3TG5A

Structure of smyd2 in complex with p53 and sah
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
425
structure length
425
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human SMYD2 reveals the basis of p53 tumor suppressor methylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-lysine methyltransferase SMYD2
total genus 137
structure length 425
sequence length 425
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3tg5A03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3tg5A01
3RO2A 4H7YA 4CGWA 4AY6A 1MT6A 2V5FA 5DIZA 4XI9A 4YVQC 2O8JA 4YPUA 4G24A 2G46A 4O6FA 3UUXA 2OOEA 5G05C 3U4TA 3SWCA 2I6HA 3AS5A 3LKUA 5T0MA 5JJ0A 3Q5MA 4GA0A 3MO5A 5DBKA 2HR2A 1NZNA 4WNFA 5EG2A 3ZHEA 2C0MA 4N3BA 3ASHA 2E2EA 3R9AB 1NA0A 4GYYA 1N6AA 3S8PA 5JJTA 4GYWA 2VSNA 3ZFWA 5M72A 4BTAA 3QOUA 5LCWJ 2PL2A 3TAXA 2GW1A 5AYFA 3OS5A 3VTXA 5D0OD 5FZRA 3MV3B 3PE3A 3QWPA 4JDSA 3OOIA 2AVPA 3M57A 4Y6WA 1A17A 4UI9C 3M59A 3ZHEB 4IN3B 2JLBA 2FEZA 4N2QA 2VGYA 5A7DB 2R5SA 4KYOB 5JIYA 2YQ8A 2KATA 1QZ2A 4YPAA 5JJ6A 3AS8A 3TGOA 3KMJA 1XNFA 3HNAA 4NJ5A 4APOA 3BEEA 3Q47B 2NC9A 3RQ4A 5KJNA 4ABNA 4I2ZA 4N3AA 4J8DA 5FZSA 4N3CA 4AU7A 1NA3A 3Q49B 2RFIA 4JL0A 3S7DA 1MVHA 3KS2A 1TJCA 1E96B 1N6CA 3CK8A 3S7FA 5FT9A 4WUYA 3ASGA 3LYAA 4CDRA 4G23A 2UWJG 5C1DA 4I51A 2HYZA 3CBPA 3M58A 5A6CA 4I9CA 4BTBA 2FO7A 4U07A 5T5GA 4NQ0A 3CK7A 3F9WA 2UY1A 3CK9A 3DB5A 2VGXB 4I2WA 5KJMA 3VUZA 3VV0A 3F9XA 4GZ3A 4LEUA 1HXIA 1IHGA 2Y4TA 2BQZA 4MI0A 2QFCA 2Y4UA 3LY9A 2WPVA 3K9IA 2VYIA 5TEGA 3ASDA 5TTFA 5CPRB 3U3WA 2DBAA 4FMUA 4QEPA 3Q15A 3S7BA 5TH7A 4IJDA 4UQZA 2BUGA 1PEGA 2XPIA 3GW4A 4IJ8A 3NF1A 4YNPA 4KXKB 4JA9A 4AY5A 4GZ5A 4YNDA 3E4BA 4BT9A 5EX3A 3TG5A 4J8OA 3IEGA 4I1AA 5FTPA 5LSZA 4J83A 3ASFA 4J8EA 4BT8A 5JINA 2PQRA 2Q7FA 4AIFA 2XGSA 4WNEA 4WNGA 3RAYA 1ELRA 2VQ2A 4NVQA 2PQNA 5F6KC 3URZA 3ULQA 3UQ3A 3QWWA 2R3AA 5HI7A 4HOUA 2XGOA 1HZ4A 3ZN3A 1ZKKA 3EDTB 4UI9J 4QEOA 3CVQA 2IF4A 2FF4A 4I17A 4GCNA 3SZ7A 4B94A 2ONDA 3GYZA 3OXLA 3ZPJA 4EQFA 3RO3A 3RKVA 3WXXA 3M55A 5F6LA 5CCLA 5BW8C 3FWVA 2FBNA 3KAEA 1PC2A 3N71A 2P58C 4HOTA 5FZQA 3PE4A 3CVNA 4BUPA 2C2LA 4U0ZA 1ZBPA 2LSVA 3MA5A 4W9RA 1B89A 4KBQA 3FPDA 3MKRA 3MO0A 3M56A 1WAO1 3M5AA 3LCAA 5G04C 3JYSA 2QPWA 3S7JA 1HH8A 3AS4A 3SF4A 4XI0A 4LDGA 4E47A 4GPKA 3QKYA 3LY7A 1N3JA 3QDNA 3CKBA 4HOSA 3KD7A 5G04J 1OUVA 4JHRA 3SW9A 2VSYA 5JJ7A 1ELWA 3GZ2A 3IHXA 3ESKA 2XCCA 3M54A 3KMTA 3RJWA 2J9QA 4JLGA 1QQEA 4A1SA 2KCLA 1Y8MA 3RU0A 2FI7A 5F5EA 1KT1A 3CEQA 2XGMA 4ME2A 4RG9A 3QWVA 5KJKA 5D0QD 5CHEE 3F9ZA 5T0KA 4H12A 4AM9A 4RZ0A 3OXGA 5ARGA 4U0SA 2IFUA 3VTYA 2JV0A 3FFLA 3OPEA 4N39A 4F3VA 4NRHB 3CVPA 3Q4AB 3MO2A 4J7IA 1MVXA 4J0UA 5LSXA 4YVOA 3K5KA 2F69A 1FCHA 1ML9A 4HOQA 4BWRA 2LNIA 3PDNA 5JHNA 1H3IA 5LCWC 4U04A 5ARFA 4GCOA 4UI9K 3O48A 1XQHA 4QENA 5BNWA 4RG6A 3UPVA 1P5QA 3M53A 4G2VA 5EX0A 4I9EA 3KMAA 2YHCA 1KT0A 2MHKA 4O30A 5BT1A 4MI5A 2IGQA 3MV2B 3HYMB 1ZU2A 3CKCA 3FP3A 5AYWD 2LSUA 2UY1B 3MEKA 2W5YA 4J7FA 1MUFA 3RJVA 4GYOA 4C1QA 1O9SA 2HO1A 3OXFA 1W3BA 3CVLA 2W5ZA 1YA0A 1KLXA 4U0UA 5EKQD 4GZ6A 4JA7A 4HORA 4N5CA 3F9YA 4GA2A 2KC7A 3CBMA 3LPZA 4G25A 4G26A 2L6JA 3ZGQA 4Z4PA 4N2SA 2XEVA 4XIFA 3CV0A 4UQXA 5KJLA 1IYGA 4YPEA 2VGXA 5FJYA 2C0LA 3LY8A 5F59A 2KCVA 4GA1A 2KCKA 3BO5A 4CGVA 4Y6CA 4J8FA 1WM5A 3CBOA 2PZIA 3GZ1A 3EP0A 2WQHA 5HQ8A 4G1TA 4UQYA 4WNDA 3TG4A 4H7XA 4YNMA 2XCBA 5CCMA 5G05J 3RIBA 3DALA
chains in the Genus database with same CATH superfamily
4CGWA 3ZU7B 1MZCA 4LNBA 2L0TB 2XHEA 4YVQC 4GMJA 3TWQA 5BV0A 4U95D 2OOEA 3EIJA 4KVMA 2RD0A 3B7SA 5BXOA 2Y3AA 1ZB1A 3D9NA 3TXNA 3LKUA 3UIPC 2XQ0A 5JJ0A 4DRXE 3FUKA 4GA0A 3DSTA 2KZTA 5B1BE 3I4RB 3MO5A 2AXZA 4WNFA 3R9AB 4LNUD 3S8PA 2EINE 5KWDA 2VSNA 4BTAA 1HE8A 3QOUA 3TXMA 5LCWJ 2PL2A 3DSVA 4U96D 3TAXA 2GW1A 4AVXA 3FEYA 3C72A 2OCCE 3P1UA 3HDXA 2CHZA 2BTDA 4JDSA 5EIBE 2LAHA 3M57A 1UN9A 3T5VA 4FULA 1FT2A 4CT0A 2NYJA 3PZ1A 5AAOA 3Q79A 3U9WA 3FUEA 4ILGA 1QZ2A 4YPAA 2ZXWE 3KMJA 3HNAA 4NJ5A 3OAWA 1D9SA 2V0PA 3ZUVB 1SVXA 4ATZD 1Z6TA 3CIAA 4N3AA 2BEDA 1FPPA 3SBTB 4JL0A 2DZOA 3MJWA 2RFIA 3KS2A 3CK8A 4OVUA 3AG1E 3AJIA 4YDWA 3ASGA 5G55A 2IY0C 4I51A 1YMPA 5BV1A 2PM7A 2M63A 2WXLA 4F1SA 4JHKA 1N95A 4L1BA 4BTBA 4U07A 2GRRB 4ACKA 3FEXA 1HO8A 1TN7A 1K1BA 4NQ0A 4CDNA 3JQ0A 3F9WA 2UY1A 2KBXA 4GTTA 3V30A 4A55A 3DB5A 1N11A 2R05A 3ONKA 4F53A 2Y4TA 3FTUA 2DYRE 4MI0A 3G2SA 5CBOA 2WPVA 1JPLA 3WG7E 1H2VC 1U3DA 2VYIA 3RRNB 3UM3A 1MYOA 3ASDA 5TTFA 5FIOA 3APDA 3U3WA 4UWKA 3TWWA 2KZTB 3DPDA 4FMUA 4IJDA 3SFXA 5CRVA 1JWFA 5ANLA 4JA9A 3DEOA 3QAQA 4PS3A 4WWNA 3D9LA 3DSSA 4JEUA 3PUKA 4J8OA 4I6GA 4I1AA 3LJ3A 5A23A 2ZISA 3DSWA 4EZJA 4G8KA 3L82A 2X6KA 4WNEA 2VQ2A 3ABME 2PQNA 5F6KC 1UJKA 2XZDG 3UQ3A 3QWWA 4L9PA 4GTRA 4FJYA 4DJAA 4U7EB 3ZN3A 3EDTB 4UI9J 4KT6B 3CVQA 3DWLG 3FHEA 1IHBA 4KMOA 3SBSA 2ONDA 3U64A 2CHWA 4EQFA 3RO3A 2P9SG 2MRIA 4B93B 4L23A 2P9LG 3N71A 4LG6A 3PE4A 2I2OA 2OEWA 1ZBPA 3L16A 4CCAA 2LSVA 3MKRA 1K3ZD 3M56A 3MO0A 3JQ1A 1BU9A 1HH8A 3SF4A 3KEZA 3UM1A 5KNHD 4E47A 5H7PA 3DXMG 1FVHA 5ENOD 1SA4A 3LY7A 3KD7A 5ENTD 4JHRA 3J5PA 2VSYA 1O5MA 3ZEFA 1O1RA 3HHMA 3ASOE 4CT4A 2L0IA 2OVFA 2H6GA 4JLGA 1QQEA 3ENEA 4FADA 3UM0A 3HXEA 2FI7A 5E75A 4BSXA 5AJDA 2P9PG 5D0QD 5T0KA 2P9IG 1O1SA 4AM9A 3JUIA 1OCRE 1UG3A 3FFLA 3IHVA 5CMWA 3KSLA 4QQIA 2OVBA 3FH8A 3HVEB 4A63B 3E34A 5JMND 4HOQA 1H3IA 3DSXA 1JWGA 1E90A 3SY2A 1XQHA 4QENA 2WXRA 2XRYA 4G2VA 2H6FA 4DX7D 4J6IA 3UT7A 3KMAA 4YDOA 4ANUA 4P29A 2MHKA 1NP7A 3UIOC 1LD8A 2DYSE 3MX3A 5BT1A 4MI5A 4M7CA 3HYMB 2UY1B 2W5YA 1MUFA 4K5BA 2VJ8A 2P9NG 2RKKA 3TJPA 3EUVA 3OXFA 1W3BA 3Q9NC 2LXMA 3ZYMA 1YA0A 4U0UA 3FUJA 5EKQD 1N4RA 2XENA 2YNQA 3HXCA 4GA2A 5J90A 2NSZA 3LPZA 1EDUA 3V31A 2H6IA 4M3OA 4Z4PA 4DX5D 2XEVA 3LY8A 2ZU6B 2XEEA 5F59A 1QBQA 3S2AA 3BU8A 4HLLA 3I5PA 1WM5A 2ETCA 3CBOA 2PZIA 5ENSD 3EP0A 3ML9A 1INZA 2A4ZA 3CGHA 4UQYA 3O4ZA 4H7XA 3EU9A 4YNMA 1U2VG 2WXJA 2QZAA 5D66A 5CEAA 3NQPA 4TV3A 2IJGX 3PEUB 4HB5A 3RO2A 2ILRA 4AY6A 1MT6A 4EECA 4L2YA 4XI9A 2O8JA 4YPUA 4G24A 2G46A 4O6FA 4Q96A 3ZXSA 3UUXA 1DCQA 2IEJA 5T3RA 4GMLA 2WMNA 5T0MA 2B6CA 3G2TA 3D9OA 3ZHEA 2KXPC 3R7RA 4ANXA 4GYYA 5JJTA 4KZ0A 1VDYA 4GYWA 3ZFWA 3PUJA 4BETA 5D2MC 2QYJA 5BXUA 2KM4A 5AYFA 2EQXA 3PRZA 3FU0A 3PZ3A 3QWPA 5CMYA 1HX8A 1HG5A 2ZGDA 1Q2ZA 4WAFA 3ZHEB 2X6JA 2FEZA 1X5BA 2GRQB 1N94A 1OWLA 5JJ6A 3B7TA 2IQCA 4APOA 1HU3A 1UW4B 3DRAA 3SI5A 4C48B 1DC2A 2DVWA 3Q49B 3QC1A 5AN8A 3S7DA 3D9MA 1RZ4A 4A3VA 3VLDA 3ULYA 3MZLB 1S70B 4WWOA 5FT9A 1TR4A 1OWOA 2GRLA 4I1MA 4XKCA 4AXHA 4B8AA 2HYZA 3E32A 3M58A 4HNAD 4I6JA 2FO7A 4BEPA 4F7AA 3ZNGA 3IHYA 4U8YD 3CK9A 3VUZA 2VGXB 3VV0A 4PDXA 4GZ3A 3APCA 4FLBA 1HXIA 1IHGA 4DK5A 2BQZA 4RVBA 3LY9A 3K9IA 3CQCB 3NAWA 5CRUA 3EHQA 2XPZA 5CPRB 4DPRA 1YCSB 2EIJE 4QEPA 4LSZE 2AWIA 1PEGA 2P9KG 3Q7FA 4I6EA 3PEVB 5FQ4A 4YNPA 2RFMA 4KXKB 1Z5SC 1IQUA 3DBSA 4AY5A 3OTNA 3ZW3A 4XKBA 4RQIA 1OWNA 3I4GA 2JABA 3TG5A 5LP0A 4IYPA 3TL5A 1IKND 5BUZA 5FTPA 3EU5A 1MX6A 3T5XA 5JINA 2PQRA 2L9BA 4C9BB 4WNGA 3RAYA 3T8MA 1H2TC 1JCSA 1FT1A 4C0MA 3URZA 2R3AA 5AIJA 4ACLA 2XGOA 3D9IA 4IULA 2GGFA 4QEOA 2QY7A 5E76A 3BUAA 3MCXA 4B94A 3I3NA 3L08A 2IOLA 3IXEA 1AWCB 3CVXA 1EPUA 2J08A 3M55A 1H2UA 5HKPA 2XZTG 3TWTA 3JXJA 3KAEA 3SD5A 1SA5A 3QJZA 4HOTA 3TWXA 4PS8A 3HRAA 2WXIA 4WWPA 2XPYA 3CVNA 2WXQA 2OV8A 4U0ZA 5ENPD 2WMOA 4FC8A 1BI8B 2Y1LE 4J8YA 3UXGA 3NOGD 3ZIMA 4GPKA 3FDHA 2R03A 3HIZA 1N3JA 5G04J 2X38A 3J5QB 5CERB 2EIME 3T9KA 1SQMA 3IHXA 3KMTA 2X6IA 3FH7A 3MKQB 4PH4B 4GTMA 1Y8MA 2EILE 4JEHA 3UI2A 5F5EA 1KT1A 2RFAA 5CHEE 1TN6A 1N4PA 4U0SA 4L2LA 3VTYA 4HRLA 4J8SA 3FTWA 4NRHB 4CRWA 3AG3E 3MO2A 5LSXA 4YVOA 5C2YA 4B0ZA 1G3NB 2VTBB 2F69A 1FCHA 1ML9A 2LNIA 4Z68A 5EYLA 1TNUA 2WXKA 1OCOE 4UI9K 5BNWA 1KPSB 1UOHA 2PNNA 3HG0D 3M53A 2WXGA 3ZXPA 2J4BA 3W9FA 2IGQA 3MV2B 2XEHA 3CKCA 3FP3A 3ZVVA 5AYWD 3MYVA 3JXIA 4XZ4A 3C5RA 1H6OA 4HQDA 1N4QA 4BY6A 4EBAA 1BI7B 1N54A 3CVLA 2W5ZA 4JD2G 4BX9A 2DCPA 4HORA 4GZ6A 4QFVA 2GRMA 4GTVA 4N5CA 2J8SD 2J07A 3PZ2A 1K1AA 4ATGA 3RK6A 4RLYA 4E6HA 4ANVA 3SGHA 3C3QA 5AENA 4UQXA 3E37A 1JCQA 2RG8A 2KCKA 4DX1A 4CGVA 4MS6A 3DSUA 3UX4A 4J8FA 1WG0A 3PS6A 1FVFA 3ZYLA 2WXHA 3ZYQA 4EZLA 2R17C 4G1TA 5AQ9A 4B89A 2AXVA 3PREA 4DLQA 3DALA 5CEDB 2V5FA 4HI9A 4DUIA 4B8CB 3G2UA 2F0YA 1NFIE 5HS0A 2I6HA 1D8EA 3CVVA 4OAVB 2R2LA 4U63A 3U66A 4FP7A 2HR2A 1H19A 5EG2A 4N3BA 1S63A 2E2EA 1NA0A 1XGWA 5FQ8A 2MOWA 2V4LA 1OWPA 4F6RD 4JXTA 3HXFA 2Y0BG 4DI3A 4LUNU 3ONLA 1Y6IA 3OS5A 3VTXA 5D0OD 1KZOA 4RSYA 5FZRA 1PAQA 1AP7A 5ENNA 4I43A 1YYHA 4J7WA 4O60A 1E7VA 4Q69A 2AVPA 2YHEA 3OOIA 3UT8A 4FHKA 3D9KA 4C0EA 3LDZA 4N5QA 4Y6WA 1A17A 4UI9C 1BPOA 2IONA 3RSEG 4AJWA 3M59A 4CYMD 4IN3B 3IBEA 3FU3A 3QARA 5A7DB 2R5SA 4KYOB 5JIYA 2KATA 1TYQG 3AS8A 3EIQC 3TGOA 3SNXA 3FUDA 3AG2E 3BEEA 3CHPA 3T8KA 1V54E 4HRMB 3W9GA 3RQ4A 5KJNA 1MJ0A 4ABNA 4I2ZA 4J8DA 2MYOA 3D9PA 5FZSA 3QK0A 1UN8A 4K5CA 2XS8A 1NA3A 4CDMA 3R9MA 1MVHA 4FA6A 1TJCA 1E96B 3S7FA 4WUYA 5CBNA 4CDRA 1MHQA 2J09A 4GTPA 2UWJG 3SHFA 4GTQA 3CBPA 4K5AB 3CHQA 5A6CA 2A5EA 4I9CA 4URKA 1Z3YA 1E8YA 3FU5A 5T5GA 3FUNA 3P2BA 4YDEA 4EHMA 2E0IA 5B1AE 3HXBA 4G11A 4LEUA 4A1GA 2I9CA 3NZSA 1LD7A 5TEGA 3B7RL 3ISMC 3CSTA 5ENRD 4O1PA 4TRQA 3S7BA 5TH7A 3L13A 2HM8A 2JEKA 1ELKA 4UQZA 2BUGA 3JCKC 5ENQD 3GW4A 3PH0C 3NF1A 1Z3XA 4FJZA 4GU5A 1OXJA 3SFZA 2VGEA 3FTXA 3FH5A 2DZNA 2AW6A 3ESLA 3IEGA 4XX5A 4J83A 1JUQA 5LFAA 4HI8A 1EYHA 4GMRA 4L7TA 4AIFA 3UMVA 4MKTA 3G2VA 4NVQA 3B95A 2GROB 1JCRA 2LO6A 3ULQA 5KCMA 4O1OA 5HI7A 3SFYA 4HOUA 2X6FA 3DEPA 2GRNB 2QC9A 3PZ4A 5KNGA 4F1PA 4TXPA 2A5UA 1E7UA 2AXUA 4GCNA 3Q9UC 3SZ7A 3ML8A 3FUMA 2WXPA 3OXLA 1HFAA 4LCTA 4HVBA 5F6LA 1WDYA 1S0PA 1S64A 2FBNA 3ZKJA 3Q78A 5LX8A 2P58C 5FZQA 4K03A 5EILA 4UWFA 4BUPA 2C2LA 4GB9A 1N4SA 4HXIA 4LNGA 3VLFA 2IOSA 3MA5A 4W9RA 4FHJA 4I1OB 3M5AA 3S7JA 4ANWA 3AS4A 3TWRA 4BX8A 3QKYA 4Q94A 5J08A 3CVYA 5JJ7A 1ELWA 3ESKA 2IO3C 4APFA 3R7QA 3RJWA 5EDSA 2J9QA 4A1SA 1N0RA 2KCLA 3DPYA 3HXDA 3SO8A 3LJNA 4D10C 4JB8P 5ANRA 3RRUA 4G8LA 2XGMA 3B7BA 4RG9A 3QWVA 1UJJA 2DWZA 4RZ0A 4FLHA 4DX2A 3UKUG 2YINA 4HS2A 2JV0A 3L54A 4N39A 4F3VA 3AG4E 2CFUA 2Y69E 3CVPA 4J7IA 1IXVA 1MVXA 3LEWA 1QYMA 4GAAA 3K5KA 3Q75A 3PDNA 5JHNA 4K0RA 4U04A 3APFA 4AOFA 5EX0A 4I9EA 2DIWA 2CG3A 3C3RA 4HRNA 4ILHB 2YHCA 2GRPB 1EF1C 3AU4A 2X3MA 3ABLE 3BQOA 4IRUA 2LSUA 3MEKA 4J7FA 2ZGGA 3V2OA 4HLEA 3RJVA 4LRZA 1DNPA 5AARA 1K8KG 3VLEA 3F6QA 5JHBA 4PS7A 5ITZF 4TXQA 5JA4D 2BF0X 4MRUA 5BPPA 2WXNA 3F9YA 1TNBA 4G25A 4G26A 3L6AA 2L6JA 3QNKA 3PZDA 1DCEA 4XIFA 5T4YA 4YPEA 2VGXA 5FJYA 2C0LA 3EJNA 4TUUA 5AQ7A 4KZCA 4GA1A 3EHRA 2VSXE 2CFZA 4PUCA 4Y6CA 3CSFA 1H0AA 3TWVA 3UKRG 4JW1A 1N52A 3GZ1A 2WQHA 2QYUA 1A5EA 3UTMA 4TUMA 4WNDA 3TG4A 2CHXA 2XCBA 1OT8A 1LF8A 1NI1A 5EYPF 5G05J 3BG0B 3IV0A 4H7YA 5DIZA 1H6KA 4BSZB 1N9AA 3D9HA 3X2QE 3LXUX 5G2NA 1TNOA 5G05C 3U4TA 3C98A 3SWCA 3B7UX 3AS5A 4AP2A 4JC8A 3Q5MA 4OAUC 5T8IA 5DBKA 3LS8A 1NZNA 3E33A 1HF8A 2C0MA 3ASHA 3LVQE 4GTOA 5AQAA 1N6AA 3PNTB 5HRYA 5M72A 4OYSA 5CECB 1TEZA 2EIKE 3KEAA 1IQRA 3MV3B 3PE3A 2WXOA 1HS6A 4OVVA 3ABKE 3G2WA 2V8SE 2IO2C 2JLBA 4N2QA 3KSQA 2WQ6A 2VGYA 2WB2A 1U3CA 2V5QC 2YQ8A 2P2CP 3IKOB 4NACA 2X6HA 1XNFA 3LVRE 1MX4A 3V79K 3ZRHA 3Q47B 4X8QA 4UWHA 2H6HA 3FU6A 2NC9A 2XS1A 4BFRA 3EHMA 4N3CA 4JZYA 4AU7A 5KBAA 3CR3A 2J49A 3E30A 2WVIA 2I1JA 1N6CA 3FUFA 1OWMA 4V3IA 3LYAA 4G23A 5C1DA 2R59A 3NB2A 4GZDA 1GW6A 3QB2A 3CK7A 3GZSA 4ILIA 4I2WA 5KJMA 3CHRA 3F9XA 1E8XA 1SZ9A 2VTBA 1MX2A 2QFCA 5EN5D 5AJLA 2Y4UA 3D9JA 5FQ6A 3AAAC 3PNLB 4XE0A 2DBAA 5JHAA 3Q15A 3BG1B 4GPMA 1SZAA 2XPIA 5FINA 1HG2A 4IJ8A 5IY5E 1TJFA 3RAUA 4GZ5A 5AQBA 2FO1E 2ETAA 4YNDA 3E4BA 4BT9A 5EX3A 4E85A 1WY6A 3EHNA 3NZUA 3L17A 5LSZA 3ASFA 4J8EA 3JUEA 4YDYA 4BT8A 2WXFA 2Q7FA 1O1TA 2XGSA 2BKKB 1ELRA 4NIKA 3L9TA 4CEMA 2LXLA 2ETBA 4DLOA 1HZ4A 1ZKKA 2I1KA 2J4DA 3FUIA 4UWGA 3FUHA 3CLJA 2IF4A 4DX6D 2FF4A 4I17A 4HBDA 3GYZA 2ZIRA 3ZPJA 2AJAA 1E8WA 3RKVA 3UM2A 3WXXA 4JVSA 3UINC 1PY1A 4TXRA 5CCLA 5BW8C 3FWVA 4CZ2D 4JPSA 1PC2A 1BLXB 1OCCE 4GZCA 1LTXA 4LERA 3HVEA 4XEIG 1B89A 4KBQA 3FPDA 1WAO1 3LCAA 5G04C 3JYSA 4ZHBA 2QPWA 3C3OA 4XI0A 2F37A 4AEZC 4LDGA 2BKGA 2B0OE 3CHMA 3TWSA 3QDNA 3CKBA 4HOSA 1OUVA 1TN8A 3SW9A 3GZ2A 2R02A 3MKQA 2XCCA 3PVLA 3M54A 2LUHA 1OY3D 2IU1A 2WM9A 1L5JA 4DI4A 3ASNE 1H6PA 3RU0A 3FTSA 3CEQA 4FU3A 4HFGA 4ME2A 5KJKA 3F9ZA 2WXMA 4H12A 4R7LA 2FULA 3AU5A 3UT4A 3SQVA 3V2XA 4AV7A 3OXGA 5ARGA 1DVPA 4JHJA 2IFUA 2HE0A 1N0QA 1QNFA 3OPEA 1TNZA 3DXKG 3D3MA 2F8XK 4EPZA 3Q4AB 3FTZA 4J0UA 3FTYA 4EZKA 2F8YA 4BWRA 5LCWC 5ARFA 3FY4A 4GCOA 3O48A 4RG6A 2PM6A 3UPVA 1P5QA 3MGBA 3ZYKA 3CVUA 2XRZA 2VSOE 4KVOA 1KT0A 5FWQA 1V55E 4O30A 4MLPA 4U8VD 4U8HA 1ZU2A 1BD8A 3TWUA 4A3TA 1NL4A 4GTSA 2P9UG 4GYOA 2WQ7A 4C1QA 1O9SA 2HO1A 4MBGA 3CVWA 2V4HC 4NURA 1KLXA 1TNYA 4JA7A 1RW2A 2CG2A 3B13A 3Q7AA 4BESA 1SW6A 2KC7A 3CBMA 3CQGB 3NOCD 3ZGQA 1X81A 2OEVA 4EBAG 4N2SA 5B3SE 4ZFHA 3CV0A 5KJLA 1IYGA 2LAIA 3FTVA 3L22A 2KCVA 3NBNB 1MQSA 3BO5A 3Q73A 1D8DA 5FQ7A 5LOZA 2L6BA 3ULEG 3RRMB 5EIDA 4UUCA 3CHSA 2NXPA 5HQ8A 1OCZE 3FULA 5CCMA 3CHOA 1KZPA 4UWLA 4BERA 1E8ZA 3RIBA
chains in the Genus database with same CATH topology
3IV0A 3RO2A 4H7YA 2ILRA 4CGWA 4AY6A 1MT6A 4EECA 2V5FA 2L0TB 4L2YA 1H6KA 2XHEA 4XI9A 4YVQC 4G24A 5DIZA 2G46A 2O8JA 4GMJA 4O6FA 4YPUA 4B8CB 5BV0A 4Q96A 3ZXSA 3LXUX 5G2NA 3G2UA 3UUXA 2OOEA 3EIJA 4KVMA 3PEUB 5G05C 2RD0A 3C98A 2I6HA 3U4TA 3B7UX 3B7SA 3SWCA 2Y3AA 5T3RA 3AS5A 3CVVA 3D9NA 4GMLA 3TXNA 4JC8A 4AP2A 3LKUA 2WMNA 5T0MA 2XQ0A 4U63A 3U66A 5JJ0A 3FUKA 3Q5MA 3G2TA 4GA0A 2KZTA 4FP7A 3I4RB 3D9OA 5T8IA 3MO5A 5DBKA 2HR2A 3LS8A 1NZNA 2AXZA 4WNFA 1H19A 5EG2A 3ZHEA 1HF8A 2C0MA 3ASHA 3LVQE 4N3BA 3R7RA 2E2EA 3R9AB 1NA0A 1XGWA 5FQ8A 4ANXA 2MOWA 4GYYA 1N6AA 3S8PA 2V4LA 5JJTA 3PNTB 4KZ0A 1VDYA 4GYWA 1OWPA 2VSNA 3ZFWA 4JXTA 3PUJA 5M72A 4BTAA 1HE8A 3QOUA 3TXMA 5LCWJ 4OYSA 2PL2A 3TAXA 2GW1A 4AVXA 3FEYA 2KM4A 4DI3A 4LUNU 3P1UA 3ONLA 1TEZA 3HDXA 2EQXA 5AYFA 1Y6IA 2CHZA 3PRZA 3FU0A 3VTXA 3OS5A 1IQRA 5D0OD 4RSYA 5FZRA 3MV3B 1PAQA 2BTDA 3PE3A 5ENNA 2WXOA 3QWPA 4I43A 4JDSA 1E7VA 1HS6A 4OVVA 2AVPA 2YHEA 2LAHA 4Q69A 3M57A 3UT8A 3OOIA 4FHKA 1HX8A 3D9KA 5CMYA 1UN9A 4C0EA 1HG5A 3T5VA 3LDZA 3G2WA 4Y6WA 2V8SE 1A17A 4UI9C 1BPOA 2IONA 4WAFA 4FULA 4AJWA 3M59A 3ZHEB 2X6JA 4IN3B 2JLBA 2FEZA 3IBEA 1X5BA 4CT0A 2WQ6A 4N2QA 3FU3A 3QARA 2VGYA 5A7DB 2R5SA 2WB2A 4KYOB 1U3CA 3U9WA 5JIYA 3FUEA 2YQ8A 2KATA 4ILGA 1QZ2A 1OWLA 4YPAA 5JJ6A 3IKOB 4NACA 3AS8A 3EIQC 2X6HA 3B7TA 2IQCA 3TGOA 3SNXA 3KMJA 1XNFA 3FUDA 3HNAA 3LVRE 4APOA 4NJ5A 1HU3A 3OAWA 3BEEA 3ZRHA 3Q47B 2V0PA 3CHPA 4UWHA 3FU6A 2NC9A 1UW4B 3RQ4A 4BFRA 5KJNA 4ABNA 1Z6TA 3CIAA 3EHMA 4I2ZA 4N3AA 4J8DA 3SI5A 3D9PA 5FZSA 4N3CA 3QK0A 1UN8A 4JZYA 4AU7A 1NA3A 3Q49B 3QC1A 4CDMA 3SBTB 3CR3A 2J49A 3MJWA 4JL0A 3D9MA 3S7DA 3KS2A 1MVHA 2RFIA 2WVIA 4FA6A 1TJCA 2I1JA 1E96B 1N6CA 3CK8A 3S7FA 4A3VA 4OVUA 3VLDA 3MZLB 3FUFA 1OWMA 4WWOA 5FT9A 4WUYA 3ASGA 4V3IA 5G55A 3LYAA 1OWOA 2GRLA 4CDRA 1MHQA 4I1MA 2J09A 4G23A 2UWJG 5C1DA 4I51A 2R59A 4XKCA 4AXHA 5BV1A 3SHFA 4B8AA 2PM7A 2M63A 2HYZA 3CBPA 2WXLA 3CHQA 4F1SA 3M58A 5A6CA 4I9CA 4I6JA 4JHKA 4URKA 4L1BA 4GZDA 2FO7A 4U07A 4BTBA 4F7AA 1GW6A 3QB2A 3IHYA 1Z3YA 4ACKA 3FEXA 1E8YA 3FU5A 1HO8A 5T5GA 3FUNA 4NQ0A 3CK7A 4CDNA 3JQ0A 3P2BA 3F9WA 2UY1A 3GZSA 4A55A 3CK9A 4ILIA 2VGXB 4I2WA 5KJMA 3DB5A 2E0IA 4PDXA 3VUZA 3VV0A 3CHRA 3ONKA 4F53A 4G11A 3F9XA 4GZ3A 4LEUA 1E8XA 3APCA 4FLBA 1HXIA 1IHGA 2I9CA 4A1GA 2Y4TA 4DK5A 3FTUA 4RVBA 2BQZA 1SZ9A 2VTBA 4MI0A 2QFCA 5AJLA 2Y4UA 3D9JA 3G2SA 3LY9A 3NZSA 5FQ6A 2WPVA 3K9IA 1JPLA 3CQCB 1H2VC 3PNLB 1U3DA 2VYIA 3RRNB 5TEGA 3ASDA 5TTFA 2XPZA 5CPRB 3APDA 3B7RL 4DPRA 4XE0A 3CSTA 3U3WA 4UWKA 2DBAA 2KZTB 5JHAA 3DPDA 4FMUA 4QEPA 3Q15A 4TRQA 3S7BA 5TH7A 3BG1B 4IJDA 3L13A 2HM8A 1ELKA 2JEKA 2AWIA 4UQZA 2BUGA 1PEGA 3JCKC 1SZAA 2XPIA 3GW4A 4I6EA 1HG2A 1JWFA 3NF1A 1Z3XA 3PH0C 4FJZA 4IJ8A 3PEVB 5FQ4A 4YNPA 5ANLA 4KXKB 1TJFA 1IQUA 3DBSA 4JA9A 4AY5A 3QAQA 4GZ5A 4PS3A 4WWNA 4GU5A 3D9LA 3OTNA 3SFZA 3ZW3A 4XKBA 1OWNA 3FTXA 3E4BA 3I4GA 3FH5A 4JEUA 4YNDA 5EX3A 3PUKA 4BT9A 3TG5A 4E85A 5LP0A 4J8OA 4IYPA 1WY6A 4XX5A 2AW6A 3ESLA 3IEGA 3TL5A 4I6GA 3EHNA 4I1AA 5BUZA 3NZUA 3L17A 3LJ3A 5FTPA 4J83A 5LSZA 1JUQA 3ASFA 5LFAA 5A23A 4J8EA 4BT8A 1EYHA 3T5XA 5JINA 4L7TA 4EZJA 2WXFA 2PQRA 2Q7FA 2X6KA 2L9BA 4AIFA 4C9BB 3UMVA 2XGSA 4MKTA 4WNEA 3G2VA 4WNGA 3RAYA 1ELRA 2VQ2A 3T8MA 4NVQA 1H2TC 2PQNA 5F6KC 4C0MA 1UJKA 2LO6A 3URZA 3ULQA 5KCMA 4CEMA 3UQ3A 3QWWA 5AIJA 2R3AA 4ACLA 5HI7A 4HOUA 2XGOA 3D9IA 4DLOA 1HZ4A 4FJYA 3ZN3A 2X6FA 4DJAA 1ZKKA 3EDTB 2I1KA 2J4DA 4IULA 4UI9J 4KT6B 2GGFA 4QEOA 3CVQA 2QY7A 3FHEA 3FUIA 4UWGA 3FUHA 3CLJA 5E76A 2IF4A 3MCXA 2A5UA 2FF4A 4KMOA 1E7UA 2AXUA 4GCNA 3I3NA 3L08A 2ONDA 3ML8A 3FUMA 3GYZA 4I17A 2WXPA 3SBSA 3OXLA 2IOLA 3U64A 3ZPJA 2CHWA 1HFAA 4EQFA 3RO3A 1E8WA 3SZ7A 4LCTA 4HVBA 2MRIA 3RKVA 3WXXA 1EPUA 2J08A 4JVSA 3CVXA 3M55A 5F6LA 1H2UA 4L23A 1PY1A 1S0PA 5CCLA 5BW8C 3FWVA 2FBNA 3KAEA 4JPSA 3SD5A 1PC2A 3N71A 2P58C 3QJZA 5LX8A 4HOTA 4K03A 4PS8A 3PE4A 2I2OA 4UWFA 5FZQA 4GZCA 2WXIA 4WWPA 2XPYA 3CVNA 4LERA 3HVEA 2C2LA 4BUPA 4GB9A 2WXQA 2OV8A 4U0ZA 1ZBPA 4HXIA 3L16A 4CCAA 3VLFA 2IOSA 2LSVA 3MA5A 2WMOA 4W9RA 1B89A 4KBQA 4FC8A 3MKRA 4FHJA 3FPDA 4I1OB 1WAO1 3M56A 3M5AA 3LCAA 5G04C 3MO0A 3JQ1A 3JYSA 2QPWA 3S7JA 4ANWA 1HH8A 3AS4A 3SF4A 3KEZA 4XI0A 4AEZC 4BX8A 4LDGA 4E47A 3ZIMA 4GPKA 1FVHA 3CHMA 3FDHA 3QKYA 4Q94A 3LY7A 5J08A 3HIZA 3QDNA 3CKBA 4B94A 4HOSA 3KD7A 1N3JA 5G04J 1OUVA 5T0KA 3CVYA 4JHRA 2X38A 3SW9A 2VSYA 1SQMA 5JJ7A 1ELWA 3GZ2A 3IHXA 3ESKA 3MKQA 2XCCA 3ZEFA 3HHMA 3PVLA 4CT4A 3M54A 2L0IA 2OVFA 4APFA 2X6IA 3R7QA 3KMTA 3RJWA 5EDSA 2J9QA 3FH7A 4JLGA 3MKQB 4PH4B 1QQEA 2IU1A 2WM9A 4A1SA 1L5JA 3ENEA 4DI4A 4FADA 2KCLA 1Y8MA 3RU0A 4JEHA 4D10C 2FI7A 5F5EA 3FTSA 1KT1A 3CEQA 4FU3A 5E75A 4BSXA 5ANRA 3RRUA 2XGMA 4HFGA 4ME2A 4RG9A 3QWVA 5AJDA 5KJKA 5D0QD 1UJJA 5CHEE 3F9ZA 2WXMA 4H12A 4R7LA 4AM9A 2FULA 3AU5A 3UT4A 4RZ0A 3JUIA 4FLHA 1UG3A 4AV7A 3OXGA 5ARGA 1DVPA 4JHJA 2YINA 4HS2A 4U0SA 2IFUA 4L2LA 3VTYA 2JV0A 1QNFA 3FFLA 3L54A 4J8SA 3OPEA 3FTWA 4N39A 4F3VA 2CFUA 3IHVA 4NRHB 4CRWA 3D3MA 3CVPA 4EPZA 3Q4AB 3MO2A 4J7IA 5CMWA 3LEWA 1MVXA 3FTZA 4J0UA 5LSXA 3FTYA 4GAAA 4YVOA 5C2YA 2OVBA 4B0ZA 3FH8A 3HVEB 4EZKA 3K5KA 2VTBB 2F69A 1FCHA 1ML9A 4HOQA 4BWRA 2LNIA 3PDNA 5JHNA 1H3IA 5LCWC 4K0RA 4U04A 5ARFA 1JWGA 1E90A 2WXKA 3FY4A 4GCOA 4UI9K 3O48A 1XQHA 3APFA 4QENA 5BNWA 4AOFA 4RG6A 2PM6A 3UPVA 2WXRA 1P5QA 2XRYA 3MGBA 3M53A 4G2VA 5EX0A 4I9EA 3ZYKA 2DIWA 3CVUA 2WXGA 2XRZA 2CG3A 4J6IA 3UT7A 2VSOE 4ILHB 3KMAA 2J4BA 4ANUA 4KVOA 2YHCA 1KT0A 4P29A 5FWQA 2MHKA 1NP7A 1EF1C 3AU4A 4O30A 2X3MA 3MX3A 5BT1A 4MI5A 2IGQA 4MLPA 3MV2B 3HYMB 4U8HA 1ZU2A 3CKCA 3FP3A 4IRUA 3ZVVA 5AYWD 2LSUA 2UY1B 3MYVA 4A3TA 3MEKA 2W5YA 4J7FA 4XZ4A 1MUFA 2VJ8A 4HLEA 3RJVA 3TJPA 4BY6A 4GYOA 2WQ7A 4C1QA 1O9SA 2HO1A 4EBAA 3CVWA 3OXFA 1W3BA 1N54A 3CVLA 4LRZA 3ZYMA 3RIBA 2W5ZA 1DNPA 1YA0A 4NURA 1KLXA 4U0UA 4BX9A 2DCPA 3VLEA 4PS7A 3FUJA 5JHBA 5EKQD 4GZ6A 4JA7A 4QFVA 2GRMA 4HORA 2BF0X 3B13A 2CG2A 4MRUA 2YNQA 4N5CA 5BPPA 2J07A 2WXNA 3F9YA 4GA2A 2KC7A 3CBMA 3CQGB 2NSZA 3LPZA 4G25A 4ATGA 4G26A 3RK6A 3L6AA 5J90A 1EDUA 2L6JA 3ZGQA 3QNKA 4M3OA 4Z4PA 4E6HA 4EBAG 4ANVA 3PZDA 3SGHA 4N2SA 5AENA 2XEVA 4XIFA 3CV0A 4UQXA 5T4YA 5KJLA 1IYGA 4YPEA 2VGXA 5FJYA 2C0LA 2LAIA 3LY8A 3FTVA 3L22A 2ZU6B 3EJNA 5F59A 4TUUA 2KCVA 1MQSA 2RG8A 4GA1A 4KZCA 3S2AA 2KCKA 3BO5A 2VSXE 2CFZA 4PUCA 4CGVA 4MS6A 4Y6CA 3CSFA 5FQ7A 5LOZA 3UX4A 1H0AA 3I5PA 4J8FA 1WM5A 3CBOA 3RRMB 4JW1A 1N52A 2PZIA 3GZ1A 3CHSA 3EP0A 3ML9A 2WQHA 2NXPA 1INZA 3PS6A 1FVFA 3ZYLA 5HQ8A 2WXHA 2A4ZA 2R17C 3CGHA 3ZYQA 4G1TA 4UQYA 4WNDA 3TG4A 4EZLA 2CHXA 4B89A 3O4ZA 4H7XA 4YNMA 2XCBA 3FULA 2WXJA 5CCMA 3CHOA 2AXVA 4UWLA 1LF8A 3NQPA 5G05J 4TV3A 1E8ZA 3PREA 4DLQA 2IJGX 3BG0B 3DALA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RO2 A;  4H7Y A;  4CGW A;  4AY6 A;  1MT6 A;  2V5F A;  5DIZ A;  4XI9 A;  4YVQ C;  2O8J A;  4YPU A;  4G24 A;  2G46 A;  4O6F A;  3UUX A;  2OOE A;  5G05 C;  3U4T A;  3SWC A;  2I6H A;  3AS5 A;  3LKU A;  5T0M A;  5JJ0 A;  3Q5M A;  4GA0 A;  3MO5 A;  5DBK A;  2HR2 A;  1NZN A;  4WNF A;  5EG2 A;  3ZHE A;  2C0M A;  4N3B A;  3ASH A;  2E2E A;  3R9A B;  1NA0 A;  4GYY A;  1N6A A;  3S8P A;  5JJT A;  4GYW A;  2VSN A;  3ZFW A;  5M72 A;  4BTA A;  3QOU A;  5LCW J;  2PL2 A;  3TAX A;  2GW1 A;  5AYF A;  3OS5 A;  3VTX A;  5D0O D;  5FZR A;  3MV3 B;  3PE3 A;  3QWP A;  4JDS A;  3OOI A;  2AVP A;  3M57 A;  4Y6W A;  1A17 A;  4UI9 C;  3M59 A;  3ZHE B;  4IN3 B;  2JLB A;  2FEZ A;  4N2Q A;  2VGY A;  5A7D B;  2R5S A;  4KYO B;  5JIY A;  2YQ8 A;  2KAT A;  1QZ2 A;  4YPA A;  5JJ6 A;  3AS8 A;  3TGO A;  3KMJ A;  1XNF A;  3HNA A;  4NJ5 A;  4APO A;  3BEE A;  3Q47 B;  2NC9 A;  3RQ4 A;  5KJN A;  4ABN A;  4I2Z A;  4N3A A;  4J8D A;  5FZS A;  4N3C A;  4AU7 A;  1NA3 A;  3Q49 B;  2RFI A;  4JL0 A;  3S7D A;  1MVH A;  3KS2 A;  1TJC A;  1E96 B;  1N6C A;  3CK8 A;  3S7F A;  5FT9 A;  4WUY A;  3ASG A;  3LYA A;  4CDR A;  4G23 A;  2UWJ G;  5C1D A;  4I51 A;  2HYZ A;  3CBP A;  3M58 A;  5A6C A;  4I9C A;  4BTB A;  2FO7 A;  4U07 A;  5T5G A;  4NQ0 A;  3CK7 A;  3F9W A;  2UY1 A;  3CK9 A;  3DB5 A;  2VGX B;  4I2W A;  5KJM A;  3VUZ A;  3VV0 A;  3F9X A;  4GZ3 A;  4LEU A;  1HXI A;  1IHG A;  2Y4T A;  2BQZ A;  4MI0 A;  2QFC A;  2Y4U A;  3LY9 A;  2WPV A;  3K9I A;  2VYI A;  5TEG A;  3ASD A;  5TTF A;  5CPR B;  3U3W A;  2DBA A;  4FMU A;  4QEP A;  3Q15 A;  3S7B A;  5TH7 A;  4IJD A;  4UQZ A;  2BUG A;  1PEG A;  2XPI A;  3GW4 A;  4IJ8 A;  3NF1 A;  4YNP A;  4KXK B;  4JA9 A;  4AY5 A;  4GZ5 A;  4YND A;  3E4B A;  4BT9 A;  5EX3 A;  3TG5 A;  4J8O A;  3IEG A;  4I1A A;  5FTP A;  5LSZ A;  4J83 A;  3ASF A;  4J8E A;  4BT8 A;  5JIN A;  2PQR A;  2Q7F A;  4AIF A;  2XGS A;  4WNE A;  4WNG A;  3RAY A;  1ELR A;  2VQ2 A;  4NVQ A;  2PQN A;  5F6K C;  3URZ A;  3ULQ A;  3UQ3 A;  3QWW A;  2R3A A;  5HI7 A;  4HOU A;  2XGO A;  1HZ4 A;  3ZN3 A;  1ZKK A;  3EDT B;  4UI9 J;  4QEO A;  3CVQ A;  2IF4 A;  2FF4 A;  4I17 A;  4GCN A;  3SZ7 A;  4B94 A;  2OND A;  3GYZ A;  3OXL A;  3ZPJ A;  4EQF A;  3RO3 A;  3RKV A;  3WXX A;  3M55 A;  5F6L A;  5CCL A;  5BW8 C;  3FWV A;  2FBN A;  3KAE A;  1PC2 A;  3N71 A;  2P58 C;  4HOT A;  5FZQ A;  3PE4 A;  3CVN A;  4BUP A;  2C2L A;  4U0Z A;  1ZBP A;  2LSV A;  3MA5 A;  4W9R A;  1B89 A;  4KBQ A;  3FPD A;  3MKR A;  3MO0 A;  3M56 A;  1WAO 1;  3M5A A;  3LCA A;  5G04 C;  3JYS A;  2QPW A;  3S7J A;  1HH8 A;  3AS4 A;  3SF4 A;  4XI0 A;  4LDG A;  4E47 A;  4GPK A;  3QKY A;  3LY7 A;  1N3J A;  3QDN A;  3CKB A;  4HOS A;  3KD7 A;  5G04 J;  1OUV A;  4JHR A;  3SW9 A;  2VSY A;  5JJ7 A;  1ELW A;  3GZ2 A;  3IHX A;  3ESK A;  2XCC A;  3M54 A;  3KMT A;  3RJW A;  2J9Q A;  4JLG A;  1QQE A;  4A1S A;  2KCL A;  1Y8M A;  3RU0 A;  2FI7 A;  5F5E A;  1KT1 A;  3CEQ A;  2XGM A;  4ME2 A;  4RG9 A;  3QWV A;  5KJK A;  5D0Q D;  5CHE E;  3F9Z A;  5T0K A;  4H12 A;  4AM9 A;  4RZ0 A;  3OXG A;  5ARG A;  4U0S A;  2IFU A;  3VTY A;  2JV0 A;  3FFL A;  3OPE A;  4N39 A;  4F3V A;  4NRH B;  3CVP A;  3Q4A B;  3MO2 A;  4J7I A;  1MVX A;  4J0U A;  5LSX A;  4YVO A;  3K5K A;  2F69 A;  1FCH A;  1ML9 A;  4HOQ A;  4BWR A;  2LNI A;  3PDN A;  5JHN A;  1H3I A;  5LCW C;  4U04 A;  5ARF A;  4GCO A;  4UI9 K;  3O48 A;  1XQH A;  4QEN A;  5BNW A;  4RG6 A;  3UPV A;  1P5Q A;  3M53 A;  4G2V A;  5EX0 A;  4I9E A;  3KMA A;  2YHC A;  1KT0 A;  2MHK A;  4O30 A;  5BT1 A;  4MI5 A;  2IGQ A;  3MV2 B;  3HYM B;  1ZU2 A;  3CKC A;  3FP3 A;  5AYW D;  2LSU A;  2UY1 B;  3MEK A;  2W5Y A;  4J7F A;  1MUF A;  3RJV A;  4GYO A;  4C1Q A;  1O9S A;  2HO1 A;  3OXF A;  1W3B A;  3CVL A;  2W5Z A;  1YA0 A;  1KLX A;  4U0U A;  5EKQ D;  4GZ6 A;  4JA7 A;  4HOR A;  4N5C A;  3F9Y A;  4GA2 A;  2KC7 A;  3CBM A;  3LPZ A;  4G25 A;  4G26 A;  2L6J A;  3ZGQ A;  4Z4P A;  4N2S A;  2XEV A;  4XIF A;  3CV0 A;  4UQX A;  5KJL A;  1IYG A;  4YPE A;  2VGX A;  5FJY A;  2C0L A;  3LY8 A;  5F59 A;  2KCV A;  4GA1 A;  2KCK A;  3BO5 A;  4CGV A;  4Y6C A;  4J8F A;  1WM5 A;  3CBO A;  2PZI A;  3GZ1 A;  3EP0 A;  2WQH A;  5HQ8 A;  4G1T A;  4UQY A;  4WND A;  3TG4 A;  4H7X A;  4YNM A;  2XCB A;  5CCM A;  5G05 J;  3RIB A;  3DAL A; 
#chains in the Genus database with same CATH topology
 4CGW A;  3ZU7 B;  1MZC A;  4LNB A;  2L0T B;  2XHE A;  4YVQ C;  4GMJ A;  3TWQ A;  5BV0 A;  4U95 D;  2OOE A;  3EIJ A;  4KVM A;  2RD0 A;  3B7S A;  5BXO A;  2Y3A A;  1ZB1 A;  3D9N A;  3TXN A;  3LKU A;  3UIP C;  2XQ0 A;  5JJ0 A;  4DRX E;  3FUK A;  4GA0 A;  3DST A;  2KZT A;  5B1B E;  3I4R B;  3MO5 A;  2AXZ A;  4WNF A;  3R9A B;  4LNU D;  3S8P A;  2EIN E;  5KWD A;  2VSN A;  4BTA A;  1HE8 A;  3QOU A;  3TXM A;  5LCW J;  2PL2 A;  3DSV A;  4U96 D;  3TAX A;  2GW1 A;  4AVX A;  3FEY A;  3C72 A;  2OCC E;  3P1U A;  3HDX A;  2CHZ A;  2BTD A;  4JDS A;  5EIB E;  2LAH A;  3M57 A;  1UN9 A;  3T5V A;  4FUL A;  1FT2 A;  4CT0 A;  2NYJ A;  3PZ1 A;  5AAO A;  3Q79 A;  3U9W A;  3FUE A;  4ILG A;  1QZ2 A;  4YPA A;  2ZXW E;  3KMJ A;  3HNA A;  4NJ5 A;  3OAW A;  1D9S A;  2V0P A;  3ZUV B;  1SVX A;  4ATZ D;  1Z6T A;  3CIA A;  4N3A A;  2BED A;  1FPP A;  3SBT B;  4JL0 A;  2DZO A;  3MJW A;  2RFI A;  3KS2 A;  3CK8 A;  4OVU A;  3AG1 E;  3AJI A;  4YDW A;  3ASG A;  5G55 A;  2IY0 C;  4I51 A;  1YMP A;  5BV1 A;  2PM7 A;  2M63 A;  2WXL A;  4F1S A;  4JHK A;  1N95 A;  4L1B A;  4BTB A;  4U07 A;  2GRR B;  4ACK A;  3FEX A;  1HO8 A;  1TN7 A;  1K1B A;  4NQ0 A;  4CDN A;  3JQ0 A;  3F9W A;  2UY1 A;  2KBX A;  4GTT A;  3V30 A;  4A55 A;  3DB5 A;  1N11 A;  2R05 A;  3ONK A;  4F53 A;  2Y4T A;  3FTU A;  2DYR E;  4MI0 A;  3G2S A;  5CBO A;  2WPV A;  1JPL A;  3WG7 E;  1H2V C;  1U3D A;  2VYI A;  3RRN B;  3UM3 A;  1MYO A;  3ASD A;  5TTF A;  5FIO A;  3APD A;  3U3W A;  4UWK A;  3TWW A;  2KZT B;  3DPD A;  4FMU A;  4IJD A;  3SFX A;  5CRV A;  1JWF A;  5ANL A;  4JA9 A;  3DEO A;  3QAQ A;  4PS3 A;  4WWN A;  3D9L A;  3DSS A;  4JEU A;  3PUK A;  4J8O A;  4I6G A;  4I1A A;  3LJ3 A;  5A23 A;  2ZIS A;  3DSW A;  4EZJ A;  4G8K A;  3L82 A;  2X6K A;  4WNE A;  2VQ2 A;  3ABM E;  2PQN A;  5F6K C;  1UJK A;  2XZD G;  3UQ3 A;  3QWW A;  4L9P A;  4GTR A;  4FJY A;  4DJA A;  4U7E B;  3ZN3 A;  3EDT B;  4UI9 J;  4KT6 B;  3CVQ A;  3DWL G;  3FHE A;  1IHB A;  4KMO A;  3SBS A;  2OND A;  3U64 A;  2CHW A;  4EQF A;  3RO3 A;  2P9S G;  2MRI A;  4B93 B;  4L23 A;  2P9L G;  3N71 A;  4LG6 A;  3PE4 A;  2I2O A;  2OEW A;  1ZBP A;  3L16 A;  4CCA A;  2LSV A;  3MKR A;  1K3Z D;  3M56 A;  3MO0 A;  3JQ1 A;  1BU9 A;  1HH8 A;  3SF4 A;  3KEZ A;  3UM1 A;  5KNH D;  4E47 A;  5H7P A;  3DXM G;  1FVH A;  5ENO D;  1SA4 A;  3LY7 A;  3KD7 A;  5ENT D;  4JHR A;  3J5P A;  2VSY A;  1O5M A;  3ZEF A;  1O1R A;  3HHM A;  3ASO E;  4CT4 A;  2L0I A;  2OVF A;  2H6G A;  4JLG A;  1QQE A;  3ENE A;  4FAD A;  3UM0 A;  3HXE A;  2FI7 A;  5E75 A;  4BSX A;  5AJD A;  2P9P G;  5D0Q D;  5T0K A;  2P9I G;  1O1S A;  4AM9 A;  3JUI A;  1OCR E;  1UG3 A;  3FFL A;  3IHV A;  5CMW A;  3KSL A;  4QQI A;  2OVB A;  3FH8 A;  3HVE B;  4A63 B;  3E34 A;  5JMN D;  4HOQ A;  1H3I A;  3DSX A;  1JWG A;  1E90 A;  3SY2 A;  1XQH A;  4QEN A;  2WXR A;  2XRY A;  4G2V A;  2H6F A;  4DX7 D;  4J6I A;  3UT7 A;  3KMA A;  4YDO A;  4ANU A;  4P29 A;  2MHK A;  1NP7 A;  3UIO C;  1LD8 A;  2DYS E;  3MX3 A;  5BT1 A;  4MI5 A;  4M7C A;  3HYM B;  2UY1 B;  2W5Y A;  1MUF A;  4K5B A;  2VJ8 A;  2P9N G;  2RKK A;  3TJP A;  3EUV A;  3OXF A;  1W3B A;  3Q9N C;  2LXM A;  3ZYM A;  1YA0 A;  4U0U A;  3FUJ A;  5EKQ D;  1N4R A;  2XEN A;  2YNQ A;  3HXC A;  4GA2 A;  5J90 A;  2NSZ A;  3LPZ A;  1EDU A;  3V31 A;  2H6I A;  4M3O A;  4Z4P A;  4DX5 D;  2XEV A;  3LY8 A;  2ZU6 B;  2XEE A;  5F59 A;  1QBQ A;  3S2A A;  3BU8 A;  4HLL A;  3I5P A;  1WM5 A;  2ETC A;  3CBO A;  2PZI A;  5ENS D;  3EP0 A;  3ML9 A;  1INZ A;  2A4Z A;  3CGH A;  4UQY A;  3O4Z A;  4H7X A;  3EU9 A;  4YNM A;  1U2V G;  2WXJ A;  2QZA A;  5D66 A;  5CEA A;  3NQP A;  4TV3 A;  2IJG X;  3PEU B;  4HB5 A;  3RO2 A;  2ILR A;  4AY6 A;  1MT6 A;  4EEC A;  4L2Y A;  4XI9 A;  2O8J A;  4YPU A;  4G24 A;  2G46 A;  4O6F A;  4Q96 A;  3ZXS A;  3UUX A;  1DCQ A;  2IEJ A;  5T3R A;  4GML A;  2WMN A;  5T0M A;  2B6C A;  3G2T A;  3D9O A;  3ZHE A;  2KXP C;  3R7R A;  4ANX A;  4GYY A;  5JJT A;  4KZ0 A;  1VDY A;  4GYW A;  3ZFW A;  3PUJ A;  4BET A;  5D2M C;  2QYJ A;  5BXU A;  2KM4 A;  5AYF A;  2EQX A;  3PRZ A;  3FU0 A;  3PZ3 A;  3QWP A;  5CMY A;  1HX8 A;  1HG5 A;  2ZGD A;  1Q2Z A;  4WAF A;  3ZHE B;  2X6J A;  2FEZ A;  1X5B A;  2GRQ B;  1N94 A;  1OWL A;  5JJ6 A;  3B7T A;  2IQC A;  4APO A;  1HU3 A;  1UW4 B;  3DRA A;  3SI5 A;  4C48 B;  1DC2 A;  2DVW A;  3Q49 B;  3QC1 A;  5AN8 A;  3S7D A;  3D9M A;  1RZ4 A;  4A3V A;  3VLD A;  3ULY A;  3MZL B;  1S70 B;  4WWO A;  5FT9 A;  1TR4 A;  1OWO A;  2GRL A;  4I1M A;  4XKC A;  4AXH A;  4B8A A;  2HYZ A;  3E32 A;  3M58 A;  4HNA D;  4I6J A;  2FO7 A;  4BEP A;  4F7A A;  3ZNG A;  3IHY A;  4U8Y D;  3CK9 A;  3VUZ A;  2VGX B;  3VV0 A;  4PDX A;  4GZ3 A;  3APC A;  4FLB A;  1HXI A;  1IHG A;  4DK5 A;  2BQZ A;  4RVB A;  3LY9 A;  3K9I A;  3CQC B;  3NAW A;  5CRU A;  3EHQ A;  2XPZ A;  5CPR B;  4DPR A;  1YCS B;  2EIJ E;  4QEP A;  4LSZ E;  2AWI A;  1PEG A;  2P9K G;  3Q7F A;  4I6E A;  3PEV B;  5FQ4 A;  4YNP A;  2RFM A;  4KXK B;  1Z5S C;  1IQU A;  3DBS A;  4AY5 A;  3OTN A;  3ZW3 A;  4XKB A;  4RQI A;  1OWN A;  3I4G A;  2JAB A;  3TG5 A;  5LP0 A;  4IYP A;  3TL5 A;  1IKN D;  5BUZ A;  5FTP A;  3EU5 A;  1MX6 A;  3T5X A;  5JIN A;  2PQR A;  2L9B A;  4C9B B;  4WNG A;  3RAY A;  3T8M A;  1H2T C;  1JCS A;  1FT1 A;  4C0M A;  3URZ A;  2R3A A;  5AIJ A;  4ACL A;  2XGO A;  3D9I A;  4IUL A;  2GGF A;  4QEO A;  2QY7 A;  5E76 A;  3BUA A;  3MCX A;  4B94 A;  3I3N A;  3L08 A;  2IOL A;  3IXE A;  1AWC B;  3CVX A;  1EPU A;  2J08 A;  3M55 A;  1H2U A;  5HKP A;  2XZT G;  3TWT A;  3JXJ A;  3KAE A;  3SD5 A;  1SA5 A;  3QJZ A;  4HOT A;  3TWX A;  4PS8 A;  3HRA A;  2WXI A;  4WWP A;  2XPY A;  3CVN A;  2WXQ A;  2OV8 A;  4U0Z A;  5ENP D;  2WMO A;  4FC8 A;  1BI8 B;  2Y1L E;  4J8Y A;  3UXG A;  3NOG D;  3ZIM A;  4GPK A;  3FDH A;  2R03 A;  3HIZ A;  1N3J A;  5G04 J;  2X38 A;  3J5Q B;  5CER B;  2EIM E;  3T9K A;  1SQM A;  3IHX A;  3KMT A;  2X6I A;  3FH7 A;  3MKQ B;  4PH4 B;  4GTM A;  1Y8M A;  2EIL E;  4JEH A;  3UI2 A;  5F5E A;  1KT1 A;  2RFA A;  5CHE E;  1TN6 A;  1N4P A;  4U0S A;  4L2L A;  3VTY A;  4HRL A;  4J8S A;  3FTW A;  4NRH B;  4CRW A;  3AG3 E;  3MO2 A;  5LSX A;  4YVO A;  5C2Y A;  4B0Z A;  1G3N B;  2VTB B;  2F69 A;  1FCH A;  1ML9 A;  2LNI A;  4Z68 A;  5EYL A;  1TNU A;  2WXK A;  1OCO E;  4UI9 K;  5BNW A;  1KPS B;  1UOH A;  2PNN A;  3HG0 D;  3M53 A;  2WXG A;  3ZXP A;  2J4B A;  3W9F A;  2IGQ A;  3MV2 B;  2XEH A;  3CKC A;  3FP3 A;  3ZVV A;  5AYW D;  3MYV A;  3JXI A;  4XZ4 A;  3C5R A;  1H6O A;  4HQD A;  1N4Q A;  4BY6 A;  4EBA A;  1BI7 B;  1N54 A;  3CVL A;  2W5Z A;  4JD2 G;  4BX9 A;  2DCP A;  4HOR A;  4GZ6 A;  4QFV A;  2GRM A;  4GTV A;  4N5C A;  2J8S D;  2J07 A;  3PZ2 A;  1K1A A;  4ATG A;  3RK6 A;  4RLY A;  4E6H A;  4ANV A;  3SGH A;  3C3Q A;  5AEN A;  4UQX A;  3E37 A;  1JCQ A;  2RG8 A;  2KCK A;  4DX1 A;  4CGV A;  4MS6 A;  3DSU A;  3UX4 A;  4J8F A;  1WG0 A;  3PS6 A;  1FVF A;  3ZYL A;  2WXH A;  3ZYQ A;  4EZL A;  2R17 C;  4G1T A;  5AQ9 A;  4B89 A;  2AXV A;  3PRE A;  4DLQ A;  3DAL A;  5CED B;  2V5F A;  4HI9 A;  4DUI A;  4B8C B;  3G2U A;  2F0Y A;  1NFI E;  5HS0 A;  2I6H A;  1D8E A;  3CVV A;  4OAV B;  2R2L A;  4U63 A;  3U66 A;  4FP7 A;  2HR2 A;  1H19 A;  5EG2 A;  4N3B A;  1S63 A;  2E2E A;  1NA0 A;  1XGW A;  5FQ8 A;  2MOW A;  2V4L A;  1OWP A;  4F6R D;  4JXT A;  3HXF A;  2Y0B G;  4DI3 A;  4LUN U;  3ONL A;  1Y6I A;  3OS5 A;  3VTX A;  5D0O D;  1KZO A;  4RSY A;  5FZR A;  1PAQ A;  1AP7 A;  5ENN A;  4I43 A;  1YYH A;  4J7W A;  4O60 A;  1E7V A;  4Q69 A;  2AVP A;  2YHE A;  3OOI A;  3UT8 A;  4FHK A;  3D9K A;  4C0E A;  3LDZ A;  4N5Q A;  4Y6W A;  1A17 A;  4UI9 C;  1BPO A;  2ION A;  3RSE G;  4AJW A;  3M59 A;  4CYM D;  4IN3 B;  3IBE A;  3FU3 A;  3QAR A;  5A7D B;  2R5S A;  4KYO B;  5JIY A;  2KAT A;  1TYQ G;  3AS8 A;  3EIQ C;  3TGO A;  3SNX A;  3FUD A;  3AG2 E;  3BEE A;  3CHP A;  3T8K A;  1V54 E;  4HRM B;  3W9G A;  3RQ4 A;  5KJN A;  1MJ0 A;  4ABN A;  4I2Z A;  4J8D A;  2MYO A;  3D9P A;  5FZS A;  3QK0 A;  1UN8 A;  4K5C A;  2XS8 A;  1NA3 A;  4CDM A;  3R9M A;  1MVH A;  4FA6 A;  1TJC A;  1E96 B;  3S7F A;  4WUY A;  5CBN A;  4CDR A;  1MHQ A;  2J09 A;  4GTP A;  2UWJ G;  3SHF A;  4GTQ A;  3CBP A;  4K5A B;  3CHQ A;  5A6C A;  2A5E A;  4I9C A;  4URK A;  1Z3Y A;  1E8Y A;  3FU5 A;  5T5G A;  3FUN A;  3P2B A;  4YDE A;  4EHM A;  2E0I A;  5B1A E;  3HXB A;  4G11 A;  4LEU A;  4A1G A;  2I9C A;  3NZS A;  1LD7 A;  5TEG A;  3B7R L;  3ISM C;  3CST A;  5ENR D;  4O1P A;  4TRQ A;  3S7B A;  5TH7 A;  3L13 A;  2HM8 A;  2JEK A;  1ELK A;  4UQZ A;  2BUG A;  3JCK C;  5ENQ D;  3GW4 A;  3PH0 C;  3NF1 A;  1Z3X A;  4FJZ A;  4GU5 A;  1OXJ A;  3SFZ A;  2VGE A;  3FTX A;  3FH5 A;  2DZN A;  2AW6 A;  3ESL A;  3IEG A;  4XX5 A;  4J83 A;  1JUQ A;  5LFA A;  4HI8 A;  1EYH A;  4GMR A;  4L7T A;  4AIF A;  3UMV A;  4MKT A;  3G2V A;  4NVQ A;  3B95 A;  2GRO B;  1JCR A;  2LO6 A;  3ULQ A;  5KCM A;  4O1O A;  5HI7 A;  3SFY A;  4HOU A;  2X6F A;  3DEP A;  2GRN B;  2QC9 A;  3PZ4 A;  5KNG A;  4F1P A;  4TXP A;  2A5U A;  1E7U A;  2AXU A;  4GCN A;  3Q9U C;  3SZ7 A;  3ML8 A;  3FUM A;  2WXP A;  3OXL A;  1HFA A;  4LCT A;  4HVB A;  5F6L A;  1WDY A;  1S0P A;  1S64 A;  2FBN A;  3ZKJ A;  3Q78 A;  5LX8 A;  2P58 C;  5FZQ A;  4K03 A;  5EIL A;  4UWF A;  4BUP A;  2C2L A;  4GB9 A;  1N4S A;  4HXI A;  4LNG A;  3VLF A;  2IOS A;  3MA5 A;  4W9R A;  4FHJ A;  4I1O B;  3M5A A;  3S7J A;  4ANW A;  3AS4 A;  3TWR A;  4BX8 A;  3QKY A;  4Q94 A;  5J08 A;  3CVY A;  5JJ7 A;  1ELW A;  3ESK A;  2IO3 C;  4APF A;  3R7Q A;  3RJW A;  5EDS A;  2J9Q A;  4A1S A;  1N0R A;  2KCL A;  3DPY A;  3HXD A;  3SO8 A;  3LJN A;  4D10 C;  4JB8 P;  5ANR A;  3RRU A;  4G8L A;  2XGM A;  3B7B A;  4RG9 A;  3QWV A;  1UJJ A;  2DWZ A;  4RZ0 A;  4FLH A;  4DX2 A;  3UKU G;  2YIN A;  4HS2 A;  2JV0 A;  3L54 A;  4N39 A;  4F3V A;  3AG4 E;  2CFU A;  2Y69 E;  3CVP A;  4J7I A;  1IXV A;  1MVX A;  3LEW A;  1QYM A;  4GAA A;  3K5K A;  3Q75 A;  3PDN A;  5JHN A;  4K0R A;  4U04 A;  3APF A;  4AOF A;  5EX0 A;  4I9E A;  2DIW A;  2CG3 A;  3C3R A;  4HRN A;  4ILH B;  2YHC A;  2GRP B;  1EF1 C;  3AU4 A;  2X3M A;  3ABL E;  3BQO A;  4IRU A;  2LSU A;  3MEK A;  4J7F A;  2ZGG A;  3V2O A;  4HLE A;  3RJV A;  4LRZ A;  1DNP A;  5AAR A;  1K8K G;  3VLE A;  3F6Q A;  5JHB A;  4PS7 A;  5ITZ F;  4TXQ A;  5JA4 D;  2BF0 X;  4MRU A;  5BPP A;  2WXN A;  3F9Y A;  1TNB A;  4G25 A;  4G26 A;  3L6A A;  2L6J A;  3QNK A;  3PZD A;  1DCE A;  4XIF A;  5T4Y A;  4YPE A;  2VGX A;  5FJY A;  2C0L A;  3EJN A;  4TUU A;  5AQ7 A;  4KZC A;  4GA1 A;  3EHR A;  2VSX E;  2CFZ A;  4PUC A;  4Y6C A;  3CSF A;  1H0A A;  3TWV A;  3UKR G;  4JW1 A;  1N52 A;  3GZ1 A;  2WQH A;  2QYU A;  1A5E A;  3UTM A;  4TUM A;  4WND A;  3TG4 A;  2CHX A;  2XCB A;  1OT8 A;  1LF8 A;  1NI1 A;  5EYP F;  5G05 J;  3BG0 B;  3IV0 A;  4H7Y A;  5DIZ A;  1H6K A;  4BSZ B;  1N9A A;  3D9H A;  3X2Q E;  3LXU X;  5G2N A;  1TNO A;  5G05 C;  3U4T A;  3C98 A;  3SWC A;  3B7U X;  3AS5 A;  4AP2 A;  4JC8 A;  3Q5M A;  4OAU C;  5T8I A;  5DBK A;  3LS8 A;  1NZN A;  3E33 A;  1HF8 A;  2C0M A;  3ASH A;  3LVQ E;  4GTO A;  5AQA A;  1N6A A;  3PNT B;  5HRY A;  5M72 A;  4OYS A;  5CEC B;  1TEZ A;  2EIK E;  3KEA A;  1IQR A;  3MV3 B;  3PE3 A;  2WXO A;  1HS6 A;  4OVV A;  3ABK E;  3G2W A;  2V8S E;  2IO2 C;  2JLB A;  4N2Q A;  3KSQ A;  2WQ6 A;  2VGY A;  2WB2 A;  1U3C A;  2V5Q C;  2YQ8 A;  2P2C P;  3IKO B;  4NAC A;  2X6H A;  1XNF A;  3LVR E;  1MX4 A;  3V79 K;  3ZRH A;  3Q47 B;  4X8Q A;  4UWH A;  2H6H A;  3FU6 A;  2NC9 A;  2XS1 A;  4BFR A;  3EHM A;  4N3C A;  4JZY A;  4AU7 A;  5KBA A;  3CR3 A;  2J49 A;  3E30 A;  2WVI A;  2I1J A;  1N6C A;  3FUF A;  1OWM A;  4V3I A;  3LYA A;  4G23 A;  5C1D A;  2R59 A;  3NB2 A;  4GZD A;  1GW6 A;  3QB2 A;  3CK7 A;  3GZS A;  4ILI A;  4I2W A;  5KJM A;  3CHR A;  3F9X A;  1E8X A;  1SZ9 A;  2VTB A;  1MX2 A;  2QFC A;  5EN5 D;  5AJL A;  2Y4U A;  3D9J A;  5FQ6 A;  3AAA C;  3PNL B;  4XE0 A;  2DBA A;  5JHA A;  3Q15 A;  3BG1 B;  4GPM A;  1SZA A;  2XPI A;  5FIN A;  1HG2 A;  4IJ8 A;  5IY5 E;  1TJF A;  3RAU A;  4GZ5 A;  5AQB A;  2FO1 E;  2ETA A;  4YND A;  3E4B A;  4BT9 A;  5EX3 A;  4E85 A;  1WY6 A;  3EHN A;  3NZU A;  3L17 A;  5LSZ A;  3ASF A;  4J8E A;  3JUE A;  4YDY A;  4BT8 A;  2WXF A;  2Q7F A;  1O1T A;  2XGS A;  2BKK B;  1ELR A;  4NIK A;  3L9T A;  4CEM A;  2LXL A;  2ETB A;  4DLO A;  1HZ4 A;  1ZKK A;  2I1K A;  2J4D A;  3FUI A;  4UWG A;  3FUH A;  3CLJ A;  2IF4 A;  4DX6 D;  2FF4 A;  4I17 A;  4HBD A;  3GYZ A;  2ZIR A;  3ZPJ A;  2AJA A;  1E8W A;  3RKV A;  3UM2 A;  3WXX A;  4JVS A;  3UIN C;  1PY1 A;  4TXR A;  5CCL A;  5BW8 C;  3FWV A;  4CZ2 D;  4JPS A;  1PC2 A;  1BLX B;  1OCC E;  4GZC A;  1LTX A;  4LER A;  3HVE A;  4XEI G;  1B89 A;  4KBQ A;  3FPD A;  1WAO 1;  3LCA A;  5G04 C;  3JYS A;  4ZHB A;  2QPW A;  3C3O A;  4XI0 A;  2F37 A;  4AEZ C;  4LDG A;  2BKG A;  2B0O E;  3CHM A;  3TWS A;  3QDN A;  3CKB A;  4HOS A;  1OUV A;  1TN8 A;  3SW9 A;  3GZ2 A;  2R02 A;  3MKQ A;  2XCC A;  3PVL A;  3M54 A;  2LUH A;  1OY3 D;  2IU1 A;  2WM9 A;  1L5J A;  4DI4 A;  3ASN E;  1H6P A;  3RU0 A;  3FTS A;  3CEQ A;  4FU3 A;  4HFG A;  4ME2 A;  5KJK A;  3F9Z A;  2WXM A;  4H12 A;  4R7L A;  2FUL A;  3AU5 A;  3UT4 A;  3SQV A;  3V2X A;  4AV7 A;  3OXG A;  5ARG A;  1DVP A;  4JHJ A;  2IFU A;  2HE0 A;  1N0Q A;  1QNF A;  3OPE A;  1TNZ A;  3DXK G;  3D3M A;  2F8X K;  4EPZ A;  3Q4A B;  3FTZ A;  4J0U A;  3FTY A;  4EZK A;  2F8Y A;  4BWR A;  5LCW C;  5ARF A;  3FY4 A;  4GCO A;  3O48 A;  4RG6 A;  2PM6 A;  3UPV A;  1P5Q A;  3MGB A;  3ZYK A;  3CVU A;  2XRZ A;  2VSO E;  4KVO A;  1KT0 A;  5FWQ A;  1V55 E;  4O30 A;  4MLP A;  4U8V D;  4U8H A;  1ZU2 A;  1BD8 A;  3TWU A;  4A3T A;  1NL4 A;  4GTS A;  2P9U G;  4GYO A;  2WQ7 A;  4C1Q A;  1O9S A;  2HO1 A;  4MBG A;  3CVW A;  2V4H C;  4NUR A;  1KLX A;  1TNY A;  4JA7 A;  1RW2 A;  2CG2 A;  3B13 A;  3Q7A A;  4BES A;  1SW6 A;  2KC7 A;  3CBM A;  3CQG B;  3NOC D;  3ZGQ A;  1X81 A;  2OEV A;  4EBA G;  4N2S A;  5B3S E;  4ZFH A;  3CV0 A;  5KJL A;  1IYG A;  2LAI A;  3FTV A;  3L22 A;  2KCV A;  3NBN B;  1MQS A;  3BO5 A;  3Q73 A;  1D8D A;  5FQ7 A;  5LOZ A;  2L6B A;  3ULE G;  3RRM B;  5EID A;  4UUC A;  3CHS A;  2NXP A;  5HQ8 A;  1OCZ E;  3FUL A;  5CCM A;  3CHO A;  1KZP A;  4UWL A;  4BER A;  1E8Z A;  3RIB A; 
#chains in the Genus database with same CATH homology
 3IV0 A;  3RO2 A;  4H7Y A;  2ILR A;  4CGW A;  4AY6 A;  1MT6 A;  4EEC A;  2V5F A;  2L0T B;  4L2Y A;  1H6K A;  2XHE A;  4XI9 A;  4YVQ C;  4G24 A;  5DIZ A;  2G46 A;  2O8J A;  4GMJ A;  4O6F A;  4YPU A;  4B8C B;  5BV0 A;  4Q96 A;  3ZXS A;  3LXU X;  5G2N A;  3G2U A;  3UUX A;  2OOE A;  3EIJ A;  4KVM A;  3PEU B;  5G05 C;  2RD0 A;  3C98 A;  2I6H A;  3U4T A;  3B7U X;  3B7S A;  3SWC A;  2Y3A A;  5T3R A;  3AS5 A;  3CVV A;  3D9N A;  4GML A;  3TXN A;  4JC8 A;  4AP2 A;  3LKU A;  2WMN A;  5T0M A;  2XQ0 A;  4U63 A;  3U66 A;  5JJ0 A;  3FUK A;  3Q5M A;  3G2T A;  4GA0 A;  2KZT A;  4FP7 A;  3I4R B;  3D9O A;  5T8I A;  3MO5 A;  5DBK A;  2HR2 A;  3LS8 A;  1NZN A;  2AXZ A;  4WNF A;  1H19 A;  5EG2 A;  3ZHE A;  1HF8 A;  2C0M A;  3ASH A;  3LVQ E;  4N3B A;  3R7R A;  2E2E A;  3R9A B;  1NA0 A;  1XGW A;  5FQ8 A;  4ANX A;  2MOW A;  4GYY A;  1N6A A;  3S8P A;  2V4L A;  5JJT A;  3PNT B;  4KZ0 A;  1VDY A;  4GYW A;  1OWP A;  2VSN A;  3ZFW A;  4JXT A;  3PUJ A;  5M72 A;  4BTA A;  1HE8 A;  3QOU A;  3TXM A;  5LCW J;  4OYS A;  2PL2 A;  3TAX A;  2GW1 A;  4AVX A;  3FEY A;  2KM4 A;  4DI3 A;  4LUN U;  3P1U A;  3ONL A;  1TEZ A;  3HDX A;  2EQX A;  5AYF A;  1Y6I A;  2CHZ A;  3PRZ A;  3FU0 A;  3VTX A;  3OS5 A;  1IQR A;  5D0O D;  4RSY A;  5FZR A;  3MV3 B;  1PAQ A;  2BTD A;  3PE3 A;  5ENN A;  2WXO A;  3QWP A;  4I43 A;  4JDS A;  1E7V A;  1HS6 A;  4OVV A;  2AVP A;  2YHE A;  2LAH A;  4Q69 A;  3M57 A;  3UT8 A;  3OOI A;  4FHK A;  1HX8 A;  3D9K A;  5CMY A;  1UN9 A;  4C0E A;  1HG5 A;  3T5V A;  3LDZ A;  3G2W A;  4Y6W A;  2V8S E;  1A17 A;  4UI9 C;  1BPO A;  2ION A;  4WAF A;  4FUL A;  4AJW A;  3M59 A;  3ZHE B;  2X6J A;  4IN3 B;  2JLB A;  2FEZ A;  3IBE A;  1X5B A;  4CT0 A;  2WQ6 A;  4N2Q A;  3FU3 A;  3QAR A;  2VGY A;  5A7D B;  2R5S A;  2WB2 A;  4KYO B;  1U3C A;  3U9W A;  5JIY A;  3FUE A;  2YQ8 A;  2KAT A;  4ILG A;  1QZ2 A;  1OWL A;  4YPA A;  5JJ6 A;  3IKO B;  4NAC A;  3AS8 A;  3EIQ C;  2X6H A;  3B7T A;  2IQC A;  3TGO A;  3SNX A;  3KMJ A;  1XNF A;  3FUD A;  3HNA A;  3LVR E;  4APO A;  4NJ5 A;  1HU3 A;  3OAW A;  3BEE A;  3ZRH A;  3Q47 B;  2V0P A;  3CHP A;  4UWH A;  3FU6 A;  2NC9 A;  1UW4 B;  3RQ4 A;  4BFR A;  5KJN A;  4ABN A;  1Z6T A;  3CIA A;  3EHM A;  4I2Z A;  4N3A A;  4J8D A;  3SI5 A;  3D9P A;  5FZS A;  4N3C A;  3QK0 A;  1UN8 A;  4JZY A;  4AU7 A;  1NA3 A;  3Q49 B;  3QC1 A;  4CDM A;  3SBT B;  3CR3 A;  2J49 A;  3MJW A;  4JL0 A;  3D9M A;  3S7D A;  3KS2 A;  1MVH A;  2RFI A;  2WVI A;  4FA6 A;  1TJC A;  2I1J A;  1E96 B;  1N6C A;  3CK8 A;  3S7F A;  4A3V A;  4OVU A;  3VLD A;  3MZL B;  3FUF A;  1OWM A;  4WWO A;  5FT9 A;  4WUY A;  3ASG A;  4V3I A;  5G55 A;  3LYA A;  1OWO A;  2GRL A;  4CDR A;  1MHQ A;  4I1M A;  2J09 A;  4G23 A;  2UWJ G;  5C1D A;  4I51 A;  2R59 A;  4XKC A;  4AXH A;  5BV1 A;  3SHF A;  4B8A A;  2PM7 A;  2M63 A;  2HYZ A;  3CBP A;  2WXL A;  3CHQ A;  4F1S A;  3M58 A;  5A6C A;  4I9C A;  4I6J A;  4JHK A;  4URK A;  4L1B A;  4GZD A;  2FO7 A;  4U07 A;  4BTB A;  4F7A A;  1GW6 A;  3QB2 A;  3IHY A;  1Z3Y A;  4ACK A;  3FEX A;  1E8Y A;  3FU5 A;  1HO8 A;  5T5G A;  3FUN A;  4NQ0 A;  3CK7 A;  4CDN A;  3JQ0 A;  3P2B A;  3F9W A;  2UY1 A;  3GZS A;  4A55 A;  3CK9 A;  4ILI A;  2VGX B;  4I2W A;  5KJM A;  3DB5 A;  2E0I A;  4PDX A;  3VUZ A;  3VV0 A;  3CHR A;  3ONK A;  4F53 A;  4G11 A;  3F9X A;  4GZ3 A;  4LEU A;  1E8X A;  3APC A;  4FLB A;  1HXI A;  1IHG A;  2I9C A;  4A1G A;  2Y4T A;  4DK5 A;  3FTU A;  4RVB A;  2BQZ A;  1SZ9 A;  2VTB A;  4MI0 A;  2QFC A;  5AJL A;  2Y4U A;  3D9J A;  3G2S A;  3LY9 A;  3NZS A;  5FQ6 A;  2WPV A;  3K9I A;  1JPL A;  3CQC B;  1H2V C;  3PNL B;  1U3D A;  2VYI A;  3RRN B;  5TEG A;  3ASD A;  5TTF A;  2XPZ A;  5CPR B;  3APD A;  3B7R L;  4DPR A;  4XE0 A;  3CST A;  3U3W A;  4UWK A;  2DBA A;  2KZT B;  5JHA A;  3DPD A;  4FMU A;  4QEP A;  3Q15 A;  4TRQ A;  3S7B A;  5TH7 A;  3BG1 B;  4IJD A;  3L13 A;  2HM8 A;  1ELK A;  2JEK A;  2AWI A;  4UQZ A;  2BUG A;  1PEG A;  3JCK C;  1SZA A;  2XPI A;  3GW4 A;  4I6E A;  1HG2 A;  1JWF A;  3NF1 A;  1Z3X A;  3PH0 C;  4FJZ A;  4IJ8 A;  3PEV B;  5FQ4 A;  4YNP A;  5ANL A;  4KXK B;  1TJF A;  1IQU A;  3DBS A;  4JA9 A;  4AY5 A;  3QAQ A;  4GZ5 A;  4PS3 A;  4WWN A;  4GU5 A;  3D9L A;  3OTN A;  3SFZ A;  3ZW3 A;  4XKB A;  1OWN A;  3FTX A;  3E4B A;  3I4G A;  3FH5 A;  4JEU A;  4YND A;  5EX3 A;  3PUK A;  4BT9 A;  3TG5 A;  4E85 A;  5LP0 A;  4J8O A;  4IYP A;  1WY6 A;  4XX5 A;  2AW6 A;  3ESL A;  3IEG A;  3TL5 A;  4I6G A;  3EHN A;  4I1A A;  5BUZ A;  3NZU A;  3L17 A;  3LJ3 A;  5FTP A;  4J83 A;  5LSZ A;  1JUQ A;  3ASF A;  5LFA A;  5A23 A;  4J8E A;  4BT8 A;  1EYH A;  3T5X A;  5JIN A;  4L7T A;  4EZJ A;  2WXF A;  2PQR A;  2Q7F A;  2X6K A;  2L9B A;  4AIF A;  4C9B B;  3UMV A;  2XGS A;  4MKT A;  4WNE A;  3G2V A;  4WNG A;  3RAY A;  1ELR A;  2VQ2 A;  3T8M A;  4NVQ A;  1H2T C;  2PQN A;  5F6K C;  4C0M A;  1UJK A;  2LO6 A;  3URZ A;  3ULQ A;  5KCM A;  4CEM A;  3UQ3 A;  3QWW A;  5AIJ A;  2R3A A;  4ACL A;  5HI7 A;  4HOU A;  2XGO A;  3D9I A;  4DLO A;  1HZ4 A;  4FJY A;  3ZN3 A;  2X6F A;  4DJA A;  1ZKK A;  3EDT B;  2I1K A;  2J4D A;  4IUL A;  4UI9 J;  4KT6 B;  2GGF A;  4QEO A;  3CVQ A;  2QY7 A;  3FHE A;  3FUI A;  4UWG A;  3FUH A;  3CLJ A;  5E76 A;  2IF4 A;  3MCX A;  2A5U A;  2FF4 A;  4KMO A;  1E7U A;  2AXU A;  4GCN A;  3I3N A;  3L08 A;  2OND A;  3ML8 A;  3FUM A;  3GYZ A;  4I17 A;  2WXP A;  3SBS A;  3OXL A;  2IOL A;  3U64 A;  3ZPJ A;  2CHW A;  1HFA A;  4EQF A;  3RO3 A;  1E8W A;  3SZ7 A;  4LCT A;  4HVB A;  2MRI A;  3RKV A;  3WXX A;  1EPU A;  2J08 A;  4JVS A;  3CVX A;  3M55 A;  5F6L A;  1H2U A;  4L23 A;  1PY1 A;  1S0P A;  5CCL A;  5BW8 C;  3FWV A;  2FBN A;  3KAE A;  4JPS A;  3SD5 A;  1PC2 A;  3N71 A;  2P58 C;  3QJZ A;  5LX8 A;  4HOT A;  4K03 A;  4PS8 A;  3PE4 A;  2I2O A;  4UWF A;  5FZQ A;  4GZC A;  2WXI A;  4WWP A;  2XPY A;  3CVN A;  4LER A;  3HVE A;  2C2L A;  4BUP A;  4GB9 A;  2WXQ A;  2OV8 A;  4U0Z A;  1ZBP A;  4HXI A;  3L16 A;  4CCA A;  3VLF A;  2IOS A;  2LSV A;  3MA5 A;  2WMO A;  4W9R A;  1B89 A;  4KBQ A;  4FC8 A;  3MKR A;  4FHJ A;  3FPD A;  4I1O B;  1WAO 1;  3M56 A;  3M5A A;  3LCA A;  5G04 C;  3MO0 A;  3JQ1 A;  3JYS A;  2QPW A;  3S7J A;  4ANW A;  1HH8 A;  3AS4 A;  3SF4 A;  3KEZ A;  4XI0 A;  4AEZ C;  4BX8 A;  4LDG A;  4E47 A;  3ZIM A;  4GPK A;  1FVH A;  3CHM A;  3FDH A;  3QKY A;  4Q94 A;  3LY7 A;  5J08 A;  3HIZ A;  3QDN A;  3CKB A;  4B94 A;  4HOS A;  3KD7 A;  1N3J A;  5G04 J;  1OUV A;  5T0K A;  3CVY A;  4JHR A;  2X38 A;  3SW9 A;  2VSY A;  1SQM A;  5JJ7 A;  1ELW A;  3GZ2 A;  3IHX A;  3ESK A;  3MKQ A;  2XCC A;  3ZEF A;  3HHM A;  3PVL A;  4CT4 A;  3M54 A;  2L0I A;  2OVF A;  4APF A;  2X6I A;  3R7Q A;  3KMT A;  3RJW A;  5EDS A;  2J9Q A;  3FH7 A;  4JLG A;  3MKQ B;  4PH4 B;  1QQE A;  2IU1 A;  2WM9 A;  4A1S A;  1L5J A;  3ENE A;  4DI4 A;  4FAD A;  2KCL A;  1Y8M A;  3RU0 A;  4JEH A;  4D10 C;  2FI7 A;  5F5E A;  3FTS A;  1KT1 A;  3CEQ A;  4FU3 A;  5E75 A;  4BSX A;  5ANR A;  3RRU A;  2XGM A;  4HFG A;  4ME2 A;  4RG9 A;  3QWV A;  5AJD A;  5KJK A;  5D0Q D;  1UJJ A;  5CHE E;  3F9Z A;  2WXM A;  4H12 A;  4R7L A;  4AM9 A;  2FUL A;  3AU5 A;  3UT4 A;  4RZ0 A;  3JUI A;  4FLH A;  1UG3 A;  4AV7 A;  3OXG A;  5ARG A;  1DVP A;  4JHJ A;  2YIN A;  4HS2 A;  4U0S A;  2IFU A;  4L2L A;  3VTY A;  2JV0 A;  1QNF A;  3FFL A;  3L54 A;  4J8S A;  3OPE A;  3FTW A;  4N39 A;  4F3V A;  2CFU A;  3IHV A;  4NRH B;  4CRW A;  3D3M A;  3CVP A;  4EPZ A;  3Q4A B;  3MO2 A;  4J7I A;  5CMW A;  3LEW A;  1MVX A;  3FTZ A;  4J0U A;  5LSX A;  3FTY A;  4GAA A;  4YVO A;  5C2Y A;  2OVB A;  4B0Z A;  3FH8 A;  3HVE B;  4EZK A;  3K5K A;  2VTB B;  2F69 A;  1FCH A;  1ML9 A;  4HOQ A;  4BWR A;  2LNI A;  3PDN A;  5JHN A;  1H3I A;  5LCW C;  4K0R A;  4U04 A;  5ARF A;  1JWG A;  1E90 A;  2WXK A;  3FY4 A;  4GCO A;  4UI9 K;  3O48 A;  1XQH A;  3APF A;  4QEN A;  5BNW A;  4AOF A;  4RG6 A;  2PM6 A;  3UPV A;  2WXR A;  1P5Q A;  2XRY A;  3MGB A;  3M53 A;  4G2V A;  5EX0 A;  4I9E A;  3ZYK A;  2DIW A;  3CVU A;  2WXG A;  2XRZ A;  2CG3 A;  4J6I A;  3UT7 A;  2VSO E;  4ILH B;  3KMA A;  2J4B A;  4ANU A;  4KVO A;  2YHC A;  1KT0 A;  4P29 A;  5FWQ A;  2MHK A;  1NP7 A;  1EF1 C;  3AU4 A;  4O30 A;  2X3M A;  3MX3 A;  5BT1 A;  4MI5 A;  2IGQ A;  4MLP A;  3MV2 B;  3HYM B;  4U8H A;  1ZU2 A;  3CKC A;  3FP3 A;  4IRU A;  3ZVV A;  5AYW D;  2LSU A;  2UY1 B;  3MYV A;  4A3T A;  3MEK A;  2W5Y A;  4J7F A;  4XZ4 A;  1MUF A;  2VJ8 A;  4HLE A;  3RJV A;  3TJP A;  4BY6 A;  4GYO A;  2WQ7 A;  4C1Q A;  1O9S A;  2HO1 A;  4EBA A;  3CVW A;  3OXF A;  1W3B A;  1N54 A;  3CVL A;  4LRZ A;  3ZYM A;  3RIB A;  2W5Z A;  1DNP A;  1YA0 A;  4NUR A;  1KLX A;  4U0U A;  4BX9 A;  2DCP A;  3VLE A;  4PS7 A;  3FUJ A;  5JHB A;  5EKQ D;  4GZ6 A;  4JA7 A;  4QFV A;  2GRM A;  4HOR A;  2BF0 X;  3B13 A;  2CG2 A;  4MRU A;  2YNQ A;  4N5C A;  5BPP A;  2J07 A;  2WXN A;  3F9Y A;  4GA2 A;  2KC7 A;  3CBM A;  3CQG B;  2NSZ A;  3LPZ A;  4G25 A;  4ATG A;  4G26 A;  3RK6 A;  3L6A A;  5J90 A;  1EDU A;  2L6J A;  3ZGQ A;  3QNK A;  4M3O A;  4Z4P A;  4E6H A;  4EBA G;  4ANV A;  3PZD A;  3SGH A;  4N2S A;  5AEN A;  2XEV A;  4XIF A;  3CV0 A;  4UQX A;  5T4Y A;  5KJL A;  1IYG A;  4YPE A;  2VGX A;  5FJY A;  2C0L A;  2LAI A;  3LY8 A;  3FTV A;  3L22 A;  2ZU6 B;  3EJN A;  5F59 A;  4TUU A;  2KCV A;  1MQS A;  2RG8 A;  4GA1 A;  4KZC A;  3S2A A;  2KCK A;  3BO5 A;  2VSX E;  2CFZ A;  4PUC A;  4CGV A;  4MS6 A;  4Y6C A;  3CSF A;  5FQ7 A;  5LOZ A;  3UX4 A;  1H0A A;  3I5P A;  4J8F A;  1WM5 A;  3CBO A;  3RRM B;  4JW1 A;  1N52 A;  2PZI A;  3GZ1 A;  3CHS A;  3EP0 A;  3ML9 A;  2WQH A;  2NXP A;  1INZ A;  3PS6 A;  1FVF A;  3ZYL A;  5HQ8 A;  2WXH A;  2A4Z A;  2R17 C;  3CGH A;  3ZYQ A;  4G1T A;  4UQY A;  4WND A;  3TG4 A;  4EZL A;  2CHX A;  4B89 A;  3O4Z A;  4H7X A;  4YNM A;  2XCB A;  3FUL A;  2WXJ A;  5CCM A;  3CHO A;  2AXV A;  4UWL A;  1LF8 A;  3NQP A;  5G05 J;  4TV3 A;  1E8Z A;  3PRE A;  4DLQ A;  2IJG X;  3BG0 B;  3DAL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...