3TG5A

Structure of smyd2 in complex with p53 and sah
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
425
structure length
425
Chain Sequence
b'LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Structure of human SMYD2 reveals the basis of p53 tumor suppressor methylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 137
structure length 425
sequence length 425
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3tg5A03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3tg5A01
5KJLA 4WNGA 4F3VA 2C0LA 3CKBA 5HI7A 1NZNA 3CBPA 4AY6A 3VV0A 2KCVA 4UQZA 3TG5A 2PL2A 4E47A 4RG6A 1MUFA 2JV0A 2XCCA 2O8JA 2LSUA 5A7DB 4J8EA 2Y4UA 3LCAA 3GZ1A 4GZ5A 3KMJA 4CGVA 2VGXA 3LYAA 2QPWA 4RG9A 2W5YA 3RKVA 1A17A 2KCKA 2KCLA 3VUZA 5LCWC 3CVQA 4J8FA 1PEGA 5CCLA 3PE3A 3ULQA 2IF4A 4BT9A 1KLXA 5T0MA 4B94A 2GW1A 5D0OD 4J7FA 3ASDA 2FBNA 3OXLA 5JIYA 4U0UA 1MVXA 3GW4A 5LSZA 3QWVA 3MEKA 3U4TA 4Z4PA 5FZQA 3CEQA 2WQHA 3O48A 3KMTA 3QDNA 1XNFA 2R3AA 2HO1A 4O30A 4KBQA 4J7IA 5T0KA 4J0UA 4GCOA 4WNEA 1OUVA 4H7XA 2VQ2A 3EP0A 2P58C 3CBOA 4O6FA 3F9XA 5CHEE 1YA0A 4NJ5A 4LEUA 3OS5A 5JJ0A 2KATA 3S7FA 2C2LA 4AM9A 2ONDA 2NC9A 2PQNA 4GPKA 5JJTA 3M56A 4G1TA 2E2EA 2XGOA 3JYSA 2XPIA 3QWPA 4WNFA 3MO2A 3HYMB 4JLGA 3RO2A 5G05J 3OXFA 4HOUA 3MV2B 2UY1B 3LKUA 3OXGA 3TGOA 1WAO1 5T5GA 1XQHA 5CPRB 3CVNA 1N6AA 1PC2A 3ZN3A 3HNAA 5F59A 3ASGA 4G26A 4XIFA 1ELWA 1Y8MA 1ZU2A 3OOIA 4IN3B 4MI0A 4N39A 5HQ8A 3KD7A 3S8PA 4HOTA 4APOA 2Y4TA 3CV0A 2F69A 1IHGA 3IHXA 4UI9J 4ME2A 1HZ4A 4I17A 2VSYA 2I6HA 2PZIA 4FMUA 3Q4AB 2G46A 3ZHEB 1W3BA 3EDTB 4I2WA 4JDSA 2FF4A 4A1SA 4XI9A 1O9SA 4H12A 3VTXA 4YVOA 3N71A 3URZA 3WXXA 3AS8A 3ZPJA 4N2SA 3FPDA 2BUGA 4UQXA 3QKYA 3OPEA 2FO7A 4GYWA 3CBMA 3FP3A 4IJ8A 4N3AA 4IJDA 3CKCA 3M59A 4I2ZA 3TAXA 4HOSA 2YQ8A 4G25A 4HOQA 5KJKA 4U0SA 3RIBA 2VSNA 3F9YA 3F9WA 3RJWA 4N5CA 5G05C 4Y6CA 5JJ7A 5C1DA 4RZ0A 4GCNA 4GZ3A 3SZ7A 2QFCA 3ESKA 3LY8A 2R5SA 3M54A 5G04C 3ZHEA 1KT1A 3LY7A 5AYWD 3GYZA 4GYOA 5F6LA 3MO5A 4UI9K 2RFIA 2XCBA 3ASHA 3ZGQA 3CK9A 2KC7A 1IYGA 3PE4A 3SF4A 3CVLA 4G24A 4XI0A 4KYOB 3K5KA 3MA5A 3BO5A 3RU0A 3M5AA 2XGMA 3TG4A 3SWCA 1P5QA 4NRHB 1WM5A 5ARGA 5DIZA 5ARFA 3U3WA 4AIFA 1ML9A 5BW8C 3Q15A 5EKQD 5D0QD 1HH8A 3Q5MA 2Q7FA 3M53A 4J8DA 4C1QA 4J8OA 3ASFA 3RJVA 1FCHA 4UI9C 4N2QA 3MO0A 1MT6A 2LNIA 3M57A 2J9QA 2V5FA 4YVQC 5FZSA 1NA0A 3RQ4A 4I1AA 3BEEA 3LY9A 4JA9A 2VYIA 1MVHA 2W5ZA 3UQ3A 4I9EA 3RAYA 2L6JA 1QZ2A 1ZBPA 3UUXA 4WNDA 1ELRA 4EQFA 4GA1A 5EG2A 3PDNA 1ZKKA 4G2VA 3NF1A 4YNDA 4NVQA 4BUPA 2AVPA 5FJYA 5FZRA 4NQ0A 4BTBA 4I51A 2BQZA 2UY1A 3S7BA 2FI7A 1NA3A 1TJCA 1E96B 4U07A 3Q49B 2MHKA 4HORA 4CDRA 2FEZA 3DALA 3IEGA 3CK8A 3M55A 4N3BA 3Q47B 4CGWA 4BTAA 3AS5A 1N3JA 5A6CA 3E4BA 1QQEA 4YPUA 2C0MA 3MKRA 5F5EA 2XEVA 1HXIA 4U0ZA 3AS4A 2IGQA 3UPVA 5F6KC 4AU7A 3M58A 5TH7A 3VTYA 2HR2A 5FTPA 1N6CA 5JHNA 4Y6WA 4BT8A 4UQYA 5LCWJ 3FWVA 2YHCA 2DBAA 2HYZA 5JJ6A 1B89A 5FT9A 5CCMA 4GA2A 2LSVA 3KMAA 5TEGA 1H3IA 4BWRA 2PQRA 5M72A 5TTFA 5DBKA 2JLBA 1KT0A 3QOUA 3DB5A 2WPVA 3FFLA 5KJMA 2IFUA 4GZ6A 4I9CA 4MI5A 2VGYA 4KXKB 3CK7A 4YNPA 4JHRA 3KAEA 5KJNA 4GA0A 4AY5A 2VGXB 4YPAA 4WUYA 4W9RA 2OOEA 5EX0A 5JINA 5BNWA 4YNMA 3SW9A 4GYYA 3S7DA 5BT1A 4YPEA 3S7JA 4G23A 3ZFWA 4U04A 3LPZA 5G04J 4ABNA 3GZ2A 4QEPA 4LDGA 4J83A 4QENA 3R9AB 3RO3A 5AYFA 3F9ZA 3CVPA 3MV3B 5EX3A 2UWJG 4N3CA 4JA7A 4JL0A 3KS2A 4QEOA 4H7YA 3K9IA 5LSXA 2XGSA 3QWWA
chains in the Genus database with same CATH superfamily
5KJLA 2F8YA 4CCAA 2J4BA 4E47A 1OWMA 5CMYA 4OVUA 2O8JA 4I6GA 2Y4UA 4RSYA 4F6RD 4QFVA 3RKVA 3FUNA 2KCLA 1JCRA 5LCWC 4FADA 1MX4A 4L1BA 5ENNA 1PEGA 5CCLA 3LVQE 5FQ4A 4CDMA 4BT9A 3L08A 3OXLA 3DEPA 5AAOA 2X6JA 2QC9A 2I9CA 3I4RB 1SA4A 4KT6B 4Z4PA 5FZQA 4A55A 4ANVA 3L13A 3UINC 4ANXA 3CHRA 1XNFA 3D9OA 2R3AA 4O30A 1TNZA 4KBQA 4J7IA 4C0EA 3ABKE 4J0UA 4GCOA 2WXGA 4GZCA 1OWPA 4BSXA 2VQ2A 2CG2A 4O6FA 3KEZA 3F9XA 2OVFA 3JCKC 1YA0A 1BI7B 4DK5A 3TJPA 3FUIA 4HLLA 3S7FA 5CEAA 3AG4E 3TWVA 4HNAD 1DC2A 3TL5A 3UIPC 1QYMA 4GTTA 1BLXB 5H7PA 3MCXA 2XGOA 3FTUA 2XPIA 1YYHA 1SA5A 3HYMB 3ZXPA 3RO2A 4JLGA 5HS0A 4F53A 1WAO1 3DRAA 1XQHA 3CVNA 2EINE 3P2BA 1MZCA 3ZN3A 3V30A 5JHAA 4UWKA 2WVIA 3D9KA 3CR3A 1Y8MA 1OCRE 3BQOA 1H2UA 1DCQA 4MI0A 1SVXA 4OVVA 1UW4B 4HOTA 3ONLA 1U2VG 2F69A 3PZDA 3NOGD 4PDXA 1IHGA 4RQIA 1EDUA 3IHXA 3IXEA 4C9BB 4AV7A 3MKQA 2X6IA 1UJJA 3ML9A 2VSYA 4J6IA 2PZIA 3FEYA 2ETBA 2CFZA 2V8SE 3ZHEB 1N4RA 1W3BA 4LNUD 1O9SA 4EECA 3I3NA 3VTXA 3WXXA 3LJNA 3UM2A 2X6KA 3ENEA 4LNBA 5FQ6A 3PREA 4GTPA 4MBGA 3FP3A 2RKKA 4L9PA 4N3AA 4IJDA 2H6GA 3Q9UC 3M59A 5A23A 4I2ZA 3FH8A 3ZKJA 5LP0A 1MYOA 2YQ8A 1KZOA 5KJKA 3UIOC 3F9WA 3RJWA 4N5CA 5G05C 4RZ0A 1IKND 5CECB 5CMWA 3L54A 4FU3A 4UI9K 4FJZA 3ASHA 3ZGQA 2E0IA 4O1OA 3APFA 1LTXA 2KM4A 3AG1E 4XI0A 3K5KA 3CQGB 1N52A 3V2XA 4JPSA 2L0IA 3E30A 3TG4A 2I1KA 1P5QA 1WM5A 1MJ0A 2AWIA 5DIZA 4UWLA 2L9BA 4ZHBA 4IRUA 3FEXA 1ML9A 5BW8C 3CHMA 3Q15A 2BKGA 5D0QD 2BEDA 3CHOA 5CBOA 4J8DA 1FCHA 1H2TC 2VTBB 2J9QA 3R9MA 1UOHA 4I1AA 3FU3A 5AQ9A 3BEEA 2OEWA 3UQ3A 2P9UG 1MQSA 3E33A 3UUXA 2GROB 5B3SE 4K5BA 3TXNA 5IY5E 4GA1A 1FPPA 1ZKKA 4YNDA 3ZEFA 4NVQA 2NSZA 1N4SA 1G3NB 3HVEA 4M3OA 5FINA 3UT8A 3CLJA 4NQ0A 5ITZF 3SNXA 3DSSA 5EIDA 3QB2A 2IQCA 3W9FA 1MX2A 1V54E 2VSOE 1OCZE 4R7LA 2I1JA 2CHZA 3FTVA 2GRQB 4DX1A 3Q47B 3HG0D 3BG0B 1K8KG 5ENSD 3PZ2A 1S0PA 3CIAA 2WXHA 3DPYA 5BXOA 2J08A 2XEVA 1HXIA 4U0ZA 5KNGA 5CEDB 2IGQA 3UPVA 1O1RA 2YNQA 3FHEA 3DBSA 3VTYA 5D2MC 2HM8A 4DRXE 4CT0A 1BPOA 3FWVA 5E75A 3UT7A 4GA2A 3LDZA 5AQBA 4ILIA 3SBTB 3L16A 3QC1A 2XS1A 1XGWA 1KT0A 3DB5A 2WPVA 3FFLA 4HRLA 5KJMA 2LO6A 4I9CA 1SW6A 2IY0C 2JABA 5KJNA 3FUKA 4IYPA 4AY5A 4HRNA 3FUJA 3PNTB 3MZLB 3PZ3A 4N5QA 4HS2A 3TXMA 3DEOA 1AP7A 2ILRA 5EYLA 4LSZE 3QNKA 3S7JA 1QBQA 3LPZA 3CSFA 4QEPA 3WG7E 3R9AB 3RO3A 4F1SA 5AYFA 4TUUA 3F9ZA 3MV3B 4FHJA 3TWRA 2ETCA 4WWPA 5LSXA 2XZTG 3Q9NC 3ASNE 1JCSA 3QWWA 3LEWA 4GAAA 2C0LA 2DZOA 2OV8A 3CBPA 1HX8A 3ZU7B 4RG6A 2JV0A 1TNOA 4BX9A 2R2LA 2LSUA 2ZXWE 3KMJA 4A1GA 4RG9A 4BFRA 3AAAC 3HHMA 3D9MA 2F37A 3CVQA 2VGEA 4J8FA 1TN6A 2IF4A 1KLXA 2WXIA 3RSEG 2IJGX 5D0OD 2FBNA 1HE8A 5JIYA 4U0UA 1MVXA 1K1BA 3FU6A 5LSZA 1FT2A 2YINA 3QWVA 2FULA 1JPLA 2QYJA 5EN5D 4JVSA 1UN8A 2HO1A 4PS7A 1HF8A 3FUFA 5LOZA 2P9PG 3PEUB 2WXJA 4WNEA 4CYMD 4H7XA 3EP0A 2P58C 4DX6D 5BUZA 3CBOA 1TNUA 4PS8A 5CHEE 4BY6A 4LEUA 3G2WA 2M63A 4G8LA 2KATA 2C2LA 5AJDA 1X81A 2DZNA 3ABLE 1UJKA 5JJTA 3M56A 4G1TA 3MKQB 2E2EA 2WM9A 1X5BA 4WNFA 3MO2A 3ONKA 3ZYKA 3AJIA 3EHQA 4U7EB 1FT1A 3CHQA 3OXFA 4HOUA 2WMOA 3MV2B 2UY1B 3LKUA 1U3CA 3DSUA 4CZ2D 3ZXSA 3Q7AA 2BKKB 3R7QA 3OTNA 4PS3A 5F59A 4BSZB 2V5QC 4TXQA 3FH7A 4G26A 4XIFA 1ZU2A 3OOIA 4N39A 1OY3D 3S8PA 2DYRE 4NURA 1N4PA 3CVYA 1IQUA 1E8ZA 4UI9J 1DNPA 3ZNGA 4FMUA 5LFAA 4G8KA 4DX5D 4EPZA 2G46A 3EDTB 3U64A 4APFA 1OT8A 2FF4A 2KZTA 2ZU6B 4U8HA 5HKPA 3EIQC 4BEPA 2DWZA 4ACLA 5T8IA 4E6HA 4UQXA 1OCOE 3QAQA 4KMOA 5KWDA 4F1PA 4IJ8A 4MRUA 4BESA 1TYQG 2MYOA 1BD8A 3TAXA 2XHEA 2OCCE 4U0SA 4FP7A 2EQXA 2LAIA 1E8XA 3F9YA 4ATZD 1N9AA 5C1DA 4GCNA 3LY8A 5G04C 5JMND 3LY7A 5AYWD 3GYZA 3PUJA 5EILA 3CK9A 2CHXA 5ANRA 1IYGA 3SFYA 1NP7A 5JA4D 5BV1A 1Z6TA 4E85A 3CVLA 4G24A 4KYOB 3HVEB 4X8QA 5AN8A 5FWQA 4A3VA 5FIOA 5CRUA 4CRWA 1HH8A 3G2UA 2XPYA 2WXPA 3ASFA 3RJVA 4N2QA 4GTSA 5G2NA 4GTRA 4KZCA 3B7SA 2J07A 4YDYA 1TJFA 3MO0A 4IULA 3M57A 3CQCB 3QK0A 5FZSA 1NA0A 4FULA 4XKBA 2BTDA 5E76A 3L9TA 1IQRA 2DYSE 2CHWA 5ENTD 3C5RA 4I9EA 4DX7D 1QZ2A 4GTQA 4WNDA 4DJAA 1ELRA 4EQFA 4C0MA 5EG2A 3UM1A 3T8KA 4BUPA 1O5MA 3L6AA 3SFXA 5FZRA 4LERA 3DXMG 4JEUA 1TEZA 2L0TB 2UY1A 3S7BA 3Q49B 4XE0A 2Y0BG 4XZ4A 3M55A 2WXKA 4HVBA 4CGWA 4BTAA 3NQPA 3MGBA 3JQ0A 2C0MA 4YPUA 2MRIA 5AARA 3Q75A 2LAHA 4FC8A 3FU5A 4O60A 4UUCA 3PUKA 4GPMA 5FTPA 1N11A 2LXMA 1N6CA 5JHNA 4M7CA 2ZIRA 3E34A 4UQYA 1O1TA 5LCWJ 2YHCA 2NYJA 2XZDG 4L2LA 4GTOA 2HYZA 4K03A 5JJ6A 1B89A 3ZYMA 4HB5A 5FT9A 3UM0A 5TEGA 3KMAA 2V0PA 4TUMA 4BWRA 2PQRA 3G2SA 5DBKA 5EIBE 4UWFA 3RRUA 1RW2A 5KCMA 3UM3A 3FTWA 4MI5A 3ESLA 4DX2A 5BPPA 1N94A 2EIME 2RG8A 3KAEA 4LCTA 3SHFA 1N54A 4GZDA 1E90A 5JINA 2VJ8A 3B7BA 4JEHA 4NIKA 3FULA 4GYYA 4HFGA 4JC8A 4G23A 4U04A 5G04J 3GZ2A 3J5PA 2DCPA 3SY2A 3W9GA 4J83A 4QENA 4ANWA 3CVPA 3J5QB 3LVRE 3B95A 4N3CA 1TR4A 2EILE 4L2YA 4P29A 4KZ0A 4L23A 4YDEA 3HXDA 1KZPA 4F3VA 2RFAA 5BV0A 5HI7A 1NI1A 3SFZA 4L7TA 3D9NA 2KCVA 3U9WA 3TG5A 2PL2A 1MUFA 2F0YA 3UKRG 4J8EA 3LCAA 3ZW3A 4KVOA 4K5AB 2VGXA 3LYAA 5ENRD 4ANUA 2QPWA 2W5YA 3CGHA 1A17A 3HXEA 4EBAG 5ANLA 1H19A 1L5JA 3PEVB 3PE3A 2YHEA 4GMLA 2WXQA 2H6FA 4B94A 3LJ3A 2GW1A 4O1PA 4JXTA 4AOFA 3JXIA 1DCEA 2OEVA 3VLDA 4C48B 1S63A 3DSTA 3ULYA 3GW4A 4U95D 1H6OA 2JEKA 3IHVA 1HO8A 2IO2C 4FJYA 4GTMA 3O48A 3KMTA 5AENA 4G11A 5T0KA 4GB9A 1WY6A 1OUVA 2RFMA 1JCQA 4NJ5A 5JJ0A 3FUMA 3C3RA 3D9PA 3EJNA 1EF1C 4AM9A 3E32A 2PQNA 2PNNA 3DPDA 2WQ7A 1LD7A 3CSTA 2AXVA 2R02A 4MS6A 3VLFA 4TRQA 1SQMA 4D10C 1NL4A 5G05J 4Z68A 1KPSB 2KZTB 4EZJA 4YDWA 3TGOA 5T5GA 5CPRB 1UN9A 1DVPA 4LNGA 4HI9A 1HG5A 2H6IA 4LRZA 3APCA 2R17C 3P1UA 3TWXA 4I6JA 2AW6A 2IEJA 3SBSA 1TN8A 2WB2A 1WDYA 4IN3B 3D9IA 1U3DA 3KD7A 3PS6A 1K3ZD 4APOA 2WQ6A 4GU5A 3CV0A 2GRMA 4ME2A 3IHYA 1HZ4A 2XRYA 4I17A 4OAUC 3D9JA 2Y3AA 4XEIG 3Q4AB 5KNHD 4GTVA 4JDSA 2WXFA 3DWLG 1H2VC 3BU8A 1OWLA 4H12A 4YVOA 3N71A 3ZPJA 1N95A 3AG2E 4N2SA 3FPDA 4JD2G 3QKYA 3L22A 4ATGA 3OPEA 2FO7A 4CEMA 1AWCB 3KEAA 3B7UX 2OVBA 3CHPA 1Z3XA 1NFIE 3KSQA 3ZIMA 5CERB 3AG3E 4HOSA 4OAVB 4YDOA 5HRYA 2VSNA 3NOCD 3X2QE 5JJ7A 1EPUA 3EHNA 4GZ3A 5CRVA 2QFCA 3CVXA 5G55A 4DI3A 3M54A 4JB8P 2PM6A 3HXCA 4TXPA 5F6LA 3D3MA 2AXZA 2KC7A 4HI8A 3DXKG 3PE4A 2X6HA 3V79K 3FTSA 4I1OB 3RU0A 2L6BA 3M5AA 3ZYQA 4DLQA 3SWCA 4NRHB 2V4HC 3B7RL 1VDYA 4AIFA 1UG3A 1QNFA 1O1SA 4UWGA 3VLEA 2QZAA 2Q7FA 5T4YA 2RD0A 3JXJA 2J49A 4ILHB 4V3IA 1BI8B 5ENQD 3RK6A 3UI2A 2P9KG 1E8WA 2V5FA 3DSXA 4B8AA 3LY9A 5B1BE 2VYIA 3AU4A 3RAYA 5D66A 2L6JA 1N4QA 4HQDA 1H6PA 3ASOE 3PDNA 3Q79A 4HBDA 3C3QA 3UMVA 3V2OA 2AVPA 4AJWA 4RLYA 3TWWA 1H6KA 4BTBA 3TWSA 2BQZA 3NZSA 1TJCA 3R7RA 1E96B 2MHKA 4FHKA 4B0ZA 4DPRA 4HORA 4J8YA 2FEZA 3DALA 4MLPA 3CK8A 3BUAA 4J7WA 1IXVA 3FUDA 5A6CA 4ZFHA 3G2VA 3LXUX 3AS4A 1EYHA 3C72A 5F6KC 2Y1LE 2GGFA 3JQ1A 4Y6WA 2IOLA 5LX8A 1JUQA 2A5UA 1OWNA 3T5XA 3B13A 2DBAA 4JHJA 3HXFA 5CCMA 2LSVA 1H3IA 3CVWA 1HFAA 4XX5A 5M72A 2XEEA 1Z3YA 3EHMA 3IV0A 2XPZA 4A3TA 3MJWA 3EUVA 4KXKB 3CK7A 4JZYA 4JHRA 1TNBA 2VGXB 2WXLA 2XS8A 4QQIA 2XRZA 2ETAA 4YNMA 3SW9A 4YPEA 3ZFWA 2XENA 5AJLA 1MX6A 4ABNA 3E37A 4LDGA 4B89A 3DSWA 3FTZA 4I1MA 5EX3A 3UKUG 1PAQA 5AQAA 4AVXA 2DVWA 2J09A 1JWFA 3HDXA 4JL0A 4K5CA 3CVVA 1ELKA 4H7YA 3K9IA 3O4ZA 2V4LA 2GRLA 3L17A 3FH5A 4AEZC 3D9HA 2J4DA 5FQ7A 4WNGA 3SI5A 3CKBA 3NZUA 1NZNA 3EU5A 3TWQA 4AY6A 3VV0A 4UQZA 3LS8A 2XCCA 5A7DB 3GZ1A 4GZ5A 4CGVA 3G2TA 2AJAA 3IKOB 1TNYA 3EIJA 2X3MA 2KCKA 3VUZA 4CT4A 3QARA 4DUIA 2P9NG 3ULQA 1OXJA 5T0MA 4EBAA 1MHQA 4J7FA 1WG0A 3ASDA 3FUEA 2A4ZA 1SZ9A 5J90A 2ZGGA 4URKA 4WWOA 3MEKA 4U63A 3U4TA 3HIZA 3CEQA 2WQHA 2PM7A 2MOWA 3U66A 4WWNA 3QDNA 4BX8A 2KBXA 3F6QA 3ISMC 2ZGDA 3ABME 4B8CB 3UX4A 4BETA 4U8YD 2WMNA 2EIKE 3Q78A 3OS5A 4EZLA 3TWUA 4AXHA 2A5EA 5AQ7A 2IONA 1D9SA 2ONDA 2NC9A 3ZRHA 4GPKA 2XQ0A 1H0AA 3L82A 1JWGA 3JYSA 3Q73A 3QWPA 2I2OA 3RRNB 1HS6A 2HE0A 3TWTA 1GW6A 5T3RA 5CBNA 4U96D 3MYVA 3OXGA 4DI4A 1TN7A 4JW1A 2F8XK 3MX3A 4JHKA 2AXUA 1OWOA 1FVFA 3HXBA 4EHMA 1N6AA 3SO8A 4Q94A 1PC2A 4HLEA 3HNAA 4XKCA 3B7TA 2WXNA 5B1AE 2B6CA 3ASGA 2LUHA 1ELWA 3PVLA 1IHBA 3ZVVA 5HQ8A 2ZISA 2Y4TA 4CDNA 3EHRA 3RAUA 3S2AA 1K1AA 2I6HA 1INZA 2X6FA 4ILGA 3NBNB 4I2WA 3I5PA 2H6HA 4XI9A 4A1SA 2XEHA 1YMPA 3URZA 3AS8A 5EDSA 2IO3C 2EIJE 2BUGA 5C2YA 4AP2A 1S64A 4GYWA 3CBMA 4TXRA 3PH0C 2P9IG 1S70B 3CKCA 1PY1A 3NAWA 2Y69E 1RZ4A 3SGHA 4LG6A 2WXOA 4G25A 4HOQA 1N0RA 3RIBA 4K0RA 4A63B 2IOSA 3FDHA 4Y6CA 3UT4A 3SZ7A 3ESKA 3FTYA 2R5SA 4Q69A 4UWHA 3ZHEA 1KT1A 1SZAA 3GZSA 4GYOA 3MO5A 2RFIA 1V55E 2XCBA 5KBAA 3UXGA 4J8SA 3SF4A 3SQVA 5ENPD 4HRMB 1LD8A 3FTXA 3MA5A 3BO5A 4MKTA 2XGMA 4PH4B 5ARGA 3U3WA 5ARFA 4WAFA 2FO1E 5EKQD 3Q5MA 3M53A 3FY4A 5EYPF 2B0OE 4C1QA 4J8OA 2R03A 4UI9C 4NACA 1Q2ZA 2J8SD 3JUIA 2KXPC 1MT6A 2LNIA 5ENOD 3PZ1A 5AIJA 4YVQC 3RQ4A 5J08A 4LUNU 4JA9A 1Z5SC 3FU0A 1MVHA 2P2CP 2W5ZA 2WXRA 1ZBPA 2DIWA 5BXUA 4KVMA 4ACKA 3T9KA 4G2VA 3NF1A 2GRPB 4TV3A 3HRAA 1BU9A 1E7UA 3PNLB 4B93B 2LXLA 5FJYA 4GMJA 4I51A 3C98A 2FI7A 1NA3A 4U07A 2BF0X 4I6EA 2CFUA 4CDRA 1D8DA 1HG2A 3KSLA 3IEGA 1E7VA 2P9SG 2GRNB 3EU9A 4N3BA 4FLHA 3NB2A 2VTBA 4BERA 2R59A 3AS5A 4GMRA 1N3JA 2P9LG 3PZ4A 3E4BA 3RRMB 1QQEA 1N0QA 4HXIA 3UTMA 4Q96A 3MKRA 5F5EA 3OAWA 2GRRB 3BG1B 4FLBA 4AU7A 3M58A 5TH7A 2IU1A 3C3OA 2HR2A 1ZB1A 3CVUA 3I4GA 4BT8A 1Y6IA 4RVBA 1D8EA 3SD5A 3D9LA 1HU3A 1E8YA 2CG3A 5TTFA 3CHSA 3FUHA 3V31A 2JLBA 3QOUA 4I43A 2IFUA 4GZ6A 3ML8A 4OYSA 2VGYA 2QYUA 3APDA 4YNPA 4EZKA 3PRZA 5JHBA 2QY7A 4GA0A 4YPAA 4WUYA 1A5EA 4W9RA 2OOEA 2NXPA 3T5VA 5EX0A 2X38A 1FVHA 5BNWA 1LF8A 1YCSB 4PUCA 4DLOA 3S7DA 5BT1A 3IBEA 3ZYLA 2R05A 5FQ8A 4FA6A 4U8VD 2VSXE 2UWJG 2WXMA 4JA7A 3KS2A 3QJZA 4QEOA 3JUEA 1OCCE 3AU5A 3T8MA 3ULEG 3Q7FA 2XGSA 3DSVA 3ZUVB 4F7AA
chains in the Genus database with same CATH topology
5KJLA 3LEWA 2J4DA 4GAAA 5FQ7A 4WNGA 4F3VA 4CCAA 2C0LA 3SI5A 3CKBA 3NZUA 5HI7A 5BV0A 1NZNA 2J4BA 3SFZA 2OV8A 4L7TA 3CBPA 1HX8A 4AY6A 3KMTA 3D9NA 2KCVA 4UQZA 3TG5A 2PL2A 3U9WA 3VV0A 3LS8A 4RG6A 1OWMA 1MUFA 5CMYA 2JV0A 2XCCA 4OVUA 4BX9A 4I6GA 2LSUA 2O8JA 5A7DB 4J8EA 2Y4UA 3LCAA 3ZW3A 4KVOA 3GZ1A 4GZ5A 4RSYA 3KMJA 4CGVA 2VGXA 4A1GA 3G2TA 3LYAA 4ANUA 2QPWA 4RG9A 2W5YA 3IKOB 4QFVA 4BFRA 3EIJA 3RKVA 3CGHA 2X3MA 1A17A 3FUNA 3HHMA 3D9MA 2KCKA 2KCLA 3VUZA 4EBAG 5ANLA 1H19A 5LCWC 3CVQA 4FADA 1L5JA 4CT4A 4J8FA 3PEVB 4L1BA 3QARA 5ENNA 1PEGA 5CCLA 3LVQE 3PE3A 3ULQA 2YHEA 5FQ4A 2IF4A 4CDMA 4GMLA 4BT9A 1KLXA 5T0MA 2WXIA 2WXQA 4B94A 4EBAA 1MHQA 2IJGX 3LJ3A 2GW1A 5D0OD 3L08A 3ASDA 4JXTA 3FUEA 2FBNA 4AOFA 4J7FA 3OXLA 1HE8A 3VLDA 5JIYA 2A4ZA 2X6JA 4U0UA 1SZ9A 5J90A 2I9CA 1MVXA 3GW4A 3I4RB 3FU6A 5LSZA 4KT6B 2JEKA 4URKA 2YINA 3QWVA 4WWOA 3MEKA 4U63A 3IHVA 2FULA 3HIZA 3U4TA 4Z4PA 1HO8A 5FZQA 4A55A 3CEQA 4ANVA 1JPLA 3OPEA 3L13A 2WQHA 4ANXA 4FJYA 2PM7A 3O48A 2MOWA 3U66A 3CHRA 4WWNA 3QDNA 1XNFA 3D9OA 4JVSA 5AENA 1UN8A 2HO1A 4G11A 2R3AA 4PS7A 1HF8A 4BX8A 4KBQA 3FUFA 4O30A 4J7IA 5LOZA 5T0KA 4GB9A 1WY6A 4C0EA 4J0UA 3PEUB 4GCOA 2WXJA 4WNEA 1OUVA 2WXGA 4H7XA 4GZCA 1OWPA 4B8CB 3UX4A 4BSXA 2VQ2A 3EP0A 3U3WA 2CG2A 2P58C 5BUZA 3CBOA 2WMNA 4O6FA 3KEZA 4PS8A 3F9XA 2OVFA 3JCKC 5CHEE 1YA0A 4BY6A 4NJ5A 4LEUA 4DK5A 3G2WA 2M63A 3OS5A 4EZLA 3TJPA 3FUMA 5JJ0A 3FUIA 2KATA 3S7FA 3D9PA 4AXHA 2C2LA 5AJDA 3EJNA 1EF1C 4AM9A 2IONA 2ONDA 2NC9A 3ZRHA 2PQNA 4GPKA 4E47A 1UJKA 2XQ0A 3DPDA 3TL5A 5JJTA 2WQ7A 3M56A 4G1TA 1H0AA 2E2EA 3CSTA 2XGOA 2WM9A 3FTUA 3MCXA 3MKQB 1X5BA 1JWGA 2AXVA 3JYSA 2XPIA 3QWPA 4WNFA 2I2OA 4MS6A 3RRNB 3VLFA 3ONKA 1SQMA 4TRQA 1HS6A 3MO2A 3ZYKA 4D10C 1GW6A 3HYMB 4JLGA 3RO2A 3CHQA 5G05J 3OXFA 4HOUA 5T3RA 2KZTB 2WMOA 3MV2B 3MYVA 2UY1B 3LKUA 3OXGA 4EZJA 1U3CA 4DI4A 3TGOA 3ZXSA 4F53A 1WAO1 5T5GA 4JW1A 1XQHA 3MX3A 4JHKA 2AXUA 1OWOA 1FVFA 5CPRB 3CVNA 1N6AA 1UN9A 1DVPA 3P2BA 4Q94A 1PC2A 3ZN3A 3R7QA 4HLEA 3HNAA 4XKCA 1HG5A 3B7TA 4LRZA 5JHAA 3OTNA 3APCA 2R17C 2WXNA 4PS3A 4UWKA 3P1UA 5F59A 2WVIA 3FH7A 3ASGA 4G26A 3D9KA 4I6JA 2AW6A 4XIFA 1ELWA 3CR3A 1Y8MA 3PVLA 3SBSA 2WB2A 1ZU2A 3ZVVA 3OOIA 1H2UA 4IN3B 4MI0A 3D9IA 4N39A 1U3DA 5HQ8A 3KD7A 3S8PA 4OVVA 1UW4B 3PS6A 4HOTA 4NURA 4APOA 3ONLA 2Y4TA 2WQ6A 4GU5A 3CV0A 2F69A 3PZDA 2GRMA 4PDXA 1IHGA 4CDNA 1EDUA 3CVYA 3IHXA 4C9BB 1IQUA 4AV7A 1E8ZA 3MKQA 2X6IA 4ME2A 3IHYA 4UI9J 1HZ4A 1DNPA 1UJJA 2XRYA 3ML9A 4I17A 3S2AA 2VSYA 2I6HA 3D9JA 4J6IA 2PZIA 2Y3AA 3FEYA 4FMUA 5LFAA 2CFZA 4EPZA 3Q4AB 2G46A 1INZA 2V8SE 2X6FA 4ILGA 3ZHEB 1W3BA 3EDTB 3U64A 4APFA 4I2WA 4JDSA 2FF4A 2WXFA 3I5PA 4A1SA 4XI9A 1H2VC 2KZTA 2ZU6B 4EECA 1O9SA 1OWLA 4U8HA 3I3NA 4YVOA 3VTXA 4H12A 3N71A 3URZA 3WXXA 3AS8A 3ZPJA 5EDSA 4N2SA 3FPDA 3EIQC 4ACLA 5T8IA 2BUGA 4E6HA 4UQXA 5C2YA 3QKYA 2X6KA 3L22A 3ENEA 3QAQA 4KMOA 5FQ6A 2FO7A 4AP2A 4ATGA 4CEMA 3PREA 4GYWA 3CBMA 3FP3A 4IJ8A 3B7UX 2OVBA 3CHPA 3PH0C 4MRUA 4N3AA 1Z3XA 4IJDA 3CKCA 3ZIMA 1PY1A 3M59A 5A23A 4I2ZA 3FH8A 5LP0A 3TAXA 3SGHA 4HOSA 2YQ8A 2WXOA 2XHEA 4G25A 4HOQA 5KJKA 4U0SA 4FP7A 3RIBA 2EQXA 2LAIA 4K0RA 1E8XA 2IOSA 2VSNA 3F9YA 3FDHA 3F9WA 3RJWA 4N5CA 5G05C 4Y6CA 5JJ7A 5C1DA 1EPUA 4RZ0A 4GCNA 3EHNA 3UT4A 4GZ3A 3SZ7A 2QFCA 3ESKA 3FTYA 3CVXA 3LY8A 5G55A 2R5SA 4DI3A 3M54A 4Q69A 5G04C 4UWHA 2PM6A 3ZHEA 5CMWA 1KT1A 1SZAA 3GZSA 3LY7A 3L54A 3GYZA 4GYOA 4FU3A 5AYWD 5F6LA 3MO5A 4UI9K 2RFIA 3PUJA 2XCBA 3D3MA 3ASHA 4FJZA 2AXZA 2E0IA 3ZGQA 3CK9A 2CHXA 2KC7A 5ANRA 1IYGA 3PE4A 1NP7A 3APFA 4J8SA 3SF4A 5BV1A 2X6HA 3FTSA 4I1OB 2KM4A 1Z6TA 3FTXA 3CVLA 4G24A 4E85A 4XI0A 4KYOB 3K5KA 3CQGB 1N52A 3HVEB 3MA5A 4JPSA 3BO5A 3RU0A 2L0IA 3M5AA 4MKTA 2XGMA 3TG4A 3ZYQA 4PH4B 5FWQA 4A3VA 4DLQA 3SWCA 2I1KA 1P5QA 4NRHB 1WM5A 5ARGA 2AWIA 3B7RL 4UWLA 2L9BA 1VDYA 5DIZA 5ARFA 4WAFA 4IRUA 4AIFA 1UG3A 3FEXA 1QNFA 1ML9A 5BW8C 3CHMA 3Q15A 4UWGA 5EKQD 3VLEA 5D0QD 4CRWA 1HH8A 3Q5MA 2Q7FA 3M53A 3G2UA 3FY4A 5T4YA 3CHOA 2RD0A 2XPYA 4J8DA 2WXPA 4C1QA 4J8OA 3ASFA 3RJVA 1FCHA 2J49A 4NACA 4UI9C 4N2QA 5G2NA 4KZCA 4ILHB 4V3IA 3B7SA 2J07A 3JUIA 3RK6A 1TJFA 3MO0A 1MT6A 1H2TC 4IULA 2LNIA 2VTBB 3M57A 2J9QA 5AIJA 1E8WA 2V5FA 4YVQC 3CQCB 3QK0A 5FZSA 1NA0A 4FULA 4XKBA 4B8AA 4I1AA 3RQ4A 5J08A 3FU3A 2BTDA 5E76A 3BEEA 4LUNU 1IQRA 3LY9A 4JA9A 2VYIA 3FU0A 2CHWA 1MVHA 2W5ZA 3UQ3A 3AU4A 4I9EA 1MQSA 3RAYA 2L6JA 2WXRA 1QZ2A 1ZBPA 2DIWA 4WNDA 3UUXA 4DJAA 3TXNA 1ELRA 4EQFA 4GA1A 4KVMA 4C0MA 5EG2A 3PDNA 4ACKA 1ZKKA 4G2VA 3NF1A 4YNDA 3ZEFA 4NVQA 4BUPA 4TV3A 2NSZA 3UMVA 1E7UA 3HVEA 3PNLB 3L6AA 4M3OA 2AVPA 5FJYA 5FZRA 3UT8A 4LERA 4AJWA 3CLJA 4NQ0A 4GMJA 4JEUA 1H6KA 4BTBA 4I51A 2BQZA 1TEZA 3SNXA 3NZSA 2L0TB 3C98A 2UY1A 3S7BA 2FI7A 1NA3A 1TJCA 1E96B 3R7RA 4U07A 2BF0X 3Q49B 4XE0A 3QB2A 2MHKA 4FHKA 4B0ZA 2IQCA 4DPRA 4I6EA 4HORA 2CFUA 4CDRA 1HG2A 2VSOE 2FEZA 4R7LA 2I1JA 4XZ4A 2CHZA 3DALA 3IEGA 1E7VA 4MLPA 3CK8A 3FTVA 3M55A 2WXKA 4N3BA 4HVBA 4FLHA 2VTBA 3Q47B 2R59A 4CGWA 4BTAA 3BG0B 3AS5A 3FUDA 1N3JA 3NQPA 5A6CA 3E4BA 3RRMB 1QQEA 3MGBA 1S0PA 2C0MA 3CIAA 3JQ0A 4HXIA 4YPUA 4Q96A 2MRIA 3MKRA 5F5EA 2WXHA 3G2VA 3OAWA 3LXUX 2J08A 2XEVA 1HXIA 4U0ZA 3AS4A 3BG1B 1EYHA 2LAHA 4FC8A 3FU5A 2IGQA 4FLBA 3UPVA 5F6KC 4AU7A 3M58A 3PUKA 2YNQA 3FHEA 2IU1A 3DBSA 5TH7A 3VTYA 2HR2A 5FTPA 2HM8A 1N6CA 5JHNA 2GGFA 3JQ1A 4Y6WA 3I4GA 3CVUA 2IOLA 4BT8A 5LX8A 1JUQA 4CT0A 2A5UA 4UQYA 1OWNA 5LCWJ 3T5XA 1BPOA 2YHCA 1Y6IA 3B13A 3FWVA 4L2LA 2DBAA 2HYZA 4JHJA 4K03A 4RVBA 5JJ6A 1B89A 5E75A 3ZYMA 5FT9A 5CCMA 3UT7A 4GA2A 2LSVA 3KMAA 3LDZA 2V0PA 5TEGA 1H3IA 3CVWA 3SD5A 3D9LA 1HFAA 4ILIA 4BWRA 1HU3A 2PQRA 1E8YA 2CG3A 4XX5A 5M72A 3G2SA 5TTFA 3SBTB 3L16A 5DBKA 3CHSA 3FUHA 3QC1A 4UWFA 1Z3YA 2JLBA 1XGWA 3RRUA 1KT0A 3EHMA 3IV0A 2XPZA 3QOUA 3DB5A 5KCMA 2WPVA 3FFLA 4A3TA 5KJMA 2LO6A 3FTWA 2IFUA 3MJWA 4GZ6A 4I43A 3ML8A 4I9CA 4MI5A 4OYSA 3ESLA 2VGYA 4KXKB 5BPPA 3CK7A 3APDA 4YNPA 4EZKA 2RG8A 3PRZA 4JZYA 5JHBA 4JHRA 2QY7A 3KAEA 4LCTA 5KJNA 3FUKA 4IYPA 4GA0A 4AY5A 2VGXB 4YPAA 4WUYA 3SHFA 1N54A 3FUJA 4W9RA 2OOEA 2NXPA 2WXLA 3MZLB 3PNTB 3T5VA 4HS2A 4GZDA 1E90A 3TXMA 5EX0A 2X38A 5JINA 2VJ8A 2XRZA 1FVHA 5BNWA 1LF8A 4YNMA 3SW9A 2ILRA 4JEHA 4PUCA 3FULA 4GYYA 4DLOA 3S7DA 5BT1A 4YPEA 3IBEA 3QNKA 4HFGA 4JC8A 3S7JA 4G23A 3ZFWA 3ZYLA 4U04A 5AJLA 3LPZA 5G04J 3CSFA 4ABNA 3GZ2A 4QEPA 2DCPA 4LDGA 4B89A 4J83A 5FQ8A 4FA6A 4QENA 4ANWA 3R9AB 3RO3A 4F1SA 5AYFA 4TUUA 3F9ZA 3CVPA 3FTZA 3LVRE 3MV3B 4I1MA 5EX3A 1PAQA 2VSXE 4AVXA 2UWJG 2J09A 2WXMA 4N3CA 1JWFA 3HDXA 4JA7A 4JL0A 4FHJA 4L2YA 3KS2A 3QJZA 4QEOA 3CVVA 1ELKA 4H7YA 4P29A 4KZ0A 3AU5A 3K9IA 4WWPA 3T8MA 3O4ZA 5LSXA 4L23A 2V4LA 2GRLA 3L17A 3FH5A 2XGSA 3QWWA 4F7AA 4AEZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KJL A;  4WNG A;  4F3V A;  2C0L A;  3CKB A;  5HI7 A;  1NZN A;  3CBP A;  4AY6 A;  3VV0 A;  2KCV A;  4UQZ A;  3TG5 A;  2PL2 A;  4E47 A;  4RG6 A;  1MUF A;  2JV0 A;  2XCC A;  2O8J A;  2LSU A;  5A7D B;  4J8E A;  2Y4U A;  3LCA A;  3GZ1 A;  4GZ5 A;  3KMJ A;  4CGV A;  2VGX A;  3LYA A;  2QPW A;  4RG9 A;  2W5Y A;  3RKV A;  1A17 A;  2KCK A;  2KCL A;  3VUZ A;  5LCW C;  3CVQ A;  4J8F A;  1PEG A;  5CCL A;  3PE3 A;  3ULQ A;  2IF4 A;  4BT9 A;  1KLX A;  5T0M A;  4B94 A;  2GW1 A;  5D0O D;  4J7F A;  3ASD A;  2FBN A;  3OXL A;  5JIY A;  4U0U A;  1MVX A;  3GW4 A;  5LSZ A;  3QWV A;  3MEK A;  3U4T A;  4Z4P A;  5FZQ A;  3CEQ A;  2WQH A;  3O48 A;  3KMT A;  3QDN A;  1XNF A;  2R3A A;  2HO1 A;  4O30 A;  4KBQ A;  4J7I A;  5T0K A;  4J0U A;  4GCO A;  4WNE A;  1OUV A;  4H7X A;  2VQ2 A;  3EP0 A;  2P58 C;  3CBO A;  4O6F A;  3F9X A;  5CHE E;  1YA0 A;  4NJ5 A;  4LEU A;  3OS5 A;  5JJ0 A;  2KAT A;  3S7F A;  2C2L A;  4AM9 A;  2OND A;  2NC9 A;  2PQN A;  4GPK A;  5JJT A;  3M56 A;  4G1T A;  2E2E A;  2XGO A;  3JYS A;  2XPI A;  3QWP A;  4WNF A;  3MO2 A;  3HYM B;  4JLG A;  3RO2 A;  5G05 J;  3OXF A;  4HOU A;  3MV2 B;  2UY1 B;  3LKU A;  3OXG A;  3TGO A;  1WAO 1;  5T5G A;  1XQH A;  5CPR B;  3CVN A;  1N6A A;  1PC2 A;  3ZN3 A;  3HNA A;  5F59 A;  3ASG A;  4G26 A;  4XIF A;  1ELW A;  1Y8M A;  1ZU2 A;  3OOI A;  4IN3 B;  4MI0 A;  4N39 A;  5HQ8 A;  3KD7 A;  3S8P A;  4HOT A;  4APO A;  2Y4T A;  3CV0 A;  2F69 A;  1IHG A;  3IHX A;  4UI9 J;  4ME2 A;  1HZ4 A;  4I17 A;  2VSY A;  2I6H A;  2PZI A;  4FMU A;  3Q4A B;  2G46 A;  3ZHE B;  1W3B A;  3EDT B;  4I2W A;  4JDS A;  2FF4 A;  4A1S A;  4XI9 A;  1O9S A;  4H12 A;  3VTX A;  4YVO A;  3N71 A;  3URZ A;  3WXX A;  3AS8 A;  3ZPJ A;  4N2S A;  3FPD A;  2BUG A;  4UQX A;  3QKY A;  3OPE A;  2FO7 A;  4GYW A;  3CBM A;  3FP3 A;  4IJ8 A;  4N3A A;  4IJD A;  3CKC A;  3M59 A;  4I2Z A;  3TAX A;  4HOS A;  2YQ8 A;  4G25 A;  4HOQ A;  5KJK A;  4U0S A;  3RIB A;  2VSN A;  3F9Y A;  3F9W A;  3RJW A;  4N5C A;  5G05 C;  4Y6C A;  5JJ7 A;  5C1D A;  4RZ0 A;  4GCN A;  4GZ3 A;  3SZ7 A;  2QFC A;  3ESK A;  3LY8 A;  2R5S A;  3M54 A;  5G04 C;  3ZHE A;  1KT1 A;  3LY7 A;  5AYW D;  3GYZ A;  4GYO A;  5F6L A;  3MO5 A;  4UI9 K;  2RFI A;  2XCB A;  3ASH A;  3ZGQ A;  3CK9 A;  2KC7 A;  1IYG A;  3PE4 A;  3SF4 A;  3CVL A;  4G24 A;  4XI0 A;  4KYO B;  3K5K A;  3MA5 A;  3BO5 A;  3RU0 A;  3M5A A;  2XGM A;  3TG4 A;  3SWC A;  1P5Q A;  4NRH B;  1WM5 A;  5ARG A;  5DIZ A;  5ARF A;  3U3W A;  4AIF A;  1ML9 A;  5BW8 C;  3Q15 A;  5EKQ D;  5D0Q D;  1HH8 A;  3Q5M A;  2Q7F A;  3M53 A;  4J8D A;  4C1Q A;  4J8O A;  3ASF A;  3RJV A;  1FCH A;  4UI9 C;  4N2Q A;  3MO0 A;  1MT6 A;  2LNI A;  3M57 A;  2J9Q A;  2V5F A;  4YVQ C;  5FZS A;  1NA0 A;  3RQ4 A;  4I1A A;  3BEE A;  3LY9 A;  4JA9 A;  2VYI A;  1MVH A;  2W5Z A;  3UQ3 A;  4I9E A;  3RAY A;  2L6J A;  1QZ2 A;  1ZBP A;  3UUX A;  4WND A;  1ELR A;  4EQF A;  4GA1 A;  5EG2 A;  3PDN A;  1ZKK A;  4G2V A;  3NF1 A;  4YND A;  4NVQ A;  4BUP A;  2AVP A;  5FJY A;  5FZR A;  4NQ0 A;  4BTB A;  4I51 A;  2BQZ A;  2UY1 A;  3S7B A;  2FI7 A;  1NA3 A;  1TJC A;  1E96 B;  4U07 A;  3Q49 B;  2MHK A;  4HOR A;  4CDR A;  2FEZ A;  3DAL A;  3IEG A;  3CK8 A;  3M55 A;  4N3B A;  3Q47 B;  4CGW A;  4BTA A;  3AS5 A;  1N3J A;  5A6C A;  3E4B A;  1QQE A;  4YPU A;  2C0M A;  3MKR A;  5F5E A;  2XEV A;  1HXI A;  4U0Z A;  3AS4 A;  2IGQ A;  3UPV A;  5F6K C;  4AU7 A;  3M58 A;  5TH7 A;  3VTY A;  2HR2 A;  5FTP A;  1N6C A;  5JHN A;  4Y6W A;  4BT8 A;  4UQY A;  5LCW J;  3FWV A;  2YHC A;  2DBA A;  2HYZ A;  5JJ6 A;  1B89 A;  5FT9 A;  5CCM A;  4GA2 A;  2LSV A;  3KMA A;  5TEG A;  1H3I A;  4BWR A;  2PQR A;  5M72 A;  5TTF A;  5DBK A;  2JLB A;  1KT0 A;  3QOU A;  3DB5 A;  2WPV A;  3FFL A;  5KJM A;  2IFU A;  4GZ6 A;  4I9C A;  4MI5 A;  2VGY A;  4KXK B;  3CK7 A;  4YNP A;  4JHR A;  3KAE A;  5KJN A;  4GA0 A;  4AY5 A;  2VGX B;  4YPA A;  4WUY A;  4W9R A;  2OOE A;  5EX0 A;  5JIN A;  5BNW A;  4YNM A;  3SW9 A;  4GYY A;  3S7D A;  5BT1 A;  4YPE A;  3S7J A;  4G23 A;  3ZFW A;  4U04 A;  3LPZ A;  5G04 J;  4ABN A;  3GZ2 A;  4QEP A;  4LDG A;  4J83 A;  4QEN A;  3R9A B;  3RO3 A;  5AYF A;  3F9Z A;  3CVP A;  3MV3 B;  5EX3 A;  2UWJ G;  4N3C A;  4JA7 A;  4JL0 A;  3KS2 A;  4QEO A;  4H7Y A;  3K9I A;  5LSX A;  2XGS A;  3QWW A; 
#chains in the Genus database with same CATH topology
 5KJL A;  2F8Y A;  4CCA A;  2J4B A;  4E47 A;  1OWM A;  5CMY A;  4OVU A;  2O8J A;  4I6G A;  2Y4U A;  4RSY A;  4F6R D;  4QFV A;  3RKV A;  3FUN A;  2KCL A;  1JCR A;  5LCW C;  4FAD A;  1MX4 A;  4L1B A;  5ENN A;  1PEG A;  5CCL A;  3LVQ E;  5FQ4 A;  4CDM A;  4BT9 A;  3L08 A;  3OXL A;  3DEP A;  5AAO A;  2X6J A;  2QC9 A;  2I9C A;  3I4R B;  1SA4 A;  4KT6 B;  4Z4P A;  5FZQ A;  4A55 A;  4ANV A;  3L13 A;  3UIN C;  4ANX A;  3CHR A;  1XNF A;  3D9O A;  2R3A A;  4O30 A;  1TNZ A;  4KBQ A;  4J7I A;  4C0E A;  3ABK E;  4J0U A;  4GCO A;  2WXG A;  4GZC A;  1OWP A;  4BSX A;  2VQ2 A;  2CG2 A;  4O6F A;  3KEZ A;  3F9X A;  2OVF A;  3JCK C;  1YA0 A;  1BI7 B;  4DK5 A;  3TJP A;  3FUI A;  4HLL A;  3S7F A;  5CEA A;  3AG4 E;  3TWV A;  4HNA D;  1DC2 A;  3TL5 A;  3UIP C;  1QYM A;  4GTT A;  1BLX B;  5H7P A;  3MCX A;  2XGO A;  3FTU A;  2XPI A;  1YYH A;  1SA5 A;  3HYM B;  3ZXP A;  3RO2 A;  4JLG A;  5HS0 A;  4F53 A;  1WAO 1;  3DRA A;  1XQH A;  3CVN A;  2EIN E;  3P2B A;  1MZC A;  3ZN3 A;  3V30 A;  5JHA A;  4UWK A;  2WVI A;  3D9K A;  3CR3 A;  1Y8M A;  1OCR E;  3BQO A;  1H2U A;  1DCQ A;  4MI0 A;  1SVX A;  4OVV A;  1UW4 B;  4HOT A;  3ONL A;  1U2V G;  2F69 A;  3PZD A;  3NOG D;  4PDX A;  1IHG A;  4RQI A;  1EDU A;  3IHX A;  3IXE A;  4C9B B;  4AV7 A;  3MKQ A;  2X6I A;  1UJJ A;  3ML9 A;  2VSY A;  4J6I A;  2PZI A;  3FEY A;  2ETB A;  2CFZ A;  2V8S E;  3ZHE B;  1N4R A;  1W3B A;  4LNU D;  1O9S A;  4EEC A;  3I3N A;  3VTX A;  3WXX A;  3LJN A;  3UM2 A;  2X6K A;  3ENE A;  4LNB A;  5FQ6 A;  3PRE A;  4GTP A;  4MBG A;  3FP3 A;  2RKK A;  4L9P A;  4N3A A;  4IJD A;  2H6G A;  3Q9U C;  3M59 A;  5A23 A;  4I2Z A;  3FH8 A;  3ZKJ A;  5LP0 A;  1MYO A;  2YQ8 A;  1KZO A;  5KJK A;  3UIO C;  3F9W A;  3RJW A;  4N5C A;  5G05 C;  4RZ0 A;  1IKN D;  5CEC B;  5CMW A;  3L54 A;  4FU3 A;  4UI9 K;  4FJZ A;  3ASH A;  3ZGQ A;  2E0I A;  4O1O A;  3APF A;  1LTX A;  2KM4 A;  3AG1 E;  4XI0 A;  3K5K A;  3CQG B;  1N52 A;  3V2X A;  4JPS A;  2L0I A;  3E30 A;  3TG4 A;  2I1K A;  1P5Q A;  1WM5 A;  1MJ0 A;  2AWI A;  5DIZ A;  4UWL A;  2L9B A;  4ZHB A;  4IRU A;  3FEX A;  1ML9 A;  5BW8 C;  3CHM A;  3Q15 A;  2BKG A;  5D0Q D;  2BED A;  3CHO A;  5CBO A;  4J8D A;  1FCH A;  1H2T C;  2VTB B;  2J9Q A;  3R9M A;  1UOH A;  4I1A A;  3FU3 A;  5AQ9 A;  3BEE A;  2OEW A;  3UQ3 A;  2P9U G;  1MQS A;  3E33 A;  3UUX A;  2GRO B;  5B3S E;  4K5B A;  3TXN A;  5IY5 E;  4GA1 A;  1FPP A;  1ZKK A;  4YND A;  3ZEF A;  4NVQ A;  2NSZ A;  1N4S A;  1G3N B;  3HVE A;  4M3O A;  5FIN A;  3UT8 A;  3CLJ A;  4NQ0 A;  5ITZ F;  3SNX A;  3DSS A;  5EID A;  3QB2 A;  2IQC A;  3W9F A;  1MX2 A;  1V54 E;  2VSO E;  1OCZ E;  4R7L A;  2I1J A;  2CHZ A;  3FTV A;  2GRQ B;  4DX1 A;  3Q47 B;  3HG0 D;  3BG0 B;  1K8K G;  5ENS D;  3PZ2 A;  1S0P A;  3CIA A;  2WXH A;  3DPY A;  5BXO A;  2J08 A;  2XEV A;  1HXI A;  4U0Z A;  5KNG A;  5CED B;  2IGQ A;  3UPV A;  1O1R A;  2YNQ A;  3FHE A;  3DBS A;  3VTY A;  5D2M C;  2HM8 A;  4DRX E;  4CT0 A;  1BPO A;  3FWV A;  5E75 A;  3UT7 A;  4GA2 A;  3LDZ A;  5AQB A;  4ILI A;  3SBT B;  3L16 A;  3QC1 A;  2XS1 A;  1XGW A;  1KT0 A;  3DB5 A;  2WPV A;  3FFL A;  4HRL A;  5KJM A;  2LO6 A;  4I9C A;  1SW6 A;  2IY0 C;  2JAB A;  5KJN A;  3FUK A;  4IYP A;  4AY5 A;  4HRN A;  3FUJ A;  3PNT B;  3MZL B;  3PZ3 A;  4N5Q A;  4HS2 A;  3TXM A;  3DEO A;  1AP7 A;  2ILR A;  5EYL A;  4LSZ E;  3QNK A;  3S7J A;  1QBQ A;  3LPZ A;  3CSF A;  4QEP A;  3WG7 E;  3R9A B;  3RO3 A;  4F1S A;  5AYF A;  4TUU A;  3F9Z A;  3MV3 B;  4FHJ A;  3TWR A;  2ETC A;  4WWP A;  5LSX A;  2XZT G;  3Q9N C;  3ASN E;  1JCS A;  3QWW A;  3LEW A;  4GAA A;  2C0L A;  2DZO A;  2OV8 A;  3CBP A;  1HX8 A;  3ZU7 B;  4RG6 A;  2JV0 A;  1TNO A;  4BX9 A;  2R2L A;  2LSU A;  2ZXW E;  3KMJ A;  4A1G A;  4RG9 A;  4BFR A;  3AAA C;  3HHM A;  3D9M A;  2F37 A;  3CVQ A;  2VGE A;  4J8F A;  1TN6 A;  2IF4 A;  1KLX A;  2WXI A;  3RSE G;  2IJG X;  5D0O D;  2FBN A;  1HE8 A;  5JIY A;  4U0U A;  1MVX A;  1K1B A;  3FU6 A;  5LSZ A;  1FT2 A;  2YIN A;  3QWV A;  2FUL A;  1JPL A;  2QYJ A;  5EN5 D;  4JVS A;  1UN8 A;  2HO1 A;  4PS7 A;  1HF8 A;  3FUF A;  5LOZ A;  2P9P G;  3PEU B;  2WXJ A;  4WNE A;  4CYM D;  4H7X A;  3EP0 A;  2P58 C;  4DX6 D;  5BUZ A;  3CBO A;  1TNU A;  4PS8 A;  5CHE E;  4BY6 A;  4LEU A;  3G2W A;  2M63 A;  4G8L A;  2KAT A;  2C2L A;  5AJD A;  1X81 A;  2DZN A;  3ABL E;  1UJK A;  5JJT A;  3M56 A;  4G1T A;  3MKQ B;  2E2E A;  2WM9 A;  1X5B A;  4WNF A;  3MO2 A;  3ONK A;  3ZYK A;  3AJI A;  3EHQ A;  4U7E B;  1FT1 A;  3CHQ A;  3OXF A;  4HOU A;  2WMO A;  3MV2 B;  2UY1 B;  3LKU A;  1U3C A;  3DSU A;  4CZ2 D;  3ZXS A;  3Q7A A;  2BKK B;  3R7Q A;  3OTN A;  4PS3 A;  5F59 A;  4BSZ B;  2V5Q C;  4TXQ A;  3FH7 A;  4G26 A;  4XIF A;  1ZU2 A;  3OOI A;  4N39 A;  1OY3 D;  3S8P A;  2DYR E;  4NUR A;  1N4P A;  3CVY A;  1IQU A;  1E8Z A;  4UI9 J;  1DNP A;  3ZNG A;  4FMU A;  5LFA A;  4G8K A;  4DX5 D;  4EPZ A;  2G46 A;  3EDT B;  3U64 A;  4APF A;  1OT8 A;  2FF4 A;  2KZT A;  2ZU6 B;  4U8H A;  5HKP A;  3EIQ C;  4BEP A;  2DWZ A;  4ACL A;  5T8I A;  4E6H A;  4UQX A;  1OCO E;  3QAQ A;  4KMO A;  5KWD A;  4F1P A;  4IJ8 A;  4MRU A;  4BES A;  1TYQ G;  2MYO A;  1BD8 A;  3TAX A;  2XHE A;  2OCC E;  4U0S A;  4FP7 A;  2EQX A;  2LAI A;  1E8X A;  3F9Y A;  4ATZ D;  1N9A A;  5C1D A;  4GCN A;  3LY8 A;  5G04 C;  5JMN D;  3LY7 A;  5AYW D;  3GYZ A;  3PUJ A;  5EIL A;  3CK9 A;  2CHX A;  5ANR A;  1IYG A;  3SFY A;  1NP7 A;  5JA4 D;  5BV1 A;  1Z6T A;  4E85 A;  3CVL A;  4G24 A;  4KYO B;  3HVE B;  4X8Q A;  5AN8 A;  5FWQ A;  4A3V A;  5FIO A;  5CRU A;  4CRW A;  1HH8 A;  3G2U A;  2XPY A;  2WXP A;  3ASF A;  3RJV A;  4N2Q A;  4GTS A;  5G2N A;  4GTR A;  4KZC A;  3B7S A;  2J07 A;  4YDY A;  1TJF A;  3MO0 A;  4IUL A;  3M57 A;  3CQC B;  3QK0 A;  5FZS A;  1NA0 A;  4FUL A;  4XKB A;  2BTD A;  5E76 A;  3L9T A;  1IQR A;  2DYS E;  2CHW A;  5ENT D;  3C5R A;  4I9E A;  4DX7 D;  1QZ2 A;  4GTQ A;  4WND A;  4DJA A;  1ELR A;  4EQF A;  4C0M A;  5EG2 A;  3UM1 A;  3T8K A;  4BUP A;  1O5M A;  3L6A A;  3SFX A;  5FZR A;  4LER A;  3DXM G;  4JEU A;  1TEZ A;  2L0T B;  2UY1 A;  3S7B A;  3Q49 B;  4XE0 A;  2Y0B G;  4XZ4 A;  3M55 A;  2WXK A;  4HVB A;  4CGW A;  4BTA A;  3NQP A;  3MGB A;  3JQ0 A;  2C0M A;  4YPU A;  2MRI A;  5AAR A;  3Q75 A;  2LAH A;  4FC8 A;  3FU5 A;  4O60 A;  4UUC A;  3PUK A;  4GPM A;  5FTP A;  1N11 A;  2LXM A;  1N6C A;  5JHN A;  4M7C A;  2ZIR A;  3E34 A;  4UQY A;  1O1T A;  5LCW J;  2YHC A;  2NYJ A;  2XZD G;  4L2L A;  4GTO A;  2HYZ A;  4K03 A;  5JJ6 A;  1B89 A;  3ZYM A;  4HB5 A;  5FT9 A;  3UM0 A;  5TEG A;  3KMA A;  2V0P A;  4TUM A;  4BWR A;  2PQR A;  3G2S A;  5DBK A;  5EIB E;  4UWF A;  3RRU A;  1RW2 A;  5KCM A;  3UM3 A;  3FTW A;  4MI5 A;  3ESL A;  4DX2 A;  5BPP A;  1N94 A;  2EIM E;  2RG8 A;  3KAE A;  4LCT A;  3SHF A;  1N54 A;  4GZD A;  1E90 A;  5JIN A;  2VJ8 A;  3B7B A;  4JEH A;  4NIK A;  3FUL A;  4GYY A;  4HFG A;  4JC8 A;  4G23 A;  4U04 A;  5G04 J;  3GZ2 A;  3J5P A;  2DCP A;  3SY2 A;  3W9G A;  4J83 A;  4QEN A;  4ANW A;  3CVP A;  3J5Q B;  3LVR E;  3B95 A;  4N3C A;  1TR4 A;  2EIL E;  4L2Y A;  4P29 A;  4KZ0 A;  4L23 A;  4YDE A;  3HXD A;  1KZP A;  4F3V A;  2RFA A;  5BV0 A;  5HI7 A;  1NI1 A;  3SFZ A;  4L7T A;  3D9N A;  2KCV A;  3U9W A;  3TG5 A;  2PL2 A;  1MUF A;  2F0Y A;  3UKR G;  4J8E A;  3LCA A;  3ZW3 A;  4KVO A;  4K5A B;  2VGX A;  3LYA A;  5ENR D;  4ANU A;  2QPW A;  2W5Y A;  3CGH A;  1A17 A;  3HXE A;  4EBA G;  5ANL A;  1H19 A;  1L5J A;  3PEV B;  3PE3 A;  2YHE A;  4GML A;  2WXQ A;  2H6F A;  4B94 A;  3LJ3 A;  2GW1 A;  4O1P A;  4JXT A;  4AOF A;  3JXI A;  1DCE A;  2OEV A;  3VLD A;  4C48 B;  1S63 A;  3DST A;  3ULY A;  3GW4 A;  4U95 D;  1H6O A;  2JEK A;  3IHV A;  1HO8 A;  2IO2 C;  4FJY A;  4GTM A;  3O48 A;  3KMT A;  5AEN A;  4G11 A;  5T0K A;  4GB9 A;  1WY6 A;  1OUV A;  2RFM A;  1JCQ A;  4NJ5 A;  5JJ0 A;  3FUM A;  3C3R A;  3D9P A;  3EJN A;  1EF1 C;  4AM9 A;  3E32 A;  2PQN A;  2PNN A;  3DPD A;  2WQ7 A;  1LD7 A;  3CST A;  2AXV A;  2R02 A;  4MS6 A;  3VLF A;  4TRQ A;  1SQM A;  4D10 C;  1NL4 A;  5G05 J;  4Z68 A;  1KPS B;  2KZT B;  4EZJ A;  4YDW A;  3TGO A;  5T5G A;  5CPR B;  1UN9 A;  1DVP A;  4LNG A;  4HI9 A;  1HG5 A;  2H6I A;  4LRZ A;  3APC A;  2R17 C;  3P1U A;  3TWX A;  4I6J A;  2AW6 A;  2IEJ A;  3SBS A;  1TN8 A;  2WB2 A;  1WDY A;  4IN3 B;  3D9I A;  1U3D A;  3KD7 A;  3PS6 A;  1K3Z D;  4APO A;  2WQ6 A;  4GU5 A;  3CV0 A;  2GRM A;  4ME2 A;  3IHY A;  1HZ4 A;  2XRY A;  4I17 A;  4OAU C;  3D9J A;  2Y3A A;  4XEI G;  3Q4A B;  5KNH D;  4GTV A;  4JDS A;  2WXF A;  3DWL G;  1H2V C;  3BU8 A;  1OWL A;  4H12 A;  4YVO A;  3N71 A;  3ZPJ A;  1N95 A;  3AG2 E;  4N2S A;  3FPD A;  4JD2 G;  3QKY A;  3L22 A;  4ATG A;  3OPE A;  2FO7 A;  4CEM A;  1AWC B;  3KEA A;  3B7U X;  2OVB A;  3CHP A;  1Z3X A;  1NFI E;  3KSQ A;  3ZIM A;  5CER B;  3AG3 E;  4HOS A;  4OAV B;  4YDO A;  5HRY A;  2VSN A;  3NOC D;  3X2Q E;  5JJ7 A;  1EPU A;  3EHN A;  4GZ3 A;  5CRV A;  2QFC A;  3CVX A;  5G55 A;  4DI3 A;  3M54 A;  4JB8 P;  2PM6 A;  3HXC A;  4TXP A;  5F6L A;  3D3M A;  2AXZ A;  2KC7 A;  4HI8 A;  3DXK G;  3PE4 A;  2X6H A;  3V79 K;  3FTS A;  4I1O B;  3RU0 A;  2L6B A;  3M5A A;  3ZYQ A;  4DLQ A;  3SWC A;  4NRH B;  2V4H C;  3B7R L;  1VDY A;  4AIF A;  1UG3 A;  1QNF A;  1O1S A;  4UWG A;  3VLE A;  2QZA A;  2Q7F A;  5T4Y A;  2RD0 A;  3JXJ A;  2J49 A;  4ILH B;  4V3I A;  1BI8 B;  5ENQ D;  3RK6 A;  3UI2 A;  2P9K G;  1E8W A;  2V5F A;  3DSX A;  4B8A A;  3LY9 A;  5B1B E;  2VYI A;  3AU4 A;  3RAY A;  5D66 A;  2L6J A;  1N4Q A;  4HQD A;  1H6P A;  3ASO E;  3PDN A;  3Q79 A;  4HBD A;  3C3Q A;  3UMV A;  3V2O A;  2AVP A;  4AJW A;  4RLY A;  3TWW A;  1H6K A;  4BTB A;  3TWS A;  2BQZ A;  3NZS A;  1TJC A;  3R7R A;  1E96 B;  2MHK A;  4FHK A;  4B0Z A;  4DPR A;  4HOR A;  4J8Y A;  2FEZ A;  3DAL A;  4MLP A;  3CK8 A;  3BUA A;  4J7W A;  1IXV A;  3FUD A;  5A6C A;  4ZFH A;  3G2V A;  3LXU X;  3AS4 A;  1EYH A;  3C72 A;  5F6K C;  2Y1L E;  2GGF A;  3JQ1 A;  4Y6W A;  2IOL A;  5LX8 A;  1JUQ A;  2A5U A;  1OWN A;  3T5X A;  3B13 A;  2DBA A;  4JHJ A;  3HXF A;  5CCM A;  2LSV A;  1H3I A;  3CVW A;  1HFA A;  4XX5 A;  5M72 A;  2XEE A;  1Z3Y A;  3EHM A;  3IV0 A;  2XPZ A;  4A3T A;  3MJW A;  3EUV A;  4KXK B;  3CK7 A;  4JZY A;  4JHR A;  1TNB A;  2VGX B;  2WXL A;  2XS8 A;  4QQI A;  2XRZ A;  2ETA A;  4YNM A;  3SW9 A;  4YPE A;  3ZFW A;  2XEN A;  5AJL A;  1MX6 A;  4ABN A;  3E37 A;  4LDG A;  4B89 A;  3DSW A;  3FTZ A;  4I1M A;  5EX3 A;  3UKU G;  1PAQ A;  5AQA A;  4AVX A;  2DVW A;  2J09 A;  1JWF A;  3HDX A;  4JL0 A;  4K5C A;  3CVV A;  1ELK A;  4H7Y A;  3K9I A;  3O4Z A;  2V4L A;  2GRL A;  3L17 A;  3FH5 A;  4AEZ C;  3D9H A;  2J4D A;  5FQ7 A;  4WNG A;  3SI5 A;  3CKB A;  3NZU A;  1NZN A;  3EU5 A;  3TWQ A;  4AY6 A;  3VV0 A;  4UQZ A;  3LS8 A;  2XCC A;  5A7D B;  3GZ1 A;  4GZ5 A;  4CGV A;  3G2T A;  2AJA A;  3IKO B;  1TNY A;  3EIJ A;  2X3M A;  2KCK A;  3VUZ A;  4CT4 A;  3QAR A;  4DUI A;  2P9N G;  3ULQ A;  1OXJ A;  5T0M A;  4EBA A;  1MHQ A;  4J7F A;  1WG0 A;  3ASD A;  3FUE A;  2A4Z A;  1SZ9 A;  5J90 A;  2ZGG A;  4URK A;  4WWO A;  3MEK A;  4U63 A;  3U4T A;  3HIZ A;  3CEQ A;  2WQH A;  2PM7 A;  2MOW A;  3U66 A;  4WWN A;  3QDN A;  4BX8 A;  2KBX A;  3F6Q A;  3ISM C;  2ZGD A;  3ABM E;  4B8C B;  3UX4 A;  4BET A;  4U8Y D;  2WMN A;  2EIK E;  3Q78 A;  3OS5 A;  4EZL A;  3TWU A;  4AXH A;  2A5E A;  5AQ7 A;  2ION A;  1D9S A;  2OND A;  2NC9 A;  3ZRH A;  4GPK A;  2XQ0 A;  1H0A A;  3L82 A;  1JWG A;  3JYS A;  3Q73 A;  3QWP A;  2I2O A;  3RRN B;  1HS6 A;  2HE0 A;  3TWT A;  1GW6 A;  5T3R A;  5CBN A;  4U96 D;  3MYV A;  3OXG A;  4DI4 A;  1TN7 A;  4JW1 A;  2F8X K;  3MX3 A;  4JHK A;  2AXU A;  1OWO A;  1FVF A;  3HXB A;  4EHM A;  1N6A A;  3SO8 A;  4Q94 A;  1PC2 A;  4HLE A;  3HNA A;  4XKC A;  3B7T A;  2WXN A;  5B1A E;  2B6C A;  3ASG A;  2LUH A;  1ELW A;  3PVL A;  1IHB A;  3ZVV A;  5HQ8 A;  2ZIS A;  2Y4T A;  4CDN A;  3EHR A;  3RAU A;  3S2A A;  1K1A A;  2I6H A;  1INZ A;  2X6F A;  4ILG A;  3NBN B;  4I2W A;  3I5P A;  2H6H A;  4XI9 A;  4A1S A;  2XEH A;  1YMP A;  3URZ A;  3AS8 A;  5EDS A;  2IO3 C;  2EIJ E;  2BUG A;  5C2Y A;  4AP2 A;  1S64 A;  4GYW A;  3CBM A;  4TXR A;  3PH0 C;  2P9I G;  1S70 B;  3CKC A;  1PY1 A;  3NAW A;  2Y69 E;  1RZ4 A;  3SGH A;  4LG6 A;  2WXO A;  4G25 A;  4HOQ A;  1N0R A;  3RIB A;  4K0R A;  4A63 B;  2IOS A;  3FDH A;  4Y6C A;  3UT4 A;  3SZ7 A;  3ESK A;  3FTY A;  2R5S A;  4Q69 A;  4UWH A;  3ZHE A;  1KT1 A;  1SZA A;  3GZS A;  4GYO A;  3MO5 A;  2RFI A;  1V55 E;  2XCB A;  5KBA A;  3UXG A;  4J8S A;  3SF4 A;  3SQV A;  5ENP D;  4HRM B;  1LD8 A;  3FTX A;  3MA5 A;  3BO5 A;  4MKT A;  2XGM A;  4PH4 B;  5ARG A;  3U3W A;  5ARF A;  4WAF A;  2FO1 E;  5EKQ D;  3Q5M A;  3M53 A;  3FY4 A;  5EYP F;  2B0O E;  4C1Q A;  4J8O A;  2R03 A;  4UI9 C;  4NAC A;  1Q2Z A;  2J8S D;  3JUI A;  2KXP C;  1MT6 A;  2LNI A;  5ENO D;  3PZ1 A;  5AIJ A;  4YVQ C;  3RQ4 A;  5J08 A;  4LUN U;  4JA9 A;  1Z5S C;  3FU0 A;  1MVH A;  2P2C P;  2W5Z A;  2WXR A;  1ZBP A;  2DIW A;  5BXU A;  4KVM A;  4ACK A;  3T9K A;  4G2V A;  3NF1 A;  2GRP B;  4TV3 A;  3HRA A;  1BU9 A;  1E7U A;  3PNL B;  4B93 B;  2LXL A;  5FJY A;  4GMJ A;  4I51 A;  3C98 A;  2FI7 A;  1NA3 A;  4U07 A;  2BF0 X;  4I6E A;  2CFU A;  4CDR A;  1D8D A;  1HG2 A;  3KSL A;  3IEG A;  1E7V A;  2P9S G;  2GRN B;  3EU9 A;  4N3B A;  4FLH A;  3NB2 A;  2VTB A;  4BER A;  2R59 A;  3AS5 A;  4GMR A;  1N3J A;  2P9L G;  3PZ4 A;  3E4B A;  3RRM B;  1QQE A;  1N0Q A;  4HXI A;  3UTM A;  4Q96 A;  3MKR A;  5F5E A;  3OAW A;  2GRR B;  3BG1 B;  4FLB A;  4AU7 A;  3M58 A;  5TH7 A;  2IU1 A;  3C3O A;  2HR2 A;  1ZB1 A;  3CVU A;  3I4G A;  4BT8 A;  1Y6I A;  4RVB A;  1D8E A;  3SD5 A;  3D9L A;  1HU3 A;  1E8Y A;  2CG3 A;  5TTF A;  3CHS A;  3FUH A;  3V31 A;  2JLB A;  3QOU A;  4I43 A;  2IFU A;  4GZ6 A;  3ML8 A;  4OYS A;  2VGY A;  2QYU A;  3APD A;  4YNP A;  4EZK A;  3PRZ A;  5JHB A;  2QY7 A;  4GA0 A;  4YPA A;  4WUY A;  1A5E A;  4W9R A;  2OOE A;  2NXP A;  3T5V A;  5EX0 A;  2X38 A;  1FVH A;  5BNW A;  1LF8 A;  1YCS B;  4PUC A;  4DLO A;  3S7D A;  5BT1 A;  3IBE A;  3ZYL A;  2R05 A;  5FQ8 A;  4FA6 A;  4U8V D;  2VSX E;  2UWJ G;  2WXM A;  4JA7 A;  3KS2 A;  3QJZ A;  4QEO A;  3JUE A;  1OCC E;  3AU5 A;  3T8M A;  3ULE G;  3Q7F A;  2XGS A;  3DSV A;  3ZUV B;  4F7A A; 
#chains in the Genus database with same CATH homology
 5KJL A;  3LEW A;  2J4D A;  4GAA A;  5FQ7 A;  4WNG A;  4F3V A;  4CCA A;  2C0L A;  3SI5 A;  3CKB A;  3NZU A;  5HI7 A;  5BV0 A;  1NZN A;  2J4B A;  3SFZ A;  2OV8 A;  4L7T A;  3CBP A;  1HX8 A;  4AY6 A;  3KMT A;  3D9N A;  2KCV A;  4UQZ A;  3TG5 A;  2PL2 A;  3U9W A;  3VV0 A;  3LS8 A;  4RG6 A;  1OWM A;  1MUF A;  5CMY A;  2JV0 A;  2XCC A;  4OVU A;  4BX9 A;  4I6G A;  2LSU A;  2O8J A;  5A7D B;  4J8E A;  2Y4U A;  3LCA A;  3ZW3 A;  4KVO A;  3GZ1 A;  4GZ5 A;  4RSY A;  3KMJ A;  4CGV A;  2VGX A;  4A1G A;  3G2T A;  3LYA A;  4ANU A;  2QPW A;  4RG9 A;  2W5Y A;  3IKO B;  4QFV A;  4BFR A;  3EIJ A;  3RKV A;  3CGH A;  2X3M A;  1A17 A;  3FUN A;  3HHM A;  3D9M A;  2KCK A;  2KCL A;  3VUZ A;  4EBA G;  5ANL A;  1H19 A;  5LCW C;  3CVQ A;  4FAD A;  1L5J A;  4CT4 A;  4J8F A;  3PEV B;  4L1B A;  3QAR A;  5ENN A;  1PEG A;  5CCL A;  3LVQ E;  3PE3 A;  3ULQ A;  2YHE A;  5FQ4 A;  2IF4 A;  4CDM A;  4GML A;  4BT9 A;  1KLX A;  5T0M A;  2WXI A;  2WXQ A;  4B94 A;  4EBA A;  1MHQ A;  2IJG X;  3LJ3 A;  2GW1 A;  5D0O D;  3L08 A;  3ASD A;  4JXT A;  3FUE A;  2FBN A;  4AOF A;  4J7F A;  3OXL A;  1HE8 A;  3VLD A;  5JIY A;  2A4Z A;  2X6J A;  4U0U A;  1SZ9 A;  5J90 A;  2I9C A;  1MVX A;  3GW4 A;  3I4R B;  3FU6 A;  5LSZ A;  4KT6 B;  2JEK A;  4URK A;  2YIN A;  3QWV A;  4WWO A;  3MEK A;  4U63 A;  3IHV A;  2FUL A;  3HIZ A;  3U4T A;  4Z4P A;  1HO8 A;  5FZQ A;  4A55 A;  3CEQ A;  4ANV A;  1JPL A;  3OPE A;  3L13 A;  2WQH A;  4ANX A;  4FJY A;  2PM7 A;  3O48 A;  2MOW A;  3U66 A;  3CHR A;  4WWN A;  3QDN A;  1XNF A;  3D9O A;  4JVS A;  5AEN A;  1UN8 A;  2HO1 A;  4G11 A;  2R3A A;  4PS7 A;  1HF8 A;  4BX8 A;  4KBQ A;  3FUF A;  4O30 A;  4J7I A;  5LOZ A;  5T0K A;  4GB9 A;  1WY6 A;  4C0E A;  4J0U A;  3PEU B;  4GCO A;  2WXJ A;  4WNE A;  1OUV A;  2WXG A;  4H7X A;  4GZC A;  1OWP A;  4B8C B;  3UX4 A;  4BSX A;  2VQ2 A;  3EP0 A;  3U3W A;  2CG2 A;  2P58 C;  5BUZ A;  3CBO A;  2WMN A;  4O6F A;  3KEZ A;  4PS8 A;  3F9X A;  2OVF A;  3JCK C;  5CHE E;  1YA0 A;  4BY6 A;  4NJ5 A;  4LEU A;  4DK5 A;  3G2W A;  2M63 A;  3OS5 A;  4EZL A;  3TJP A;  3FUM A;  5JJ0 A;  3FUI A;  2KAT A;  3S7F A;  3D9P A;  4AXH A;  2C2L A;  5AJD A;  3EJN A;  1EF1 C;  4AM9 A;  2ION A;  2OND A;  2NC9 A;  3ZRH A;  2PQN A;  4GPK A;  4E47 A;  1UJK A;  2XQ0 A;  3DPD A;  3TL5 A;  5JJT A;  2WQ7 A;  3M56 A;  4G1T A;  1H0A A;  2E2E A;  3CST A;  2XGO A;  2WM9 A;  3FTU A;  3MCX A;  3MKQ B;  1X5B A;  1JWG A;  2AXV A;  3JYS A;  2XPI A;  3QWP A;  4WNF A;  2I2O A;  4MS6 A;  3RRN B;  3VLF A;  3ONK A;  1SQM A;  4TRQ A;  1HS6 A;  3MO2 A;  3ZYK A;  4D10 C;  1GW6 A;  3HYM B;  4JLG A;  3RO2 A;  3CHQ A;  5G05 J;  3OXF A;  4HOU A;  5T3R A;  2KZT B;  2WMO A;  3MV2 B;  3MYV A;  2UY1 B;  3LKU A;  3OXG A;  4EZJ A;  1U3C A;  4DI4 A;  3TGO A;  3ZXS A;  4F53 A;  1WAO 1;  5T5G A;  4JW1 A;  1XQH A;  3MX3 A;  4JHK A;  2AXU A;  1OWO A;  1FVF A;  5CPR B;  3CVN A;  1N6A A;  1UN9 A;  1DVP A;  3P2B A;  4Q94 A;  1PC2 A;  3ZN3 A;  3R7Q A;  4HLE A;  3HNA A;  4XKC A;  1HG5 A;  3B7T A;  4LRZ A;  5JHA A;  3OTN A;  3APC A;  2R17 C;  2WXN A;  4PS3 A;  4UWK A;  3P1U A;  5F59 A;  2WVI A;  3FH7 A;  3ASG A;  4G26 A;  3D9K A;  4I6J A;  2AW6 A;  4XIF A;  1ELW A;  3CR3 A;  1Y8M A;  3PVL A;  3SBS A;  2WB2 A;  1ZU2 A;  3ZVV A;  3OOI A;  1H2U A;  4IN3 B;  4MI0 A;  3D9I A;  4N39 A;  1U3D A;  5HQ8 A;  3KD7 A;  3S8P A;  4OVV A;  1UW4 B;  3PS6 A;  4HOT A;  4NUR A;  4APO A;  3ONL A;  2Y4T A;  2WQ6 A;  4GU5 A;  3CV0 A;  2F69 A;  3PZD A;  2GRM A;  4PDX A;  1IHG A;  4CDN A;  1EDU A;  3CVY A;  3IHX A;  4C9B B;  1IQU A;  4AV7 A;  1E8Z A;  3MKQ A;  2X6I A;  4ME2 A;  3IHY A;  4UI9 J;  1HZ4 A;  1DNP A;  1UJJ A;  2XRY A;  3ML9 A;  4I17 A;  3S2A A;  2VSY A;  2I6H A;  3D9J A;  4J6I A;  2PZI A;  2Y3A A;  3FEY A;  4FMU A;  5LFA A;  2CFZ A;  4EPZ A;  3Q4A B;  2G46 A;  1INZ A;  2V8S E;  2X6F A;  4ILG A;  3ZHE B;  1W3B A;  3EDT B;  3U64 A;  4APF A;  4I2W A;  4JDS A;  2FF4 A;  2WXF A;  3I5P A;  4A1S A;  4XI9 A;  1H2V C;  2KZT A;  2ZU6 B;  4EEC A;  1O9S A;  1OWL A;  4U8H A;  3I3N A;  4YVO A;  3VTX A;  4H12 A;  3N71 A;  3URZ A;  3WXX A;  3AS8 A;  3ZPJ A;  5EDS A;  4N2S A;  3FPD A;  3EIQ C;  4ACL A;  5T8I A;  2BUG A;  4E6H A;  4UQX A;  5C2Y A;  3QKY A;  2X6K A;  3L22 A;  3ENE A;  3QAQ A;  4KMO A;  5FQ6 A;  2FO7 A;  4AP2 A;  4ATG A;  4CEM A;  3PRE A;  4GYW A;  3CBM A;  3FP3 A;  4IJ8 A;  3B7U X;  2OVB A;  3CHP A;  3PH0 C;  4MRU A;  4N3A A;  1Z3X A;  4IJD A;  3CKC A;  3ZIM A;  1PY1 A;  3M59 A;  5A23 A;  4I2Z A;  3FH8 A;  5LP0 A;  3TAX A;  3SGH A;  4HOS A;  2YQ8 A;  2WXO A;  2XHE A;  4G25 A;  4HOQ A;  5KJK A;  4U0S A;  4FP7 A;  3RIB A;  2EQX A;  2LAI A;  4K0R A;  1E8X A;  2IOS A;  2VSN A;  3F9Y A;  3FDH A;  3F9W A;  3RJW A;  4N5C A;  5G05 C;  4Y6C A;  5JJ7 A;  5C1D A;  1EPU A;  4RZ0 A;  4GCN A;  3EHN A;  3UT4 A;  4GZ3 A;  3SZ7 A;  2QFC A;  3ESK A;  3FTY A;  3CVX A;  3LY8 A;  5G55 A;  2R5S A;  4DI3 A;  3M54 A;  4Q69 A;  5G04 C;  4UWH A;  2PM6 A;  3ZHE A;  5CMW A;  1KT1 A;  1SZA A;  3GZS A;  3LY7 A;  3L54 A;  3GYZ A;  4GYO A;  4FU3 A;  5AYW D;  5F6L A;  3MO5 A;  4UI9 K;  2RFI A;  3PUJ A;  2XCB A;  3D3M A;  3ASH A;  4FJZ A;  2AXZ A;  2E0I A;  3ZGQ A;  3CK9 A;  2CHX A;  2KC7 A;  5ANR A;  1IYG A;  3PE4 A;  1NP7 A;  3APF A;  4J8S A;  3SF4 A;  5BV1 A;  2X6H A;  3FTS A;  4I1O B;  2KM4 A;  1Z6T A;  3FTX A;  3CVL A;  4G24 A;  4E85 A;  4XI0 A;  4KYO B;  3K5K A;  3CQG B;  1N52 A;  3HVE B;  3MA5 A;  4JPS A;  3BO5 A;  3RU0 A;  2L0I A;  3M5A A;  4MKT A;  2XGM A;  3TG4 A;  3ZYQ A;  4PH4 B;  5FWQ A;  4A3V A;  4DLQ A;  3SWC A;  2I1K A;  1P5Q A;  4NRH B;  1WM5 A;  5ARG A;  2AWI A;  3B7R L;  4UWL A;  2L9B A;  1VDY A;  5DIZ A;  5ARF A;  4WAF A;  4IRU A;  4AIF A;  1UG3 A;  3FEX A;  1QNF A;  1ML9 A;  5BW8 C;  3CHM A;  3Q15 A;  4UWG A;  5EKQ D;  3VLE A;  5D0Q D;  4CRW A;  1HH8 A;  3Q5M A;  2Q7F A;  3M53 A;  3G2U A;  3FY4 A;  5T4Y A;  3CHO A;  2RD0 A;  2XPY A;  4J8D A;  2WXP A;  4C1Q A;  4J8O A;  3ASF A;  3RJV A;  1FCH A;  2J49 A;  4NAC A;  4UI9 C;  4N2Q A;  5G2N A;  4KZC A;  4ILH B;  4V3I A;  3B7S A;  2J07 A;  3JUI A;  3RK6 A;  1TJF A;  3MO0 A;  1MT6 A;  1H2T C;  4IUL A;  2LNI A;  2VTB B;  3M57 A;  2J9Q A;  5AIJ A;  1E8W A;  2V5F A;  4YVQ C;  3CQC B;  3QK0 A;  5FZS A;  1NA0 A;  4FUL A;  4XKB A;  4B8A A;  4I1A A;  3RQ4 A;  5J08 A;  3FU3 A;  2BTD A;  5E76 A;  3BEE A;  4LUN U;  1IQR A;  3LY9 A;  4JA9 A;  2VYI A;  3FU0 A;  2CHW A;  1MVH A;  2W5Z A;  3UQ3 A;  3AU4 A;  4I9E A;  1MQS A;  3RAY A;  2L6J A;  2WXR A;  1QZ2 A;  1ZBP A;  2DIW A;  4WND A;  3UUX A;  4DJA A;  3TXN A;  1ELR A;  4EQF A;  4GA1 A;  4KVM A;  4C0M A;  5EG2 A;  3PDN A;  4ACK A;  1ZKK A;  4G2V A;  3NF1 A;  4YND A;  3ZEF A;  4NVQ A;  4BUP A;  4TV3 A;  2NSZ A;  3UMV A;  1E7U A;  3HVE A;  3PNL B;  3L6A A;  4M3O A;  2AVP A;  5FJY A;  5FZR A;  3UT8 A;  4LER A;  4AJW A;  3CLJ A;  4NQ0 A;  4GMJ A;  4JEU A;  1H6K A;  4BTB A;  4I51 A;  2BQZ A;  1TEZ A;  3SNX A;  3NZS A;  2L0T B;  3C98 A;  2UY1 A;  3S7B A;  2FI7 A;  1NA3 A;  1TJC A;  1E96 B;  3R7R A;  4U07 A;  2BF0 X;  3Q49 B;  4XE0 A;  3QB2 A;  2MHK A;  4FHK A;  4B0Z A;  2IQC A;  4DPR A;  4I6E A;  4HOR A;  2CFU A;  4CDR A;  1HG2 A;  2VSO E;  2FEZ A;  4R7L A;  2I1J A;  4XZ4 A;  2CHZ A;  3DAL A;  3IEG A;  1E7V A;  4MLP A;  3CK8 A;  3FTV A;  3M55 A;  2WXK A;  4N3B A;  4HVB A;  4FLH A;  2VTB A;  3Q47 B;  2R59 A;  4CGW A;  4BTA A;  3BG0 B;  3AS5 A;  3FUD A;  1N3J A;  3NQP A;  5A6C A;  3E4B A;  3RRM B;  1QQE A;  3MGB A;  1S0P A;  2C0M A;  3CIA A;  3JQ0 A;  4HXI A;  4YPU A;  4Q96 A;  2MRI A;  3MKR A;  5F5E A;  2WXH A;  3G2V A;  3OAW A;  3LXU X;  2J08 A;  2XEV A;  1HXI A;  4U0Z A;  3AS4 A;  3BG1 B;  1EYH A;  2LAH A;  4FC8 A;  3FU5 A;  2IGQ A;  4FLB A;  3UPV A;  5F6K C;  4AU7 A;  3M58 A;  3PUK A;  2YNQ A;  3FHE A;  2IU1 A;  3DBS A;  5TH7 A;  3VTY A;  2HR2 A;  5FTP A;  2HM8 A;  1N6C A;  5JHN A;  2GGF A;  3JQ1 A;  4Y6W A;  3I4G A;  3CVU A;  2IOL A;  4BT8 A;  5LX8 A;  1JUQ A;  4CT0 A;  2A5U A;  4UQY A;  1OWN A;  5LCW J;  3T5X A;  1BPO A;  2YHC A;  1Y6I A;  3B13 A;  3FWV A;  4L2L A;  2DBA A;  2HYZ A;  4JHJ A;  4K03 A;  4RVB A;  5JJ6 A;  1B89 A;  5E75 A;  3ZYM A;  5FT9 A;  5CCM A;  3UT7 A;  4GA2 A;  2LSV A;  3KMA A;  3LDZ A;  2V0P A;  5TEG A;  1H3I A;  3CVW A;  3SD5 A;  3D9L A;  1HFA A;  4ILI A;  4BWR A;  1HU3 A;  2PQR A;  1E8Y A;  2CG3 A;  4XX5 A;  5M72 A;  3G2S A;  5TTF A;  3SBT B;  3L16 A;  5DBK A;  3CHS A;  3FUH A;  3QC1 A;  4UWF A;  1Z3Y A;  2JLB A;  1XGW A;  3RRU A;  1KT0 A;  3EHM A;  3IV0 A;  2XPZ A;  3QOU A;  3DB5 A;  5KCM A;  2WPV A;  3FFL A;  4A3T A;  5KJM A;  2LO6 A;  3FTW A;  2IFU A;  3MJW A;  4GZ6 A;  4I43 A;  3ML8 A;  4I9C A;  4MI5 A;  4OYS A;  3ESL A;  2VGY A;  4KXK B;  5BPP A;  3CK7 A;  3APD A;  4YNP A;  4EZK A;  2RG8 A;  3PRZ A;  4JZY A;  5JHB A;  4JHR A;  2QY7 A;  3KAE A;  4LCT A;  5KJN A;  3FUK A;  4IYP A;  4GA0 A;  4AY5 A;  2VGX B;  4YPA A;  4WUY A;  3SHF A;  1N54 A;  3FUJ A;  4W9R A;  2OOE A;  2NXP A;  2WXL A;  3MZL B;  3PNT B;  3T5V A;  4HS2 A;  4GZD A;  1E90 A;  3TXM A;  5EX0 A;  2X38 A;  5JIN A;  2VJ8 A;  2XRZ A;  1FVH A;  5BNW A;  1LF8 A;  4YNM A;  3SW9 A;  2ILR A;  4JEH A;  4PUC A;  3FUL A;  4GYY A;  4DLO A;  3S7D A;  5BT1 A;  4YPE A;  3IBE A;  3QNK A;  4HFG A;  4JC8 A;  3S7J A;  4G23 A;  3ZFW A;  3ZYL A;  4U04 A;  5AJL A;  3LPZ A;  5G04 J;  3CSF A;  4ABN A;  3GZ2 A;  4QEP A;  2DCP A;  4LDG A;  4B89 A;  4J83 A;  5FQ8 A;  4FA6 A;  4QEN A;  4ANW A;  3R9A B;  3RO3 A;  4F1S A;  5AYF A;  4TUU A;  3F9Z A;  3CVP A;  3FTZ A;  3LVR E;  3MV3 B;  4I1M A;  5EX3 A;  1PAQ A;  2VSX E;  4AVX A;  2UWJ G;  2J09 A;  2WXM A;  4N3C A;  1JWF A;  3HDX A;  4JA7 A;  4JL0 A;  4FHJ A;  4L2Y A;  3KS2 A;  3QJZ A;  4QEO A;  3CVV A;  1ELK A;  4H7Y A;  4P29 A;  4KZ0 A;  3AU5 A;  3K9I A;  4WWP A;  3T8M A;  3O4Z A;  5LSX A;  4L23 A;  2V4L A;  2GRL A;  3L17 A;  3FH5 A;  2XGS A;  3QWW A;  4F7A A;  4AEZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...