MA5A 4MQEA 2JH9A 5JYEA 1FXWF 1M2VA 4DTCA 5DKFA 4RVFA 1B16A 4X8LA 1H2AS 2YWBA 2NPFA 3BK1A 1PZMA 3T3EA 3HYTA 2H1SA 2X5KO 2C94A 4EHJA 5KB3A 1JNYA 5TC4A 3SK0A 1Q0ZA 2R60A 2W6MA 4IVNA 3X1YA 4ZI7F 2KLBA 3L8MA 3HFSA 3WZLA 5JYDA 1WABA 4IJ6A 5F78A 4A4DA 1SCBA 4FYVA 5SY6A 1NRIA 1OUMA 1MJNA 4CTKA 1X8LA 1G0NA 2V8OA 2ZI9A 1C1HA 2FUNB 2H4JA 4LJSA 4B09A 3HYCA 4RKWA 1H1DA 3DKRA 4EENA 5A9RA 4QAQA 1ZI9A 4FMDF 3V6MA 4NCIA 3ANTA 5FBQB 1WUYA 3FJ1A 4C30A 4GU5A 5K2MA 3PRYA 1MVLA 4C89A 5BT8A 3KX2A 1Z5WA 1SKMA 2IOHA 4NWIA 4BEBA 1LK0A 1OD6A 1QIHA 3H83A 4UVIA 1MW8X 1SVMA 1N0IA 5FYDA 3E7FA 2G77B 1M2WA 5JZOA 3EXG1 3UC9A 2BGIA 4KVZA 4RHEA 2IZ1A 1XEFA 3TPFA 1RADA 3OEYA 2WV9A 4ALJA 1TVKA 4JLWA 2C07A 3A9RA 3B1WA 4FD2A 3TRJA 5LNK6 4L7QA 3Q9SA 2K2QB 2D7DA 4P32A 5EHXA 2A78A 1NBHA 2EFDB 3LT1A 4KLRA 5EP3A 2G6BA 1EM6A 3E5NA 1IY9A 2GLTA 2OVBA 3VU9B 4E5YA 1ZJ5A 2CNOA 2IP4A 3K5PA 3IR5A 4RJ2A 1J1UA 2FN9A 3SG0A 2WSBA 5TV2A 4NBTA 3NB0A 3LY9A 3TXYA 2Q6VA 4DLYA 4DT1A 4CM9A 5DN6A 4ZMRA 3LS2A 1G98A 1DJMA 1J5XA 1IATA 4HWSA 3T7TA 1P2GA 4ME6A 1W8IA 2VAXA 4DMLA 4KZPA 5CFMA 4DCUA 2I78A 3A9SA 3FN4A 4LPKA 5AUQA 2O1WA 3SQXA 5JC8A 4JB2A 1HLFA 4GGMX 2FFHA 3HBLA 4NBWA 3FJYA 3LW8A 4YRTA 5JXJA 4K6OA 3BC1A 4ZOCA 5E1OA 3EYWA 1ZNWA 4Q4DA 3RUDA 4N41A 3U09A 3G1TA 3FUTA 4MV1A 4TM7A 1UDAA 5IKOA 3TO5A 3TI9A 4DB4A 4TTAA 3U4QB 2ORVA 5EYPB 3MJVA 3FNIA 3K3PA 5JAOA 2C8KA 4M7PA 2Y1DA 1Q0PA 1PR2A 1TM1E 1W4CA 3ONVA 4QO7A 4ZQEA 2WHPA 3IXMA 4WRRA 2H7YA 2JJ2D 4RDXA 1LJLA 2IC5A 3SJ7A 3EQ6A 5D3MA 4AN4A 1J8QA 4UNSA 3AR7A 2CFRA 4C6RA 3AJ9A 4NCKA 4WCFA 1XNJA 1EAMA 1SVLA 2EKLA 4IL5A 1MNQA 4CTJA 1EMDA 5BUQA 4LG1A 4N39A 1AMUA 4B2LA 3I6MA 4AJ1A 4DM4A 3MG9A 2WUGA 2TMYA 2XTNA 2VJBA 3QI7A 4M8LA 1PZHA 4Y1GA 5IKXA 4DAEA 1SD5A 2ETXA 2QUBA 5JD4A 2GZ3A 4HRXA 3TTSA 3H2GA 1LRLA 1LQUA 1SZJG 1E9FA 2VDQB 4LC9A 4E30A 3VYRB 3I5AA 3M3DA 2PPVA 1JI3A 3B9PA 4ENWA 4YCNA 4WJZA 2VTEA 2VDKB 4N0EA 1W8DA 4KN8A 3RSSA 2WTEA 2C7VA 4BKOA 4F85A 4F96A 1ZCFA 2QBYB 2WJPA 2WTMA 3R44A 5MGNA 4WLNA 1CZLA 5CT4A 5T3UA 2C04A 3WL3A 3GLGE 1JDNA 4XIIA 4OQXA 3Q7TA 4LN1A 3FOEC 4GQAA 4ASUA 3EDOA 2XA9A 5TMBA 2C4WA 4QUHA 2OHIA 1NZFA 3QHAA 3TZLA 2O07A 4LJRA 2PSJA 4GM4A 1BH2A 3T0GA 4CFZA 1DBPA 3H0CA 4ZRMA 4M1QA 1PV2A 1VCNA 1B14A 2QXTA 4M9SA 3ZWVA 3PVZA 5FBRB 4HT3B 4FE7A 2QM8A 2CLEB 5H4HA 4FEGA 1Z63A 4MIEA 5JLJA 2UVPB 3FWNA 1BCSA 1GLVA 2A9JA 3IPRA 3GLGB 2EFCB 1UZNA 1KORA 3D81A 3Q2IA 4CKXA 4HUJA 3K73O 2QNBA 2O3JA 5JDCA 4IQ0A 3UMFA 2F8MA 3QQPA 4LHEA 1RLTA 1EK6A 1KAOA 1P2BA 1QZZA 1V96A 2DQZA 1EUQA 2QZJA 2VP5A 2CJPA 4IKOA 4MI1A 2IZ0A 4O2BB 5E0KB 1SKUA 3LT4A 4OQ4A 3MVEA 3EJ6A 3OQPA 4S1OA 1VP9A 1MP0A 2REQA 4B8YA 2YIDA 4CMCA 3HYNA 4FB5A 4ZN6A 2R00C 4FDUA 1QJ4A 2RDMA 4HVAA 1OLOA 4MUBA 4WZAE 2QVCA 4GWKA 3DGFC 2C4KA 3T5BA 4PY2A 4ECAA 3ETLA 3GGJA 2CLIB 3QVSA 5C2JB 1SHTX 1NMZA 3QX7A 4X3OA 4XSGA 3B2NA 3L7JA 1MHPA 3HDVA 3ZX5A 3WGNA 2QNRA 3UFXB 3DEIA 3AEKA 4TOIA 3WI7A 2JGRA 2C7OA 1MH1A 4WKBA 2M6RA 1Z37A 3CHYA 4TTSA 3SR3A 4AO6A 4C4SA 1RM3A 1Z8HA 4CXMA 2VSNA 5HEKA 3CLHA 3ZHYA 4JU9A 3TGPA 1YZVA 2G5TA 2OCPA 1YJXA 3DZGA 4RZ3A 3ILVA 3ZCXA 3DHWC 1JFRA 1T5TA 2Z2ZA 3HFGA 5FFMA 4OHKA 2YCLA 1HE4A 1JT9A 4Z9AA 5FYQA 4OGWA 1TYZA 1DEXA 3F6EX 2ZJ0A 4RKYA 1Z4KA 4Z4FA 5ADWA 5E6SB 1L4NA 2NOAA 1G3UA 3KPWA 1VSBA 1PQYA 3Q12A 1N7IA 5DHAA 5KEIA 4MUYA 3BKXA 3X1MA 2GRJA 4OP3A 2XMZA 4O4JF 4TV9B 2JG3A 2FPPA 3GNTA 3NIGB 4HPWA 4OV6B 3H4MA 4EEZA 1WPGA 9MHTA 4YRJA 2QRGA 2D2EA 3QFRA 5B6JA 2GM3A 4WESA 4GYKA 2G1JA 3ENNA 4FGUA 1Y4DE 5JJLA 1JHAA 2R5NA 3W79A 4A0HA 4YUWA 3TRHA 5I47A 5IYZA 1W73A 1GILA 3BMNB 2FPIB 2QAGC 3BWMA 1KJ8A 3E7WA 4HLQB 4NENA 4U2FA 4QHYA 1F38A 4Q48A 5KNDD 4Z5XA 1DIOB 3O93A 2WYIA 1NUUA 3T3PB 5ECWA 4C14A 4WLUA 2QPOA 2HQRA 1HT0A 3CNHA 5DDIP 3PVCA 4YFVA 4RANA 1UMCB 1TYBE 2PKCA 4YP5A 3SIRA 1ADJA 2A67A 2PA3A 3AB7A 3C6ZA 1N6NA 3AM4A 3DE0X 3H75A 3MXOA 2EFYA 3QM1A 4AKHA 2WIGA 2ZR9A 2PGJA 4JI1B 2RG1A 1CUCA 4Q37A 4HGRA 5CT5A 2PZEA 5M7EA 3GLIE 4HI0E 2ZIWB 3I2JA 5GPBA 1U2DA 4LKOA 4Q7QA 4BX8A 1FYXA 4LX0A 2F1OA 3RFVA 3HR7A 3X1KA 4B7AA 4QGAA 1NVXQ 1TKAA 3I92A 1K4MA 3F6RA 1VHLA 2CCKA 2R8RA 3AILA 3EVNA 3MF4A 3QBDA 2JGLA 4G63A 4R3UC 4S04A 3DCNA 3GP8A 4LGYA 4Q4JB 4MW4A 3PCTA 1A88A 1AF7A 4UEQA 3LOUA 2PYZA 2Q5IA 3S28A 5BY2A 1YCFA 1UP4A 4MQBA 5EQDA 2XNDD 3PXEA 4NK5A 2V3VA 3KS9A 2FJPA 4LDPA 2J9FB 3GAZA 2Q3MA 3GLSA 5LQNA 2RHOA 5KUTA 1HTWA 4KQ1A 1KMQA 2WSSA 5L51A 2Q1WA 1PW5A 2W2TA 4ZO7A 4KIWA 4Q3CA 4XYBA 2C3OA 3KQKA 1SUWA 1YMQA 2QGFA 3BZBA 4PNZA 3TLCA 3AWDA 3GOHA 3VR4D 3JQAB 4BU0A 4UPEA 1ORWA 2YBEA 1I1HA 1GPNA 5DGDA 3Q7PA 4Y6QA 2DBZA 4WLFA 4IX9A 2O8BA 3GVCA 2H1RA 3SNKA 3N6RA 3F71A 3G13A 2WAOA 4HDKA 4Q1BA 2D0DA 1TGVA 4R6WA 3H0EA 3NDPA 1DQPA 1YS6A 2IHKA 4R8LA 5DTRA 4TYWA 2Y71A 1N0HA 4G8BA 1RXUA 3AW8A 3U5TA 1V71A 1HR0B 1XO1A 4JC0A 4BTVA 3O92A 5KYXB 3I62A 1EESA 5CNMA 3MWGA 2AFRA 2R1TA 3B5JA 1BHJA 3AZPA 4CYMA 1BQ4A 3DT8A 1T5DX 1XZLA 2IS2A 2QL7A 2Q3FA 2OLEA 4Z0HO 3SS8A 1N6KA 3DVSX 1FBTA 4TMWA 1GY8A 2R6ZA 3I12A 3CYFA 5I9MA 5I8ZA 3REOA 3IVXA 2Z5LA 3JQAA 1K75A 1NF9A 1YHYA 3KTDA 3PGKA 4JJGA 5DI3A 1I4TD 5JI2E 1CD5A 3QHPA 2VLBA 1XTIA 3TBKA 4AN0A 5H8WA 3EMKA 2BKUA 4L4SA 3AEQA 4NF2A 3SC4A 1P7VA 3BSFA 3EDCA 1J0AA 2HM7A 3DKKA 2XTMA 3L6BA 3DVAB 1MC8A 4U4AA 4PPGA 1Z5UA 2P2GA 5AKHA 4HH3C 4P35A 3E2IA 2H9YA 1YRAA 1IK4A 5EXPA 2EBUA 3WKAA 1A2KC 4Q3NA 3OZUA 5KNBH 5FBLB 1RXYA 3ZCRA 4DLTA 1VJCA 2M6LA 3QUBA 4PLPA 4XUCA 4YJ2B 4C2AA 3CLVA 1V8ZA 1YS2X 4G37A 4XI9A 5ALTA 4DBLC 2H6EA 1NOIA 2F00A 1F8XA 2KBEA 5AKYA 3R41A 3WWZA 4P34A 2JAWA 2YY5A 3NWOA 3C70A 4Y6GB 3KPUA 4AI6A 2RAPA 1NVEA 4N54A 2H9IA 3U44A 5KS2A 2LBPA 1JWLA 5K0ZA 3QVUA 3HB5X 1ZICA 2VJCA 4NYMR 3KVVA 4UAGA 1EFDN 4RPKA 4ZVVA 1G20A 3H5NA 4OQYA 3ZWKA 3LX4A 2ZIFA 1YE3A 1B2RA 2XCSB 3STUA 1QIEA 4A91A 2OOSA 4X71A 2LDXA 4DCPA 4FOLA 4L74A 4XM1A 3FVVA 1NF3A 4ZT3A 1QHHA 4ZWNA 4B3JA 1MV5A 4HYQA 3VTFA 4YRSA 1HYGA 1V4VA 4RFVA 4LYGA 4QTYA 1W4BA 4MYRA 3H2ZA 2CXXA 3RO7A 2NO0A 3O0DA 1KI4A 2BGKA 2WLSA 2YIJA 3BMNA 3QU9A 3ECSA 3FCAA 4MIKA 1TMGE 2YXLA 1U7ZA 3ZZ1A 1P2SA 1GL7A 2BFAA 4MK4A 2GZRA 3DQPA 2H57A 2OXRA 2C2WA 2VUTA 2ZWMA 4HNAA 4HQ0A 4UTXA 4CF5A 1VKHA 2JFOA 1R0SA 2R1VA 3GUVA 2OBBA 3N6XA 1G4HA 4DMKA 3BOSA 3FZQA 1VDZA 3PNSA 3H9QA 3OTGA 1BVYF 4GOLD 1IPHA 3ZIAA 5KTPA 3SC3A 1TUBA 2JCVA 4HYYA 1SQ0A 3ZC3A 4QYXA 1MIOA 2DH5A 5ALEA 5EIEA 3KE8A 2NU9A 2IP2A 2ECPA 1U8CB 1CUVA 3O2QB 1O8BA 5ALVA 2RHWA 1S8FA 4NJMB 2Q3JA 1P9WA 2RD2A 2FRXA 1JIJA 3AVYA 1J2JA 1XV5A 4DLUA 1VZ2A 4O5OA 3HI6A 4BWYA 3GBSA 4FW9A 4H3SA 5FUBA 3VM6A 1OZGA 4BKUA 4Q1DA 4ZV7A 1XA4A 4CEHB 2I87A 2ZRKA 4IEFB 2PE5A 5AKLA 4IOJA 3NBKA 3L0DA 4JVMA 3B1KA 3K0FA 4IJWA 3DDZX 3TLZA 4BNJA 1UK9A 3HV2A 4L0CA 5CYFA 2F3UA 4ID9A 3UEOA 4AJLA 1Q0TA 5JMOA 4IVPA 1ID8A 2ZJFA 2CLKB 1DJLA 2XB8A 2WKWA 3RARA 3B5IA 4ECEA 1J0CA 2XGJA 1OAOC 3PS9A 5C8VA 2R0QC 2MTBA 4DLLA 5IDWA 5DNCA 5FLEX 1W0JD 4XJTA 1LVHA 1T9GS 4LY3A 4LYHA 4TQ9A 3BTUA 2Q1UA 3C5WP 2FZ5A 2X8JA 1ZN2A 3PPVA 2B78A 2CL7X 2FQXA 4V0LA 6AT1A 1FTWA 1PVVA 3BXFA 1DS6A 2YZ7A 4DIEA 1Q3TA 4L78A 3WMGA 2WNSA 1QFMA 2D3WA 3LM8A 4BDTA 4FFOA 2GN4A 3GGPA 1YASA 3ZHZA 1TUEA 1YJQA 4D44A 5J58A 5EC8A 4E5MA 3B51X 2R65A 3KBBA 3BRWD 4UKDA 4Y9DA 2GO1A 2JFGA 3NGLA 4YFYA 5CTJA 3W90A 4FXOA 4EO9A 1T2NA 5BR8B 1OI7A 2ZRCA 3K20A 3ER8A 1WOYA 5TGTA 4H1VA 3PF8A 1WVGA 4AF8A 4YMVA 4LBYA 2OB2A 2XAAA 2FXIA 3RS3A 1Z4JA 2FEWB 5G0TA 4LZWA 3DVLA 1GNVA 1T3GA 3ELUA 2C0QA 5G4KB 1USWA 5IUKC 1B23P 3PENA 4WXEA 3D5EA 3LQ4A 2ILTA 1GU1A 1UP7A 5I7VA 4HOYA 2O05A 5AW6A 2C98A 3ONFA 2PO5A 2E4XA 4ALNA 1ZRHA 5CD9A 3BIXA 1CS0B 2IQIA 2FZEA 2TYSB 1JZSA 1P4AA 2P9HA 2EU8A 3R3HA 4F4FA 5GVRA 2UV8A 3OT1A 5FUXA 4ZEVA 4IJUA 2HA0A 4M0KA 1RTTA 5A0VA 3H5IA 1C9DB 1JDUA 2ACWA 2N75A 1UJCA 3K2QA 5EHGA 5BXQC 1P9RA 2Y1CA 4CQMA 1P33A 2QE7A 4KO4S 3L1UA 1R5JA 4PF1A 3MTQA 2X19A 3AT1A 4ZAXA 4NH0A 4OY3A 4I99A 1N0WA 2HR1A 2Q6KA 2Z09A 3NTUA 1VJ1A 1A71A 3JD3A 4ZHQB 2RBEA 2YWGA 2ETVA 1PX0A 4NU0A 3TW8B 4NNPA 2JI9A 4BP8A 1QFJA 2I55A 3JPWA 2P78A 2CZQA 3VRHA 2KM1A 5FBHA 4GKBA 4X62B 4DA7A 1Q19A 2P91A 3RVJA 1ZNYA 2HRDA 4BNMA 1KEEB 5GJCA 3GUUA 3DTTA 3UUWA 3VR3D 3EXEA 4K9OA 1Q7GA 2FR1A 5D3MB 2VYFA 3ZDBA 2WAMA 4L5BA 2IY8A 1PFYA 2Y4OA 1ILWA 1IQUA 2JLQA 2OILA 2ZWPA 4HH0A 4KO2S 3EX7C 2W71A 4PHCA 1REQA 2OPBA 1OTYA 1OYVA 3Q5DA 4DCGA 4E5SA 4BO0A 3A7DA 4KDCA 5IARA 1EVZA 3HVRA 1JMVA 1FXUA 4QSMA 2ZJ6A 1RVDA 5TSDA 3RWOA 1USVA 4J7XA 1G18A 3UYKA 1P3Y1 4X1KB 5HQ3A 2J1LA 1RD4A 2NWQA 1KBQA 4D7AA 4L75A 3PWSA 1TGYA 4FR2A 1WHTB 4RY2A 4Z4CA 3D6FA 5H7XA 1RWKA 1DUVG 4NYIR 1VA4A 4MUGA 4FSHA 1SN7A 2MSKA 1S5PA 3FRHA 1QDEA 2YIMA 1TAGA 3KK0A 5CIWA 2FNAA 2Q8NA 4IFEA 4ACAA 5JSQA 4KH1A 2FEPA 2B83A 1PUJA 1JEQA 2GF0A 2HTFA 2RHHA 4I50B 3JQBA 2P4EA 2RJNA 2A0XA 2AKAB 3D0OA 3EIXA 2CKMA 4HPXB 2FWJA 3CGWA 5CIQA 1M66A 3LSYA 3OUTA 2IIQA 3BHIA 1ST3A 4L2IB 4X6XA 2I0FA 4P22A 4PGFA 4MVJI 1CUDA 2SKCA 4ZT2A 1DPGA 1E4EA 1DRJA 2CD9A 4NOMA 2NV0A 2Q6IA 3QVOA 2BHRA 1A4UA 2HV8A 5J2TF 1RYYA 4BNVA 2FQWA 4KFSA 4CF6A 5BVHB 2GZ2A 1QIFA 1IY8A 2HNBA 3FLEA 1C3OB 3S1SA 1DC3A 2D6FA 4LZLA 1UC9A 2V7VA 2ZJOA 5DRYA 2DSTA 2PAAA 1C1YA 1QFZA 4J3FA 4NE2A 5ALQA 4RSHA 4V3BA 1ITZA 1DOHA 1EZ4A 1Q12A 2OCBA 2QL9A 3LTEA 4QDXA 3KETA 2IOFK 3DW3X 3NUQA 2XNHA 1GZUA 3PGLA 4EOGA 4YAUA 3I9V1 5G1PA 1M1NA 2H1LA 4N3NA 1RPTA 1GUZA 1NXTA 2TS1A 3M8KA 2P8SA 4ZCSA 5J4YA 1AHIA 4QDUA 3BVPA 2A5JA 4WX2B 1QHNA 3WJ7A 2ZBGA 4NEHB 5CFLA 3ABZA 3FWYA 3C5EA 3GN1A 4F6RA 4YY3B 2IIVA 2WMOB 1VLJA 2ACKA 4NESA 4RXUA 1KBOA 2FRDC 3EYAA 5LQSA 7YASA 1IOWA 1JR6A 5F98A 1WR8A 1U3FA 1RFLA 2XSZA 4D3XA 2C00A 1QAMA 1ZJWA 4MTLA 4EEXA 2RGNC 2QD1A 2MT9A 3IIJA 1FRNA 3LBYA 3WQSB 4CT0A 2YV4A 4F56A 1L7PA 4MAFA 3T4PA 2M6KA 1T2UA 1LI5A 1Q11A 3ILYA 4ND6A 2H4XA 4ZVNA 3CRRA 1PLJA 4TLAA 2ZS9A 3LY7A 3PWZA 1I51A 2XQGA 2E9SA 4ZVOA 4JI6B 1GG9A 4F7WA 1E1RA 1R6XA 4F04A 5C8XA 1U2TA 2BCGY 2YICA 1GCGA 1SXIA 2VAVA 2F1HA 3DFKA 3GHYA 4I5EA 1J1IA 5EQTA 4CLOB 3LA8A 5BRAA 1Z0SA 1GAQA 2I7XA 1BJRE 2JLWA 2R7NA 3LUDA 1LDBA 3QH4A 1OXXK 2ZI7A 4I5FA 3WYNA 3V4RA 5JZMA 1K5HA 2P2SA 1XT6A 3M1YA 4KOEC 4DSTA 2IHVA 4EJSB 1YOBA 1ZOSA 3Q4GA 4FDVA 4N0MA 2GYYA 2ZUCA 1WUTA 2IXEA 4NCXA 4XFKA 2PMWB 4X6YA 4M8IA 2PL5A 3LIIA 4O8ZA 4CLOA 3DV0B 2IT1A 4C78A 1A2OA 3PNBA 4I19A 4LXXA 4BZPA 4C0JA 1BDHA 1QNLA 2FETA 3U3OA 1IK6A 1U2EA 1AS2A 3CW9A 4PIMA 5MN5A 1GGFA 2V9CA 2PUGA 1EE1A 3N8NA 5ULLA 1MIHA 4EG3A 4K0KB 2P5SA 3R5FA 3CEMA 4P0PB 1GQFA 4X00A 2WWIA 1Q7CA 4MW5A 3OPYI 2K6GA 1GPWB 5ICGA 3CV3A 4YV2A 5DXAA 1T34A 3MS2A 2VATA 2YRFA 3TPZA 3JSAA 2Q5JA 4YCBA 1IOLA 3QPBA 3UN1A 5B7QA 5BSGA 2XPCA 1L5OA 5CDHA 1J9GA 1JHRA 4XJXA 4X1YB 3GEDA 3C3CA 4JDPA 3QPAA 5FNZA 3A36A 4EB6B 5ANRB 1ZW1A 4CDRA 3ESCA 3TQTA 1SFRA 1VJGA 4J0KA 4EX6A 3U7GA 3ZHUA 2H7VA 4UEJA 3UNXA 2YUTA 4DJEC 5HKKA 4X65B 3JAMA 1AS0A 4Y0AA 5AJWA 1A2QA 2L82A 2G88A 4DA0A 1RR6A 1Z2CA 2NNLD 1AC5A 1G2PA 3FBGA 4RA9B 2CXRA 1C8BA 3DOJA 3B70A 4WLEA 2NZYA 3NYRA 1WMEA 1XCPA 4EWLA 1AKVA 2EQ5A 1HYQA 3BMQB 2QPTA 3JQGB 5B3JA 3Q9LA 4H4EA 1DKQA 2WAAA 3PHCA 2BTEA 2WFMA 2IUFA 3FMPB 4OHPA 2YV5A 5CURA 3Q8KA 2HADA 2O9JA 1HK7A 3OPVA 4O4LF 3Q5EA 3FZGA 1BYIA 4YREA 1YVPA 3K6JA 3VX4A 1SC9A 1TM4E 3U4AA 3NMUF 3AJ8A 1W5SA 2ERXA 4MUHA 2GT1A 3OZWA 3LW7A 4BO7A 4UM8B 1N1GA 3CNLA 1ACLA 4HYEA 3V55A 1E7MA 1JEQB 2ZANA 4PIVA 2X0RA 1CZHA 4V0QA 2A6PA 5D51S 3ZW7A 1U2RA 1C7RA 1P1BA 1I7LA 5IT0A 1FDWA 1HDXA 4HAZA 4U02A 1AS3A 4KH0A 3AI1A 4OEHA 3ODGA 4GOJA 4Y6OA 5CVEA 4DLVA 1QU3A 3HWSA 2WM2A 1MLDA 4K81B 1IONA 3S3TA 3WYFA 5MN4A 2AFIE 4QGFA 5EFOA 2F1KA 2GRAA 2Z43A 3JARB 2HQ1A 5KYTA 4DCVA 1N57A 2EWWA 3M4YA 5TR9A 4ZOQI 1VBMA 2DMRA 2VJMB 3R09A 4HAVA 4P81A 2J4DA 1MB0A 1F51E 1DEKA 2NXNA 2OG1A 3D8UA 4TUYB 5C7LO 2OO5C 1TLLA 1PNRA 3NGMA 4PLVA 2O20A 3CCBA 2P9EA 5J5CA 1Z75A 4OHWA 3QY9A 4DBZA 1VLMA 2IYSA 2QW1A 3G0OA 3B2EA 2EJUA 1KBZA 2OZLA 3IGFA 3KZNA 1ZJ4A 2Z8XA 1BXGB 3JVVA 2JBWA 3NTXA 5DGTA 1J0EA 3D3WB 5AOBA 3PYLA 4ZQIA 1OMOA 3IQGX 3OCXA 1FLNA 3R23A 2F59A 4IZIA 2Y6UA 4MV0A 2W9XA 4QPZA 1NSFA 1H93A 2QLFA 2PBFA 5JAQA 1GSOA 1Q74A 4DMHA 1ZIPA 5A5GA 3CXRA 2CW5A 4S3MA 1GAEO 5H81A 3OOEA 1L8AA 5JVDF 1SKBA 3QYFA 3Q7QA 1C4OA 3FTNA 1PQPA 2VSOA 5G3YA 3DLBA 1FB5A 2PZ8A 3OO1A 3VYSB 4CM5A 3G7NA 4TZ6A 5HNKA 5IX8A 1KPGA 4BNGA 4ZAYA 3OOYA 3R6GA 4EGFA 2PV7A 4OLAA 5KTRA 4FEYA 4L3OA 1FDRA 2GSWA 1ULHA 1XELA 3G5TA 3NV9A 3GC6A 1IZZA 3CB4A 3BCRA 4HFMA 3GRPA 3ICWA 1SPXA 2ZR0A 3ESZA 3HU5A 5A9SB 2GNAA 4IH4A 3OMLA 1M2OA 3AIOA 4FDLA 3ZZTA 1EA7A 4G9EA 1MQAA 3GGGA 4IWXA 1GNTA 3VZRA 4PLGA 3EY9A 3IBSA 4JD5A 4JJ8A 5L40A 2BUCA 2Z9DA 5FWDA 1AIPA 1N2OA 4X24A 5KJ1A 4CRWB 1T8TA 5BQFA 3JSXA 1LI7A 3QVWA 1IBKB 2NUPA 1T9GR 3E0XA 3ZWMA 3FOFC 4O4JB 2O54A 4ILKA 5BT9A 3C48A 5LYYA 3RHFA 4YJ2A 2JK1A 3BHJA 1AU9A 1Y80A 1Z0FA 3T9FA 4OHBA 1GZ4A 2BSXA 3SN6A 1T8YA 1PGPA 2G83A 3LUKA 4KLZA 3UXYA 2DFTA 3UUEA 5AM2A 3QP9A 4GH5A 1HWYA 7ADHA 2VXCA 5F9FA 4J3JA 2EJVA 3ELBA 3KZ1E 1JQBA 3G89A 5JT1A 1W0CA 1VE1A 2NO4A 1W76A 3SP1A 2GLXA 2HMSA 3A37A 2PBZA 2CXTA 4GZLA 2O8CB 3OE7D 3DE5X 3V7FA 1PJQA 3V1TC 1VG8A 1XKQA 1DLJA 1I9GA 2ZAIA 3KR0A 3WWYA 2DR3A 3BREA 5C8ZA 1Z5OA 1WCIA 3K7EA 4ZIRA 4O08A 2HYDA 2QQEA 1SCDA 2QQ0A 3AKDA 1HE1C 3I32A 3MRXA 3WB9A 2Q5OA 3G0IA 4D8UA 3LL7A 1L5VA 2QGZA 4KDFA 5KQGA 2XYVA 4B75A 2IXFA 3RASA 5L3QA 4RA6B 4F3NA 1FU4A 1JR3E 1XGKA 1GL9B 4FOSA 5EMJA 3UF0A 2HEGA 4LXYA 2NZ2A 3K9WA 2RIPA 2X9LA 3QQ5A 4MQUA 1L3CA 4MGEA 3JXEA 4US2R 2Y76A 4US1R 1O95A 1Y5RA 5CDUA 1ICEA 5JECA 1NX6A 1JBKA 1H2RS 3EWIA 2X9QA 2O8FB 3K5WA 4DCSA 3OKAA 4EGQA 4G0NA 3SXUB 1GWNA 1M73E 1Z4PX 3EN0A 2XUKA 4WLVA 4D2IA 2QUJA 1JG6A 5DN9A 3KP1A 3BXGA 4QDZA 4AYWA 1COWA 5T57A 1AGNA 1R88A 1CEQA 4DJTA 4M7WA 3P9CA 2R11A 4LNUB 1N2CE 2EV9A 3DOIA 4ZCQA 3WIOA 1PS8A 1ZOPA 2OHOA 5LQDA 1R4MB 1RRVA 5AVKA 2WJ3A 5E4JA 1QQAA 4MGKR 3QE4A 2DWUA 4UD2A 5AK6A 1I7SB 5ALOA 1N32B 2JIBA 5KDDA 5HMMA 3VVMA 4FU0A 5IJ0B 3MHPA 4KBGA 3DEYX 2GF9A 4OI1A 2PSFA 2MYNA 3A27A 4KKXB 1TE2A 5EZYA 4M88A 3MJTA 1Q0RA 1ST2A 1K66A 3THYB 5JBNA 3UV7A 3PLRA 2ZIZA 1T6ZA 2A2ZA 2OGSA 1PBNA 1ZRSA 3D4IA 4AX4A 2DBQA 4LJ8A 2R48A 3PDJA 4QBHA 3VQTA 3CZ9A 4DNQA 2G9RA 3CNNA 4EL0A 1H6AA 2PJZA 2UKDA 4JI5B 2Z30A 3EFHA 2YYYA 3IBTA 3OAAD 3PHLA 4RWZA 1RWOA 3E48A 3UB3A 5BV7A 3GLFB 2UYCA 4TXLA 3CVVA 3ANYB 3TFOA 4AMZA 1KGSA 1NUSA 2PUCA 4A0FA 4FTWA 1U7TA 2BMEA 2KS6A 3BH7A 1E6KA 2WHQA 3WB1A 3TAXA 3KVYA 4L6IA 2OUKA 1GP2A 3VAZA 3PKZA 4LF8B 4HLNA 1HV8A 1XZBA 2OCIA 2V8BA 3HWRA 3JVEA 1P39A 3K32A 1LCIA 1HRDA 1NVAA 2XMQA 2PNFA 3ITDA 4MYDA 4GMKA 2GKSA 5ALWA 2FUKA 3NH9A 2Q6TA 2FP4B 5I7EA 1W96A 2XDWA 1L7MA 2WU3A 3NGXA 3QFFA 2NU8B 3W5JA 4F4IA 1YS4A 9LDBA 2QRZA 1GRRA 1MTZA 3K35A 4HTFB 4TTJA 5B1IA 1VE9A 1WULS 2JCXA 4N40A 3CF4A 1BU8A 3JZIA 1B6RA 4EL5A 3DO6A 4FONA 2VDNB 4GI3A 4BASA 1M2KA 5DF1A 1RXSA 2B8JA 1K0FA 1P45A 3DVAA 2AOUB 2IV3A 2R84A 2BFBB 1FP7A 1DC7A 3N2GA 3PWTA 2JFPA 2O8VA 4O29A 5HQ3B 2PX0A 2RAVA 1NT4A 2VJYA 3BGIA 3G79A 2HK6A 4D9FA 3W9SA 1NQXA 1PVDA 2B37A 2X3YA 3PTZA 3G1WA 4FS3A 1FX0A 3GJ5A 3A1UA 1D2RA 4RHXA 1P60A 4JVLA 3WRWA 4JR0A 4LCJA 1ZUNA 1BVUA 3QSYA 2GVDC 2X5OA 2QVXX 4PPNA 3VYUB 3EGCA 4RTMA 2WAXA 1UWKA 4V02A 4XTRA 4EGAA 4YXWD 4HTAA 4RZXA 3SVTA 2P67A 1C0PA 5JYBA 1C1DB 4TMVA 1KARA 2WJ6A 4WXRA 3OY2A 1UBRS 4V0NA 2MHCA 1L3IA 3FCYA 4IIJF 5IZ4A 1AUOA 1RBZA 2I4TA 1XSEA 2G7ZA 3U13A 5AI9A 4JBGA 5JS2A 1FSGA 2BFCA 5GM1A 1XTPA 3K1AA 2O8BB 2CJYA 3PDHA 3RCBA 3IALA 1E3WB 2ISSD 3INYA 1PJSA 2PQ6A 4Y2TA 5DK4A 2J3QA 1YJAA 1F14A 3PPIA 3E5RA 1TYDE 2J3EA 3A4IA 3U4CA 1ZNXA 4DV3B 2D2IA 1KRHA 2LE0A 1JQ3A 4G5HA 4GSLA 3ZLVA 4EHDA 1R74A 4ZOLB 3O8LA 3KC2A 3KTOA 3GX1A 4I9GA 1RE0A 2JRLA 5CLLA 3DF9A 5EEHA 1WW2A 2C9MA 2XUIA 1IOVA 3CR7A 3FZNA 1YZLA 3GARA 1A95A 3HJGA 3K9GA 5H59A 2I1WA 3UC5A 3TKYA 5IU6A 1E1YA 3MQ4A 3I01A 5DYYA 5KYUA 1RC0A 5D1NA 1P62B 1UF9A 2BGRA 2EGHA 3VOBA 3IMEA 4TL8A 4OP2A 2C4HA 3HVJA 3PEVA 3VR3A 4D0NA 4GVLA 5AKXA 4BMCA 3ROTA 3V7UA 1IBSA 1DL5A 2VP2A 2WPDA 3AHJA 3EUWA 3FLMA 4OFZA 3S2IA 3SI7A 5C1PA 2DJ5A 1L5ZA 3IXLA 3MWLA 4GKJB 4IS3A 1Z4LA 3DEFA 1E2PA 3I6IA 3O90A 3ORFA 5DTMA 1IULA 4NBRA 5G4KA 1WIWA 2MU1A 2VJOA 3I0NA 4CUJA 1OXUA 1XRNA 2OBMA 2VHWA 4C08A 1GDTA 1PSZA 2OBNA 3IP8A 1YWGO 3W1VA 5KQSA 2C2MA 1GZ7A 1PQUA 4ZC8A 5I3ZA 2FJUA 2VZ9A 5K3CA 2GPJA 2ZYHA 1I3CA 5T4EA 3VA7A 1RXVA 2D8MA 2OBLA 3WOHA 1M8FA 121PA 2FZVA 1NF2A 3ZU4A 2ZB7A 1BWSA 1O94A 1QX4A 1XAIA 3OIGA 4L6AA 2GMWA 3SZRA 5A62A 5LQCA 1UK6A 2WIDA 4A0QA 2R8YA 2HU7A 5CVDA 1GA1A 1MQSA 1Z88A 3B6ZA 3ONWA 3OF2A 3S2FA 1M6NA 2COEA 4QBKA 5IBCA 4D74A 2H1WA 2FRDA 1PZEA 2IF2A 2FN7A 1TA9A 3ZHXA 2YVQA 3IYLW 2BMVA 2H5LA 4KWEA 4OQPA 2H4WA 4XB2A 4S1NA 5EIBC 4GOND 3EG9B 3RT9A 4P4NA 1SOWA 5HUJA 4ZOLA 3KFLA 3UGTA 1BJTA 5JFTA 2Q5FA 3O94A 3VR4H 1S9DA 5I45A 2QRVB 3PV0A 2ZAGA 4XZ3A 1FUKA 4HB4A 5JXHA 1C3EA 4PPQA 3C3MA 4YMIA 1UOQA 1BN7A 4J43A 4INJA 3W2FA 4B44A 1YZHA 1C0IA 5I5EA 3HKEB 1MB3A 4Y2YA 4BFYA 4YRQA 2CLFB 3C6YA 1ZZEA 2EL9A 1CQJA 3BDAA 3GPCA 4XWAA 3FVTA 3FR7A 3JYOA 1R5NA 1B3BA 4BJ5A 1PV4A 1ZK2A 1M67A 2WU0A 2P1ZA 4F6CA 4QYIB 1XZNA 3B7PA 5F3RA 3BRWA 5CFNA 2JLVA 2Z58A 2NUAA 3FZYA 1I7PA 1AZTA 3LBNA 3V8BA 3LKZA 4IICA 4Y98A 3VSCA 2HRZA 4A1OA 4IDCA 4CMAA 3I2FA 4NULA 3SFZA 1KJZA 2ZWIA 4WN9B 5AM1A 4YCCA 2G1KA 4MV9A 4OMFG 2XY4A 2DWOA 4FIZA 3CLRD 2PIAA 1X7DA 3TQQA 5KC8A 3SDZA 3FYHA 1RVV1 1CY6A 2IHUA 1PJLA 4ZXFA 4IMIB 2P27A 5DSTA 1C29B 2F9LA 4YJ3F 2C9YA 1GUYA 2QV7A 1Y6GA 2CF6A 5F5NA 4ZVQA 4MMXB 2F43B 4XRRA 4DT1B 4LJ9A 3NOXA 5E9WA 3CZCA 5FPYA 1KVTA 1O0SA 1QS0A 1UJ2A 1X9HA 1WZIA 2QLTA 1LRJA 3LUJA 4OQEA 3V6LA 1HC7A 5HZMA 5AKEA 3C3AA 4M37A 3E1KA 2DQ4A 4S2UA 2ON6A 5GADl 5BSRA 2GSDA 1KDRA 1SU4A 3BRQA 1KKUA 1ISFA 3CLTC 3H1BA 1Q5PA 3LMKA 2HIHA 3SYMA 3I6BA 1CDZA 4HDAA 3PXGA 4C07A 2V3CC 3IAHA 3LYAA 1K8ZB 1GUFA 3EVGA 1KO8A 2R8XA 4H0CA 4JEMA 1KDYA 3IAEA 2IPOA 1QYWA 2EDAA 1JWBB 1OLSB 3DPSA 3P9ZA 4L5AA 4EI8A 1O6CA 2CVOA 3NHUA 3AUAA 3UT5B 1FJGB 5CVJA 1W87A 2FAXA 3NETA 3JATB 4NAHA 2CSUA 1Y33E 4RACA 1EX1A 4Z4EA 1N8KA 3AF1A 2WYOA 3ZH9B 1BMDA 1QIGA 4REOA 3T7EA 3T3GA 1ISPA 3SR0A 2W2KA 1P6UA 1YQTA 1QFSA 3SLGA 3ABSB 4FHZA 4Z51A 5T3YA 2D4AA 2FZLA 4U2GA 3H9CA 4TYYA 4D9GA 5CITA 1COWD 3BE6A 4UXIA 4HP8A 3RTBA 1Q3HA 1E1NA 1NNLA 3RRZA 3V9PA 4E2WA 4ETMA 2GPNA 5LKRA 2X1VA 4AVYA 2Z5GA 2QSYA 3L93A 1ZSNA 2J9ZB 4HGZA 5KBYA 1TLTA 2BZSA 2WF9A 2O6LA 3DTNA 1PZFA 3IP3A 4QUJA 2DFKB 2FPMA 2FFAA 3IVGA 4WUTA 3EASA 3ONNA 3QF4B 4WGFA 3WRYA 4QBIA 1R27A 5BSFA 1Q77A 2QBYA 3CR3C 4ZI2A 4OB6A 3PHHA 3KAQA 2Q7DA 3R3ZA 1T0UA 4HLCA 4M0EA 5FQOA 4AJJA 3OJ0A 2ES4A 3I58A 3ORQA 3ZXUB 1IJFA 4BUCA 4NU5A 3ICOA 5K01A 1HX7A 4R1TA 1IFXA 4G41A 3L1IA 4LY6A 5DWQA 4R1OA 4R1PA 4J0HA 4LIPD 1UM8A 3SXJA 5K4GA 5LP6C 3OKFA 4YR9A 3FJOA 1OXMA 2XOXA 1N5LA 1LTKA 2FDRA 2WY2D 1N34B 4LJLA 2JGIA 4U39A 2X4DA 2OV3A 2ZQYA 5B1YA 4W4TA 1N5DA 3IEPA 5FR1A 2VHZA 4TRMA 2CHUA 2XWBF 3TWOA 3OLYA 3P0HA 3PJDA 3C3YA 3ZCQA 2O2ZA 3GRKA 5HMLA 3KQOA 3W4KA 5LL6P 2PX5A 2LKDA 3IAM6 4AWXA 4EYGA 3TSWA 1N1EA 1UDRA 5F23A 3WGLA 4JVOA 4RHCA 1KVSA 5G2OA 3WAKA 3DWEX 3O91A 1E7QA 4A7PA 2ZRMA 4GRIA 3RC9A 3L8EA 1CW2B 2P4QA 3MWFA 4J16A 3BQNB 5CD1A 4Q3LA 1V5GA 5DNYB 3A70A 1WL8A 1B15A 2IA5A 1AKNA 4REQB 3NZEA 4B0PA 5I4CA 1KY2A 5DJ5A 5EUMA 2H1HA 3DHEA 2BFEA 2NT4A 5ILOA 5BSVA 3QIVA 1JU4A 2JDIA 2GDZA 4BMSA 3NP9A 1LZKA 3AU8A 1P9LA 1OY1A 3UV6A 3HY6A 1O7JA 4CL0A 5LQAA 3WL4A 2JA2A 1RW4A 4YQFA 4AS1A 3R7FA 2ZTLA 4KTVE 2QL6A 1U0EA 1MR3F 3KE9A 3MT0A 4PHHA 4UFOA 2R87A 4ZYZA 5C4IA 3TG2A 4H6WA 1K5DA 5BORA 2I6SA 3A1FA 4HNQA 2RK3A 2C7RA 1ELOA 4DMFA 1RE1A 1ZI6A 5DULA 3LC0A 4ZI5A 3BIJA 3JYHA 1PT8A 1KYTA 4OSPA 4WLOA 4C7BA 4CDNA 3PA8A 1NC3A 5HKAA 2C3YA 4O2AA 4N6OA 2B1RA 1FVFA 3BX1A 3UMYA 1BE6A 5KSOA 1EFUA 1Z8NA 1QCZA 4JIMA 2EKDA 3FTPA 1XAHA 1UEXC 4KE6A 4HJXA 4OL0A 3TNLA 4E5VA 3DBVO 3MLAA 1M3SA 3A0RB 1N75A 2XADA 2RGNA 3JU3A 4J0CA 3FMFA 4TQAA 4DIBA 3KVRA 5IH3A 2YHSA 5JTTA 4YRAA 1T0IA 2V7BA 5EIWA 4PANA 5HFAA 2IV7A 3K0HA 3OPYA 4KMMA 4YBZA 1QV9A 2IKQA 4HAXA 5FB3A 2UVDA 2ZAYA 5GONA 4CKZA 4XJSA 2HSGA 4H0FA 4HH1A 4DSOA 1M72A 4QPJC 1RQ7A 3ICEA 3LUCA 5EMKA 2PUVA 2EZ4A 4RL4A 3VH4A 1TTTA 3PDCA 3K4HA 4NENB 4GLOA 4XGQA 2XR1A 1FP4A 1ZA2A 4MV7A 1V3QE 3MBIA 3OOWA 3H16A 3ZCVA 1M33A 1QHSA 4KC0A 2Z2KA 1C3XA 4F60A 5TGZA 4HZIA 1KH1A 2ANCA 2EARA 3BE5A 3B78A 3DGEC 3PUJA 1NL3A 5KYKA 2ZROA 1YE5A 3I64A 4ZANA 4L02A 4UDYX 3CUSA 2H08A 3DB1A 3A1DA 3QTBA 1Z0ZA 1AKWA 1SVKA 1XZJA 3G2QA 4GMFA 3UAYA 3FCXA 1TKBA 5HUQA 1QVVA 2Q99A 2WD9A 4UXJA 4UNRA 5AI5A 2VP0A 5EIBD 4OHOA 2GM4A 5CP8A 5IHPA 3HCRA 4ALKA 4P4UA 2V6GA 4BNYA 4FDTA 1T4MA 2AT1A 3PUYA 4EAAA 2RGUA 3NKLA 5CMLA 4YCSA 4YAFA 4ZCIA 4M0PA 4CG2A 1H3NA 3QOXA 4MW2A 5DNEA 4YPOA 4J6EA 1TIPA 4RENA 3TSOA 1WD7A 3OC0A 4LF5B 4OBBA 2BM9A 1JG1A 4YP0A 4W9NA 3V1MA 2ZR8A 1BKYA 3GZNA 3QG1A 4GS5A 3EXFA 3VR1A 4B46A 1CNFA 2JLCA 1RABA 2QMHA 2XGSA 4LZPA 2J5BA 2G25A 4P1ZA 5PGMA 1MX9A 1G3IA 1R4NB 2A8YA 5AVRA 5DT2A 1RJEA 1ZITA 3AGQA 1QXSA 1UOPA 2HU2A 1I4DD 2HNKA 3OJFA 5AVOA 1FPMA 5DE3A 4AJOA 4B2IA 1DU4A 1YDEA 1IY0A 1AVTA 1UADA 1QOPB 3AHDA 4XR9A 1NFFA 1E79D 3IKVA 1V0JA 1V41E 1PS0A 4PZPA 4IMPA 3NC1C 1AGYA 2H16A 1SH7A 5DCLA 5HKKD 3OQMA 1XA3A 1EK2A 1ZUD1 5CVUA 1YAHA 1L4MA 3C0KA 1FFCA 1G0OA 1E1MA 1TMOA 2G80A 1FL9A 2PJDA 1T1RA 2Y9PB 3IXQA 1M6VA 3O5AA 4GE0A 4ZT7A 2DE0X 1QVZA 1LW6E 4O5AA 3F6CA 3IKMB 4JCCA 2P1RA 2W90A 1M0TA 5TJHA 4JCOA 3B53X 3CN9A 4OBXA 3EXHB 4U7FA 3T99A 1I01A 3CVWA 4JEIA 2FX5A 3Q10A 4RTRA 1BCSB 4KN6A 1N9GB 2B8NA 4H3KB 4QWMA 2Y27A 2QD4A 1ZLYA 3H0KA 4B3BA 5LYJF 1MX3A 1IBLB 4JN6B 3WDSA 4B76A 1A9XB 3G9TA 5DT9A 5A4IS 2CHFA 1EFPA 2XCUA 5C5DA 1NVTA 1P5ZB 5MFPA 3H9UA 1L6IA 2QTAA 3DAFA 5LQKA 4TM8A 1JILA 4C1NA 1E1LA 3C3DA 2J45A 4OFXA 3ZD7A 4R05A 3CPHA 1W29A 5BPFA 4GR9A 4O63O 1Q1BA 2QAJA 1WF3A 3BGOS 3Q1LA 4JFRA 3RIXA 1OJ7A 1ZBQA 3CWCA 4F86A 5HWSA 5I9TA 1E89A 2G09A 5JVDB 1JR4A 4PPFA 5I7OA 4A0SA 5KQRA 4MXDA 1SA0A 4URWR 5BN4A 2JLRA 3UH0A 1YS7A 4N76A 2G82A 3G9QA 4CI9A 1A5SB 4TVBA 3IEVA 4YLYA 8AT1A 3FRIA 1XMVA 2QR3A 4BKPA 2HRBA 4N5MA 3KL2A 2FVYA 1NULA 4JL5A 3WZMA 5A0TA 1AK1A 1NY5A 2DUMA 2VBIA 2JGNA 5EZ6B 4CFYA 5BWOA 3D6MA 3P2EA 2QTRA 4IIDA 2VUUA 4YRDA 2OFXA 1E2QA 1QWOA 2PA0A 1NP3A 1W34A 2FV8A 4AG3A 3M6LA 1CHNA 1BKDR 1ZG3A 2C5FA 2PWAA 4KZKA 3TQIA 4DY4A 3MOIA 1J6UA 4KFCA 4XPZA 1X7ZB 2WFLA 2ONYA 2P90A 2NNWB 5HOEA 3EIFA 5JNWA 1G66A 3GEBA 4MQLA 1J8YF 3DZKA 5IAEA 3EUFA 4ASUD 2GI4A 3H4IA 1LSUA 3TNDA 5LDDC 3SEQA 1SKYB 5IASA 3IUYA 3NVMB 4RVCA 4ZAFA 4H27A 5J40A 4HDMA 5TX7A 3OTQA 1KFBB 2BV3A 4IV5A 4F91B 3I2IA 3PD0A 3BWBA 2BHSA 2D3TA 4QOEA 5J4HA 2WUDA 4P4TA 3P9YA 1XDSA 3VDQA 2HWUA 3U26A 3KFVA 3L92A 3W5IA 1A8IA 4M0LA 3GDFA 1L7QA 1UINA 1C3VA 4LJ7A 3TW4A 3NW9A 1RYDA 2X9VA 4JLAA 1T2AA 1JA1A 1SQ6A 3DNMA 2ZP1A 1U3UA 1LC3A 1RAEA 1WCIB 2FW8A 2PUJA 2WIBA 4F5WA 5BR4A 5JY1A 1M0EA 4F2PA 5BUZA 4KSBA 3N6VA 2PUBA 3A6PC 3LUBA 2O5VA 4J0DA 1DB3A 2FCAA 1POXA 4BGEA 4QJ4A 5EESA 1SELA 1L6RA 1PR0A 4RNDB 3SSMA 4EG7A 1XTZA 1JHMA 1TQ2A 1DAFA 4LDJA 3JQQA 4D80A 1AMNA 4XEHA 2Y1XA 5TVGA 3D0QA 1A9YA 1MGPA 1P2VA 2JJ2A 2XRFA 3G9XA 4HQ6A 3GLHA 4DUZB 4GIBA 1U2GC 5JG7A 4DFDA 1KIMA 3AI7A 4U2BA 1EUDB 4NK4A 5CM8B 5JCZA 3RK4A 4UUOA 4M8KA 4P0TA 4WOBA 4AL4A 2HRQA 1BXKA 1G1AA 2IIPA 1L4GA 3G5MA 4Y1FA 2O2JA 1AKQA 1DIBA 1XNRB 1P3DA 4L8YA 3N2EA 3TM5A 3QGMA 1Z4OA 3AHCA 4YASA 5AIAA 1YTLA 4OQNA 1A4IA 4DJAA 1M2NA 1T9HA 2DPHA 4L8LA 3RADC 3TFWA 1YCDA 1PEKE 2P2YA 3PDIA 1J06A 3ZBUA 1HYHA 4XYEA 2HLDD 5DN6D 2IWHA 1EIWA 2ZU6A 5EXEA 3PP8A 4MV4A 4MHTA 1B4DA 1KY3A 4JC4A 3AVXA 1D4AA 3T5CA 4HNVA 3C1OA 3HN2A 4B80A 3ZU2A 3GLFE 3ITNA 5GWXA 2V45A 2PXCA 4HUQA 4M0CA 1O94C 3R0ZA 4W1QA 3RD5A 5GINE 2QEQA 3RSGA 3RSZA 2DXIA 2CXNA 3IB6A 1YJCA 3OF3A 5DNUA 4K87A 1JNXX 4YBRA 4Y7CA 5FA6A 1H9CA 4M1YA 2X8AA 4B7ZA 1WDMA 3EULA 2GM9A 3TXXA 1QJCA 3G2NA 4PAMA 2DR2A 1TU4A 3CRVA 2E87A 1Y6ZA 2ZB2A 1M2GA 2AG8A 2QM3A 4L5IA 1HQDA 2IOYA 2WB4A 4ZU1X 2HCTA 3OSUA 5DTJA 3RRBA 2ERCA 3CF6R 4Z4GA 2GBFA 3BRCA 4OD0A 421PA 3AYXB 4MUEA 2CMKA 3JVDA 1FZTA 1A77A 4X63A 3CA8A 1D9XA 4WHMA 1EEHA 4TSFA 3PE3A 5FBKA 5IDQA 4LVCA 2BT4A 1K6IA 4EO7A 5K7SA 5LZ2A 1E2HA 2R6AA 3AP3A 4HRVA 4XOUA 4B6GA 1L7AA 5AVWA 3RYCB 1A9TA 1H2YA 621PA 4FMCF 2NYRA 5ARDA 1JR3A 2AOTA 2X8WA 3AY6A 2VRCA 3F1KA 2J0SA 2XZDA 3L04A 5TS2A 5FA8A 2Q0SA 1Z74A 4Y1RB 3VO2A 1MRZA 5GJBA 4GAEA 2HKIA 3SZLA 1W1WA 1I1QB 4D99A 4QTTB 4N9WA 1A97A 3Q8XB 4ZOLF 1AOXA 2BKVA 4KACA 2OO3A 4KXFB 1UOEA 2WWWA 3JARA 4RLSA 3HGMA 5BWLA 4OVKA 2J6IA 1OBOA 3X44A 1LD3A 1URPA 5EJEA 1FSPA 1GU0A 1DFGA 1U8YA 4BTLA 4XVRA 2DZDA 2PANA 4RK5A 1JDJA 4KR9A 5JYCA 3IEIA 3A1WA 2FVXA 1QTRA 2Z2YA 2AX3A 4PZCA 3S70A 2M1XA 3TL6A 5HTOA 1Y37A 2XWPA 3QBTA 4KFTA 5PNTA 3ZW9A 1RHMA 4REMA 1X0XA 1HKUA 4ARBA 1YB2A 1N2CB 4IXMA 3BTOA 4CL3A 4GX1A 2A59A 4LGCA 1O08A 4ZIRB 1VBKA 1KK0A 2VS1A 2ZJYA 3GLRA 3LRTA 5IBPA 1N6PA 3AESB 4HEHA 3MAJA 3AR5A 3CLKA 1JFFB 4X91A 5FBZA 4ND1A 3GJ3A 3P4UA 1UMKA 3IUSA 4G9GA 1HYBA 3AB3A 3CZ5A 4ZVUA 4BV2A 3QWBA 1JKJB 5A71A 4EJMA 2Y67A 3V7NA 2C1ZA 3CU5A 3O84A 1TEXA 4MKIA 1JAXA 4XB1A 1O5TA 4KWCA 5IM5A 1TIKA 4WBSA 1JSRA 1U5AA 1J24A 2HOQA 3GNQA 3URMA 3E5MA 4W7HA 1NBEA 4QKQA 1L5WA 2ID8A 2XE7A 5LD2B 1DQSA 3AF3A 1BD4A 3B9BA 1W0JA 1PFUA 2NUPB 3BJMA 3LX6A 3R9IA 4ZEMA 2LIPA 3NPAA 1H3EA 1DTSA 1NE7A 4HMPA 4Z49A 2BMJA 2E4WA 3H1AA 3FDZA 2FSGA 1R6DA 5COAA 1ORRA 2LR0A 1ZJZA 1BS1A 2C57A 2UZ0A 1C4WA 3EGDB 3FSEA 3M2PA 1YU9A 3HL0A 1VRCA 4M4SA 4R1MA 3VBEA 4ZCRA 5A9SA 5K3OA 5CCBA 3RWBA 1VKRA 3LQ1A 3Q2KA 4ZRDA 3OX2A 3LKDA 2MR6A 2YV1A 4X97A 2I4MA 3G2PA 1JIKA 3HBJA 2X8LA 4OMDA 2UYHA 3HKCA 1JTEA 4RSMA 1XQWA 2C5HA 3IP9A 2L42A 3DDNA 3N0WA 1SBNE 2H9AA 1WA5A 5IEBA 1E5DA 3TR6A 2VI5A 3EGIA 4A6DA 2XVXA 3LL4A 4MVJF 3V1YA 4HFNA 1V16A 3M49A 4JBNA 3QEMA 4K3VA 4QASA 2B3DA 3I8SA 4RVDA 2PEZA 3IAXA 3QXJA 4TMFA 1A5BB 1F2TA 5JLAA 1VLQA 2GZ1A 2O2EA 1KZYC 1Q2XA 3VU3A 1GKUB 2EERA 3A6HA 3MUOA 1XQVA 2PRSA 3NOVA 3V4OA 4EYQA 1H2EA 1TCAA 1TM3E 3FHTA 2EFJA 1ULBA 1Z6QA 2Z8ZA 3A6LA 3CXUA 2CJXA 3HDYA 1M1YA 3KB1A 4RD3A 1M2EA 2PK3A 1KFEB 2ID9A 4MUJA 1QGAA 2FP3A 2JKVA 4HS9A 5BNTA 1B42A 2XUZA 5CXXA 3KZMA 3WBJA 1CR1A 2JCBA 4W82A 3JZFA 3K0FB 2I76A 3CX6A 4II7A 4W5NA 2DGDA 1JMKC 1Z6ZA 1QANA 1J97A 3V3TA 1XTVA 1GPDG 4RF5A 4X85A 1OILA 4GO1A 2EIHA 1PO7A 2ODEA 3MWKA 1KQNA 4ZVPA 1N2BA 1JB9A 3GR6A 2G0NA 4NBSA 2HCJB 2QN2A 4Q9JA 3T41A 4NJMA 4YRMA 4IG9A 4MI3A 4OTZA 1KU6A 1E8NA 5DCUA 4ER6A 2W2LA 1J8VA 1FA9A 4DM3A 1IN5A 5AUPB 2OCLA 4ZGBA 2AMLA 4XUGB 3UJ6A 2C54A 4AURA 1Q15A 1ZJYA 1JPNA 4HYTA 3N5CA 1ZM3A 4MULA 5A7GA 2XMGA 4W6QA 2XOEA 1Y3DE 4XKJA 3T3MB 4GSKA 2QJFA 5CLQA 4ZYVA 2BCJQ 3DE2X 3I1YA 1NI3A 1V9CA 2AUTA 2L69A 2O2DA 3B48A 3L77A 1BEEA 2IF0A 1KMCA 2LDBA 3MJFA 1VRVA 4LMAA 5K20A 1D8AA 2IYWA 2J8ZA 1AKTA 3OVMA 4ER0A 4IIEA 4L9SA 1FP4B 1F6DA 3KVOA 4K46A 2MMCA 4QGHA 4K6FA 4LYJA 1HKHA 1XMXA 2BFDA 4B74A 5KVQA 2I2FA 3WL8A 4XIJA 3HE3A 2FK7A 4E22A 3SBOA 5IK2D 2ADMA 1A04A 2E2WA 2YS6A 5CXUA 3RR2A 3SEAA 4KIFA 3U7EB 1C7JA 1JW9B 1PSWA 1SKQA 2P8JA 2XT0A 2JLBA 3N76A 3NALA 4IIXA 3I5YA 2HHLA 3ZK8A 3A26A 4HQFA 2B7CA 1TQ4A 1T4CB 3IMKA 2GEDA 3ILHA 4QUBA 1I5OA 4JQZA 1YS1X 1NJFA 2QLBA 3WDLA 3FYUB 1DBRA 3ZWPA 2RHDA 3NEAA 3CKMA 4DIDA 1DBWA 1NV9A 3ZDYB 2WUFA 3DJYA 4GKAA 3ZXYA 4EHNA 5KQPA 2C8LA 2O6HA 2PBLA 3EFEA 1Y1QA 4R2IA 5EE5B 2N0SA 2PD4A 2VPIA 2ROQA 4QD3A 1I9CA 1DSSG 1OZHA 3ZWDA 5COBA 3WGGA 5E6RA 4YXFA 3GLIA 3LK7A 1MC4A 2OQ2A 1F3OA 1XTKA 3GK3A 2OWEA 3TX6A 3UB4A 1ZIXA 2OV6A 2GK7A 4DXHA 2WWTA 4EB6A 1PWXA 3ENZA 4RVGA 4QT0A 1U0LA 1TMKA 1T8SA 1XZEA 3NRJA 5JJIA 4QDTA 5K2OA 1V11A 2J87A 3SDBA 3KAJA 1N7JA 4LXGA 4RCYA 2QLJA 3K6RA 4PU0A 3FOCA 4JX8A 4WASA 3VPAA 1S3FA 3NHYA 4PIPA 2JFHA 4TTVA 3A4LA 1DIHA 3BAZA 4X1KA 4V0RA 1T29A 5U4XA 3QLEA 4WQMA 2H1IA 1FNNA 3AR9A 3EIEA 4Z0TA 5LOVB 1M1UA 4HSGA 1F4PA 1JZQA 2IYEA 3IUJA 3WISA 1QPZA 1AQJA 4OLBA 2WSSD 1II0A 5E3HA 4P3XA 5HM6A 1J0BA 3TOVA 3NBQA 4LECA 1R8YA 1Z7GA 2AGVA 1E3JA 2VNIA 2BVNA 4IV8A 4NPHA 4U2KA 4WD3A 2OFFA 1CUIA 2WTUA 4EG5A 2BKLA 5HCUA 2FMTA 1YR2A 2RI6A 3GRFA 4IILA 5DVZA 3M6UA 1WLSA 3LYHA 5J2UA 3G0HA 1S2OA 2FEAA 3MFYA 3OFKA 4FMBB 1S2IA 3KLMX 4KMSA 4DQKA 2D0IA 1Z0JA 1RAIA 3H18A 4K6CA 3ZXXA 2YWEA 3GNLA 5FP0A 3KUUA 3T12A 1X1EA 2X0JA 3MYYA 2ZYTX 1XHFA 2WU4A 3PIIA 4Q1CA 3AXTA 4DLKA 1ZD8A 1JU9A 2XT6A 1VG1A 4OHMA 4PSKA 1TAUA 4BIIA 4FFNA 5ALYA 5K51A 5E4TA 2WIFA 4FI3F 4R51A 1EXMA 2XQIA 1EX7A 3LUAA 4RGYA 1KDZA 3UA3A 3KQYA 3GVPA 1PFGA 1YJ8A 2QTVA 3RFUA 1V8BA 3PA6A 3HA7A 3H7AA 4W9NC 3BSWA 4JB0A 4YRFA 2OBXA 2JJQA 3Q3VA 1UL1X 3NV7A 3SYNA 4KUGA 3TR0A 1FDTA 1WKBA 5FWXA 2D5LA 2RH9B 5FOTA 4GKVA 5DNWA 3K2BA 3UJCA 4GSYA 4Y3UA 3P4XA 1RAAA 3F3KA 4TWBA 3HCEA 2TSYB 4Q4JA 5CA1F 1K6XA 4EMSA 3FOZA 1MZPA 1KP9A 1PYDA 2B98A 1Y8RA 5K3EA 5L3SA 1KXJA 3MERA 5K3BA 3KJQA 1C2YA 4FBGA 1D4OA 2PMDA 5IPFA 1I1OA 1VCHA 2ZU0C 3D4PA 1Z62A 3F5SA 1MBZA 3IDAA 3CM0A 4NZNA 4GXTA 1PW7A 4RTQA 4V1CB 4RULA 3ISTA 1E2NA 1NW9B 4LXHA 4XDYA 2H1OA 1YQQA 1WSWA 5EQJB 5ICFA 2W2LD 3HEBA 4CR8A 3QU2A 1CFZA 3ZBQA 2OC9A 4JLNA 2I8AA 3TVYA 4B48A 4EHAA 5JQGB 5BVHA 1NG9A 3IOYA 3EPPA 5TPWB 5K8IA 3F49S 3G7UA 4BECA 4M1SA 2W48A 2CD7A 4Y0VA 1CIPA 2A9VA 1LTQA 1VPVA 1XL0A 3IT2A 4TKVB 3BFXA 4D4KA 4CIXA 3E4DA 5G1NA 2JD2A 1JIXA 4HV4A 4QREA 3HP4A 1UPUA 1N4DA 4CNQA 1R0YA 2JZCA 3AR2A 3CRNA 1NW4A 1U2DC 2PZLA 2VRNA 4F92B 2CLMB 2ZDHA 5IJXA