3TG5A

Structure of smyd2 in complex with p53 and sah
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
425
structure length
425
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human SMYD2 reveals the basis of p53 tumor suppressor methylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-lysine methyltransferase SMYD2
total genus 137
structure length 425
sequence length 425
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3tg5A03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3tg5A01
3PE4A 2AVPA 1MT6A 4XI9A 2JV0A 3MEKA 1TJCA 5G04J 3VTXA 2QFCA 1B89A 1NA0A 3IEGA 3MV3B 2VGXA 1O9SA 4BT8A 4HOTA 2MHKA 5F5EA 4U0ZA 5EX0A 4UQYA 3CKCA 2C0LA 4IN3B 1KT1A 2LSUA 3KMTA 2P58C 2XGOA 3GYZA 1A17A 3GZ2A 4YNDA 4Y6WA 4YVOA 4JL0A 4IJ8A 3Q47B 4QENA 1KT0A 1Y8MA 2HR2A 2PZIA 5LCWJ 4Y6CA 2UY1B 3LPZA 1HH8A 3KMAA 4GYOA 4BT9A 4UI9J 2WPVA 3HYMB 3CBOA 4WNGA 4GA0A 4GZ6A 5D0QD 4KYOB 1ML9A 5FT9A 3FFLA 1PC2A 2XEVA 3BEEA 3FP3A 3ZHEB 5JHNA 3S7JA 2NC9A 3ZGQA 4BWRA 5F6KC 3LCAA 3QWVA 2RFIA 5TEGA 2LSVA 2F69A 4JDSA 4GZ3A 2DBAA 2IGQA 2L6JA 4G24A 3KD7A 3URZA 4AIFA 2FF4A 3Q49B 3CV0A 4C1QA 3RJWA 5JINA 4MI0A 3DALA 3FWVA 3SWCA 1ELRA 3SF4A 1E96B 4N2QA 3GZ1A 5KJKA 4G23A 4AY6A 3K5KA 5KJLA 5JJ6A 3Q5MA 4A1SA 5LSXA 2PL2A 4GCNA 1IHGA 3FPDA 4LDGA 4YPEA 2FBNA 5JJTA 3UUXA 3M56A 3TAXA 5ARGA 4GPKA 4NVQA 3SW9A 4G1TA 5HQ8A 4U0SA 4JHRA 4H7XA 3Q15A 5BW8C 3F9WA 3RKVA 4CGWA 4O30A 4H12A 2VGYA 2VYIA 2UWJG 4FMUA 3QKYA 3IHXA 3ASDA 4U0UA 5G05C 3ZN3A 3VUZA 1HXIA 2HO1A 4AM9A 4EQFA 2XGSA 4HOSA 3AS4A 3CK9A 3OXGA 3MA5A 5LSZA 3KMJA 3ASHA 3UQ3A 4GCOA 4UQZA 5LCWC 4GA2A 3MO5A 1ELWA 4GYYA 4I2ZA 4APOA 1WM5A 2W5YA 3M55A 3LY8A 2Y4TA 2BUGA 4IJDA 5DBKA 2VSNA 4I9EA 4YPUA 4LEUA 3M58A 3CVNA 2XCCA 3Q4AB 5CCMA 2VQ2A 3BO5A 3VTYA 3VV0A 5G04C 3QOUA 2KCKA 4HORA 3RIBA 4NJ5A 5BNWA 4BTBA 3ZFWA 4GA1A 4J83A 5EX3A 2LNIA 4RG9A 1NA3A 3NF1A 3N71A 3RJVA 1KLXA 3M53A 4UI9K 5F59A 3DB5A 4MI5A 3AS8A 2XPIA 3TG4A 3WXXA 4J8FA 3S7FA 1PEGA 1W3BA 5F6LA 3CBPA 1P5QA 2KCLA 3KS2A 3M54A 4B94A 1OUVA 5KJNA 3QWWA 3OXLA 4G25A 3JYSA 3KAEA 4U04A 3ULQA 3ZPJA 4H7YA 3HNAA 4YNPA 4WNEA 4I2WA 4NQ0A 2FO7A 3CVLA 1XQHA 5BT1A 3ESKA 5CPRB 3OXFA 2VGXB 5AYWD 5FJYA 1XNFA 2PQNA 4CGVA 2UY1A 2I6HA 1N6AA 4W9RA 4GYWA 4AU7A 4J8DA 4WNFA 2PQRA 4YVQC 2R5SA 3TGOA 3M57A 5EKQD 3LY9A 4NRHB 5CHEE 4XI0A 3TG5A 4QEPA 5DIZA 4BUPA 3LYAA 5T0KA 2GW1A 1NZNA 5AYFA 2JLBA 2C2LA 3ZHEA 3RQ4A 3PE3A 4YPAA 3OPEA 3F9ZA 5M72A 3M59A 4BTAA 3ASGA 4N3BA 2IFUA 2R3AA 4JLGA 3AS5A 1MUFA 5KJMA 2XCBA 5G05J 1ZBPA 4KBQA 3E4BA 5FZQA 3MO0A 2HYZA 4N3AA 1N6CA 2E2EA 2J9QA 2IF4A 1ZU2A 3CVQA 2O8JA 3F9YA 2Y4UA 3O48A 4G2VA 2Q7FA 3RO3A 3CK7A 3RAYA 3M5AA 2XGMA 1MVXA 3QWPA 5JJ0A 3LY7A 5FZRA 2QPWA 5T0MA 2YHCA 4O6FA 4J8EA 4RG6A 1MVHA 5ARFA 3S8PA 4I1AA 2YQ8A 4RZ0A 1QZ2A 3EDTB 3S7DA 4J8OA 4G26A 3K9IA 4HOUA 5FZSA 4AY5A 2VSYA 4WUYA 3RO2A 5FTPA 4YNMA 4WNDA 1IYGA 4U07A 1H3IA 4Z4PA 4I17A 3R9AB 5D0OD 3MV2B 2V5FA 4N39A 3U3WA 2KATA 4N3CA 4N5CA 4UI9C 2WQHA 3F9XA 3RU0A 3UPVA 2W5ZA 3OOIA 3PDNA 2C0MA 2FEZA 4GZ5A 3EP0A 4CDRA 3CVPA 1ZKKA 3QDNA 2KC7A 3U4TA 4ABNA 5A7DB 3S7BA 4HOQA 1N3JA 2ONDA 5C1DA 4KXKB 3CK8A 1HZ4A 4QEOA 5JIYA 4J7IA 2OOEA 3CBMA 4I51A 2FI7A 4ME2A 4F3VA 3LKUA 2BQZA 4J0UA 5CCLA 5TTFA 3CEQA 1WAO1 4I9CA 5T5GA 5A6CA 5TH7A 2G46A 1YA0A 3ASFA 5EG2A 4UQXA 4N2SA 3MKRA 2KCVA 4J7FA 4JA9A 5HI7A 1QQEA 3OS5A 3MO2A 3SZ7A 3GW4A 4XIFA 4E47A 5JJ7A 3CKBA 4JA7A 1FCHA
chains in the Genus database with same CATH superfamily
2AVPA 3FULA 4XI9A 3J5PA 3B95A 3CGHA 4E6HA 1B89A 4KZCA 1NA0A 1S0PA 2MHKA 2LAIA 2VSOE 5F5EA 2OEVA 1OWPA 4U0ZA 4LSZE 2X3MA 2F0YA 1FVHA 4KT6B 2LSUA 3S2AA 2KZTB 3BU8A 3GYZA 3FUHA 1GW6A 3GZ2A 5AQBA 2CHZA 3SI5A 1SVXA 3IKOB 4JL0A 2HR2A 4Y6CA 1IKND 4GTVA 3LPZA 5AQAA 4GYOA 2OVFA 4UI9J 4I6EA 5J90A 4GA0A 1O5MA 2A4ZA 5FT9A 3FFLA 4WWNA 3T8KA 5T8IA 4AOFA 5TEGA 5D2MC 3FTYA 2GRRB 2F69A 1HG5A 2WXIA 4PS8A 4JDSA 5G55A 2DBAA 2AXUA 2L6JA 4G24A 2ZISA 4I43A 3EU9A 3URZA 4UWFA 1LD7A 2FF4A 3CV0A 5JA4D 5FQ4A 4BX9A 1H2TC 3ZXPA 5JHBA 4JVSA 3Q9UC 1ELRA 4HFGA 1E96B 4N2QA 5KJKA 2IQCA 5JJ6A 5LSXA 2PL2A 1IHGA 1RZ4A 2DVWA 2ETAA 4LDGA 3UKUG 4GPKA 5T4YA 3SW9A 4JHRA 4B89A 3Q15A 5BW8C 2R59A 1Z3YA 2IJGX 4FMUA 3QKYA 4A3VA 3AS4A 3CK9A 3OXGA 3LVRE 4GTTA 5LSZA 3KMJA 3ASHA 3UQ3A 4GA2A 3PRZA 3MO5A 1ELWA 5CBNA 4GYYA 4APOA 1WM5A 3NZSA 4JHKA 3LY8A 3DEOA 1DNPA 3G2VA 4I9EA 3CVVA 3ABLE 2AXVA 3C3QA 4LEUA 1N4PA 3KEZA 3QARA 3JQ0A 2VQ2A 4YDWA 1BI8B 3BO5A 3IHVA 3VTYA 3D9NA 3L13A 5G04C 5EYPF 3QOUA 5HS0A 2DYRE 2J8SD 1VDYA 1S63A 4TXPA 1N9AA 2NYJA 1WY6A 3MKQA 1H2UA 3B7TA 4O60A 5KWDA 4C48B 2LAHA 1Z5SC 5F59A 3UINC 2WXLA 3WXXA 2WMOA 1QNFA 3S7FA 1AP7A 1W3BA 1PEGA 5JHAA 3ZVVA 2GRLA 2EQXA 2KCLA 2CG2A 3BQOA 5FIOA 3M54A 3SBTB 1TEZA 2Y1LE 1OCOE 3KAEA 3JYSA 1TJFA 4EECA 2KXPC 4PS7A 4B0ZA 3L08A 3D9HA 4G8KA 4ILIA 1YYHA 2X6IA 4I2WA 2KZTA 2FO7A 2ZXWE 2IONA 3KSLA 3AU5A 5HRYA 3HIZA 5CERB 3E32A 2EILE 3NOCD 3TXNA 3E37A 3PVLA 4ACKA 5BXUA 1TYQG 1N0RA 1N6AA 4AU7A 4JW1A 1NI1A 2OEWA 4HLEA 3TGOA 3Q75A 3UM0A 1HU3A 4WWOA 5B1BE 3UT4A 4BUPA 3MX3A 4EZJA 4DI3A 3RQ4A 3PE3A 3OPEA 3UTMA 3SGHA 4BTAA 1OT8A 3ASGA 2WXJA 3CHPA 2R3AA 4EZLA 3AG4E 3AS5A 5G05J 4KBQA 3E4BA 4CRWA 4N3AA 3NOGD 3R7RA 1V55E 2R05A 2E2EA 2J9QA 3V31A 3G2SA 3RAYA 4RQIA 2XGMA 5T3RA 1UJJA 2LXMA 3LJNA 3JUIA 3EUVA 5FZRA 4O6FA 4J8EA 1MVHA 2XEEA 3E30A 3FTZA 4FULA 5ARFA 4CDNA 5AQ9A 2WQ7A 3T9KA 3JUEA 2DIWA 1QZ2A 4FLBA 3EDTB 4AP2A 4G26A 4AJWA 3HXFA 3K9IA 3PNLB 3PZ4A 4F7AA 4AY5A 3BG1B 1N11A 4K5CA 4WUYA 3C72A 4TUUA 4YNMA 2J4DA 4WNDA 4CZ2D 1IYGA 4NACA 3SFXA 3QK0A 1H3IA 1ELKA 4Z4PA 3FU6A 5D0OD 2DZOA 3ABME 4FHJA 3U3WA 4Q96A 5H7PA 4HNAD 2X6KA 1UOHA 2P2CP 2H6HA 2WQHA 3F9XA 3UPVA 4XE0A 3OOIA 3PDNA 4FU3A 1JWFA 3U4TA 3FH5A 3AAAC 3HVEA 4BEPA 4L2YA 2ONDA 3AG2E 1YMPA 1S70B 4KXKB 1U2VG 3QC1A 2J09A 4QEOA 4E85A 4D10C 2OV8A 4KVMA 5E75A 3DWLG 1KZPA 3DSXA 3EJNA 2BQZA 4J0UA 1HO8A 4JC8A 5TTFA 3ZEFA 2IEJA 5T5GA 1Z6TA 3PNTB 3ASFA 3E33A 5EIBE 1U3CA 3MKRA 3ZW3A 2CHWA 4G11A 2KCVA 1D9SA 4I6GA 2MRIA 5HI7A 3OS5A 3GW4A 5J08A 4EBAA 4GTQA 4I1MA 3TWWA 2XS1A 4APFA 4JA7A 4BERA 3FU0A 4ANWA 4HRMB 1FCHA 2GRMA 3PE4A 1OWOA 3D9IA 4UWKA 1OCCE 3DXKG 2QYJA 3MEKA 4TRQA 3VTXA 2QFCA 2V5QC 4MLPA 2J49A 3ML9A 1TNZA 3AG1E 5FINA 4F1SA 4AXHA 1O1RA 3MZLB 4LNUD 1A17A 4AEZC 4YNDA 4Y6WA 3DSVA 4YVOA 3TWQA 4IJ8A 2KM4A 1Y8MA 2XPZA 4MKTA 3ZXSA 3SQVA 2XRZA 5IY5E 2WXHA 2UY1B 1HH8A 1E90A 3FHEA 4URKA 4GTOA 2WPVA 3RRMB 4WNGA 3MCXA 4Q94A 5D0QD 2P9IG 3ZUVB 2V4LA 4GTSA 4U7EB 5CMWA 2NC9A 1L5JA 4BWRA 3Q7FA 1LTXA 3ZNGA 5D66A 5LFAA 4GZ3A 4FJZA 2NSZA 1SZ9A 2Y69E 3KD7A 3C3RA 5JINA 3FTUA 4MI0A 4PH4B 1UW4B 2EIKE 1SW6A 3IHYA 1RW2A 3DALA 3SWCA 3SF4A 3FUFA 3ML8A 3Q5MA 1TNYA 4A1SA 3KSQA 4YPEA 1JUQA 2FBNA 5JJTA 3VLFA 3M56A 3TAXA 4NVQA 5CECB 1D8DA 3PREA 4G1TA 2XEHA 4DRXE 3FUNA 4U63A 4H7XA 4LNBA 3ULEG 1EF1C 3TWVA 4O30A 3VLEA 3KEAA 4UWGA 3TWRA 3ASDA 5ENPD 4EQFA 3R9MA 2L6BA 4HOSA 4WWPA 3FUJA 3RRNB 5ITZF 2J4BA 2ETBA 4CYMD 5ENNA 3IXEA 1LD8A 4DPRA 2J08A 3M55A 2IO2C 3D3MA 3AG3E 1K3ZD 2VSNA 4YPUA 3SBSA 3CVYA 2RFMA 3PEVB 3EU5A 3Q4AB 4HBDA 3FUKA 3U66A 2XHEA 3VV0A 3C98A 4HORA 5HKPA 2LUHA 5KBAA 4Z68A 3FTXA 3DSWA 4J83A 3GZSA 3V2OA 3OTNA 1NA3A 3ASOE 3N71A 4DK5A 3FU3A 1KLXA 4UI9K 2WXKA 5CEAA 4HRNA 3ULYA 1EPUA 2GRNB 4MI5A 2X6HA 1E8YA 1HG2A 4AV7A 3CBPA 5ENTD 1SQMA 3RAUA 2ETCA 5KJNA 1N94A 2V8SE 2CFZA 3FU5A 3TWTA 1IHBA 4U04A 3ZPJA 3UXGA 3DEPA 2P9PG 4H7YA 3HNAA 5AJLA 5ENRD 5KNGA 3CVLA 5BT1A 3DSUA 4JZYA 1WDYA 4TXRA 2IU1A 4I1OB 5CPRB 2BEDA 3OXFA 1ZB1A 5AYWD 4HI8A 4EHMA 1XNFA 2PQNA 2UY1A 2I6HA 4GYWA 4C0EA 2VJ8A 3I3NA 4J8DA 3EHRA 3G2TA 5EKQD 4QEPA 4XEIG 5DIZA 4X8QA 4GU5A 5AYFA 3UM1A 3F9ZA 5LX8A 3B7RL 3HVEB 2IFUA 1MUFA 2BF0X 5KJMA 5FZQA 2HYZA 1N6CA 3QB2A 4DX6D 2XENA 3X2QE 3APCA 4FLHA 1D8EA 3JXIA 3ZYMA 3D9OA 3F9YA 2J07A 4CT4A 4WAFA 1JPLA 2GROB 2Q7FA 4DLQA 3ZYQA 3CQGB 2WMNA 1JCSA 5LOZA 5JJ0A 2QPWA 5T0MA 2YHCA 4R7LA 1QYMA 3ONKA 5G2NA 3FH7A 4RZ0A 2ZGDA 1H19A 3S7DA 2WM9A 4J8OA 3T5VA 1H0AA 5BV0A 4UWHA 2F37A 4L7TA 2P9LG 2EINE 3APFA 4I17A 4KZ0A 5BPPA 2L0TB 2V5FA 4N39A 2KATA 2P9KG 5A23A 3SO8A 2HM8A 4N3CA 2W5ZA 2C0MA 4GZ5A 2QC9A 3MGBA 4GTPA 5A7DB 3IV0A 3HXDA 3PZDA 4HOQA 1N3JA 2EIJE 3RK6A 3APDA 4JEUA 5AQ7A 2XRYA 4OAUC 3CK8A 4FHKA 4F3VA 5E76A 5AARA 3Q9NC 2IOSA 3O4ZA 4GMLA 2ZU6B 4CCAA 3CEQA 1TNUA 3W9FA 4I9CA 3MJWA 3DXMG 3DSTA 4U8HA 4ILHB 3B7UX 2DYSE 2GRPB 4J8YA 4HS2A 1H6OA 1NP7A 2KBXA 5ENQD 2OVBA 1JCQA 4A1GA 4BX8A 4XIFA 1IQUA 3TXMA 4E47A 1E8WA 4A55A 3Q79A 1UG3A 3D9LA 1MT6A 1N0QA 1LF8A 2JV0A 1H6KA 3FUMA 1TJCA 1YCSB 1DC2A 5G04J 3IEGA 3MV3B 3LVQE 3CHOA 2YINA 1JWGA 3U9WA 3CKCA 3CIAA 1KT1A 3SY2A 4XX5A 2P58C 3FEXA 3UT8A 1WG0A 2I9CA 1K1BA 3PS6A 2PZIA 2AXZA 3MKQB 1X5BA 2P9UG 2XZDG 4BT9A 4ZHBA 3CBOA 3B7BA 3HYMB 4GZ6A 2AWIA 4EPZA 5EIDA 4KYOB 4L1BA 2AJAA 4NURA 2XEVA 3D9JA 3FP3A 5JHNA 3S7JA 4BFRA 4TV3A 3ZGQA 5ENSD 2RFIA 3UX4A 3UKRG 3L9TA 4MBGA 2IGQA 1OCZE 2JABA 4BSZB 4M3OA 3ESLA 4CDMA 4HVBA 4AIFA 3HHMA 4C1QA 1EDUA 3RJWA 4CEMA 2I1JA 4I6JA 1U3DA 3GZ1A 4AY6A 3K5KA 5KJLA 5B1AE 4HB5A 2XPYA 2IO3C 4ANUA 4PDXA 2OCCE 3FPDA 3J5QB 1E8ZA 3UM3A 4F1PA 5EN5D 4K5AB 1SA5A 5ARGA 3JXJA 3T5XA 4ANXA 5HQ8A 4DLOA 3FH8A 3LXUX 4Q69A 1HS6A 5ENOD 5AN8A 3RKVA 4DX7D 3UI2A 2VGYA 2VYIA 4ZFHA 1E7VA 2QY7A 4U0UA 5G05C 1JCRA 1HXIA 4AM9A 5ANLA 5FQ7A 3LEWA 3NBNB 1MX2A 2WVIA 1IQRA 3T8MA 3MA5A 5BUZA 1UN8A 1DCEA 1MJ0A 3B7SA 4GCOA 4HRLA 4ANVA 2VTBA 2W5YA 3BUAA 4L2LA 5CRUA 4PUCA 2BUGA 4IJDA 3I5PA 3UMVA 3TL5A 3DBSA 4U8YD 2XQ0A 5AAOA 3ZIMA 1TN7A 1E7UA 2HE0A 2XCCA 2FULA 2WXNA 5CCMA 3V30A 3RIBA 3SFYA 1H6PA 3DRAA 2WXRA 4NJ5A 5AIJA 1UN9A 3TWSA 4BTBA 2PNNA 4XZ4A 3TWUA 2QYUA 2LNIA 4RG9A 1G3NB 2MYOA 3NF1A 2WXMA 3RJVA 5BXOA 3HXCA 1PAQA 3ABKE 3PZ2A 4J7WA 5KCMA 3AS8A 3ZRHA 2GGFA 1P5QA 3FTVA 4YDEA 3KS2A 4A63B 3ASNE 4K03A 1OUVA 1FVFA 3UIPC 3QWWA 2YNQA 1OWMA 1V54E 3ULQA 3LDZA 1S64A 3RSEG 3MYVA 4RSYA 3CSTA 3ESKA 3I4GA 4FC8A 2VGXB 2R2LA 4MS6A 5FJYA 1MQSA 2WXGA 4W9RA 5CEDB 4WNFA 5JMND 2PQRA 4BY6A 2NXPA 3M57A 2IOLA 4DJAA 3UT7A 3LY9A 5FQ8A 4NRHB 5CHEE 1NZNA 3ZHEA 4YPAA 1OCRE 5M72A 4M7CA 3F6QA 5AENA 4FJYA 1K1AA 4JLGA 2B0OE 2XCBA 1MX6A 4AVXA 3MO0A 2JEKA 1N54A 3NAWA 2ZGGA 4A3TA 4C9BB 4C0MA 2IF4A 2QZAA 1ZU2A 3NB2A 2O8JA 4OVUA 2WXPA 2Y4UA 1O1SA 3O48A 1A5EA 4BETA 4G2VA 3CVUA 1OWLA 2X6JA 5CBOA 2BKKB 1N95A 1MVXA 3QWPA 3W9GA 2VGEA 4RG6A 2DWZA 3S8PA 2LO6A 4BESA 3CLJA 2YQ8A 2ILRA 4HOUA 5FZSA 1HX8A 4U8VD 3QAQA 3RO2A 5FTPA 1Y6IA 4U07A 4K5BA 5LP0A 4CT0A 3R9AB 1Q2ZA 4L23A 4EBAG 3HDXA 1NFIE 4J6IA 4N5CA 4UI9C 4MRUA 3EHMA 3RU0A 2FEZA 3L22A 1N52A 3CHSA 4LNGA 1E8XA 1TNOA 4CDRA 1ZKKA 4IYPA 4ABNA 3Q7AA 3S7BA 3EIJA 4F53A 5C1DA 5JIYA 2PM6A 4J7IA 3E34A 2OOEA 4QQIA 4ME2A 3VLDA 3LKUA 4JXTA 4YDYA 3TJPA 4DX1A 3P2BA 3CHQA 4ATZD 1TNBA 4B8CB 5CCLA 2BTDA 3EIQC 1MX4A 1WAO1 2XZTG 2RKKA 3QNKA 4UUCA 5A6CA 5TH7A 1OXJA 1YA0A 1AWCB 3FEYA 4UQXA 3HXEA 4JB8P 4KMOA 2V0PA 2MOWA 4J7FA 3SHFA 4B93B 4GB9A 4U95D 3CVXA 3HRAA 4O1OA 3CKBA 4GMRA 1BLXB 4HLLA 4FA6A 4ACLA 2H6FA 3PEUB 5KNHD 2P9SG 2WB2A 3EHQA 4GAAA 1O9SA 2VGXA 3FTSA 4BT8A 4HOTA 5EX0A 3OAWA 4JEHA 1H2VC 4UQYA 2C0LA 4IN3B 3KMTA 2RG8A 2XGOA 2GRQB 5CRVA 5C2YA 4KVOA 4HXIA 3LS8A 3Q47B 3FY4A 1N4SA 1HE8A 3C3OA 4QENA 1KT0A 5LCWJ 3SNXA 2LXLA 3KMAA 2H6GA 5EILA 1N4QA 2PM7A 4GTRA 5ANRA 3D9KA 1ML9A 1PC2A 1QBQA 4TXQA 3BEEA 3DSSA 4JD2G 3ZHEB 5F6KC 3LCAA 3QWVA 2LSVA 3RRUA 1Z3XA 3HXBA 3Q78A 3FUIA 4QFVA 4XKCA 3Q49B 3TWXA 2EIME 3FWVA 2IY0C 4G23A 3CR3A 4L9PA 4LRZA 3LJ3A 4GCNA 2Y0BG 3L6AA 3NZUA 4V3IA 3SD5A 3UUXA 2ZIRA 3ISMC 4U0SA 3PUKA 5EYLA 3QJZA 1N4RA 4OYSA 4GZDA 3F9WA 3BG0B 4CGWA 3I4RB 4H12A 2UWJG 1SZAA 3IHXA 3ZN3A 1IXVA 3R7QA 3VUZA 2HO1A 2XGSA 3DPDA 4ATGA 4PS3A 5BV1A 4UQZA 5LCWC 4G8LA 2V4HC 1MHQA 2WXQA 4I2ZA 3L54A 3UIOC 2VSXE 2Y4TA 4HQDA 1KPSB 3L16A 5DBKA 2WQ6A 4DUIA 1OWNA 2WXFA 3M58A 3CVNA 3CHRA 1BI7B 1K8KG 2I2OA 2Y3AA 3ZYKA 3P1UA 2KCKA 4K0RA 5BNWA 4IRUA 5EDSA 3ZFWA 4GA1A 1X81A 2DZNA 5EX3A 2VTBB 3M53A 1SA4A 3SFZA 3DB5A 3PZ3A 2WXOA 2XPIA 3D9MA 4UWLA 4JHJA 3TG4A 3ENEA 1MZCA 2FO1E 1BD8A 2YHEA 4J8FA 5F6LA 1BU9A 2H6IA 3FUEA 2L0IA 4B94A 3D9PA 3OXLA 4G25A 3C5RA 2P9NG 3FDHA 4YNPA 4WNEA 4NQ0A 4DX5D 4FP7A 3WG7E 1HF8A 1XQHA 4DI4A 1FT1A 4NIKA 2M63A 3FTWA 4CGVA 1FT2A 4JPSA 3FUDA 3ZU7B 4F6RD 1NL4A 2RD0A 4ILGA 2R5SA 4YVQC 1MYOA 2I1KA 4U96D 2F8YA 1XGWA 4LG6A 3CVWA 1FPPA 4XI0A 3TG5A 3PH0C 3LYAA 5T0KA 2GW1A 1O1TA 2JLBA 2C2LA 5FWQA 3CQCB 1OY3D 1INZA 4IULA 1DVPA 3JQ1A 4P29A 3M59A 2AW6A 4N3BA 1KZOA 4O1PA 3IBEA 4TUMA 1ZBPA 2A5EA 3AJIA 4N5QA 3L17A 3NQPA 2B6CA 3HG0D 3JCKC 4J8SA 1BPOA 1HFAA 3B13A 2R02A 3CVQA 3G2UA 1UJKA 2CG3A 2R03A 3RO3A 3CK7A 3M5AA 1TR4A 4GMJA 3LY7A 4I1AA 3V79K 4LUNU 2DCPA 3ZYLA 2RFAA 2BKGA 3PUJA 1DCQA 2CFUA 4GPMA 3DPYA 4HI9A 5AJDA 2E0IA 2VSYA 4GTMA 4OVVA 4FADA 3CSFA 3MV2B 4LERA 4BSXA 5FQ6A 2R17C 3L82A 4YDOA 4LCTA 4EZKA 1TN8A 4B8AA 2L9BA 3EP0A 3Q73A 3CVPA 3QDNA 2KC7A 1EYHA 3PZ1A 4RLYA 3UM2A 3ZKJA 3U64A 2F8XK 1TN6A 2CHXA 1HZ4A 5B3SE 3CBMA 4I51A 2A5UA 2FI7A 5CMYA 3V2XA 3AU4A 4OAVB 4RVBA 2XS8A 3ONLA 2X6FA 4XKBA 4GZCA 4DX2A 2G46A 3G2WA 5EG2A 4N2SA 3EHNA 4JA9A 1QQEA 1PY1A 3SZ7A 3MO2A 3CHMA 5JJ7A 2X38A
chains in the Genus database with same CATH topology
3PE4A 4ACLA 2AVPA 3D9LA 1MT6A 3PEUB 3FULA 1OWOA 3D9IA 4UWKA 4XI9A 1LF8A 2JV0A 1H6KA 3FUMA 3MEKA 3CGHA 1TJCA 2WB2A 4E6HA 5G04J 4TRQA 3VTXA 2QFCA 1B89A 4KZCA 1NA0A 4GAAA 1S0PA 3IEGA 2VGXA 3FTSA 3MV3B 4MLPA 4BT8A 4HOTA 1O9SA 2MHKA 2LAIA 2J49A 2VSOE 3LVQE 3ML9A 3CHOA 2YINA 5F5EA 1JWGA 3U9WA 1OWPA 4U0ZA 5EX0A 4F1SA 2X3MA 3OAWA 4JEHA 1H2VC 4UQYA 3CKCA 4AXHA 1FVHA 3CIAA 2C0LA 4IN3B 4KT6B 1KT1A 2LSUA 3S2AA 4XX5A 3KMTA 2RG8A 2P58C 2KZTB 3MZLB 3FEXA 2XGOA 3GYZA 3FUHA 3UT8A 1A17A 1GW6A 3GZ2A 5C2YA 4KVOA 4HXIA 4YNDA 2CHZA 3SI5A 4AEZC 3LS8A 4Y6WA 3IKOB 2I9CA 4YVOA 4JL0A 4IJ8A 2KM4A 3Q47B 3FY4A 3PS6A 1HE8A 4QENA 1KT0A 1Y8MA 2HR2A 2PZIA 2XPZA 4MKTA 3ZXSA 5LCWJ 2XRZA 2WXHA 4Y6CA 2UY1B 2AXZA 3LPZA 3SNXA 3MKQB 1HH8A 1X5BA 3KMAA 4GYOA 1E90A 2OVFA 4BT9A 4UI9J 3FHEA 4I6EA 4URKA 5J90A 2WPVA 3HYMB 3RRMB 3CBOA 4WNGA 3MCXA 4GA0A 4GZ6A 2AWIA 4Q94A 5D0QD 4KYOB 2PM7A 2A4ZA 4L1BA 5ANRA 4EPZA 3D9KA 1ML9A 5FT9A 3FFLA 1PC2A 4WWNA 4NURA 2XEVA 3BEEA 2V4LA 3D9JA 3FP3A 3ZHEB 5T8IA 5JHNA 5CMWA 3S7JA 2NC9A 1L5JA 4BFRA 4TV3A 3ZGQA 4BWRA 5F6KC 3LCAA 3QWVA 4AOFA 2RFIA 5TEGA 2LSVA 3FTYA 3UX4A 2F69A 1HG5A 2WXIA 4PS8A 4JDSA 5LFAA 5G55A 4GZ3A 3RRUA 1Z3XA 2DBAA 2IGQA 4FJZA 2AXUA 4M3OA 2NSZA 2L6JA 3FUIA 1SZ9A 3ESLA 4G24A 4QFVA 4XKCA 3KD7A 4I43A 4CDMA 4HVBA 3URZA 4AIFA 4UWFA 2FF4A 3HHMA 3Q49B 3CV0A 4C1QA 1EDUA 5FQ4A 4BX9A 3RJWA 5JINA 3FTUA 4MI0A 4PH4B 1UW4B 4CEMA 2I1JA 1H2TC 4I6JA 3IHYA 3DALA 5JHBA 4JVSA 3FWVA 1U3DA 3SWCA 1ELRA 3SF4A 4HFGA 1E96B 4N2QA 3GZ1A 5KJKA 3FUFA 4G23A 4AY6A 5KJLA 2IQCA 3ML8A 5JJ6A 3Q5MA 4A1SA 3CR3A 5LSXA 4LRZA 2PL2A 2XPYA 3LJ3A 4GCNA 4PDXA 1IHGA 4ANUA 3FPDA 4LDGA 1E8ZA 3L6AA 3NZUA 1JUQA 4V3IA 3SD5A 4YPEA 2FBNA 5JJTA 3UUXA 3VLFA 3M56A 3TAXA 5ARGA 4GPKA 4NVQA 5T4YA 3SW9A 3PREA 4G1TA 3T5XA 4ANXA 4U0SA 5HQ8A 4JHRA 3PUKA 3FUNA 4DLOA 4B89A 3FH8A 4U63A 3LXUX 4H7XA 4Q69A 3Q15A 5BW8C 1HS6A 3QJZA 4OYSA 4GZDA 3F9WA 3BG0B 2R59A 1EF1C 1Z3YA 3RKVA 4CGWA 3I4RB 2IJGX 4O30A 4H12A 3VLEA 2VGYA 2VYIA 1E7VA 2UWJG 4FMUA 2QY7A 3QKYA 1SZAA 4UWGA 3IHXA 3ASDA 4U0UA 5G05C 3ZN3A 3R7QA 3VUZA 1HXIA 2HO1A 4AM9A 4EQFA 5ANLA 4A3VA 5FQ7A 2XGSA 3LEWA 4HOSA 3DPDA 3AS4A 3CK9A 4ATGA 4PS3A 2WVIA 1IQRA 3OXGA 4WWPA 3T8MA 3MA5A 3FUJA 3LVRE 5BV1A 5BUZA 3RRNB 5LSZA 3KMJA 3ASHA 3UQ3A 1UN8A 2J4BA 3B7SA 4GCOA 4UQZA 5LCWC 4GA2A 3PRZA 3MO5A 1ELWA 5ENNA 1MHQA 2WXQA 4GYYA 4ANVA 4I2ZA 4APOA 2VTBA 1WM5A 2W5YA 3L54A 4DPRA 4L2LA 3K5KA 2J08A 3NZSA 4JHKA 3M55A 2VSXE 3LY8A 2Y4TA 4PUCA 2BUGA 1DNPA 4IJDA 3I5PA 3D3MA 3G2VA 3UMVA 3L16A 5DBKA 2VSNA 4I9EA 3TL5A 3CVVA 3DBSA 2WQ6A 4YPUA 3SBSA 2XQ0A 3CVYA 1OWNA 3ZIMA 2AXVA 4LEUA 1E7UA 2WXFA 3PEVB 3M58A 3KEZA 3QARA 3CVNA 3CHRA 2XCCA 3Q4AB 2I2OA 2FULA 3JQ0A 2WXNA 5CCMA 2VQ2A 3FUKA 2Y3AA 2XHEA 3IHVA 3VTYA 3D9NA 3L13A 3ZYKA 3U66A 3BO5A 3VV0A 5G04C 3QOUA 3P1UA 2KCKA 1VDYA 3C98A 4K0RA 4HORA 3RIBA 2WXRA 4NJ5A 5AIJA 1UN9A 5BNWA 4IRUA 4BTBA 5EDSA 4XZ4A 1WY6A 3FTXA 3MKQA 4GA1A 3ZFWA 1H2UA 4J83A 3GZSA 3B7TA 5EX3A 2LNIA 4RG9A 3OTNA 1NA3A 2WXMA 3NF1A 3N71A 4DK5A 3FU3A 3RJVA 2VTBB 1KLXA 2LAHA 3M53A 4UI9K 2WXKA 5F59A 1PAQA 1EPUA 3SFZA 5KCMA 3DB5A 4MI5A 3AS8A 2X6HA 2WXOA 2XPIA 3D9MA 4UWLA 3ZRHA 2WXLA 4JHJA 3ENEA 3TG4A 3WXXA 2WMOA 1QNFA 2GGFA 1E8YA 2YHEA 1HG2A 4J8FA 3S7FA 1W3BA 1PEGA 4AV7A 3CBPA 5F6LA 1P5QA 5JHAA 3FTVA 3ZVVA 2GRLA 3FUEA 2EQXA 2KCLA 1SQMA 2CG2A 2L0IA 3KS2A 3M54A 4B94A 4K03A 1OUVA 1FVFA 3D9PA 5KJNA 2V8SE 3SBTB 1TEZA 2CFZA 3QWWA 3KAEA 3FU5A 2YNQA 1OWMA 1TJFA 3JYSA 3OXLA 4G25A 4EECA 4U04A 3ULQA 3LDZA 3ZPJA 4H7YA 3HNAA 4PS7A 4B0ZA 3L08A 3FDHA 4YNPA 4ILIA 4WNEA 2X6IA 5AJLA 4I2WA 4NQ0A 2KZTA 2FO7A 3MYVA 4FP7A 2IONA 1HF8A 3CVLA 1XQHA 5BT1A 4RSYA 4DI4A 3CSTA 4JZYA 3AU5A 3ESKA 3HIZA 2IU1A 4I1OB 5CPRB 3I4GA 3OXFA 1UG3A 4FC8A 2M63A 2VGXB 5AYWD 4MS6A 3TXNA 3PVLA 5FJYA 3FTWA 4ACKA 1XNFA 2PQNA 4CGVA 2UY1A 1MQSA 2I6HA 4JPSA 1N6AA 2WXGA 4GYWA 4W9RA 4JW1A 3FUDA 4C0EA 4AU7A 2VJ8A 3I3NA 4J8DA 4WNFA 2PQRA 2RD0A 4YVQC 4ILGA 2R5SA 4HLEA 3TGOA 4BY6A 2NXPA 3M57A 2I1KA 2IOLA 4DJAA 3UT7A 3G2TA 5EKQD 1XGWA 3LY9A 3CVWA 5FQ8A 4NRHB 5CHEE 1HU3A 4WWOA 4XI0A 3TG5A 4QEPA 3PH0C 3UT4A 5DIZA 4BUPA 3MX3A 3LYAA 5T0KA 2GW1A 1NZNA 4EZJA 4GU5A 5AYFA 2JLBA 2C2LA 5FWQA 3ZHEA 3CQCB 4DI3A 3RQ4A 3PE3A 1INZA 4YPAA 4IULA 1DVPA 3OPEA 3JQ1A 3F9ZA 4P29A 5M72A 5LX8A 3M59A 3SGHA 2AW6A 3B7RL 3HVEB 4BTAA 3ASGA 4N3BA 2WXJA 2IFUA 3CHPA 5AENA 2R3AA 4FJYA 3IBEA 4JLGA 4EZLA 3AS5A 1MUFA 2BF0X 5KJMA 2XCBA 5G05J 1ZBPA 4KBQA 3E4BA 5FZQA 4AVXA 3L17A 3MO0A 2JEKA 1N54A 2HYZA 3NQPA 4CRWA 3JCKC 4J8SA 4N3AA 1N6CA 4A3TA 4C9BB 3QB2A 4C0MA 3R7RA 2E2EA 1BPOA 2IF4A 1HFAA 2J9QA 3B13A 1ZU2A 3APCA 4FLHA 3CVQA 2O8JA 4OVUA 3G2UA 3ZYMA 3D9OA 3F9YA 1UJKA 2J07A 2WXPA 2Y4UA 2CG3A 4CT4A 3O48A 3CVUA 4G2VA 4WAFA 1OWLA 1JPLA 3G2SA 2Q7FA 4DLQA 2X6JA 3ZYQA 3RO3A 3CK7A 3CQGB 3RAYA 2WMNA 3M5AA 2XGMA 5T3RA 1UJJA 1MVXA 3QWPA 4GMJA 5LOZA 3JUIA 5JJ0A 3LY7A 5FZRA 2QPWA 5T0MA 2YHCA 4O6FA 4J8EA 4RG6A 4R7LA 1MVHA 3FTZA 4FULA 5ARFA 3S8PA 4I1AA 4CDNA 3ONKA 2WQ7A 2LO6A 5G2NA 3FH7A 4LUNU 2DCPA 2DIWA 3CLJA 3ZYLA 2YQ8A 4RZ0A 1QZ2A 4FLBA 1H19A 3PUJA 3EDTB 3S7DA 4AP2A 2WM9A 4J8OA 4G26A 4AJWA 2ILRA 3K9IA 4HOUA 3PNLB 5FZSA 2CFUA 3T5VA 1HX8A 4F7AA 1H0AA 5BV0A 4UWHA 5AJDA 4AY5A 3BG1B 2E0IA 2VSYA 3QAQA 4WUYA 3RO2A 4L7TA 4TUUA 5FTPA 4YNMA 1Y6IA 2J4DA 4OVVA 4WNDA 1IYGA 4NACA 4U07A 3QK0A 5LP0A 3APFA 4FADA 1H3IA 1ELKA 4Z4PA 3FU6A 4CT0A 4I17A 3R9AB 3CSFA 5D0OD 3MV2B 4LERA 4KZ0A 4L23A 5BPPA 2L0TB 2V5FA 4FHJA 4N39A 4BSXA 5FQ6A 2KATA 4Q96A 4EBAG 3U3WA 3HDXA 2R17C 5A23A 2X6KA 2HM8A 4J6IA 4N3CA 4N5CA 4UI9C 2WQHA 4MRUA 3F9XA 3EHMA 3RU0A 3UPVA 4XE0A 2W5ZA 4LCTA 3PDNA 3OOIA 2C0MA 4EZKA 2FEZA 3L22A 4GZ5A 1N52A 3CHSA 1E8XA 4B8AA 2L9BA 3EP0A 4CDRA 4FU3A 1JWFA 3CVPA 1ZKKA 3QDNA 2KC7A 4IYPA 3MGBA 1EYHA 3U4TA 4ABNA 5A7DB 3FH5A 3S7BA 3HVEA 3IV0A 3PZDA 4HOQA 3U64A 1N3JA 4L2YA 3RK6A 3EIJA 2ONDA 3APDA 4JEUA 4F53A 2XRYA 5C1DA 2CHXA 4KXKB 3QC1A 3CK8A 1HZ4A 2J09A 4QEOA 4E85A 2PM6A 4J7IA 4FHKA 5JIYA 2OOEA 4D10C 3CBMA 4I51A 2OV8A 2A5UA 2FI7A 4KVMA 5E75A 4ME2A 4F3VA 5CMYA 3VLDA 3LKUA 4JXTA 5E76A 3TJPA 3EJNA 2BQZA 4J0UA 3P2BA 2IOSA 3CHQA 3O4ZA 1HO8A 4GMLA 4JC8A 2ZU6B 4B8CB 5CCLA 5TTFA 3AU4A 4CCAA 3CEQA 4RVBA 2BTDA 3EIQC 3ZEFA 1WAO1 4I9CA 3MJWA 3QNKA 3ONLA 2X6FA 5T5GA 1Z6TA 4XKBA 3PNTB 5A6CA 4GZCA 4U8HA 5TH7A 2G46A 4ILHB 3B7UX 1YA0A 3G2WA 3ASFA 4HS2A 5EG2A 3FEYA 1U3CA 1NP7A 4UQXA 4N2SA 3EHNA 3MKRA 3ZW3A 2CHWA 2OVBA 4G11A 4KMOA 2V0PA 2MOWA 2KCVA 4I6GA 4J7FA 3SHFA 2MRIA 4JA9A 5HI7A 4A1GA 4BX8A 1QQEA 4GB9A 3OS5A 3CVXA 1PY1A 3SZ7A 3MO2A 3GW4A 3CHMA 4XIFA 1IQUA 3TXMA 4EBAA 5J08A 4I1MA 4E47A 5JJ7A 3CKBA 1E8WA 4APFA 4A55A 4JA7A 4FA6A 3FU0A 4ANWA 2X38A 1FCHA 2GRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PE4 A;  2AVP A;  1MT6 A;  4XI9 A;  2JV0 A;  3MEK A;  1TJC A;  5G04 J;  3VTX A;  2QFC A;  1B89 A;  1NA0 A;  3IEG A;  3MV3 B;  2VGX A;  1O9S A;  4BT8 A;  4HOT A;  2MHK A;  5F5E A;  4U0Z A;  5EX0 A;  4UQY A;  3CKC A;  2C0L A;  4IN3 B;  1KT1 A;  2LSU A;  3KMT A;  2P58 C;  2XGO A;  3GYZ A;  1A17 A;  3GZ2 A;  4YND A;  4Y6W A;  4YVO A;  4JL0 A;  4IJ8 A;  3Q47 B;  4QEN A;  1KT0 A;  1Y8M A;  2HR2 A;  2PZI A;  5LCW J;  4Y6C A;  2UY1 B;  3LPZ A;  1HH8 A;  3KMA A;  4GYO A;  4BT9 A;  4UI9 J;  2WPV A;  3HYM B;  3CBO A;  4WNG A;  4GA0 A;  4GZ6 A;  5D0Q D;  4KYO B;  1ML9 A;  5FT9 A;  3FFL A;  1PC2 A;  2XEV A;  3BEE A;  3FP3 A;  3ZHE B;  5JHN A;  3S7J A;  2NC9 A;  3ZGQ A;  4BWR A;  5F6K C;  3LCA A;  3QWV A;  2RFI A;  5TEG A;  2LSV A;  2F69 A;  4JDS A;  4GZ3 A;  2DBA A;  2IGQ A;  2L6J A;  4G24 A;  3KD7 A;  3URZ A;  4AIF A;  2FF4 A;  3Q49 B;  3CV0 A;  4C1Q A;  3RJW A;  5JIN A;  4MI0 A;  3DAL A;  3FWV A;  3SWC A;  1ELR A;  3SF4 A;  1E96 B;  4N2Q A;  3GZ1 A;  5KJK A;  4G23 A;  4AY6 A;  3K5K A;  5KJL A;  5JJ6 A;  3Q5M A;  4A1S A;  5LSX A;  2PL2 A;  4GCN A;  1IHG A;  3FPD A;  4LDG A;  4YPE A;  2FBN A;  5JJT A;  3UUX A;  3M56 A;  3TAX A;  5ARG A;  4GPK A;  4NVQ A;  3SW9 A;  4G1T A;  5HQ8 A;  4U0S A;  4JHR A;  4H7X A;  3Q15 A;  5BW8 C;  3F9W A;  3RKV A;  4CGW A;  4O30 A;  4H12 A;  2VGY A;  2VYI A;  2UWJ G;  4FMU A;  3QKY A;  3IHX A;  3ASD A;  4U0U A;  5G05 C;  3ZN3 A;  3VUZ A;  1HXI A;  2HO1 A;  4AM9 A;  4EQF A;  2XGS A;  4HOS A;  3AS4 A;  3CK9 A;  3OXG A;  3MA5 A;  5LSZ A;  3KMJ A;  3ASH A;  3UQ3 A;  4GCO A;  4UQZ A;  5LCW C;  4GA2 A;  3MO5 A;  1ELW A;  4GYY A;  4I2Z A;  4APO A;  1WM5 A;  2W5Y A;  3M55 A;  3LY8 A;  2Y4T A;  2BUG A;  4IJD A;  5DBK A;  2VSN A;  4I9E A;  4YPU A;  4LEU A;  3M58 A;  3CVN A;  2XCC A;  3Q4A B;  5CCM A;  2VQ2 A;  3BO5 A;  3VTY A;  3VV0 A;  5G04 C;  3QOU A;  2KCK A;  4HOR A;  3RIB A;  4NJ5 A;  5BNW A;  4BTB A;  3ZFW A;  4GA1 A;  4J83 A;  5EX3 A;  2LNI A;  4RG9 A;  1NA3 A;  3NF1 A;  3N71 A;  3RJV A;  1KLX A;  3M53 A;  4UI9 K;  5F59 A;  3DB5 A;  4MI5 A;  3AS8 A;  2XPI A;  3TG4 A;  3WXX A;  4J8F A;  3S7F A;  1PEG A;  1W3B A;  5F6L A;  3CBP A;  1P5Q A;  2KCL A;  3KS2 A;  3M54 A;  4B94 A;  1OUV A;  5KJN A;  3QWW A;  3OXL A;  4G25 A;  3JYS A;  3KAE A;  4U04 A;  3ULQ A;  3ZPJ A;  4H7Y A;  3HNA A;  4YNP A;  4WNE A;  4I2W A;  4NQ0 A;  2FO7 A;  3CVL A;  1XQH A;  5BT1 A;  3ESK A;  5CPR B;  3OXF A;  2VGX B;  5AYW D;  5FJY A;  1XNF A;  2PQN A;  4CGV A;  2UY1 A;  2I6H A;  1N6A A;  4W9R A;  4GYW A;  4AU7 A;  4J8D A;  4WNF A;  2PQR A;  4YVQ C;  2R5S A;  3TGO A;  3M57 A;  5EKQ D;  3LY9 A;  4NRH B;  5CHE E;  4XI0 A;  3TG5 A;  4QEP A;  5DIZ A;  4BUP A;  3LYA A;  5T0K A;  2GW1 A;  1NZN A;  5AYF A;  2JLB A;  2C2L A;  3ZHE A;  3RQ4 A;  3PE3 A;  4YPA A;  3OPE A;  3F9Z A;  5M72 A;  3M59 A;  4BTA A;  3ASG A;  4N3B A;  2IFU A;  2R3A A;  4JLG A;  3AS5 A;  1MUF A;  5KJM A;  2XCB A;  5G05 J;  1ZBP A;  4KBQ A;  3E4B A;  5FZQ A;  3MO0 A;  2HYZ A;  4N3A A;  1N6C A;  2E2E A;  2J9Q A;  2IF4 A;  1ZU2 A;  3CVQ A;  2O8J A;  3F9Y A;  2Y4U A;  3O48 A;  4G2V A;  2Q7F A;  3RO3 A;  3CK7 A;  3RAY A;  3M5A A;  2XGM A;  1MVX A;  3QWP A;  5JJ0 A;  3LY7 A;  5FZR A;  2QPW A;  5T0M A;  2YHC A;  4O6F A;  4J8E A;  4RG6 A;  1MVH A;  5ARF A;  3S8P A;  4I1A A;  2YQ8 A;  4RZ0 A;  1QZ2 A;  3EDT B;  3S7D A;  4J8O A;  4G26 A;  3K9I A;  4HOU A;  5FZS A;  4AY5 A;  2VSY A;  4WUY A;  3RO2 A;  5FTP A;  4YNM A;  4WND A;  1IYG A;  4U07 A;  1H3I A;  4Z4P A;  4I17 A;  3R9A B;  5D0O D;  3MV2 B;  2V5F A;  4N39 A;  3U3W A;  2KAT A;  4N3C A;  4N5C A;  4UI9 C;  2WQH A;  3F9X A;  3RU0 A;  3UPV A;  2W5Z A;  3OOI A;  3PDN A;  2C0M A;  2FEZ A;  4GZ5 A;  3EP0 A;  4CDR A;  3CVP A;  1ZKK A;  3QDN A;  2KC7 A;  3U4T A;  4ABN A;  5A7D B;  3S7B A;  4HOQ A;  1N3J A;  2OND A;  5C1D A;  4KXK B;  3CK8 A;  1HZ4 A;  4QEO A;  5JIY A;  4J7I A;  2OOE A;  3CBM A;  4I51 A;  2FI7 A;  4ME2 A;  4F3V A;  3LKU A;  2BQZ A;  4J0U A;  5CCL A;  5TTF A;  3CEQ A;  1WAO 1;  4I9C A;  5T5G A;  5A6C A;  5TH7 A;  2G46 A;  1YA0 A;  3ASF A;  5EG2 A;  4UQX A;  4N2S A;  3MKR A;  2KCV A;  4J7F A;  4JA9 A;  5HI7 A;  1QQE A;  3OS5 A;  3MO2 A;  3SZ7 A;  3GW4 A;  4XIF A;  4E47 A;  5JJ7 A;  3CKB A;  4JA7 A;  1FCH A; 
#chains in the Genus database with same CATH topology
 2AVP A;  3FUL A;  4XI9 A;  3J5P A;  3B95 A;  3CGH A;  4E6H A;  1B89 A;  4KZC A;  1NA0 A;  1S0P A;  2MHK A;  2LAI A;  2VSO E;  5F5E A;  2OEV A;  1OWP A;  4U0Z A;  4LSZ E;  2X3M A;  2F0Y A;  1FVH A;  4KT6 B;  2LSU A;  3S2A A;  2KZT B;  3BU8 A;  3GYZ A;  3FUH A;  1GW6 A;  3GZ2 A;  5AQB A;  2CHZ A;  3SI5 A;  1SVX A;  3IKO B;  4JL0 A;  2HR2 A;  4Y6C A;  1IKN D;  4GTV A;  3LPZ A;  5AQA A;  4GYO A;  2OVF A;  4UI9 J;  4I6E A;  5J90 A;  4GA0 A;  1O5M A;  2A4Z A;  5FT9 A;  3FFL A;  4WWN A;  3T8K A;  5T8I A;  4AOF A;  5TEG A;  5D2M C;  3FTY A;  2GRR B;  2F69 A;  1HG5 A;  2WXI A;  4PS8 A;  4JDS A;  5G55 A;  2DBA A;  2AXU A;  2L6J A;  4G24 A;  2ZIS A;  4I43 A;  3EU9 A;  3URZ A;  4UWF A;  1LD7 A;  2FF4 A;  3CV0 A;  5JA4 D;  5FQ4 A;  4BX9 A;  1H2T C;  3ZXP A;  5JHB A;  4JVS A;  3Q9U C;  1ELR A;  4HFG A;  1E96 B;  4N2Q A;  5KJK A;  2IQC A;  5JJ6 A;  5LSX A;  2PL2 A;  1IHG A;  1RZ4 A;  2DVW A;  2ETA A;  4LDG A;  3UKU G;  4GPK A;  5T4Y A;  3SW9 A;  4JHR A;  4B89 A;  3Q15 A;  5BW8 C;  2R59 A;  1Z3Y A;  2IJG X;  4FMU A;  3QKY A;  4A3V A;  3AS4 A;  3CK9 A;  3OXG A;  3LVR E;  4GTT A;  5LSZ A;  3KMJ A;  3ASH A;  3UQ3 A;  4GA2 A;  3PRZ A;  3MO5 A;  1ELW A;  5CBN A;  4GYY A;  4APO A;  1WM5 A;  3NZS A;  4JHK A;  3LY8 A;  3DEO A;  1DNP A;  3G2V A;  4I9E A;  3CVV A;  3ABL E;  2AXV A;  3C3Q A;  4LEU A;  1N4P A;  3KEZ A;  3QAR A;  3JQ0 A;  2VQ2 A;  4YDW A;  1BI8 B;  3BO5 A;  3IHV A;  3VTY A;  3D9N A;  3L13 A;  5G04 C;  5EYP F;  3QOU A;  5HS0 A;  2DYR E;  2J8S D;  1VDY A;  1S63 A;  4TXP A;  1N9A A;  2NYJ A;  1WY6 A;  3MKQ A;  1H2U A;  3B7T A;  4O60 A;  5KWD A;  4C48 B;  2LAH A;  1Z5S C;  5F59 A;  3UIN C;  2WXL A;  3WXX A;  2WMO A;  1QNF A;  3S7F A;  1AP7 A;  1W3B A;  1PEG A;  5JHA A;  3ZVV A;  2GRL A;  2EQX A;  2KCL A;  2CG2 A;  3BQO A;  5FIO A;  3M54 A;  3SBT B;  1TEZ A;  2Y1L E;  1OCO E;  3KAE A;  3JYS A;  1TJF A;  4EEC A;  2KXP C;  4PS7 A;  4B0Z A;  3L08 A;  3D9H A;  4G8K A;  4ILI A;  1YYH A;  2X6I A;  4I2W A;  2KZT A;  2FO7 A;  2ZXW E;  2ION A;  3KSL A;  3AU5 A;  5HRY A;  3HIZ A;  5CER B;  3E32 A;  2EIL E;  3NOC D;  3TXN A;  3E37 A;  3PVL A;  4ACK A;  5BXU A;  1TYQ G;  1N0R A;  1N6A A;  4AU7 A;  4JW1 A;  1NI1 A;  2OEW A;  4HLE A;  3TGO A;  3Q75 A;  3UM0 A;  1HU3 A;  4WWO A;  5B1B E;  3UT4 A;  4BUP A;  3MX3 A;  4EZJ A;  4DI3 A;  3RQ4 A;  3PE3 A;  3OPE A;  3UTM A;  3SGH A;  4BTA A;  1OT8 A;  3ASG A;  2WXJ A;  3CHP A;  2R3A A;  4EZL A;  3AG4 E;  3AS5 A;  5G05 J;  4KBQ A;  3E4B A;  4CRW A;  4N3A A;  3NOG D;  3R7R A;  1V55 E;  2R05 A;  2E2E A;  2J9Q A;  3V31 A;  3G2S A;  3RAY A;  4RQI A;  2XGM A;  5T3R A;  1UJJ A;  2LXM A;  3LJN A;  3JUI A;  3EUV A;  5FZR A;  4O6F A;  4J8E A;  1MVH A;  2XEE A;  3E30 A;  3FTZ A;  4FUL A;  5ARF A;  4CDN A;  5AQ9 A;  2WQ7 A;  3T9K A;  3JUE A;  2DIW A;  1QZ2 A;  4FLB A;  3EDT B;  4AP2 A;  4G26 A;  4AJW A;  3HXF A;  3K9I A;  3PNL B;  3PZ4 A;  4F7A A;  4AY5 A;  3BG1 B;  1N11 A;  4K5C A;  4WUY A;  3C72 A;  4TUU A;  4YNM A;  2J4D A;  4WND A;  4CZ2 D;  1IYG A;  4NAC A;  3SFX A;  3QK0 A;  1H3I A;  1ELK A;  4Z4P A;  3FU6 A;  5D0O D;  2DZO A;  3ABM E;  4FHJ A;  3U3W A;  4Q96 A;  5H7P A;  4HNA D;  2X6K A;  1UOH A;  2P2C P;  2H6H A;  2WQH A;  3F9X A;  3UPV A;  4XE0 A;  3OOI A;  3PDN A;  4FU3 A;  1JWF A;  3U4T A;  3FH5 A;  3AAA C;  3HVE A;  4BEP A;  4L2Y A;  2OND A;  3AG2 E;  1YMP A;  1S70 B;  4KXK B;  1U2V G;  3QC1 A;  2J09 A;  4QEO A;  4E85 A;  4D10 C;  2OV8 A;  4KVM A;  5E75 A;  3DWL G;  1KZP A;  3DSX A;  3EJN A;  2BQZ A;  4J0U A;  1HO8 A;  4JC8 A;  5TTF A;  3ZEF A;  2IEJ A;  5T5G A;  1Z6T A;  3PNT B;  3ASF A;  3E33 A;  5EIB E;  1U3C A;  3MKR A;  3ZW3 A;  2CHW A;  4G11 A;  2KCV A;  1D9S A;  4I6G A;  2MRI A;  5HI7 A;  3OS5 A;  3GW4 A;  5J08 A;  4EBA A;  4GTQ A;  4I1M A;  3TWW A;  2XS1 A;  4APF A;  4JA7 A;  4BER A;  3FU0 A;  4ANW A;  4HRM B;  1FCH A;  2GRM A;  3PE4 A;  1OWO A;  3D9I A;  4UWK A;  1OCC E;  3DXK G;  2QYJ A;  3MEK A;  4TRQ A;  3VTX A;  2QFC A;  2V5Q C;  4MLP A;  2J49 A;  3ML9 A;  1TNZ A;  3AG1 E;  5FIN A;  4F1S A;  4AXH A;  1O1R A;  3MZL B;  4LNU D;  1A17 A;  4AEZ C;  4YND A;  4Y6W A;  3DSV A;  4YVO A;  3TWQ A;  4IJ8 A;  2KM4 A;  1Y8M A;  2XPZ A;  4MKT A;  3ZXS A;  3SQV A;  2XRZ A;  5IY5 E;  2WXH A;  2UY1 B;  1HH8 A;  1E90 A;  3FHE A;  4URK A;  4GTO A;  2WPV A;  3RRM B;  4WNG A;  3MCX A;  4Q94 A;  5D0Q D;  2P9I G;  3ZUV B;  2V4L A;  4GTS A;  4U7E B;  5CMW A;  2NC9 A;  1L5J A;  4BWR A;  3Q7F A;  1LTX A;  3ZNG A;  5D66 A;  5LFA A;  4GZ3 A;  4FJZ A;  2NSZ A;  1SZ9 A;  2Y69 E;  3KD7 A;  3C3R A;  5JIN A;  3FTU A;  4MI0 A;  4PH4 B;  1UW4 B;  2EIK E;  1SW6 A;  3IHY A;  1RW2 A;  3DAL A;  3SWC A;  3SF4 A;  3FUF A;  3ML8 A;  3Q5M A;  1TNY A;  4A1S A;  3KSQ A;  4YPE A;  1JUQ A;  2FBN A;  5JJT A;  3VLF A;  3M56 A;  3TAX A;  4NVQ A;  5CEC B;  1D8D A;  3PRE A;  4G1T A;  2XEH A;  4DRX E;  3FUN A;  4U63 A;  4H7X A;  4LNB A;  3ULE G;  1EF1 C;  3TWV A;  4O30 A;  3VLE A;  3KEA A;  4UWG A;  3TWR A;  3ASD A;  5ENP D;  4EQF A;  3R9M A;  2L6B A;  4HOS A;  4WWP A;  3FUJ A;  3RRN B;  5ITZ F;  2J4B A;  2ETB A;  4CYM D;  5ENN A;  3IXE A;  1LD8 A;  4DPR A;  2J08 A;  3M55 A;  2IO2 C;  3D3M A;  3AG3 E;  1K3Z D;  2VSN A;  4YPU A;  3SBS A;  3CVY A;  2RFM A;  3PEV B;  3EU5 A;  3Q4A B;  4HBD A;  3FUK A;  3U66 A;  2XHE A;  3VV0 A;  3C98 A;  4HOR A;  5HKP A;  2LUH A;  5KBA A;  4Z68 A;  3FTX A;  3DSW A;  4J83 A;  3GZS A;  3V2O A;  3OTN A;  1NA3 A;  3ASO E;  3N71 A;  4DK5 A;  3FU3 A;  1KLX A;  4UI9 K;  2WXK A;  5CEA A;  4HRN A;  3ULY A;  1EPU A;  2GRN B;  4MI5 A;  2X6H A;  1E8Y A;  1HG2 A;  4AV7 A;  3CBP A;  5ENT D;  1SQM A;  3RAU A;  2ETC A;  5KJN A;  1N94 A;  2V8S E;  2CFZ A;  3FU5 A;  3TWT A;  1IHB A;  4U04 A;  3ZPJ A;  3UXG A;  3DEP A;  2P9P G;  4H7Y A;  3HNA A;  5AJL A;  5ENR D;  5KNG A;  3CVL A;  5BT1 A;  3DSU A;  4JZY A;  1WDY A;  4TXR A;  2IU1 A;  4I1O B;  5CPR B;  2BED A;  3OXF A;  1ZB1 A;  5AYW D;  4HI8 A;  4EHM A;  1XNF A;  2PQN A;  2UY1 A;  2I6H A;  4GYW A;  4C0E A;  2VJ8 A;  3I3N A;  4J8D A;  3EHR A;  3G2T A;  5EKQ D;  4QEP A;  4XEI G;  5DIZ A;  4X8Q A;  4GU5 A;  5AYF A;  3UM1 A;  3F9Z A;  5LX8 A;  3B7R L;  3HVE B;  2IFU A;  1MUF A;  2BF0 X;  5KJM A;  5FZQ A;  2HYZ A;  1N6C A;  3QB2 A;  4DX6 D;  2XEN A;  3X2Q E;  3APC A;  4FLH A;  1D8E A;  3JXI A;  3ZYM A;  3D9O A;  3F9Y A;  2J07 A;  4CT4 A;  4WAF A;  1JPL A;  2GRO B;  2Q7F A;  4DLQ A;  3ZYQ A;  3CQG B;  2WMN A;  1JCS A;  5LOZ A;  5JJ0 A;  2QPW A;  5T0M A;  2YHC A;  4R7L A;  1QYM A;  3ONK A;  5G2N A;  3FH7 A;  4RZ0 A;  2ZGD A;  1H19 A;  3S7D A;  2WM9 A;  4J8O A;  3T5V A;  1H0A A;  5BV0 A;  4UWH A;  2F37 A;  4L7T A;  2P9L G;  2EIN E;  3APF A;  4I17 A;  4KZ0 A;  5BPP A;  2L0T B;  2V5F A;  4N39 A;  2KAT A;  2P9K G;  5A23 A;  3SO8 A;  2HM8 A;  4N3C A;  2W5Z A;  2C0M A;  4GZ5 A;  2QC9 A;  3MGB A;  4GTP A;  5A7D B;  3IV0 A;  3HXD A;  3PZD A;  4HOQ A;  1N3J A;  2EIJ E;  3RK6 A;  3APD A;  4JEU A;  5AQ7 A;  2XRY A;  4OAU C;  3CK8 A;  4FHK A;  4F3V A;  5E76 A;  5AAR A;  3Q9N C;  2IOS A;  3O4Z A;  4GML A;  2ZU6 B;  4CCA A;  3CEQ A;  1TNU A;  3W9F A;  4I9C A;  3MJW A;  3DXM G;  3DST A;  4U8H A;  4ILH B;  3B7U X;  2DYS E;  2GRP B;  4J8Y A;  4HS2 A;  1H6O A;  1NP7 A;  2KBX A;  5ENQ D;  2OVB A;  1JCQ A;  4A1G A;  4BX8 A;  4XIF A;  1IQU A;  3TXM A;  4E47 A;  1E8W A;  4A55 A;  3Q79 A;  1UG3 A;  3D9L A;  1MT6 A;  1N0Q A;  1LF8 A;  2JV0 A;  1H6K A;  3FUM A;  1TJC A;  1YCS B;  1DC2 A;  5G04 J;  3IEG A;  3MV3 B;  3LVQ E;  3CHO A;  2YIN A;  1JWG A;  3U9W A;  3CKC A;  3CIA A;  1KT1 A;  3SY2 A;  4XX5 A;  2P58 C;  3FEX A;  3UT8 A;  1WG0 A;  2I9C A;  1K1B A;  3PS6 A;  2PZI A;  2AXZ A;  3MKQ B;  1X5B A;  2P9U G;  2XZD G;  4BT9 A;  4ZHB A;  3CBO A;  3B7B A;  3HYM B;  4GZ6 A;  2AWI A;  4EPZ A;  5EID A;  4KYO B;  4L1B A;  2AJA A;  4NUR A;  2XEV A;  3D9J A;  3FP3 A;  5JHN A;  3S7J A;  4BFR A;  4TV3 A;  3ZGQ A;  5ENS D;  2RFI A;  3UX4 A;  3UKR G;  3L9T A;  4MBG A;  2IGQ A;  1OCZ E;  2JAB A;  4BSZ B;  4M3O A;  3ESL A;  4CDM A;  4HVB A;  4AIF A;  3HHM A;  4C1Q A;  1EDU A;  3RJW A;  4CEM A;  2I1J A;  4I6J A;  1U3D A;  3GZ1 A;  4AY6 A;  3K5K A;  5KJL A;  5B1A E;  4HB5 A;  2XPY A;  2IO3 C;  4ANU A;  4PDX A;  2OCC E;  3FPD A;  3J5Q B;  1E8Z A;  3UM3 A;  4F1P A;  5EN5 D;  4K5A B;  1SA5 A;  5ARG A;  3JXJ A;  3T5X A;  4ANX A;  5HQ8 A;  4DLO A;  3FH8 A;  3LXU X;  4Q69 A;  1HS6 A;  5ENO D;  5AN8 A;  3RKV A;  4DX7 D;  3UI2 A;  2VGY A;  2VYI A;  4ZFH A;  1E7V A;  2QY7 A;  4U0U A;  5G05 C;  1JCR A;  1HXI A;  4AM9 A;  5ANL A;  5FQ7 A;  3LEW A;  3NBN B;  1MX2 A;  2WVI A;  1IQR A;  3T8M A;  3MA5 A;  5BUZ A;  1UN8 A;  1DCE A;  1MJ0 A;  3B7S A;  4GCO A;  4HRL A;  4ANV A;  2VTB A;  2W5Y A;  3BUA A;  4L2L A;  5CRU A;  4PUC A;  2BUG A;  4IJD A;  3I5P A;  3UMV A;  3TL5 A;  3DBS A;  4U8Y D;  2XQ0 A;  5AAO A;  3ZIM A;  1TN7 A;  1E7U A;  2HE0 A;  2XCC A;  2FUL A;  2WXN A;  5CCM A;  3V30 A;  3RIB A;  3SFY A;  1H6P A;  3DRA A;  2WXR A;  4NJ5 A;  5AIJ A;  1UN9 A;  3TWS A;  4BTB A;  2PNN A;  4XZ4 A;  3TWU A;  2QYU A;  2LNI A;  4RG9 A;  1G3N B;  2MYO A;  3NF1 A;  2WXM A;  3RJV A;  5BXO A;  3HXC A;  1PAQ A;  3ABK E;  3PZ2 A;  4J7W A;  5KCM A;  3AS8 A;  3ZRH A;  2GGF A;  1P5Q A;  3FTV A;  4YDE A;  3KS2 A;  4A63 B;  3ASN E;  4K03 A;  1OUV A;  1FVF A;  3UIP C;  3QWW A;  2YNQ A;  1OWM A;  1V54 E;  3ULQ A;  3LDZ A;  1S64 A;  3RSE G;  3MYV A;  4RSY A;  3CST A;  3ESK A;  3I4G A;  4FC8 A;  2VGX B;  2R2L A;  4MS6 A;  5FJY A;  1MQS A;  2WXG A;  4W9R A;  5CED B;  4WNF A;  5JMN D;  2PQR A;  4BY6 A;  2NXP A;  3M57 A;  2IOL A;  4DJA A;  3UT7 A;  3LY9 A;  5FQ8 A;  4NRH B;  5CHE E;  1NZN A;  3ZHE A;  4YPA A;  1OCR E;  5M72 A;  4M7C A;  3F6Q A;  5AEN A;  4FJY A;  1K1A A;  4JLG A;  2B0O E;  2XCB A;  1MX6 A;  4AVX A;  3MO0 A;  2JEK A;  1N54 A;  3NAW A;  2ZGG A;  4A3T A;  4C9B B;  4C0M A;  2IF4 A;  2QZA A;  1ZU2 A;  3NB2 A;  2O8J A;  4OVU A;  2WXP A;  2Y4U A;  1O1S A;  3O48 A;  1A5E A;  4BET A;  4G2V A;  3CVU A;  1OWL A;  2X6J A;  5CBO A;  2BKK B;  1N95 A;  1MVX A;  3QWP A;  3W9G A;  2VGE A;  4RG6 A;  2DWZ A;  3S8P A;  2LO6 A;  4BES A;  3CLJ A;  2YQ8 A;  2ILR A;  4HOU A;  5FZS A;  1HX8 A;  4U8V D;  3QAQ A;  3RO2 A;  5FTP A;  1Y6I A;  4U07 A;  4K5B A;  5LP0 A;  4CT0 A;  3R9A B;  1Q2Z A;  4L23 A;  4EBA G;  3HDX A;  1NFI E;  4J6I A;  4N5C A;  4UI9 C;  4MRU A;  3EHM A;  3RU0 A;  2FEZ A;  3L22 A;  1N52 A;  3CHS A;  4LNG A;  1E8X A;  1TNO A;  4CDR A;  1ZKK A;  4IYP A;  4ABN A;  3Q7A A;  3S7B A;  3EIJ A;  4F53 A;  5C1D A;  5JIY A;  2PM6 A;  4J7I A;  3E34 A;  2OOE A;  4QQI A;  4ME2 A;  3VLD A;  3LKU A;  4JXT A;  4YDY A;  3TJP A;  4DX1 A;  3P2B A;  3CHQ A;  4ATZ D;  1TNB A;  4B8C B;  5CCL A;  2BTD A;  3EIQ C;  1MX4 A;  1WAO 1;  2XZT G;  2RKK A;  3QNK A;  4UUC A;  5A6C A;  5TH7 A;  1OXJ A;  1YA0 A;  1AWC B;  3FEY A;  4UQX A;  3HXE A;  4JB8 P;  4KMO A;  2V0P A;  2MOW A;  4J7F A;  3SHF A;  4B93 B;  4GB9 A;  4U95 D;  3CVX A;  3HRA A;  4O1O A;  3CKB A;  4GMR A;  1BLX B;  4HLL A;  4FA6 A;  4ACL A;  2H6F A;  3PEU B;  5KNH D;  2P9S G;  2WB2 A;  3EHQ A;  4GAA A;  1O9S A;  2VGX A;  3FTS A;  4BT8 A;  4HOT A;  5EX0 A;  3OAW A;  4JEH A;  1H2V C;  4UQY A;  2C0L A;  4IN3 B;  3KMT A;  2RG8 A;  2XGO A;  2GRQ B;  5CRV A;  5C2Y A;  4KVO A;  4HXI A;  3LS8 A;  3Q47 B;  3FY4 A;  1N4S A;  1HE8 A;  3C3O A;  4QEN A;  1KT0 A;  5LCW J;  3SNX A;  2LXL A;  3KMA A;  2H6G A;  5EIL A;  1N4Q A;  2PM7 A;  4GTR A;  5ANR A;  3D9K A;  1ML9 A;  1PC2 A;  1QBQ A;  4TXQ A;  3BEE A;  3DSS A;  4JD2 G;  3ZHE B;  5F6K C;  3LCA A;  3QWV A;  2LSV A;  3RRU A;  1Z3X A;  3HXB A;  3Q78 A;  3FUI A;  4QFV A;  4XKC A;  3Q49 B;  3TWX A;  2EIM E;  3FWV A;  2IY0 C;  4G23 A;  3CR3 A;  4L9P A;  4LRZ A;  3LJ3 A;  4GCN A;  2Y0B G;  3L6A A;  3NZU A;  4V3I A;  3SD5 A;  3UUX A;  2ZIR A;  3ISM C;  4U0S A;  3PUK A;  5EYL A;  3QJZ A;  1N4R A;  4OYS A;  4GZD A;  3F9W A;  3BG0 B;  4CGW A;  3I4R B;  4H12 A;  2UWJ G;  1SZA A;  3IHX A;  3ZN3 A;  1IXV A;  3R7Q A;  3VUZ A;  2HO1 A;  2XGS A;  3DPD A;  4ATG A;  4PS3 A;  5BV1 A;  4UQZ A;  5LCW C;  4G8L A;  2V4H C;  1MHQ A;  2WXQ A;  4I2Z A;  3L54 A;  3UIO C;  2VSX E;  2Y4T A;  4HQD A;  1KPS B;  3L16 A;  5DBK A;  2WQ6 A;  4DUI A;  1OWN A;  2WXF A;  3M58 A;  3CVN A;  3CHR A;  1BI7 B;  1K8K G;  2I2O A;  2Y3A A;  3ZYK A;  3P1U A;  2KCK A;  4K0R A;  5BNW A;  4IRU A;  5EDS A;  3ZFW A;  4GA1 A;  1X81 A;  2DZN A;  5EX3 A;  2VTB B;  3M53 A;  1SA4 A;  3SFZ A;  3DB5 A;  3PZ3 A;  2WXO A;  2XPI A;  3D9M A;  4UWL A;  4JHJ A;  3TG4 A;  3ENE A;  1MZC A;  2FO1 E;  1BD8 A;  2YHE A;  4J8F A;  5F6L A;  1BU9 A;  2H6I A;  3FUE A;  2L0I A;  4B94 A;  3D9P A;  3OXL A;  4G25 A;  3C5R A;  2P9N G;  3FDH A;  4YNP A;  4WNE A;  4NQ0 A;  4DX5 D;  4FP7 A;  3WG7 E;  1HF8 A;  1XQH A;  4DI4 A;  1FT1 A;  4NIK A;  2M63 A;  3FTW A;  4CGV A;  1FT2 A;  4JPS A;  3FUD A;  3ZU7 B;  4F6R D;  1NL4 A;  2RD0 A;  4ILG A;  2R5S A;  4YVQ C;  1MYO A;  2I1K A;  4U96 D;  2F8Y A;  1XGW A;  4LG6 A;  3CVW A;  1FPP A;  4XI0 A;  3TG5 A;  3PH0 C;  3LYA A;  5T0K A;  2GW1 A;  1O1T A;  2JLB A;  2C2L A;  5FWQ A;  3CQC B;  1OY3 D;  1INZ A;  4IUL A;  1DVP A;  3JQ1 A;  4P29 A;  3M59 A;  2AW6 A;  4N3B A;  1KZO A;  4O1P A;  3IBE A;  4TUM A;  1ZBP A;  2A5E A;  3AJI A;  4N5Q A;  3L17 A;  3NQP A;  2B6C A;  3HG0 D;  3JCK C;  4J8S A;  1BPO A;  1HFA A;  3B13 A;  2R02 A;  3CVQ A;  3G2U A;  1UJK A;  2CG3 A;  2R03 A;  3RO3 A;  3CK7 A;  3M5A A;  1TR4 A;  4GMJ A;  3LY7 A;  4I1A A;  3V79 K;  4LUN U;  2DCP A;  3ZYL A;  2RFA A;  2BKG A;  3PUJ A;  1DCQ A;  2CFU A;  4GPM A;  3DPY A;  4HI9 A;  5AJD A;  2E0I A;  2VSY A;  4GTM A;  4OVV A;  4FAD A;  3CSF A;  3MV2 B;  4LER A;  4BSX A;  5FQ6 A;  2R17 C;  3L82 A;  4YDO A;  4LCT A;  4EZK A;  1TN8 A;  4B8A A;  2L9B A;  3EP0 A;  3Q73 A;  3CVP A;  3QDN A;  2KC7 A;  1EYH A;  3PZ1 A;  4RLY A;  3UM2 A;  3ZKJ A;  3U64 A;  2F8X K;  1TN6 A;  2CHX A;  1HZ4 A;  5B3S E;  3CBM A;  4I51 A;  2A5U A;  2FI7 A;  5CMY A;  3V2X A;  3AU4 A;  4OAV B;  4RVB A;  2XS8 A;  3ONL A;  2X6F A;  4XKB A;  4GZC A;  4DX2 A;  2G46 A;  3G2W A;  5EG2 A;  4N2S A;  3EHN A;  4JA9 A;  1QQE A;  1PY1 A;  3SZ7 A;  3MO2 A;  3CHM A;  5JJ7 A;  2X38 A; 
#chains in the Genus database with same CATH homology
 3PE4 A;  4ACL A;  2AVP A;  3D9L A;  1MT6 A;  3PEU B;  3FUL A;  1OWO A;  3D9I A;  4UWK A;  4XI9 A;  1LF8 A;  2JV0 A;  1H6K A;  3FUM A;  3MEK A;  3CGH A;  1TJC A;  2WB2 A;  4E6H A;  5G04 J;  4TRQ A;  3VTX A;  2QFC A;  1B89 A;  4KZC A;  1NA0 A;  4GAA A;  1S0P A;  3IEG A;  2VGX A;  3FTS A;  3MV3 B;  4MLP A;  4BT8 A;  4HOT A;  1O9S A;  2MHK A;  2LAI A;  2J49 A;  2VSO E;  3LVQ E;  3ML9 A;  3CHO A;  2YIN A;  5F5E A;  1JWG A;  3U9W A;  1OWP A;  4U0Z A;  5EX0 A;  4F1S A;  2X3M A;  3OAW A;  4JEH A;  1H2V C;  4UQY A;  3CKC A;  4AXH A;  1FVH A;  3CIA A;  2C0L A;  4IN3 B;  4KT6 B;  1KT1 A;  2LSU A;  3S2A A;  4XX5 A;  3KMT A;  2RG8 A;  2P58 C;  2KZT B;  3MZL B;  3FEX A;  2XGO A;  3GYZ A;  3FUH A;  3UT8 A;  1A17 A;  1GW6 A;  3GZ2 A;  5C2Y A;  4KVO A;  4HXI A;  4YND A;  2CHZ A;  3SI5 A;  4AEZ C;  3LS8 A;  4Y6W A;  3IKO B;  2I9C A;  4YVO A;  4JL0 A;  4IJ8 A;  2KM4 A;  3Q47 B;  3FY4 A;  3PS6 A;  1HE8 A;  4QEN A;  1KT0 A;  1Y8M A;  2HR2 A;  2PZI A;  2XPZ A;  4MKT A;  3ZXS A;  5LCW J;  2XRZ A;  2WXH A;  4Y6C A;  2UY1 B;  2AXZ A;  3LPZ A;  3SNX A;  3MKQ B;  1HH8 A;  1X5B A;  3KMA A;  4GYO A;  1E90 A;  2OVF A;  4BT9 A;  4UI9 J;  3FHE A;  4I6E A;  4URK A;  5J90 A;  2WPV A;  3HYM B;  3RRM B;  3CBO A;  4WNG A;  3MCX A;  4GA0 A;  4GZ6 A;  2AWI A;  4Q94 A;  5D0Q D;  4KYO B;  2PM7 A;  2A4Z A;  4L1B A;  5ANR A;  4EPZ A;  3D9K A;  1ML9 A;  5FT9 A;  3FFL A;  1PC2 A;  4WWN A;  4NUR A;  2XEV A;  3BEE A;  2V4L A;  3D9J A;  3FP3 A;  3ZHE B;  5T8I A;  5JHN A;  5CMW A;  3S7J A;  2NC9 A;  1L5J A;  4BFR A;  4TV3 A;  3ZGQ A;  4BWR A;  5F6K C;  3LCA A;  3QWV A;  4AOF A;  2RFI A;  5TEG A;  2LSV A;  3FTY A;  3UX4 A;  2F69 A;  1HG5 A;  2WXI A;  4PS8 A;  4JDS A;  5LFA A;  5G55 A;  4GZ3 A;  3RRU A;  1Z3X A;  2DBA A;  2IGQ A;  4FJZ A;  2AXU A;  4M3O A;  2NSZ A;  2L6J A;  3FUI A;  1SZ9 A;  3ESL A;  4G24 A;  4QFV A;  4XKC A;  3KD7 A;  4I43 A;  4CDM A;  4HVB A;  3URZ A;  4AIF A;  4UWF A;  2FF4 A;  3HHM A;  3Q49 B;  3CV0 A;  4C1Q A;  1EDU A;  5FQ4 A;  4BX9 A;  3RJW A;  5JIN A;  3FTU A;  4MI0 A;  4PH4 B;  1UW4 B;  4CEM A;  2I1J A;  1H2T C;  4I6J A;  3IHY A;  3DAL A;  5JHB A;  4JVS A;  3FWV A;  1U3D A;  3SWC A;  1ELR A;  3SF4 A;  4HFG A;  1E96 B;  4N2Q A;  3GZ1 A;  5KJK A;  3FUF A;  4G23 A;  4AY6 A;  5KJL A;  2IQC A;  3ML8 A;  5JJ6 A;  3Q5M A;  4A1S A;  3CR3 A;  5LSX A;  4LRZ A;  2PL2 A;  2XPY A;  3LJ3 A;  4GCN A;  4PDX A;  1IHG A;  4ANU A;  3FPD A;  4LDG A;  1E8Z A;  3L6A A;  3NZU A;  1JUQ A;  4V3I A;  3SD5 A;  4YPE A;  2FBN A;  5JJT A;  3UUX A;  3VLF A;  3M56 A;  3TAX A;  5ARG A;  4GPK A;  4NVQ A;  5T4Y A;  3SW9 A;  3PRE A;  4G1T A;  3T5X A;  4ANX A;  4U0S A;  5HQ8 A;  4JHR A;  3PUK A;  3FUN A;  4DLO A;  4B89 A;  3FH8 A;  4U63 A;  3LXU X;  4H7X A;  4Q69 A;  3Q15 A;  5BW8 C;  1HS6 A;  3QJZ A;  4OYS A;  4GZD A;  3F9W A;  3BG0 B;  2R59 A;  1EF1 C;  1Z3Y A;  3RKV A;  4CGW A;  3I4R B;  2IJG X;  4O30 A;  4H12 A;  3VLE A;  2VGY A;  2VYI A;  1E7V A;  2UWJ G;  4FMU A;  2QY7 A;  3QKY A;  1SZA A;  4UWG A;  3IHX A;  3ASD A;  4U0U A;  5G05 C;  3ZN3 A;  3R7Q A;  3VUZ A;  1HXI A;  2HO1 A;  4AM9 A;  4EQF A;  5ANL A;  4A3V A;  5FQ7 A;  2XGS A;  3LEW A;  4HOS A;  3DPD A;  3AS4 A;  3CK9 A;  4ATG A;  4PS3 A;  2WVI A;  1IQR A;  3OXG A;  4WWP A;  3T8M A;  3MA5 A;  3FUJ A;  3LVR E;  5BV1 A;  5BUZ A;  3RRN B;  5LSZ A;  3KMJ A;  3ASH A;  3UQ3 A;  1UN8 A;  2J4B A;  3B7S A;  4GCO A;  4UQZ A;  5LCW C;  4GA2 A;  3PRZ A;  3MO5 A;  1ELW A;  5ENN A;  1MHQ A;  2WXQ A;  4GYY A;  4ANV A;  4I2Z A;  4APO A;  2VTB A;  1WM5 A;  2W5Y A;  3L54 A;  4DPR A;  4L2L A;  3K5K A;  2J08 A;  3NZS A;  4JHK A;  3M55 A;  2VSX E;  3LY8 A;  2Y4T A;  4PUC A;  2BUG A;  1DNP A;  4IJD A;  3I5P A;  3D3M A;  3G2V A;  3UMV A;  3L16 A;  5DBK A;  2VSN A;  4I9E A;  3TL5 A;  3CVV A;  3DBS A;  2WQ6 A;  4YPU A;  3SBS A;  2XQ0 A;  3CVY A;  1OWN A;  3ZIM A;  2AXV A;  4LEU A;  1E7U A;  2WXF A;  3PEV B;  3M58 A;  3KEZ A;  3QAR A;  3CVN A;  3CHR A;  2XCC A;  3Q4A B;  2I2O A;  2FUL A;  3JQ0 A;  2WXN A;  5CCM A;  2VQ2 A;  3FUK A;  2Y3A A;  2XHE A;  3IHV A;  3VTY A;  3D9N A;  3L13 A;  3ZYK A;  3U66 A;  3BO5 A;  3VV0 A;  5G04 C;  3QOU A;  3P1U A;  2KCK A;  1VDY A;  3C98 A;  4K0R A;  4HOR A;  3RIB A;  2WXR A;  4NJ5 A;  5AIJ A;  1UN9 A;  5BNW A;  4IRU A;  4BTB A;  5EDS A;  4XZ4 A;  1WY6 A;  3FTX A;  3MKQ A;  4GA1 A;  3ZFW A;  1H2U A;  4J83 A;  3GZS A;  3B7T A;  5EX3 A;  2LNI A;  4RG9 A;  3OTN A;  1NA3 A;  2WXM A;  3NF1 A;  3N71 A;  4DK5 A;  3FU3 A;  3RJV A;  2VTB B;  1KLX A;  2LAH A;  3M53 A;  4UI9 K;  2WXK A;  5F59 A;  1PAQ A;  1EPU A;  3SFZ A;  5KCM A;  3DB5 A;  4MI5 A;  3AS8 A;  2X6H A;  2WXO A;  2XPI A;  3D9M A;  4UWL A;  3ZRH A;  2WXL A;  4JHJ A;  3ENE A;  3TG4 A;  3WXX A;  2WMO A;  1QNF A;  2GGF A;  1E8Y A;  2YHE A;  1HG2 A;  4J8F A;  3S7F A;  1W3B A;  1PEG A;  4AV7 A;  3CBP A;  5F6L A;  1P5Q A;  5JHA A;  3FTV A;  3ZVV A;  2GRL A;  3FUE A;  2EQX A;  2KCL A;  1SQM A;  2CG2 A;  2L0I A;  3KS2 A;  3M54 A;  4B94 A;  4K03 A;  1OUV A;  1FVF A;  3D9P A;  5KJN A;  2V8S E;  3SBT B;  1TEZ A;  2CFZ A;  3QWW A;  3KAE A;  3FU5 A;  2YNQ A;  1OWM A;  1TJF A;  3JYS A;  3OXL A;  4G25 A;  4EEC A;  4U04 A;  3ULQ A;  3LDZ A;  3ZPJ A;  4H7Y A;  3HNA A;  4PS7 A;  4B0Z A;  3L08 A;  3FDH A;  4YNP A;  4ILI A;  4WNE A;  2X6I A;  5AJL A;  4I2W A;  4NQ0 A;  2KZT A;  2FO7 A;  3MYV A;  4FP7 A;  2ION A;  1HF8 A;  3CVL A;  1XQH A;  5BT1 A;  4RSY A;  4DI4 A;  3CST A;  4JZY A;  3AU5 A;  3ESK A;  3HIZ A;  2IU1 A;  4I1O B;  5CPR B;  3I4G A;  3OXF A;  1UG3 A;  4FC8 A;  2M63 A;  2VGX B;  5AYW D;  4MS6 A;  3TXN A;  3PVL A;  5FJY A;  3FTW A;  4ACK A;  1XNF A;  2PQN A;  4CGV A;  2UY1 A;  1MQS A;  2I6H A;  4JPS A;  1N6A A;  2WXG A;  4GYW A;  4W9R A;  4JW1 A;  3FUD A;  4C0E A;  4AU7 A;  2VJ8 A;  3I3N A;  4J8D A;  4WNF A;  2PQR A;  2RD0 A;  4YVQ C;  4ILG A;  2R5S A;  4HLE A;  3TGO A;  4BY6 A;  2NXP A;  3M57 A;  2I1K A;  2IOL A;  4DJA A;  3UT7 A;  3G2T A;  5EKQ D;  1XGW A;  3LY9 A;  3CVW A;  5FQ8 A;  4NRH B;  5CHE E;  1HU3 A;  4WWO A;  4XI0 A;  3TG5 A;  4QEP A;  3PH0 C;  3UT4 A;  5DIZ A;  4BUP A;  3MX3 A;  3LYA A;  5T0K A;  2GW1 A;  1NZN A;  4EZJ A;  4GU5 A;  5AYF A;  2JLB A;  2C2L A;  5FWQ A;  3ZHE A;  3CQC B;  4DI3 A;  3RQ4 A;  3PE3 A;  1INZ A;  4YPA A;  4IUL A;  1DVP A;  3OPE A;  3JQ1 A;  3F9Z A;  4P29 A;  5M72 A;  5LX8 A;  3M59 A;  3SGH A;  2AW6 A;  3B7R L;  3HVE B;  4BTA A;  3ASG A;  4N3B A;  2WXJ A;  2IFU A;  3CHP A;  5AEN A;  2R3A A;  4FJY A;  3IBE A;  4JLG A;  4EZL A;  3AS5 A;  1MUF A;  2BF0 X;  5KJM A;  2XCB A;  5G05 J;  1ZBP A;  4KBQ A;  3E4B A;  5FZQ A;  4AVX A;  3L17 A;  3MO0 A;  2JEK A;  1N54 A;  2HYZ A;  3NQP A;  4CRW A;  3JCK C;  4J8S A;  4N3A A;  1N6C A;  4A3T A;  4C9B B;  3QB2 A;  4C0M A;  3R7R A;  2E2E A;  1BPO A;  2IF4 A;  1HFA A;  2J9Q A;  3B13 A;  1ZU2 A;  3APC A;  4FLH A;  3CVQ A;  2O8J A;  4OVU A;  3G2U A;  3ZYM A;  3D9O A;  3F9Y A;  1UJK A;  2J07 A;  2WXP A;  2Y4U A;  2CG3 A;  4CT4 A;  3O48 A;  3CVU A;  4G2V A;  4WAF A;  1OWL A;  1JPL A;  3G2S A;  2Q7F A;  4DLQ A;  2X6J A;  3ZYQ A;  3RO3 A;  3CK7 A;  3CQG B;  3RAY A;  2WMN A;  3M5A A;  2XGM A;  5T3R A;  1UJJ A;  1MVX A;  3QWP A;  4GMJ A;  5LOZ A;  3JUI A;  5JJ0 A;  3LY7 A;  5FZR A;  2QPW A;  5T0M A;  2YHC A;  4O6F A;  4J8E A;  4RG6 A;  4R7L A;  1MVH A;  3FTZ A;  4FUL A;  5ARF A;  3S8P A;  4I1A A;  4CDN A;  3ONK A;  2WQ7 A;  2LO6 A;  5G2N A;  3FH7 A;  4LUN U;  2DCP A;  2DIW A;  3CLJ A;  3ZYL A;  2YQ8 A;  4RZ0 A;  1QZ2 A;  4FLB A;  1H19 A;  3PUJ A;  3EDT B;  3S7D A;  4AP2 A;  2WM9 A;  4J8O A;  4G26 A;  4AJW A;  2ILR A;  3K9I A;  4HOU A;  3PNL B;  5FZS A;  2CFU A;  3T5V A;  1HX8 A;  4F7A A;  1H0A A;  5BV0 A;  4UWH A;  5AJD A;  4AY5 A;  3BG1 B;  2E0I A;  2VSY A;  3QAQ A;  4WUY A;  3RO2 A;  4L7T A;  4TUU A;  5FTP A;  4YNM A;  1Y6I A;  2J4D A;  4OVV A;  4WND A;  1IYG A;  4NAC A;  4U07 A;  3QK0 A;  5LP0 A;  3APF A;  4FAD A;  1H3I A;  1ELK A;  4Z4P A;  3FU6 A;  4CT0 A;  4I17 A;  3R9A B;  3CSF A;  5D0O D;  3MV2 B;  4LER A;  4KZ0 A;  4L23 A;  5BPP A;  2L0T B;  2V5F A;  4FHJ A;  4N39 A;  4BSX A;  5FQ6 A;  2KAT A;  4Q96 A;  4EBA G;  3U3W A;  3HDX A;  2R17 C;  5A23 A;  2X6K A;  2HM8 A;  4J6I A;  4N3C A;  4N5C A;  4UI9 C;  2WQH A;  4MRU A;  3F9X A;  3EHM A;  3RU0 A;  3UPV A;  4XE0 A;  2W5Z A;  4LCT A;  3PDN A;  3OOI A;  2C0M A;  4EZK A;  2FEZ A;  3L22 A;  4GZ5 A;  1N52 A;  3CHS A;  1E8X A;  4B8A A;  2L9B A;  3EP0 A;  4CDR A;  4FU3 A;  1JWF A;  3CVP A;  1ZKK A;  3QDN A;  2KC7 A;  4IYP A;  3MGB A;  1EYH A;  3U4T A;  4ABN A;  5A7D B;  3FH5 A;  3S7B A;  3HVE A;  3IV0 A;  3PZD A;  4HOQ A;  3U64 A;  1N3J A;  4L2Y A;  3RK6 A;  3EIJ A;  2OND A;  3APD A;  4JEU A;  4F53 A;  2XRY A;  5C1D A;  2CHX A;  4KXK B;  3QC1 A;  3CK8 A;  1HZ4 A;  2J09 A;  4QEO A;  4E85 A;  2PM6 A;  4J7I A;  4FHK A;  5JIY A;  2OOE A;  4D10 C;  3CBM A;  4I51 A;  2OV8 A;  2A5U A;  2FI7 A;  4KVM A;  5E75 A;  4ME2 A;  4F3V A;  5CMY A;  3VLD A;  3LKU A;  4JXT A;  5E76 A;  3TJP A;  3EJN A;  2BQZ A;  4J0U A;  3P2B A;  2IOS A;  3CHQ A;  3O4Z A;  1HO8 A;  4GML A;  4JC8 A;  2ZU6 B;  4B8C B;  5CCL A;  5TTF A;  3AU4 A;  4CCA A;  3CEQ A;  4RVB A;  2BTD A;  3EIQ C;  3ZEF A;  1WAO 1;  4I9C A;  3MJW A;  3QNK A;  3ONL A;  2X6F A;  5T5G A;  1Z6T A;  4XKB A;  3PNT B;  5A6C A;  4GZC A;  4U8H A;  5TH7 A;  2G46 A;  4ILH B;  3B7U X;  1YA0 A;  3G2W A;  3ASF A;  4HS2 A;  5EG2 A;  3FEY A;  1U3C A;  1NP7 A;  4UQX A;  4N2S A;  3EHN A;  3MKR A;  3ZW3 A;  2CHW A;  2OVB A;  4G11 A;  4KMO A;  2V0P A;  2MOW A;  2KCV A;  4I6G A;  4J7F A;  3SHF A;  2MRI A;  4JA9 A;  5HI7 A;  4A1G A;  4BX8 A;  1QQE A;  4GB9 A;  3OS5 A;  3CVX A;  1PY1 A;  3SZ7 A;  3MO2 A;  3GW4 A;  3CHM A;  4XIF A;  1IQU A;  3TXM A;  4EBA A;  5J08 A;  4I1M A;  4E47 A;  5JJ7 A;  3CKB A;  1E8W A;  4APF A;  4A55 A;  4JA7 A;  4FA6 A;  3FU0 A;  4ANW A;  2X38 A;  1FCH A;  2GRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...