3TG5A

Structure of smyd2 in complex with p53 and sah
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
425
structure length
425
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Structure of human SMYD2 reveals the basis of p53 tumor suppressor methylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 137
structure length 425
sequence length 425
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3tg5A03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3tg5A01
5TEGA 3VTYA 1XNFA 2JLBA 3FWVA 4RG9A 3RU0A 3RO2A 4LDGA 3KMJA 4YPUA 4JDSA 4WNFA 3LKUA 3HNAA 3Q47B 1N3JA 2KCLA 4GA2A 3ZN3A 5JJ0A 1KLXA 2UY1A 4I2WA 3S8PA 3N71A 3ASHA 2JV0A 2WPVA 2RFIA 3F9YA 2E2EA 5CCMA 3CBPA 1TJCA 3ZFWA 3EP0A 2ONDA 1NZNA 3M59A 4NRHB 4A1SA 4GYWA 3CBOA 3URZA 3IHXA 3GZ1A 4H12A 4LEUA 1Y8MA 4JL0A 2R3AA 3LY8A 5LSZA 4U04A 5FJYA 2PZIA 4YPAA 3S7FA 1ML9A 4JLGA 2BQZA 2VGXB 3RKVA 2QPWA 4H7YA 5T5GA 3M5AA 4GPKA 5TTFA 3M53A 4CGVA 4YPEA 1PEGA 4IN3B 1IHGA 4GA0A 3AS5A 5AYWD 1KT1A 5BNWA 4U0ZA 3U3WA 5D0QD 2Q7FA 4AU7A 3S7BA 2MHKA 3O48A 3AS8A 1NA3A 3RQ4A 3CKCA 3K5KA 1HXIA 1P5QA 3F9WA 3CVNA 4YNMA 1IYGA 5AYFA 3RAYA 5T0MA 3JYSA 3CVPA 5G04J 2BUGA 5DIZA 4HOTA 2C2LA 4CGWA 3BO5A 3MV3B 5JINA 5A7DB 3FP3A 1NA0A 4GCOA 3LYAA 4RG6A 1WAO1 3U4TA 2XGMA 1ELRA 2FBNA 5KJKA 2UY1B 5EX3A 3Q49B 3BEEA 1ELWA 4RZ0A 3VUZA 4KXKB 3TG4A 3CKBA 4GA1A 3S7DA 4NVQA 3GW4A 3MO0A 4GZ6A 3ESKA 4G23A 2OOEA 4U0UA 2PL2A 4J8DA 5FZQA 5C1DA 3M55A 4N2SA 4QEPA 5BW8C 3PE3A 4UQXA 5F6KC 3CV0A 2LNIA 5EX0A 4BTBA 1XQHA 2P58C 2C0LA 5CHEE 3NF1A 5HI7A 3UPVA 3IEGA 2VSYA 2XGSA 3SF4A 4HOQA 4JA9A 1A17A 3QWPA 1OUVA 4G1TA 3DB5A 3RJWA 4UI9J 4G24A 3M58A 1FCHA 4N3AA 3SW9A 4IJ8A 5T0KA 3FPDA 5F5EA 4Y6WA 2IGQA 1QZ2A 5CCLA 4KBQA 4J8EA 5G04C 4J8OA 3ZHEA 4HORA 5KJMA 4O30A 4AY5A 2LSVA 3TAXA 5LCWC 2UWJG 2XPIA 3WXXA 3ASFA 3DALA 2AVPA 5KJNA 4BWRA 4H7XA 3ULQA 5BT1A 2I6HA 1N6AA 2W5ZA 3F9ZA 5ARFA 1O9SA 5JJTA 3MV2B 4I9EA 2IF4A 3R9AB 5KJLA 4J0UA 4XI0A 1MVHA 3RIBA 2G46A 2HYZA 5FZSA 4J8FA 4N3BA 4U0SA 1MT6A 2FF4A 3ASDA 1HZ4A 3KS2A 5F6LA 4Y6CA 3VTXA 2VGYA 2YQ8A 3Q15A 4N39A 4I1AA 4XI9A 5JJ6A 2VSNA 4BTAA 3MO2A 2PQRA 3LY7A 2VQ2A 3LY9A 5JIYA 1YA0A 4ME2A 4UI9K 4AY6A 3K9IA 4O6FA 5LCWJ 4GYOA 2YHCA 4IJDA 4BUPA 2Y4UA 3ZGQA 4BT8A 3UUXA 4UI9C 1ZBPA 5D0OD 4Z4PA 4WNGA 3CK9A 5CPRB 4YNDA 2L6JA 3PE4A 4NJ5A 4HOSA 4WUYA 3HYMB 4HOUA 3KAEA 4KYOB 4E47A 2V5FA 4B94A 3CK7A 5HQ8A 4N2QA 2HO1A 3OS5A 2VYIA 4GZ3A 4APOA 2R5SA 2KC7A 4C1QA 4EQFA 3E4BA 1KT0A 3AS4A 3GZ2A 3EDTB 3ZHEB 4I9CA 4AIFA 3CVQA 3OPEA 4GCNA 2F69A 2W5YA 4G25A 5G05J 3Q4AB 4FMUA 1B89A 1H3IA 3F9XA 5A6CA 2FO7A 3PDNA 5FTPA 2GW1A 3ZPJA 4I2ZA 3MO5A 4YVQC 3RO3A 2C0MA 3M57A 4J7IA 1ZKKA 4N3CA 3CVLA 5TH7A 2WQHA 1WM5A 1HH8A 2J9QA 4UQYA 4BT9A 2XEVA 4NQ0A 4MI5A 4WNEA 4YNPA 3OXLA 3MA5A 4QENA 2PQNA 3KD7A 2QFCA 3CBMA 2Y4TA 4N5CA 1QQEA 2KATA 2FI7A 3TGOA 3MKRA 3UQ3A 3LPZA 1E96B 2O8JA 3M54A 3SWCA 1MUFA 4J83A 4ABNA 2XGOA 3TG5A 2XCBA 3CK8A 1N6CA 4I51A 2HR2A 4G26A 1PC2A 1ZU2A 3QKYA 5JJ7A 4U07A 5M72A 4WNDA 2NC9A 2XCCA 4JHRA 3OXGA 3ASGA 1MVXA 2VGXA 2LSUA 3SZ7A 5FZRA 4CDRA 2FEZA 5FT9A 3M56A 4AM9A 3Q5MA 2IFUA 5G05C 3QWVA 4W9RA 3QWWA 3QOUA 4I17A 4GZ5A 3VV0A 3OXFA 1W3BA 4UQZA 5ARGA 3FFLA 4MI0A 3MEKA 5LSXA 3GYZA 5DBKA 5JHNA 3RJVA 3S7JA 5F59A 2DBAA 5EG2A 3QDNA 2KCKA 4J7FA 4QEOA 3KMTA 4XIFA 5EKQD 4G2VA 4JA7A 3LCAA 4YVOA 3OOIA 4GYYA 4F3VA 2KCVA 3KMAA 3CEQA
chains in the Genus database with same CATH superfamily
4FADA 3RO2A 4YPUA 3CQCB 4OVVA 1N0QA 1K8KG 5B1AE 2R02A 4I6JA 5LP0A 4TUMA 4L9PA 4HVBA 2KCLA 3ZN3A 5KWDA 2UY1A 2I9CA 3T5XA 3RAUA 3N71A 3ASHA 4GMJA 5ANLA 2WPVA 3NQPA 2GRLA 3ZFWA 3EP0A 2ONDA 3M59A 3ENEA 5JMND 3EIQC 4U7EB 1HS6A 4ACKA 3B7SA 4H12A 4ATZD 5FQ8A 1V55E 4U04A 4EECA 4H7YA 5CRVA 3M5AA 3IHYA 2H6GA 3HXEA 4A3VA 4HRNA 3CHQA 5AYWD 5BNWA 1OT8A 2IU1A 3IV0A 4F7AA 3P2BA 5D0QD 1NFIE 2KXPC 3G2SA 3CLJA 2DIWA 5ENPD 2MHKA 1H6KA 3ZXSA 4K5BA 4EZLA 1DCQA 1BU9A 2RG8A 2Y0BG 3CVXA 3K5KA 3FUIA 3CQGB 4HQDA 2XEEA 3RAYA 5ENSD 5G04J 5DIZA 1Z5SC 3PVLA 5A7DB 2GRNB 1IQUA 4L1BA 4BY6A 3LYAA 1WAO1 4ANVA 5ENTD 5AJLA 5B3SE 2HM8A 3DSVA 3EHRA 3VUZA 5FQ7A 3CKBA 3HDXA 3S7DA 4BSXA 2OOEA 2PNNA 4BX9A 4HNAD 2AXVA 4I1MA 3NF1A 3PUKA 3IEGA 3AJIA 4ACLA 2CHXA 4HOQA 3NBNB 4GAAA 3DB5A 3RJWA 4G24A 1FCHA 3TXMA 4GMRA 2IGQA 1O5MA 3ABKE 1X5BA 1TNOA 1S70B 3TWVA 2H6IA 1TN6A 4KBQA 5CCLA 4J8EA 3ZHEA 4TXPA 2XRYA 2B0OE 4AXHA 2E0IA 2NSZA 2VJ8A 3L17A 3HHMA 4GB9A 3DALA 2AVPA 4FU3A 4HB5A 3CSFA 2I6HA 1N6AA 2W5ZA 5ARFA 1O9SA 3LVQE 5JJTA 3R9AB 5G2NA 2VSOE 2QZAA 1MVHA 3TXNA 3FU3A 2HYZA 3SQVA 3Q9UC 4J7WA 2V0PA 3ASDA 3G2VA 4FLBA 4L2LA 5EDSA 4C48B 3EUVA 2YQ8A 4I1AA 4XI9A 1UN8A 3MO2A 4UWLA 4JXTA 2A4ZA 3LY9A 1SZAA 4FA6A 4KVMA 1YA0A 4ME2A 2AW6A 2A5UA 2Y4UA 4FHJA 5ENQD 4UI9C 1ZBPA 5FIOA 3BQOA 4Z4PA 2WXNA 3PE4A 2RFAA 4U63A 3L16A 5T3RA 3LVRE 3EIJA 2X3MA 1LF8A 4E47A 5HQ8A 2HO1A 1N94A 3OS5A 3FU0A 2R5SA 2KC7A 3FEXA 4EQFA 2ZU6B 3APDA 3RRUA 4AV7A 1TNZA 4GMLA 4ATGA 3TWSA 3Q7FA 4JZYA 1Y6IA 3CHRA 4DLQA 2IJGX 3F9XA 3J5QB 3PDNA 4AJWA 3B7TA 4I2ZA 1KZPA 2EIJE 2XPYA 1LTXA 4HFGA 4J7IA 1ZKKA 3L9TA 4N3CA 4XKCA 5BXOA 3CVLA 1UG3A 2WXRA 2WQHA 2EINE 3ASNE 3RK6A 4M7CA 4NQ0A 5JHBA 3HXBA 3UM0A 4I6EA 4RSYA 5CEDB 3PREA 3UM2A 4RQIA 4O1PA 2OVFA 2QFCA 1QQEA 2KATA 2FI7A 3C98A 1S64A 1U3CA 3MKRA 3G2WA 3LPZA 2LXMA 3M54A 4PDXA 3SWCA 4BFRA 3DBSA 4ABNA 2XCBA 5T4YA 2Y1LE 3V31A 3ML9A 5J08A 4OYSA 1QYMA 4G26A 1PC2A 3MZLB 4WWNA 3UX4A 3RSEG 4WNDA 4GTTA 5LX8A 1MVXA 3SZ7A 1UW4B 3ULEG 2FEZA 1OCRE 5FT9A 3B7UX 4AM9A 4D10C 4G8KA 3PUJA 2OVBA 3QWVA 3RRNB 3VV0A 3FUKA 3UI2A 3EHMA 3FFLA 5LSXA 3S2AA 3KSQA 2DBAA 1S63A 4QEOA 3HXDA 3KMTA 3TWUA 1DVPA 2VGEA 4G2VA 2P9IG 3CVVA 3CEQA 1TNUA 4A55A 5TEGA 3VTYA 5KNHD 4B8CB 3RU0A 2WM9A 3KMJA 1TN8A 4EPZA 2QC9A 2P9LG 3LKUA 4EZKA 3HNAA 4GTMA 3Q47B 4LNBA 2GRRB 1IXVA 5CBNA 2JV0A 3CGHA 5KCMA 2E2EA 5CCMA 1HO8A 2BKGA 2VTBA 5AN8A 4NRHB 4A1SA 4GYWA 3URZA 4FHKA 5ANRA 2AXUA 5C2YA 4JL0A 3E34A 4APFA 5A23A 5JA4D 1YCSB 3LY8A 4TRQA 5FJYA 2PZIA 4YPAA 2VGXB 4EZJA 3CR3A 3CVWA 3UMVA 3FUDA 4CGVA 1BI8B 1RZ4A 5FQ4A 4U0ZA 3C72A 1FPPA 1BLXB 3U3WA 5E76A 3EU5A 3BG0B 4DK5A 4C9BB 4Q94A 3F9WA 2WXLA 4JB8P 4YDOA 2CG2A 1U2VG 2IOLA 1OWPA 4Q69A 1QNFA 3Q9NC 2ZGDA 3BO5A 3SFXA 2ETAA 3PEVB 4AVXA 3TJPA 4DX1A 3R7QA 3BEEA 5FWQA 3P1UA 3L13A 4KXKB 2FULA 4GA1A 3PZ2A 4IULA 2HE0A 2L9BA 4IRUA 2Y69E 3D9IA 3X2QE 2R03A 4KMOA 4GZ6A 3ESKA 4G23A 4U0UA 2PL2A 4J8DA 5C1DA 3M55A 3UIOC 4N2SA 1H2VC 1SZ9A 1SVXA 2WXPA 5F6KC 2DVWA 1DC2A 1IQRA 2P58C 5CHEE 2WXMA 1ZB1A 1AWCB 2VSYA 3SF4A 4JA9A 1A17A 4CCAA 4L23A 4DX6D 5B1BE 4CDMA 3U66A 3SW9A 3PZ3A 4ILGA 2V4HC 3FPDA 2IONA 3UINC 4LERA 4J8OA 4HORA 2DZOA 4GZDA 2R59A 4ILIA 1INZA 5CRUA 3FUMA 2DWZA 1HFAA 3MCXA 2LSVA 3TAXA 4K03A 3UM1A 2GROB 3MJWA 4GTQA 3UXGA 4EBAG 2J09A 5KJNA 4Z68A 1D9SA 4BWRA 4H7XA 1NI1A 1E8YA 2LO6A 5AQ9A 3DSWA 3ASOE 4J0UA 5H7PA 4OAVB 5AAOA 1PAQA 2G46A 4I1OB 4BERA 4U0SA 3FUHA 1MT6A 2FF4A 5ITZF 3AG2E 2IOSA 5CMYA 2J49A 4Y6CA 3TWTA 3VTXA 2VGYA 2X6KA 5JJ6A 1EPUA 4BTAA 3GZSA 3LY7A 4KZ0A 4JHKA 3C3RA 1RW2A 3L08A 5LCWJ 3V79K 4GYOA 4PH4B 2YHCA 1AP7A 4BUPA 2LAIA 4NACA 2KZTA 3UUXA 3QK0A 3CK9A 3FDHA 5CPRB 4YNDA 4BETA 2L6JA 3Q79A 3UT8A 4HOSA 4JEUA 2LUHA 3SY2A 3ABME 2V8SE 3MKQA 5EYPF 3ZIMA 2AJAA 3C3QA 2V5FA 3CK7A 1XGWA 2IO2C 3ZEFA 4HRMB 4DLOA 3FU5A 1KZOA 4CT4A 5HKPA 2JEKA 3G2UA 3ZYLA 3E4BA 4JC8A 3GZ2A 3EHQA 4HI9A 4BEPA 4I9CA 4JVSA 4QQIA 3UTMA 4AIFA 5CBOA 3IXEA 4RVBA 4A63B 2W5YA 1EDUA 3Q4AB 2XENA 4JHJA 1B89A 1H3IA 3PZ4A 1MZCA 2I1KA 3ZPJA 4LRZA 4HI8A 3ZW3A 3L82A 3M57A 1Z6TA 4YDWA 4F1SA 1N0RA 5TH7A 1HH8A 2XEHA 4UQYA 3LJ3A 2XEVA 2YHEA 3PH0C 4DPRA 2IY0C 4MI5A 4F6RD 3E37A 2WQ7A 4XX5A 2GRQB 2X6IA 3MA5A 1IHBA 4QENA 1FVHA 2NYJA 2Y4TA 4N5CA 1E7UA 3ZVVA 1FT2A 2CHZA 4GTSA 1N9AA 2O8JA 3SGHA 4B0ZA 1H6OA 2WXJA 4I6GA 3FUFA 1A5EA 2MYOA 5AIJA 1N6CA 2ZISA 3AU5A 2HR2A 2P9SG 3B7RL 2XRZA 2J07A 1ZU2A 3QKYA 5M72A 1X81A 5BV1A 1KPSB 3OXGA 4CDRA 3M56A 1YYHA 2JABA 2GGFA 4DI4A 3HG0D 5G05C 3VLFA 3BG1B 3FH8A 1N11A 3JXJA 2X6HA 1JWGA 5LOZA 3E32A 3Q73A 5DBKA 5AARA 3S7JA 3FTWA 5F59A 2V5QC 3DEOA 2Y3AA 3ZYKA 4M3OA 1MJ0A 3QJZA 4GTRA 4CEMA 5BUZA 3ZNGA 3FTZA 1XNFA 4FLHA 4PS7A 4R7LA 2WXHA 2WXFA 3FTYA 4WNFA 3KSLA 4DUIA 3T8MA 2R17C 4FP7A 3ZU7B 2WXIA 1KLXA 4I2WA 3S8PA 1G3NB 4AEZC 1DNPA 4O1OA 3OTNA 3PNLB 3F9YA 1NZNA 3QARA 1E8ZA 3CBOA 1N4QA 3IHXA 1YMPA 1WG0A 2IQCA 2CFUA 4LEUA 1Y8MA 4BX8A 2R3AA 3DSTA 5LSZA 2P9UG 1ML9A 3FH5A 3T8KA 3RKVA 2QPWA 1H2UA 3DSSA 4WWOA 5T5GA 3CVYA 4GPKA 5TTFA 3CHSA 1PEGA 4IN3B 1IHGA 3J5PA 4GA0A 4B89A 1E7VA 3I5PA 3D9PA 2Q7FA 4AU7A 3HVEB 3DWLG 5FINA 3O48A 5AJDA 1NA3A 4F53A 1UJKA 4K5CA 1E8WA 3CKCA 1HXIA 3ONKA 5ENOD 4YNMA 4BSZB 2XHEA 1IYGA 5AYFA 3AG3E 5T0MA 3ONLA 3JYSA 5FQ6A 3CVPA 4HOTA 2C2LA 4CGWA 3T5VA 4CDNA 1HE8A 3FP3A 1NA0A 3UKRG 2XZTG 1PY1A 3TL5A 1TN7A 4GCOA 1OXJA 1H2TC 3U9WA 5BXUA 4JD2G 3U4TA 2QYUA 2XGMA 2H6HA 1ELRA 3HIZA 5EYLA 2FBNA 5KJKA 2UY1B 5EX3A 3MX3A 2CG3A 3TG4A 4A1GA 3V2XA 4NVQA 3LJNA 3SFYA 2ILRA 3GW4A 4LUNU 5D2MC 3EJNA 1N95A 5FZQA 4QEPA 4N5QA 4I43A 4UQXA 2L6BA 2LNIA 3SBTB 5EX0A 4BTBA 1HX8A 5AQAA 2C0LA 4U96D 2ZXWE 2XGSA 4HBDA 2J8SD 1TEZA 4FC8A 4P29A 3TWRA 1K3ZD 3NOCD 1OUVA 5J90A 4UI9J 4ANUA 3M58A 4N3AA 3CIAA 5F5EA 2F0YA 2WXGA 1QZ2A 3D9KA 1S0PA 5G04C 2KBXA 5T8IA 5KJMA 3SHFA 3D3MA 1MX6A 4AY5A 4HLEA 2LXLA 5LCWC 4GZCA 2XPIA 4KT6B 2J4DA 3ASFA 2OCCE 4XEIG 1HF8A 2ZIRA 3O4ZA 5JHAA 3AAAC 2BEDA 3F9ZA 3FULA 1UJJA 1N4SA 3MV2B 4I9EA 2IF4A 5CECB 4K0RA 1OCZE 1HG5A 4DX2A 3RIBA 1L5JA 2J4BA 1GW6A 1V54E 5FZSA 4N3BA 3L22A 4U8YD 2KZTB 3TWQA 4NIKA 1DCEA 5BPPA 5KBAA 3Q15A 3QC1A 1TNBA 2VSXE 3QAQA 2VQ2A 2XZDG 1E90A 3ZYMA 4UI9K 4O6FA 3PZDA 4CZ2D 5ENNA 1OWMA 4LNUD 3B13A 4CT0A 1N54A 5D0OD 4WNGA 4G11A 2R05A 4E6HA 1MHQA 4TV3A 2QY7A 4WUYA 1Z3YA 3HYMB 3FHEA 3ESLA 3FUJA 4KYOB 3TWXA 4ANWA 4B94A 3V2OA 4BESA 3OAWA 4MRUA 4NURA 4N2QA 1Z3XA 4FJYA 4APOA 4C1QA 3W9FA 3NOGD 3ZHEB 4KVOA 4IYPA 4Q96A 4HXIA 1MYOA 3UKUG 4V3IA 4GCNA 2F69A 4YDYA 4G25A 1Q2ZA 4FMUA 2M63A 2NXPA 3L54A 4CRWA 2P2CP 3CVUA 1QBQA 1U3DA 2GW1A 2X38A 3IBEA 1D8DA 2IO3C 3MO5A 1UN9A 4GTOA 3D9NA 3D9JA 3QNKA 1N4PA 1WM5A 3APFA 4BT9A 4UWKA 1SA4A 1H6PA 5D66A 3AU4A 3FEYA 4OAUC 3OXLA 3D9HA 2L0IA 4MKTA 1N4RA 4L2YA 1MQSA 1TYQG 2WXKA 4J6IA 3TGOA 3UQ3A 3E30A 2CHWA 1FT1A 3DSUA 1IKND 3JQ0A 1MUFA 4J83A 1OWNA 2XGOA 1TR4A 4FJZA 3HRAA 2MOWA 3HXCA 4U8VD 3PZ1A 1BI7B 2ZGGA 3DPYA 2BTDA 4I51A 3CHMA 1LD7A 2YINA 3DXMG 2NC9A 4JHRA 2VGXA 3UT4A 3AG1E 2PM6A 3Q5MA 2IFUA 3Q75A 3L6AA 1OY3D 3MYVA 3E33A 3QWWA 4WWPA 4XE0A 1O1TA 3OXFA 1W3BA 4PUCA 5ARGA 4ZHBA 1UOHA 2OEWA 4HRLA 4JPSA 3GYZA 2XQ0A 3ZUVB 4J7FA 5CMWA 2ETCA 3AG4E 5EKQD 3ZKJA 2X6JA 4GYYA 4F3VA 1JCQA 5AQ7A 2F37A 5HS0A 2H6FA 2JLBA 1NL4A 3KEAA 3FWVA 4RG9A 3U64A 2DYSE 4G8LA 4LDGA 4JDSA 3JCKC 4JW1A 2V4LA 2WQ6A 1N3JA 3BUAA 4GA2A 5JJ0A 1E8XA 1O1SA 3LEWA 3CHPA 4UWGA 4TXRA 3WG7E 2RFIA 3CBPA 1TJCA 3DEPA 4MS6A 3D9MA 2R2LA 5ENRD 1MX4A 3GZ1A 2IEJA 3ZXPA 2XS8A 1JPLA 3SD5A 3S7FA 4JLGA 2BQZA 2I2OA 3R7RA 3JUIA 2L0TB 3MGBA 4URKA 3M53A 2QYJA 3I4GA 2WMNA 4YPEA 3VLEA 5EIDA 3VLDA 2BKKB 3AS5A 1KT1A 4E85A 3V30A 2RKKA 3F6QA 3UM3A 3S7BA 3IKOB 2GRPB 3AS8A 3RQ4A 2I1JA 3SNXA 3T9KA 5IY5E 4DX7D 4HLLA 3Q7AA 1P5QA 3CVNA 5HRYA 2P9PG 3FUNA 2KM4A 2A5EA 2BUGA 2EIME 1K1AA 3ULYA 3MV3B 1O1RA 5JINA 5CEAA 3W9GA 1SA5A 3I3NA 4UUCA 4RG6A 2WB2A 1VDYA 5AQBA 3QB2A 3Q49B 2F8XK 1ELWA 4RZ0A 5G55A 4QFVA 4ILHB 2AXZA 3NAWA 4XZ4A 3IHVA 3MO0A 4LCTA 5EIBE 1WY6A 2VTBB 4GU5A 3LS8A 2DZNA 5BW8C 4YDEA 3HXFA 4KZCA 1BD8A 4PS8A 3PE3A 3CV0A 1XQHA 3FTSA 2MRIA 5HI7A 3UPVA 3KEZA 2F8YA 4JEHA 3JXIA 4TXQA 1WDYA 3QWPA 4G1TA 3I4RB 4MBGA 2LAHA 4GTVA 4AOFA 4IJ8A 5T0KA 3LXUX 4GPMA 3UIPC 4Y6WA 2DYRE 3FUEA 2EIKE 1JCSA 3JQ1A 3G2TA 4LSZE 3ZRHA 1TNYA 3CSTA 2BF0X 1OCCE 4O30A 4TUUA 4DJAA 3NB2A 3WXXA 2UWJG 4UWFA 4C0EA 3BU8A 3ULQA 5BT1A 2CFZA 2OEVA 5KJLA 2AWIA 4XI0A 1OCOE 2P9KG 4XKBA 4LG6A 4J8FA 2PM7A 5AENA 1HZ4A 3C5RA 3KS2A 5F6LA 1K1BA 2RFMA 4N39A 3DRAA 4ZFHA 1EYHA 2VSNA 3NZUA 2PQRA 4B8AA 1JCRA 3SI5A 3D9LA 3TWWA 5JIYA 4AY6A 3PNTB 3K9IA 2WMOA 4J8YA 1HG2A 4IJDA 1SW6A 2J08A 4GTPA 3ZGQA 4BT8A 4DX5D 4EBAA 3PEUB 4WAFA 4DI3A 2GRMA 3C3OA 3ISMC 3JUEA 4NJ5A 1SQMA 2XPZA 3FTVA 4HOUA 3KAEA 5KNGA 2XS1A 4K5AB 1MX2A 3B95A 2ETBA 1LD8A 4O60A 2VYIA 4GZ3A 3Q78A 1JUQA 3PS6A 5BV0A 1KT0A 3AS4A 4MLPA 3EDTB 3CVQA 4AP2A 4DRXE 1BPOA 3SO8A 1OWLA 4LNGA 3OPEA 1OWOA 3LDZA 5G05J 5E75A 1JWFA 4B93B 4CYMD 5A6CA 2YNQA 2FO7A 3EHNA 5EILA 5FTPA 3RRMB 2P9NG 3R9MA 3NZSA 1H0AA 4YVQC 3ML8A 1TJFA 3DSXA 4EHMA 3RO3A 2C0MA 3APCA 2OV8A 2WVIA 4HS2A 4ANXA 3FU6A 2J9QA 3PRZA 4L7TA 4F1PA 4WNEA 5LFAA 4J8SA 4PS3A 4YNPA 3B7BA 1HU3A 2PQNA 3KD7A 3CBMA 2RD0A 4FULA 3FH7A 3SBSA 2B6CA 1E96B 1FVFA 5EN5D 3TG5A 3CK8A 4OVUA 3DPDA 2X6FA 1NP7A 5JJ7A 4U07A 4X8QA 2XCCA 1N52A 3MKQB 3ASGA 2LSUA 5CERB 5FZRA 2WXOA 3EU9A 2DCPA 4C0MA 1H19A 3FY4A 2WXQA 1EF1C 4W9RA 4U95D 3QOUA 3FTUA 4I17A 4GZ5A 1ELKA 4A3TA 4UQZA 4U8HA 4MI0A 3MEKA 4UWHA 3FTXA 5JHNA 3HVEA 4RLYA 3RJVA 5EG2A 3DXKG 3QDNA 3SFZA 2KCKA 3UT7A 2EILE 2EQXA 3D9OA 2FO1E 4XIFA 3CHOA 3OOIA 4JA7A 4YVOA 3LCAA 3ZYQA 1D8EA 2KCVA 3ABLE 3KMAA
chains in the Genus database with same CATH topology
4A55A 5TEGA 3VTYA 1XNFA 4FADA 2JLBA 3FWVA 4B8CB 4FLHA 4PS7A 4RG9A 2WXHA 4R7LA 3RU0A 2WXFA 3U64A 3FTYA 3RO2A 2WM9A 4LDGA 3KMJA 4YPUA 3CQCB 4OVVA 4JDSA 4WNFA 4EPZA 3JCKC 3LKUA 3T8MA 4JW1A 4EZKA 3HNAA 4I6JA 2R17C 2V4LA 5LP0A 4FP7A 2WQ6A 3Q47B 1N3JA 4HVBA 2KCLA 4GA2A 2WXIA 3ZN3A 5JJ0A 1KLXA 2UY1A 1E8XA 3LEWA 2I9CA 3CHPA 4I2WA 3S8PA 3T5XA 3N71A 3ASHA 4AEZC 1DNPA 2JV0A 4GMJA 5ANLA 2WPVA 3CGHA 3OTNA 3PNLB 4UWGA 2RFIA 5KCMA 3F9YA 3NQPA 2E2EA 2GRLA 5CCMA 1HO8A 3CBPA 1TJCA 3ZFWA 3EP0A 2ONDA 1NZNA 2VTBA 3M59A 4NRHB 3QARA 4MS6A 3ENEA 3D9MA 4A1SA 4GYWA 1E8ZA 3CBOA 3EIQC 3URZA 4FHKA 3IHXA 1HS6A 3GZ1A 2AXUA 5ANRA 4ACKA 5C2YA 2IQCA 2CFUA 3B7SA 4H12A 4LEUA 5FQ8A 1Y8MA 4JL0A 1JPLA 4BX8A 4APFA 5A23A 2R3AA 3LY8A 3SD5A 4TRQA 5LSZA 4U04A 5FJYA 2PZIA 4EECA 4YPAA 3S7FA 1ML9A 3FH5A 2BQZA 4JLGA 2VGXB 3RKVA 2QPWA 4H7YA 2I2OA 4EZJA 1H2UA 3R7RA 3CR3A 4WWOA 5T5GA 3M5AA 3CVWA 3JUIA 2L0TB 3CVYA 3IHYA 4GPKA 3MGBA 5TTFA 4URKA 3M53A 3UMVA 3FUDA 3I4GA 4CGVA 4A3VA 2WMNA 3CHSA 3VLEA 4YPEA 1PEGA 4IN3B 1IHGA 3VLDA 4GA0A 4B89A 3AS5A 3CHQA 1E7VA 1KT1A 5FQ4A 3I5PA 2IU1A 4U0ZA 5AYWD 4E85A 5BNWA 3IV0A 4F7AA 3U3WA 3P2BA 5D0QD 5E76A 3G2SA 3D9PA 3CLJA 2Q7FA 4AU7A 2DIWA 3S7BA 3BG0B 2MHKA 1H6KA 3HVEB 4DK5A 3IKOB 3O48A 3AS8A 1NA3A 2I1JA 5AJDA 3SNXA 3ZXSA 4F53A 4EZLA 1UJKA 4C9BB 1E8WA 3CKCA 2RG8A 4Q94A 3CVXA 3K5KA 1HXIA 1P5QA 3ONKA 3F9WA 3CVNA 2WXLA 3FUIA 2CG2A 4YNMA 3CQGB 2XHEA 1IYGA 2IOLA 1OWPA 3FUNA 5AYFA 2KM4A 4Q69A 1QNFA 3RAYA 5T0MA 3ONLA 3JYSA 5FQ6A 3CVPA 5G04J 2BUGA 5DIZA 4HOTA 2C2LA 4CGWA 3BO5A 3PVLA 3MV3B 3T5VA 4CDNA 5JINA 3WXXA 3I3NA 1HE8A 5A7DB 3FP3A 1NA0A 3PEVB 1IQUA 1PY1A 3TL5A 4AVXA 4GCOA 4L1BA 1H2TC 4BY6A 3LYAA 4RG6A 1WAO1 3U9WA 2WB2A 1VDYA 3TJPA 3U4TA 2XGMA 3QB2A 1ELRA 3HIZA 2FBNA 3R7QA 4ANVA 5KJKA 2UY1B 5EX3A 5AJLA 3MX3A 2CG3A 3Q49B 3BEEA 1ELWA 5FWQA 3P1UA 4RZ0A 3L13A 2HM8A 4KXKB 5G55A 3VUZA 5FQ7A 4QFVA 3TG4A 2FULA 3CKBA 4ILHB 4GA1A 4A1GA 3HDXA 3S7DA 4NVQA 4IULA 2AXZA 4BSXA 2L9BA 4IRUA 3D9IA 2ILRA 4XZ4A 3GW4A 3IHVA 4KMOA 3MO0A 4LCTA 4GZ6A 1WY6A 4LUNU 3ESKA 2VTBB 4G23A 2OOEA 4GU5A 2PL2A 4U0UA 3EJNA 3LS8A 4J8DA 4BX9A 5FZQA 5C1DA 3M55A 4N2SA 2AXVA 4QEPA 5BW8C 1H2VC 4I1MA 1SZ9A 4KZCA 4PS8A 2WXPA 3PE3A 4I43A 4UQXA 5F6KC 3CV0A 1IQRA 2LNIA 3SBTB 5EX0A 4BTBA 1XQHA 3FTSA 2P58C 1HX8A 2C0LA 5CHEE 3NF1A 2MRIA 2WXMA 5HI7A 3UPVA 3PUKA 3IEGA 4ACLA 3KEZA 2VSYA 4JEHA 2CHXA 2XGSA 3SF4A 4HOQA 4JA9A 1A17A 1TEZA 3QWPA 4CCAA 4FC8A 4L23A 4P29A 4GAAA 4CDMA 1OUVA 4G1TA 5J90A 3DB5A 3RJWA 3I4RB 4UI9J 4ANUA 2LAHA 4AOFA 3U66A 4G24A 3M58A 1FCHA 3TXMA 4N3AA 3SW9A 4IJ8A 4ILGA 3CIAA 5T0KA 3FPDA 3LXUX 2IONA 5F5EA 4Y6WA 2IGQA 1X5BA 3FUEA 4LERA 2WXGA 1QZ2A 3D9KA 5CCLA 4KBQA 1S0PA 4J8EA 5G04C 4J8OA 3ZHEA 4HORA 5T8IA 5KJMA 3JQ1A 3SHFA 3G2TA 3ZRHA 2XRYA 4GZDA 2R59A 4ILIA 1INZA 4AXHA 3CSTA 3D3MA 2BF0X 2E0IA 3FUMA 4O30A 1HFAA 3MCXA 4AY5A 2LSVA 4HLEA 4TUUA 4DJAA 2NSZA 3TAXA 5LCWC 4K03A 2VJ8A 4GZCA 2UWJG 2XPIA 3HHMA 3L17A 3MJWA 4GB9A 2J4DA 4KT6B 3ASFA 4UWFA 2AVPA 2J09A 4C0EA 4EBAG 5KJNA 3DALA 4BWRA 4FU3A 4H7XA 3ULQA 1HF8A 3CSFA 1E8YA 2I6HA 2CFZA 3O4ZA 5BT1A 5JHAA 1N6AA 2LO6A 2W5ZA 3F9ZA 5ARFA 3FULA 3LVQE 1UJJA 5JJTA 1O9SA 3MV2B 4I9EA 2IF4A 3R9AB 5KJLA 4J0UA 4K0RA 1HG5A 5G2NA 2VSOE 2AWIA 4XI0A 1MVHA 1PAQA 3TXNA 3RIBA 4XKBA 1L5JA 3FU3A 2G46A 2HYZA 1GW6A 2J4BA 5FZSA 4I1OB 2PM7A 4J8FA 4N3BA 4U0SA 3FUHA 5AENA 1MT6A 3L22A 2FF4A 2KZTB 2V0PA 3ASDA 1HZ4A 2IOSA 3G2VA 4FLBA 4L2LA 5EDSA 3KS2A 5CMYA 2J49A 4Y6CA 5BPPA 5F6LA 3VTXA 2VGYA 2X6KA 2YQ8A 3Q15A 4N39A 4I1AA 4XI9A 5JJ6A 1EYHA 1EPUA 2VSNA 1UN8A 3NZUA 3QC1A 2PQRA 4UWLA 4BTAA 3MO2A 3GZSA 4JXTA 2VSXE 4B8AA 3SI5A 3LY7A 4KZ0A 4JHKA 3D9LA 2A4ZA 2VQ2A 3QAQA 3LY9A 5JIYA 1SZAA 1E90A 4FA6A 4KVMA 3ZYMA 1YA0A 4ME2A 4UI9K 3PNTB 2AW6A 3K9IA 4AY6A 2WMOA 3L08A 1HG2A 4O6FA 3PZDA 5LCWJ 5ENNA 4GYOA 4PH4B 1OWMA 2YHCA 2A5UA 4IJDA 4BUPA 2LAIA 2J08A 2Y4UA 4FHJA 4NACA 3ZGQA 4BT8A 2KZTA 3UUXA 4EBAA 4UI9C 1ZBPA 3B13A 4CT0A 1N54A 3QK0A 3PEUB 5D0OD 4Z4PA 4WNGA 4WAFA 4DI3A 4G11A 3CK9A 2GRMA 3FDHA 4YNDA 5CPRB 4E6HA 2WXNA 2L6JA 1MHQA 3PE4A 4NJ5A 4TV3A 3UT8A 4JEUA 1SQMA 2QY7A 2XPZA 4U63A 4WUYA 4HOSA 3FTVA 1Z3YA 3HYMB 4HOUA 3L16A 3FHEA 5T3RA 3ESLA 3KAEA 3LVRE 3EIJA 2V8SE 3FUJA 3MKQA 2X3MA 4KYOB 1LF8A 3ZIMA 4E47A 4ANWA 2V5FA 4B94A 3CK7A 1XGWA 3ZEFA 3OAWA 5HQ8A 4MRUA 4NURA 4N2QA 1Z3XA 2HO1A 4DLOA 3FU5A 3OS5A 2VYIA 4CT4A 4FJYA 3FU0A 4GZ3A 4APOA 1JUQA 2KC7A 2R5SA 3FEXA 4C1QA 3PS6A 5BV0A 2JEKA 3G2UA 3ZYLA 4EQFA 2ZU6B 3E4BA 1KT0A 3AS4A 4MLPA 4JC8A 3GZ2A 3EDTB 3ZHEB 4KVOA 3APDA 4I9CA 4JVSA 4IYPA 4AIFA 3CVQA 4Q96A 4HXIA 3RRUA 4AP2A 1BPOA 4AV7A 1OWLA 4RVBA 3OPEA 4V3IA 1OWOA 3LDZA 4GCNA 4GMLA 2F69A 2W5YA 4G25A 4ATGA 1EDUA 5G05J 4JZYA 1Y6IA 3CHRA 3Q4AB 5E75A 2M63A 1JWFA 2NXPA 4DLQA 4FMUA 4JHJA 1B89A 2IJGX 3L54A 1H3IA 3F9XA 5A6CA 4CRWA 3CVUA 2YNQA 2FO7A 3PDNA 2I1KA 1U3DA 3EHNA 5FTPA 2GW1A 3RRMB 2X38A 3IBEA 4AJWA 3B7TA 3ZPJA 3NZSA 4I2ZA 4LRZA 1H0AA 4YVQC 1UN9A 3MO5A 3ML8A 1TJFA 2XPYA 3RO3A 2C0MA 3ZW3A 3APCA 3D9NA 2OV8A 3M57A 4HFGA 4J7IA 3D9JA 1ZKKA 4N3CA 2WVIA 1Z6TA 4XKCA 4HS2A 4F1SA 3QNKA 3CVLA 4ANXA 1UG3A 2WXRA 3FU6A 5TH7A 2WQHA 1WM5A 1HH8A 2J9QA 3APFA 3PRZA 4UQYA 4BT9A 3LJ3A 2XEVA 2YHEA 3PH0C 4UWKA 3RK6A 4L7TA 4NQ0A 4DPRA 5JHBA 4MI5A 4WNEA 5LFAA 2WQ7A 3AU4A 3FEYA 4J8SA 4PS3A 3OXLA 4XX5A 2X6IA 4I6EA 3MA5A 4YNPA 4RSYA 2L0IA 3PREA 4MKTA 4QENA 1HU3A 2OVFA 2PQNA 1FVHA 3KD7A 4L2YA 2QFCA 3CBMA 1MQSA 2Y4TA 4N5CA 1QQEA 2KATA 2RD0A 2WXKA 2FI7A 4FULA 3FH7A 4J6IA 3C98A 3SBSA 1E7UA 3TGOA 1U3CA 3ZVVA 3MKRA 3UQ3A 3G2WA 2CHZA 3LPZA 1E96B 2CHWA 2O8JA 1FVFA 3SGHA 3M54A 4PDXA 3SWCA 4BFRA 4B0ZA 3JQ0A 1MUFA 4J83A 1OWNA 2WXJA 2XGOA 3DBSA 4I6GA 3TG5A 4ABNA 4FJZA 2XCBA 3FUFA 2MOWA 3CK8A 5T4YA 5AIJA 1N6CA 4OVUA 3DPDA 3ML9A 2BTDA 3AU5A 4OYSA 5J08A 2X6FA 4I51A 3B7RL 2HR2A 3CHMA 1NP7A 2J07A 4G26A 2XRZA 1PC2A 3MZLB 1ZU2A 3QKYA 4WWNA 4U07A 2YINA 5JJ7A 5M72A 3UX4A 5BV1A 4WNDA 2NC9A 2XCCA 1N52A 4JHRA 3OXGA 3MKQB 3ASGA 5LX8A 1MVXA 2VGXA 2LSUA 3SZ7A 3UT4A 1UW4B 5FZRA 4CDRA 2FEZA 2WXOA 5FT9A 3B7UX 2PM6A 2DCPA 4AM9A 3M56A 2GGFA 3Q5MA 2IFUA 3PUJA 4D10C 4C0MA 4DI4A 1H19A 5G05C 3FY4A 3VLFA 3L6AA 2OVBA 3BG1B 3QWVA 2WXQA 1EF1C 3FH8A 3MYVA 4W9RA 3QWWA 4WWPA 3QOUA 3FTUA 4I17A 3RRNB 4GZ5A 4XE0A 1ELKA 4A3TA 3VV0A 3FUKA 3OXFA 1W3BA 4PUCA 4UQZA 3EHMA 5ARGA 3FFLA 4U8HA 2X6HA 3MEKA 4MI0A 1JWGA 5LSXA 4JPSA 3GYZA 5LOZA 3S2AA 4UWHA 3FTXA 5DBKA 3HVEA 5JHNA 3RJVA 3S7JA 3FTWA 2DBAA 5EG2A 5F59A 3QDNA 2XQ0A 3SFZA 2KCKA 3UT7A 4J7FA 2EQXA 4QEOA 3KMTA 1DVPA 2Y3AA 3D9OA 5CMWA 4XIFA 4M3OA 3ZYKA 3CHOA 3RQ4A 3QJZA 4G2VA 4JA7A 3LCAA 4YVOA 5EKQD 3ZYQA 4CEMA 3OOIA 2X6JA 4GYYA 4F3VA 2KCVA 3CVVA 3KMAA 3CEQA 5BUZA 3FTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TEG A;  3VTY A;  1XNF A;  2JLB A;  3FWV A;  4RG9 A;  3RU0 A;  3RO2 A;  4LDG A;  3KMJ A;  4YPU A;  4JDS A;  4WNF A;  3LKU A;  3HNA A;  3Q47 B;  1N3J A;  2KCL A;  4GA2 A;  3ZN3 A;  5JJ0 A;  1KLX A;  2UY1 A;  4I2W A;  3S8P A;  3N71 A;  3ASH A;  2JV0 A;  2WPV A;  2RFI A;  3F9Y A;  2E2E A;  5CCM A;  3CBP A;  1TJC A;  3ZFW A;  3EP0 A;  2OND A;  1NZN A;  3M59 A;  4NRH B;  4A1S A;  4GYW A;  3CBO A;  3URZ A;  3IHX A;  3GZ1 A;  4H12 A;  4LEU A;  1Y8M A;  4JL0 A;  2R3A A;  3LY8 A;  5LSZ A;  4U04 A;  5FJY A;  2PZI A;  4YPA A;  3S7F A;  1ML9 A;  4JLG A;  2BQZ A;  2VGX B;  3RKV A;  2QPW A;  4H7Y A;  5T5G A;  3M5A A;  4GPK A;  5TTF A;  3M53 A;  4CGV A;  4YPE A;  1PEG A;  4IN3 B;  1IHG A;  4GA0 A;  3AS5 A;  5AYW D;  1KT1 A;  5BNW A;  4U0Z A;  3U3W A;  5D0Q D;  2Q7F A;  4AU7 A;  3S7B A;  2MHK A;  3O48 A;  3AS8 A;  1NA3 A;  3RQ4 A;  3CKC A;  3K5K A;  1HXI A;  1P5Q A;  3F9W A;  3CVN A;  4YNM A;  1IYG A;  5AYF A;  3RAY A;  5T0M A;  3JYS A;  3CVP A;  5G04 J;  2BUG A;  5DIZ A;  4HOT A;  2C2L A;  4CGW A;  3BO5 A;  3MV3 B;  5JIN A;  5A7D B;  3FP3 A;  1NA0 A;  4GCO A;  3LYA A;  4RG6 A;  1WAO 1;  3U4T A;  2XGM A;  1ELR A;  2FBN A;  5KJK A;  2UY1 B;  5EX3 A;  3Q49 B;  3BEE A;  1ELW A;  4RZ0 A;  3VUZ A;  4KXK B;  3TG4 A;  3CKB A;  4GA1 A;  3S7D A;  4NVQ A;  3GW4 A;  3MO0 A;  4GZ6 A;  3ESK A;  4G23 A;  2OOE A;  4U0U A;  2PL2 A;  4J8D A;  5FZQ A;  5C1D A;  3M55 A;  4N2S A;  4QEP A;  5BW8 C;  3PE3 A;  4UQX A;  5F6K C;  3CV0 A;  2LNI A;  5EX0 A;  4BTB A;  1XQH A;  2P58 C;  2C0L A;  5CHE E;  3NF1 A;  5HI7 A;  3UPV A;  3IEG A;  2VSY A;  2XGS A;  3SF4 A;  4HOQ A;  4JA9 A;  1A17 A;  3QWP A;  1OUV A;  4G1T A;  3DB5 A;  3RJW A;  4UI9 J;  4G24 A;  3M58 A;  1FCH A;  4N3A A;  3SW9 A;  4IJ8 A;  5T0K A;  3FPD A;  5F5E A;  4Y6W A;  2IGQ A;  1QZ2 A;  5CCL A;  4KBQ A;  4J8E A;  5G04 C;  4J8O A;  3ZHE A;  4HOR A;  5KJM A;  4O30 A;  4AY5 A;  2LSV A;  3TAX A;  5LCW C;  2UWJ G;  2XPI A;  3WXX A;  3ASF A;  3DAL A;  2AVP A;  5KJN A;  4BWR A;  4H7X A;  3ULQ A;  5BT1 A;  2I6H A;  1N6A A;  2W5Z A;  3F9Z A;  5ARF A;  1O9S A;  5JJT A;  3MV2 B;  4I9E A;  2IF4 A;  3R9A B;  5KJL A;  4J0U A;  4XI0 A;  1MVH A;  3RIB A;  2G46 A;  2HYZ A;  5FZS A;  4J8F A;  4N3B A;  4U0S A;  1MT6 A;  2FF4 A;  3ASD A;  1HZ4 A;  3KS2 A;  5F6L A;  4Y6C A;  3VTX A;  2VGY A;  2YQ8 A;  3Q15 A;  4N39 A;  4I1A A;  4XI9 A;  5JJ6 A;  2VSN A;  4BTA A;  3MO2 A;  2PQR A;  3LY7 A;  2VQ2 A;  3LY9 A;  5JIY A;  1YA0 A;  4ME2 A;  4UI9 K;  4AY6 A;  3K9I A;  4O6F A;  5LCW J;  4GYO A;  2YHC A;  4IJD A;  4BUP A;  2Y4U A;  3ZGQ A;  4BT8 A;  3UUX A;  4UI9 C;  1ZBP A;  5D0O D;  4Z4P A;  4WNG A;  3CK9 A;  5CPR B;  4YND A;  2L6J A;  3PE4 A;  4NJ5 A;  4HOS A;  4WUY A;  3HYM B;  4HOU A;  3KAE A;  4KYO B;  4E47 A;  2V5F A;  4B94 A;  3CK7 A;  5HQ8 A;  4N2Q A;  2HO1 A;  3OS5 A;  2VYI A;  4GZ3 A;  4APO A;  2R5S A;  2KC7 A;  4C1Q A;  4EQF A;  3E4B A;  1KT0 A;  3AS4 A;  3GZ2 A;  3EDT B;  3ZHE B;  4I9C A;  4AIF A;  3CVQ A;  3OPE A;  4GCN A;  2F69 A;  2W5Y A;  4G25 A;  5G05 J;  3Q4A B;  4FMU A;  1B89 A;  1H3I A;  3F9X A;  5A6C A;  2FO7 A;  3PDN A;  5FTP A;  2GW1 A;  3ZPJ A;  4I2Z A;  3MO5 A;  4YVQ C;  3RO3 A;  2C0M A;  3M57 A;  4J7I A;  1ZKK A;  4N3C A;  3CVL A;  5TH7 A;  2WQH A;  1WM5 A;  1HH8 A;  2J9Q A;  4UQY A;  4BT9 A;  2XEV A;  4NQ0 A;  4MI5 A;  4WNE A;  4YNP A;  3OXL A;  3MA5 A;  4QEN A;  2PQN A;  3KD7 A;  2QFC A;  3CBM A;  2Y4T A;  4N5C A;  1QQE A;  2KAT A;  2FI7 A;  3TGO A;  3MKR A;  3UQ3 A;  3LPZ A;  1E96 B;  2O8J A;  3M54 A;  3SWC A;  1MUF A;  4J83 A;  4ABN A;  2XGO A;  3TG5 A;  2XCB A;  3CK8 A;  1N6C A;  4I51 A;  2HR2 A;  4G26 A;  1PC2 A;  1ZU2 A;  3QKY A;  5JJ7 A;  4U07 A;  5M72 A;  4WND A;  2NC9 A;  2XCC A;  4JHR A;  3OXG A;  3ASG A;  1MVX A;  2VGX A;  2LSU A;  3SZ7 A;  5FZR A;  4CDR A;  2FEZ A;  5FT9 A;  3M56 A;  4AM9 A;  3Q5M A;  2IFU A;  5G05 C;  3QWV A;  4W9R A;  3QWW A;  3QOU A;  4I17 A;  4GZ5 A;  3VV0 A;  3OXF A;  1W3B A;  4UQZ A;  5ARG A;  3FFL A;  4MI0 A;  3MEK A;  5LSX A;  3GYZ A;  5DBK A;  5JHN A;  3RJV A;  3S7J A;  5F59 A;  2DBA A;  5EG2 A;  3QDN A;  2KCK A;  4J7F A;  4QEO A;  3KMT A;  4XIF A;  5EKQ D;  4G2V A;  4JA7 A;  3LCA A;  4YVO A;  3OOI A;  4GYY A;  4F3V A;  2KCV A;  3KMA A;  3CEQ A; 
#chains in the Genus database with same CATH topology
 4FAD A;  3RO2 A;  4YPU A;  3CQC B;  4OVV A;  1N0Q A;  1K8K G;  5B1A E;  2R02 A;  4I6J A;  5LP0 A;  4TUM A;  4L9P A;  4HVB A;  2KCL A;  3ZN3 A;  5KWD A;  2UY1 A;  2I9C A;  3T5X A;  3RAU A;  3N71 A;  3ASH A;  4GMJ A;  5ANL A;  2WPV A;  3NQP A;  2GRL A;  3ZFW A;  3EP0 A;  2OND A;  3M59 A;  3ENE A;  5JMN D;  3EIQ C;  4U7E B;  1HS6 A;  4ACK A;  3B7S A;  4H12 A;  4ATZ D;  5FQ8 A;  1V55 E;  4U04 A;  4EEC A;  4H7Y A;  5CRV A;  3M5A A;  3IHY A;  2H6G A;  3HXE A;  4A3V A;  4HRN A;  3CHQ A;  5AYW D;  5BNW A;  1OT8 A;  2IU1 A;  3IV0 A;  4F7A A;  3P2B A;  5D0Q D;  1NFI E;  2KXP C;  3G2S A;  3CLJ A;  2DIW A;  5ENP D;  2MHK A;  1H6K A;  3ZXS A;  4K5B A;  4EZL A;  1DCQ A;  1BU9 A;  2RG8 A;  2Y0B G;  3CVX A;  3K5K A;  3FUI A;  3CQG B;  4HQD A;  2XEE A;  3RAY A;  5ENS D;  5G04 J;  5DIZ A;  1Z5S C;  3PVL A;  5A7D B;  2GRN B;  1IQU A;  4L1B A;  4BY6 A;  3LYA A;  1WAO 1;  4ANV A;  5ENT D;  5AJL A;  5B3S E;  2HM8 A;  3DSV A;  3EHR A;  3VUZ A;  5FQ7 A;  3CKB A;  3HDX A;  3S7D A;  4BSX A;  2OOE A;  2PNN A;  4BX9 A;  4HNA D;  2AXV A;  4I1M A;  3NF1 A;  3PUK A;  3IEG A;  3AJI A;  4ACL A;  2CHX A;  4HOQ A;  3NBN B;  4GAA A;  3DB5 A;  3RJW A;  4G24 A;  1FCH A;  3TXM A;  4GMR A;  2IGQ A;  1O5M A;  3ABK E;  1X5B A;  1TNO A;  1S70 B;  3TWV A;  2H6I A;  1TN6 A;  4KBQ A;  5CCL A;  4J8E A;  3ZHE A;  4TXP A;  2XRY A;  2B0O E;  4AXH A;  2E0I A;  2NSZ A;  2VJ8 A;  3L17 A;  3HHM A;  4GB9 A;  3DAL A;  2AVP A;  4FU3 A;  4HB5 A;  3CSF A;  2I6H A;  1N6A A;  2W5Z A;  5ARF A;  1O9S A;  3LVQ E;  5JJT A;  3R9A B;  5G2N A;  2VSO E;  2QZA A;  1MVH A;  3TXN A;  3FU3 A;  2HYZ A;  3SQV A;  3Q9U C;  4J7W A;  2V0P A;  3ASD A;  3G2V A;  4FLB A;  4L2L A;  5EDS A;  4C48 B;  3EUV A;  2YQ8 A;  4I1A A;  4XI9 A;  1UN8 A;  3MO2 A;  4UWL A;  4JXT A;  2A4Z A;  3LY9 A;  1SZA A;  4FA6 A;  4KVM A;  1YA0 A;  4ME2 A;  2AW6 A;  2A5U A;  2Y4U A;  4FHJ A;  5ENQ D;  4UI9 C;  1ZBP A;  5FIO A;  3BQO A;  4Z4P A;  2WXN A;  3PE4 A;  2RFA A;  4U63 A;  3L16 A;  5T3R A;  3LVR E;  3EIJ A;  2X3M A;  1LF8 A;  4E47 A;  5HQ8 A;  2HO1 A;  1N94 A;  3OS5 A;  3FU0 A;  2R5S A;  2KC7 A;  3FEX A;  4EQF A;  2ZU6 B;  3APD A;  3RRU A;  4AV7 A;  1TNZ A;  4GML A;  4ATG A;  3TWS A;  3Q7F A;  4JZY A;  1Y6I A;  3CHR A;  4DLQ A;  2IJG X;  3F9X A;  3J5Q B;  3PDN A;  4AJW A;  3B7T A;  4I2Z A;  1KZP A;  2EIJ E;  2XPY A;  1LTX A;  4HFG A;  4J7I A;  1ZKK A;  3L9T A;  4N3C A;  4XKC A;  5BXO A;  3CVL A;  1UG3 A;  2WXR A;  2WQH A;  2EIN E;  3ASN E;  3RK6 A;  4M7C A;  4NQ0 A;  5JHB A;  3HXB A;  3UM0 A;  4I6E A;  4RSY A;  5CED B;  3PRE A;  3UM2 A;  4RQI A;  4O1P A;  2OVF A;  2QFC A;  1QQE A;  2KAT A;  2FI7 A;  3C98 A;  1S64 A;  1U3C A;  3MKR A;  3G2W A;  3LPZ A;  2LXM A;  3M54 A;  4PDX A;  3SWC A;  4BFR A;  3DBS A;  4ABN A;  2XCB A;  5T4Y A;  2Y1L E;  3V31 A;  3ML9 A;  5J08 A;  4OYS A;  1QYM A;  4G26 A;  1PC2 A;  3MZL B;  4WWN A;  3UX4 A;  3RSE G;  4WND A;  4GTT A;  5LX8 A;  1MVX A;  3SZ7 A;  1UW4 B;  3ULE G;  2FEZ A;  1OCR E;  5FT9 A;  3B7U X;  4AM9 A;  4D10 C;  4G8K A;  3PUJ A;  2OVB A;  3QWV A;  3RRN B;  3VV0 A;  3FUK A;  3UI2 A;  3EHM A;  3FFL A;  5LSX A;  3S2A A;  3KSQ A;  2DBA A;  1S63 A;  4QEO A;  3HXD A;  3KMT A;  3TWU A;  1DVP A;  2VGE A;  4G2V A;  2P9I G;  3CVV A;  3CEQ A;  1TNU A;  4A55 A;  5TEG A;  3VTY A;  5KNH D;  4B8C B;  3RU0 A;  2WM9 A;  3KMJ A;  1TN8 A;  4EPZ A;  2QC9 A;  2P9L G;  3LKU A;  4EZK A;  3HNA A;  4GTM A;  3Q47 B;  4LNB A;  2GRR B;  1IXV A;  5CBN A;  2JV0 A;  3CGH A;  5KCM A;  2E2E A;  5CCM A;  1HO8 A;  2BKG A;  2VTB A;  5AN8 A;  4NRH B;  4A1S A;  4GYW A;  3URZ A;  4FHK A;  5ANR A;  2AXU A;  5C2Y A;  4JL0 A;  3E34 A;  4APF A;  5A23 A;  5JA4 D;  1YCS B;  3LY8 A;  4TRQ A;  5FJY A;  2PZI A;  4YPA A;  2VGX B;  4EZJ A;  3CR3 A;  3CVW A;  3UMV A;  3FUD A;  4CGV A;  1BI8 B;  1RZ4 A;  5FQ4 A;  4U0Z A;  3C72 A;  1FPP A;  1BLX B;  3U3W A;  5E76 A;  3EU5 A;  3BG0 B;  4DK5 A;  4C9B B;  4Q94 A;  3F9W A;  2WXL A;  4JB8 P;  4YDO A;  2CG2 A;  1U2V G;  2IOL A;  1OWP A;  4Q69 A;  1QNF A;  3Q9N C;  2ZGD A;  3BO5 A;  3SFX A;  2ETA A;  3PEV B;  4AVX A;  3TJP A;  4DX1 A;  3R7Q A;  3BEE A;  5FWQ A;  3P1U A;  3L13 A;  4KXK B;  2FUL A;  4GA1 A;  3PZ2 A;  4IUL A;  2HE0 A;  2L9B A;  4IRU A;  2Y69 E;  3D9I A;  3X2Q E;  2R03 A;  4KMO A;  4GZ6 A;  3ESK A;  4G23 A;  4U0U A;  2PL2 A;  4J8D A;  5C1D A;  3M55 A;  3UIO C;  4N2S A;  1H2V C;  1SZ9 A;  1SVX A;  2WXP A;  5F6K C;  2DVW A;  1DC2 A;  1IQR A;  2P58 C;  5CHE E;  2WXM A;  1ZB1 A;  1AWC B;  2VSY A;  3SF4 A;  4JA9 A;  1A17 A;  4CCA A;  4L23 A;  4DX6 D;  5B1B E;  4CDM A;  3U66 A;  3SW9 A;  3PZ3 A;  4ILG A;  2V4H C;  3FPD A;  2ION A;  3UIN C;  4LER A;  4J8O A;  4HOR A;  2DZO A;  4GZD A;  2R59 A;  4ILI A;  1INZ A;  5CRU A;  3FUM A;  2DWZ A;  1HFA A;  3MCX A;  2LSV A;  3TAX A;  4K03 A;  3UM1 A;  2GRO B;  3MJW A;  4GTQ A;  3UXG A;  4EBA G;  2J09 A;  5KJN A;  4Z68 A;  1D9S A;  4BWR A;  4H7X A;  1NI1 A;  1E8Y A;  2LO6 A;  5AQ9 A;  3DSW A;  3ASO E;  4J0U A;  5H7P A;  4OAV B;  5AAO A;  1PAQ A;  2G46 A;  4I1O B;  4BER A;  4U0S A;  3FUH A;  1MT6 A;  2FF4 A;  5ITZ F;  3AG2 E;  2IOS A;  5CMY A;  2J49 A;  4Y6C A;  3TWT A;  3VTX A;  2VGY A;  2X6K A;  5JJ6 A;  1EPU A;  4BTA A;  3GZS A;  3LY7 A;  4KZ0 A;  4JHK A;  3C3R A;  1RW2 A;  3L08 A;  5LCW J;  3V79 K;  4GYO A;  4PH4 B;  2YHC A;  1AP7 A;  4BUP A;  2LAI A;  4NAC A;  2KZT A;  3UUX A;  3QK0 A;  3CK9 A;  3FDH A;  5CPR B;  4YND A;  4BET A;  2L6J A;  3Q79 A;  3UT8 A;  4HOS A;  4JEU A;  2LUH A;  3SY2 A;  3ABM E;  2V8S E;  3MKQ A;  5EYP F;  3ZIM A;  2AJA A;  3C3Q A;  2V5F A;  3CK7 A;  1XGW A;  2IO2 C;  3ZEF A;  4HRM B;  4DLO A;  3FU5 A;  1KZO A;  4CT4 A;  5HKP A;  2JEK A;  3G2U A;  3ZYL A;  3E4B A;  4JC8 A;  3GZ2 A;  3EHQ A;  4HI9 A;  4BEP A;  4I9C A;  4JVS A;  4QQI A;  3UTM A;  4AIF A;  5CBO A;  3IXE A;  4RVB A;  4A63 B;  2W5Y A;  1EDU A;  3Q4A B;  2XEN A;  4JHJ A;  1B89 A;  1H3I A;  3PZ4 A;  1MZC A;  2I1K A;  3ZPJ A;  4LRZ A;  4HI8 A;  3ZW3 A;  3L82 A;  3M57 A;  1Z6T A;  4YDW A;  4F1S A;  1N0R A;  5TH7 A;  1HH8 A;  2XEH A;  4UQY A;  3LJ3 A;  2XEV A;  2YHE A;  3PH0 C;  4DPR A;  2IY0 C;  4MI5 A;  4F6R D;  3E37 A;  2WQ7 A;  4XX5 A;  2GRQ B;  2X6I A;  3MA5 A;  1IHB A;  4QEN A;  1FVH A;  2NYJ A;  2Y4T A;  4N5C A;  1E7U A;  3ZVV A;  1FT2 A;  2CHZ A;  4GTS A;  1N9A A;  2O8J A;  3SGH A;  4B0Z A;  1H6O A;  2WXJ A;  4I6G A;  3FUF A;  1A5E A;  2MYO A;  5AIJ A;  1N6C A;  2ZIS A;  3AU5 A;  2HR2 A;  2P9S G;  3B7R L;  2XRZ A;  2J07 A;  1ZU2 A;  3QKY A;  5M72 A;  1X81 A;  5BV1 A;  1KPS B;  3OXG A;  4CDR A;  3M56 A;  1YYH A;  2JAB A;  2GGF A;  4DI4 A;  3HG0 D;  5G05 C;  3VLF A;  3BG1 B;  3FH8 A;  1N11 A;  3JXJ A;  2X6H A;  1JWG A;  5LOZ A;  3E32 A;  3Q73 A;  5DBK A;  5AAR A;  3S7J A;  3FTW A;  5F59 A;  2V5Q C;  3DEO A;  2Y3A A;  3ZYK A;  4M3O A;  1MJ0 A;  3QJZ A;  4GTR A;  4CEM A;  5BUZ A;  3ZNG A;  3FTZ A;  1XNF A;  4FLH A;  4PS7 A;  4R7L A;  2WXH A;  2WXF A;  3FTY A;  4WNF A;  3KSL A;  4DUI A;  3T8M A;  2R17 C;  4FP7 A;  3ZU7 B;  2WXI A;  1KLX A;  4I2W A;  3S8P A;  1G3N B;  4AEZ C;  1DNP A;  4O1O A;  3OTN A;  3PNL B;  3F9Y A;  1NZN A;  3QAR A;  1E8Z A;  3CBO A;  1N4Q A;  3IHX A;  1YMP A;  1WG0 A;  2IQC A;  2CFU A;  4LEU A;  1Y8M A;  4BX8 A;  2R3A A;  3DST A;  5LSZ A;  2P9U G;  1ML9 A;  3FH5 A;  3T8K A;  3RKV A;  2QPW A;  1H2U A;  3DSS A;  4WWO A;  5T5G A;  3CVY A;  4GPK A;  5TTF A;  3CHS A;  1PEG A;  4IN3 B;  1IHG A;  3J5P A;  4GA0 A;  4B89 A;  1E7V A;  3I5P A;  3D9P A;  2Q7F A;  4AU7 A;  3HVE B;  3DWL G;  5FIN A;  3O48 A;  5AJD A;  1NA3 A;  4F53 A;  1UJK A;  4K5C A;  1E8W A;  3CKC A;  1HXI A;  3ONK A;  5ENO D;  4YNM A;  4BSZ B;  2XHE A;  1IYG A;  5AYF A;  3AG3 E;  5T0M A;  3ONL A;  3JYS A;  5FQ6 A;  3CVP A;  4HOT A;  2C2L A;  4CGW A;  3T5V A;  4CDN A;  1HE8 A;  3FP3 A;  1NA0 A;  3UKR G;  2XZT G;  1PY1 A;  3TL5 A;  1TN7 A;  4GCO A;  1OXJ A;  1H2T C;  3U9W A;  5BXU A;  4JD2 G;  3U4T A;  2QYU A;  2XGM A;  2H6H A;  1ELR A;  3HIZ A;  5EYL A;  2FBN A;  5KJK A;  2UY1 B;  5EX3 A;  3MX3 A;  2CG3 A;  3TG4 A;  4A1G A;  3V2X A;  4NVQ A;  3LJN A;  3SFY A;  2ILR A;  3GW4 A;  4LUN U;  5D2M C;  3EJN A;  1N95 A;  5FZQ A;  4QEP A;  4N5Q A;  4I43 A;  4UQX A;  2L6B A;  2LNI A;  3SBT B;  5EX0 A;  4BTB A;  1HX8 A;  5AQA A;  2C0L A;  4U96 D;  2ZXW E;  2XGS A;  4HBD A;  2J8S D;  1TEZ A;  4FC8 A;  4P29 A;  3TWR A;  1K3Z D;  3NOC D;  1OUV A;  5J90 A;  4UI9 J;  4ANU A;  3M58 A;  4N3A A;  3CIA A;  5F5E A;  2F0Y A;  2WXG A;  1QZ2 A;  3D9K A;  1S0P A;  5G04 C;  2KBX A;  5T8I A;  5KJM A;  3SHF A;  3D3M A;  1MX6 A;  4AY5 A;  4HLE A;  2LXL A;  5LCW C;  4GZC A;  2XPI A;  4KT6 B;  2J4D A;  3ASF A;  2OCC E;  4XEI G;  1HF8 A;  2ZIR A;  3O4Z A;  5JHA A;  3AAA C;  2BED A;  3F9Z A;  3FUL A;  1UJJ A;  1N4S A;  3MV2 B;  4I9E A;  2IF4 A;  5CEC B;  4K0R A;  1OCZ E;  1HG5 A;  4DX2 A;  3RIB A;  1L5J A;  2J4B A;  1GW6 A;  1V54 E;  5FZS A;  4N3B A;  3L22 A;  4U8Y D;  2KZT B;  3TWQ A;  4NIK A;  1DCE A;  5BPP A;  5KBA A;  3Q15 A;  3QC1 A;  1TNB A;  2VSX E;  3QAQ A;  2VQ2 A;  2XZD G;  1E90 A;  3ZYM A;  4UI9 K;  4O6F A;  3PZD A;  4CZ2 D;  5ENN A;  1OWM A;  4LNU D;  3B13 A;  4CT0 A;  1N54 A;  5D0O D;  4WNG A;  4G11 A;  2R05 A;  4E6H A;  1MHQ A;  4TV3 A;  2QY7 A;  4WUY A;  1Z3Y A;  3HYM B;  3FHE A;  3ESL A;  3FUJ A;  4KYO B;  3TWX A;  4ANW A;  4B94 A;  3V2O A;  4BES A;  3OAW A;  4MRU A;  4NUR A;  4N2Q A;  1Z3X A;  4FJY A;  4APO A;  4C1Q A;  3W9F A;  3NOG D;  3ZHE B;  4KVO A;  4IYP A;  4Q96 A;  4HXI A;  1MYO A;  3UKU G;  4V3I A;  4GCN A;  2F69 A;  4YDY A;  4G25 A;  1Q2Z A;  4FMU A;  2M63 A;  2NXP A;  3L54 A;  4CRW A;  2P2C P;  3CVU A;  1QBQ A;  1U3D A;  2GW1 A;  2X38 A;  3IBE A;  1D8D A;  2IO3 C;  3MO5 A;  1UN9 A;  4GTO A;  3D9N A;  3D9J A;  3QNK A;  1N4P A;  1WM5 A;  3APF A;  4BT9 A;  4UWK A;  1SA4 A;  1H6P A;  5D66 A;  3AU4 A;  3FEY A;  4OAU C;  3OXL A;  3D9H A;  2L0I A;  4MKT A;  1N4R A;  4L2Y A;  1MQS A;  1TYQ G;  2WXK A;  4J6I A;  3TGO A;  3UQ3 A;  3E30 A;  2CHW A;  1FT1 A;  3DSU A;  1IKN D;  3JQ0 A;  1MUF A;  4J83 A;  1OWN A;  2XGO A;  1TR4 A;  4FJZ A;  3HRA A;  2MOW A;  3HXC A;  4U8V D;  3PZ1 A;  1BI7 B;  2ZGG A;  3DPY A;  2BTD A;  4I51 A;  3CHM A;  1LD7 A;  2YIN A;  3DXM G;  2NC9 A;  4JHR A;  2VGX A;  3UT4 A;  3AG1 E;  2PM6 A;  3Q5M A;  2IFU A;  3Q75 A;  3L6A A;  1OY3 D;  3MYV A;  3E33 A;  3QWW A;  4WWP A;  4XE0 A;  1O1T A;  3OXF A;  1W3B A;  4PUC A;  5ARG A;  4ZHB A;  1UOH A;  2OEW A;  4HRL A;  4JPS A;  3GYZ A;  2XQ0 A;  3ZUV B;  4J7F A;  5CMW A;  2ETC A;  3AG4 E;  5EKQ D;  3ZKJ A;  2X6J A;  4GYY A;  4F3V A;  1JCQ A;  5AQ7 A;  2F37 A;  5HS0 A;  2H6F A;  2JLB A;  1NL4 A;  3KEA A;  3FWV A;  4RG9 A;  3U64 A;  2DYS E;  4G8L A;  4LDG A;  4JDS A;  3JCK C;  4JW1 A;  2V4L A;  2WQ6 A;  1N3J A;  3BUA A;  4GA2 A;  5JJ0 A;  1E8X A;  1O1S A;  3LEW A;  3CHP A;  4UWG A;  4TXR A;  3WG7 E;  2RFI A;  3CBP A;  1TJC A;  3DEP A;  4MS6 A;  3D9M A;  2R2L A;  5ENR D;  1MX4 A;  3GZ1 A;  2IEJ A;  3ZXP A;  2XS8 A;  1JPL A;  3SD5 A;  3S7F A;  4JLG A;  2BQZ A;  2I2O A;  3R7R A;  3JUI A;  2L0T B;  3MGB A;  4URK A;  3M53 A;  2QYJ A;  3I4G A;  2WMN A;  4YPE A;  3VLE A;  5EID A;  3VLD A;  2BKK B;  3AS5 A;  1KT1 A;  4E85 A;  3V30 A;  2RKK A;  3F6Q A;  3UM3 A;  3S7B A;  3IKO B;  2GRP B;  3AS8 A;  3RQ4 A;  2I1J A;  3SNX A;  3T9K A;  5IY5 E;  4DX7 D;  4HLL A;  3Q7A A;  1P5Q A;  3CVN A;  5HRY A;  2P9P G;  3FUN A;  2KM4 A;  2A5E A;  2BUG A;  2EIM E;  1K1A A;  3ULY A;  3MV3 B;  1O1R A;  5JIN A;  5CEA A;  3W9G A;  1SA5 A;  3I3N A;  4UUC A;  4RG6 A;  2WB2 A;  1VDY A;  5AQB A;  3QB2 A;  3Q49 B;  2F8X K;  1ELW A;  4RZ0 A;  5G55 A;  4QFV A;  4ILH B;  2AXZ A;  3NAW A;  4XZ4 A;  3IHV A;  3MO0 A;  4LCT A;  5EIB E;  1WY6 A;  2VTB B;  4GU5 A;  3LS8 A;  2DZN A;  5BW8 C;  4YDE A;  3HXF A;  4KZC A;  1BD8 A;  4PS8 A;  3PE3 A;  3CV0 A;  1XQH A;  3FTS A;  2MRI A;  5HI7 A;  3UPV A;  3KEZ A;  2F8Y A;  4JEH A;  3JXI A;  4TXQ A;  1WDY A;  3QWP A;  4G1T A;  3I4R B;  4MBG A;  2LAH A;  4GTV A;  4AOF A;  4IJ8 A;  5T0K A;  3LXU X;  4GPM A;  3UIP C;  4Y6W A;  2DYR E;  3FUE A;  2EIK E;  1JCS A;  3JQ1 A;  3G2T A;  4LSZ E;  3ZRH A;  1TNY A;  3CST A;  2BF0 X;  1OCC E;  4O30 A;  4TUU A;  4DJA A;  3NB2 A;  3WXX A;  2UWJ G;  4UWF A;  4C0E A;  3BU8 A;  3ULQ A;  5BT1 A;  2CFZ A;  2OEV A;  5KJL A;  2AWI A;  4XI0 A;  1OCO E;  2P9K G;  4XKB A;  4LG6 A;  4J8F A;  2PM7 A;  5AEN A;  1HZ4 A;  3C5R A;  3KS2 A;  5F6L A;  1K1B A;  2RFM A;  4N39 A;  3DRA A;  4ZFH A;  1EYH A;  2VSN A;  3NZU A;  2PQR A;  4B8A A;  1JCR A;  3SI5 A;  3D9L A;  3TWW A;  5JIY A;  4AY6 A;  3PNT B;  3K9I A;  2WMO A;  4J8Y A;  1HG2 A;  4IJD A;  1SW6 A;  2J08 A;  4GTP A;  3ZGQ A;  4BT8 A;  4DX5 D;  4EBA A;  3PEU B;  4WAF A;  4DI3 A;  2GRM A;  3C3O A;  3ISM C;  3JUE A;  4NJ5 A;  1SQM A;  2XPZ A;  3FTV A;  4HOU A;  3KAE A;  5KNG A;  2XS1 A;  4K5A B;  1MX2 A;  3B95 A;  2ETB A;  1LD8 A;  4O60 A;  2VYI A;  4GZ3 A;  3Q78 A;  1JUQ A;  3PS6 A;  5BV0 A;  1KT0 A;  3AS4 A;  4MLP A;  3EDT B;  3CVQ A;  4AP2 A;  4DRX E;  1BPO A;  3SO8 A;  1OWL A;  4LNG A;  3OPE A;  1OWO A;  3LDZ A;  5G05 J;  5E75 A;  1JWF A;  4B93 B;  4CYM D;  5A6C A;  2YNQ A;  2FO7 A;  3EHN A;  5EIL A;  5FTP A;  3RRM B;  2P9N G;  3R9M A;  3NZS A;  1H0A A;  4YVQ C;  3ML8 A;  1TJF A;  3DSX A;  4EHM A;  3RO3 A;  2C0M A;  3APC A;  2OV8 A;  2WVI A;  4HS2 A;  4ANX A;  3FU6 A;  2J9Q A;  3PRZ A;  4L7T A;  4F1P A;  4WNE A;  5LFA A;  4J8S A;  4PS3 A;  4YNP A;  3B7B A;  1HU3 A;  2PQN A;  3KD7 A;  3CBM A;  2RD0 A;  4FUL A;  3FH7 A;  3SBS A;  2B6C A;  1E96 B;  1FVF A;  5EN5 D;  3TG5 A;  3CK8 A;  4OVU A;  3DPD A;  2X6F A;  1NP7 A;  5JJ7 A;  4U07 A;  4X8Q A;  2XCC A;  1N52 A;  3MKQ B;  3ASG A;  2LSU A;  5CER B;  5FZR A;  2WXO A;  3EU9 A;  2DCP A;  4C0M A;  1H19 A;  3FY4 A;  2WXQ A;  1EF1 C;  4W9R A;  4U95 D;  3QOU A;  3FTU A;  4I17 A;  4GZ5 A;  1ELK A;  4A3T A;  4UQZ A;  4U8H A;  4MI0 A;  3MEK A;  4UWH A;  3FTX A;  5JHN A;  3HVE A;  4RLY A;  3RJV A;  5EG2 A;  3DXK G;  3QDN A;  3SFZ A;  2KCK A;  3UT7 A;  2EIL E;  2EQX A;  3D9O A;  2FO1 E;  4XIF A;  3CHO A;  3OOI A;  4JA7 A;  4YVO A;  3LCA A;  3ZYQ A;  1D8E A;  2KCV A;  3ABL E;  3KMA A; 
#chains in the Genus database with same CATH homology
 4A55 A;  5TEG A;  3VTY A;  1XNF A;  4FAD A;  2JLB A;  3FWV A;  4B8C B;  4FLH A;  4PS7 A;  4RG9 A;  2WXH A;  4R7L A;  3RU0 A;  2WXF A;  3U64 A;  3FTY A;  3RO2 A;  2WM9 A;  4LDG A;  3KMJ A;  4YPU A;  3CQC B;  4OVV A;  4JDS A;  4WNF A;  4EPZ A;  3JCK C;  3LKU A;  3T8M A;  4JW1 A;  4EZK A;  3HNA A;  4I6J A;  2R17 C;  2V4L A;  5LP0 A;  4FP7 A;  2WQ6 A;  3Q47 B;  1N3J A;  4HVB A;  2KCL A;  4GA2 A;  2WXI A;  3ZN3 A;  5JJ0 A;  1KLX A;  2UY1 A;  1E8X A;  3LEW A;  2I9C A;  3CHP A;  4I2W A;  3S8P A;  3T5X A;  3N71 A;  3ASH A;  4AEZ C;  1DNP A;  2JV0 A;  4GMJ A;  5ANL A;  2WPV A;  3CGH A;  3OTN A;  3PNL B;  4UWG A;  2RFI A;  5KCM A;  3F9Y A;  3NQP A;  2E2E A;  2GRL A;  5CCM A;  1HO8 A;  3CBP A;  1TJC A;  3ZFW A;  3EP0 A;  2OND A;  1NZN A;  2VTB A;  3M59 A;  4NRH B;  3QAR A;  4MS6 A;  3ENE A;  3D9M A;  4A1S A;  4GYW A;  1E8Z A;  3CBO A;  3EIQ C;  3URZ A;  4FHK A;  3IHX A;  1HS6 A;  3GZ1 A;  2AXU A;  5ANR A;  4ACK A;  5C2Y A;  2IQC A;  2CFU A;  3B7S A;  4H12 A;  4LEU A;  5FQ8 A;  1Y8M A;  4JL0 A;  1JPL A;  4BX8 A;  4APF A;  5A23 A;  2R3A A;  3LY8 A;  3SD5 A;  4TRQ A;  5LSZ A;  4U04 A;  5FJY A;  2PZI A;  4EEC A;  4YPA A;  3S7F A;  1ML9 A;  3FH5 A;  2BQZ A;  4JLG A;  2VGX B;  3RKV A;  2QPW A;  4H7Y A;  2I2O A;  4EZJ A;  1H2U A;  3R7R A;  3CR3 A;  4WWO A;  5T5G A;  3M5A A;  3CVW A;  3JUI A;  2L0T B;  3CVY A;  3IHY A;  4GPK A;  3MGB A;  5TTF A;  4URK A;  3M53 A;  3UMV A;  3FUD A;  3I4G A;  4CGV A;  4A3V A;  2WMN A;  3CHS A;  3VLE A;  4YPE A;  1PEG A;  4IN3 B;  1IHG A;  3VLD A;  4GA0 A;  4B89 A;  3AS5 A;  3CHQ A;  1E7V A;  1KT1 A;  5FQ4 A;  3I5P A;  2IU1 A;  4U0Z A;  5AYW D;  4E85 A;  5BNW A;  3IV0 A;  4F7A A;  3U3W A;  3P2B A;  5D0Q D;  5E76 A;  3G2S A;  3D9P A;  3CLJ A;  2Q7F A;  4AU7 A;  2DIW A;  3S7B A;  3BG0 B;  2MHK A;  1H6K A;  3HVE B;  4DK5 A;  3IKO B;  3O48 A;  3AS8 A;  1NA3 A;  2I1J A;  5AJD A;  3SNX A;  3ZXS A;  4F53 A;  4EZL A;  1UJK A;  4C9B B;  1E8W A;  3CKC A;  2RG8 A;  4Q94 A;  3CVX A;  3K5K A;  1HXI A;  1P5Q A;  3ONK A;  3F9W A;  3CVN A;  2WXL A;  3FUI A;  2CG2 A;  4YNM A;  3CQG B;  2XHE A;  1IYG A;  2IOL A;  1OWP A;  3FUN A;  5AYF A;  2KM4 A;  4Q69 A;  1QNF A;  3RAY A;  5T0M A;  3ONL A;  3JYS A;  5FQ6 A;  3CVP A;  5G04 J;  2BUG A;  5DIZ A;  4HOT A;  2C2L A;  4CGW A;  3BO5 A;  3PVL A;  3MV3 B;  3T5V A;  4CDN A;  5JIN A;  3WXX A;  3I3N A;  1HE8 A;  5A7D B;  3FP3 A;  1NA0 A;  3PEV B;  1IQU A;  1PY1 A;  3TL5 A;  4AVX A;  4GCO A;  4L1B A;  1H2T C;  4BY6 A;  3LYA A;  4RG6 A;  1WAO 1;  3U9W A;  2WB2 A;  1VDY A;  3TJP A;  3U4T A;  2XGM A;  3QB2 A;  1ELR A;  3HIZ A;  2FBN A;  3R7Q A;  4ANV A;  5KJK A;  2UY1 B;  5EX3 A;  5AJL A;  3MX3 A;  2CG3 A;  3Q49 B;  3BEE A;  1ELW A;  5FWQ A;  3P1U A;  4RZ0 A;  3L13 A;  2HM8 A;  4KXK B;  5G55 A;  3VUZ A;  5FQ7 A;  4QFV A;  3TG4 A;  2FUL A;  3CKB A;  4ILH B;  4GA1 A;  4A1G A;  3HDX A;  3S7D A;  4NVQ A;  4IUL A;  2AXZ A;  4BSX A;  2L9B A;  4IRU A;  3D9I A;  2ILR A;  4XZ4 A;  3GW4 A;  3IHV A;  4KMO A;  3MO0 A;  4LCT A;  4GZ6 A;  1WY6 A;  4LUN U;  3ESK A;  2VTB B;  4G23 A;  2OOE A;  4GU5 A;  2PL2 A;  4U0U A;  3EJN A;  3LS8 A;  4J8D A;  4BX9 A;  5FZQ A;  5C1D A;  3M55 A;  4N2S A;  2AXV A;  4QEP A;  5BW8 C;  1H2V C;  4I1M A;  1SZ9 A;  4KZC A;  4PS8 A;  2WXP A;  3PE3 A;  4I43 A;  4UQX A;  5F6K C;  3CV0 A;  1IQR A;  2LNI A;  3SBT B;  5EX0 A;  4BTB A;  1XQH A;  3FTS A;  2P58 C;  1HX8 A;  2C0L A;  5CHE E;  3NF1 A;  2MRI A;  2WXM A;  5HI7 A;  3UPV A;  3PUK A;  3IEG A;  4ACL A;  3KEZ A;  2VSY A;  4JEH A;  2CHX A;  2XGS A;  3SF4 A;  4HOQ A;  4JA9 A;  1A17 A;  1TEZ A;  3QWP A;  4CCA A;  4FC8 A;  4L23 A;  4P29 A;  4GAA A;  4CDM A;  1OUV A;  4G1T A;  5J90 A;  3DB5 A;  3RJW A;  3I4R B;  4UI9 J;  4ANU A;  2LAH A;  4AOF A;  3U66 A;  4G24 A;  3M58 A;  1FCH A;  3TXM A;  4N3A A;  3SW9 A;  4IJ8 A;  4ILG A;  3CIA A;  5T0K A;  3FPD A;  3LXU X;  2ION A;  5F5E A;  4Y6W A;  2IGQ A;  1X5B A;  3FUE A;  4LER A;  2WXG A;  1QZ2 A;  3D9K A;  5CCL A;  4KBQ A;  1S0P A;  4J8E A;  5G04 C;  4J8O A;  3ZHE A;  4HOR A;  5T8I A;  5KJM A;  3JQ1 A;  3SHF A;  3G2T A;  3ZRH A;  2XRY A;  4GZD A;  2R59 A;  4ILI A;  1INZ A;  4AXH A;  3CST A;  3D3M A;  2BF0 X;  2E0I A;  3FUM A;  4O30 A;  1HFA A;  3MCX A;  4AY5 A;  2LSV A;  4HLE A;  4TUU A;  4DJA A;  2NSZ A;  3TAX A;  5LCW C;  4K03 A;  2VJ8 A;  4GZC A;  2UWJ G;  2XPI A;  3HHM A;  3L17 A;  3MJW A;  4GB9 A;  2J4D A;  4KT6 B;  3ASF A;  4UWF A;  2AVP A;  2J09 A;  4C0E A;  4EBA G;  5KJN A;  3DAL A;  4BWR A;  4FU3 A;  4H7X A;  3ULQ A;  1HF8 A;  3CSF A;  1E8Y A;  2I6H A;  2CFZ A;  3O4Z A;  5BT1 A;  5JHA A;  1N6A A;  2LO6 A;  2W5Z A;  3F9Z A;  5ARF A;  3FUL A;  3LVQ E;  1UJJ A;  5JJT A;  1O9S A;  3MV2 B;  4I9E A;  2IF4 A;  3R9A B;  5KJL A;  4J0U A;  4K0R A;  1HG5 A;  5G2N A;  2VSO E;  2AWI A;  4XI0 A;  1MVH A;  1PAQ A;  3TXN A;  3RIB A;  4XKB A;  1L5J A;  3FU3 A;  2G46 A;  2HYZ A;  1GW6 A;  2J4B A;  5FZS A;  4I1O B;  2PM7 A;  4J8F A;  4N3B A;  4U0S A;  3FUH A;  5AEN A;  1MT6 A;  3L22 A;  2FF4 A;  2KZT B;  2V0P A;  3ASD A;  1HZ4 A;  2IOS A;  3G2V A;  4FLB A;  4L2L A;  5EDS A;  3KS2 A;  5CMY A;  2J49 A;  4Y6C A;  5BPP A;  5F6L A;  3VTX A;  2VGY A;  2X6K A;  2YQ8 A;  3Q15 A;  4N39 A;  4I1A A;  4XI9 A;  5JJ6 A;  1EYH A;  1EPU A;  2VSN A;  1UN8 A;  3NZU A;  3QC1 A;  2PQR A;  4UWL A;  4BTA A;  3MO2 A;  3GZS A;  4JXT A;  2VSX E;  4B8A A;  3SI5 A;  3LY7 A;  4KZ0 A;  4JHK A;  3D9L A;  2A4Z A;  2VQ2 A;  3QAQ A;  3LY9 A;  5JIY A;  1SZA A;  1E90 A;  4FA6 A;  4KVM A;  3ZYM A;  1YA0 A;  4ME2 A;  4UI9 K;  3PNT B;  2AW6 A;  3K9I A;  4AY6 A;  2WMO A;  3L08 A;  1HG2 A;  4O6F A;  3PZD A;  5LCW J;  5ENN A;  4GYO A;  4PH4 B;  1OWM A;  2YHC A;  2A5U A;  4IJD A;  4BUP A;  2LAI A;  2J08 A;  2Y4U A;  4FHJ A;  4NAC A;  3ZGQ A;  4BT8 A;  2KZT A;  3UUX A;  4EBA A;  4UI9 C;  1ZBP A;  3B13 A;  4CT0 A;  1N54 A;  3QK0 A;  3PEU B;  5D0O D;  4Z4P A;  4WNG A;  4WAF A;  4DI3 A;  4G11 A;  3CK9 A;  2GRM A;  3FDH A;  4YND A;  5CPR B;  4E6H A;  2WXN A;  2L6J A;  1MHQ A;  3PE4 A;  4NJ5 A;  4TV3 A;  3UT8 A;  4JEU A;  1SQM A;  2QY7 A;  2XPZ A;  4U63 A;  4WUY A;  4HOS A;  3FTV A;  1Z3Y A;  3HYM B;  4HOU A;  3L16 A;  3FHE A;  5T3R A;  3ESL A;  3KAE A;  3LVR E;  3EIJ A;  2V8S E;  3FUJ A;  3MKQ A;  2X3M A;  4KYO B;  1LF8 A;  3ZIM A;  4E47 A;  4ANW A;  2V5F A;  4B94 A;  3CK7 A;  1XGW A;  3ZEF A;  3OAW A;  5HQ8 A;  4MRU A;  4NUR A;  4N2Q A;  1Z3X A;  2HO1 A;  4DLO A;  3FU5 A;  3OS5 A;  2VYI A;  4CT4 A;  4FJY A;  3FU0 A;  4GZ3 A;  4APO A;  1JUQ A;  2KC7 A;  2R5S A;  3FEX A;  4C1Q A;  3PS6 A;  5BV0 A;  2JEK A;  3G2U A;  3ZYL A;  4EQF A;  2ZU6 B;  3E4B A;  1KT0 A;  3AS4 A;  4MLP A;  4JC8 A;  3GZ2 A;  3EDT B;  3ZHE B;  4KVO A;  3APD A;  4I9C A;  4JVS A;  4IYP A;  4AIF A;  3CVQ A;  4Q96 A;  4HXI A;  3RRU A;  4AP2 A;  1BPO A;  4AV7 A;  1OWL A;  4RVB A;  3OPE A;  4V3I A;  1OWO A;  3LDZ A;  4GCN A;  4GML A;  2F69 A;  2W5Y A;  4G25 A;  4ATG A;  1EDU A;  5G05 J;  4JZY A;  1Y6I A;  3CHR A;  3Q4A B;  5E75 A;  2M63 A;  1JWF A;  2NXP A;  4DLQ A;  4FMU A;  4JHJ A;  1B89 A;  2IJG X;  3L54 A;  1H3I A;  3F9X A;  5A6C A;  4CRW A;  3CVU A;  2YNQ A;  2FO7 A;  3PDN A;  2I1K A;  1U3D A;  3EHN A;  5FTP A;  2GW1 A;  3RRM B;  2X38 A;  3IBE A;  4AJW A;  3B7T A;  3ZPJ A;  3NZS A;  4I2Z A;  4LRZ A;  1H0A A;  4YVQ C;  1UN9 A;  3MO5 A;  3ML8 A;  1TJF A;  2XPY A;  3RO3 A;  2C0M A;  3ZW3 A;  3APC A;  3D9N A;  2OV8 A;  3M57 A;  4HFG A;  4J7I A;  3D9J A;  1ZKK A;  4N3C A;  2WVI A;  1Z6T A;  4XKC A;  4HS2 A;  4F1S A;  3QNK A;  3CVL A;  4ANX A;  1UG3 A;  2WXR A;  3FU6 A;  5TH7 A;  2WQH A;  1WM5 A;  1HH8 A;  2J9Q A;  3APF A;  3PRZ A;  4UQY A;  4BT9 A;  3LJ3 A;  2XEV A;  2YHE A;  3PH0 C;  4UWK A;  3RK6 A;  4L7T A;  4NQ0 A;  4DPR A;  5JHB A;  4MI5 A;  4WNE A;  5LFA A;  2WQ7 A;  3AU4 A;  3FEY A;  4J8S A;  4PS3 A;  3OXL A;  4XX5 A;  2X6I A;  4I6E A;  3MA5 A;  4YNP A;  4RSY A;  2L0I A;  3PRE A;  4MKT A;  4QEN A;  1HU3 A;  2OVF A;  2PQN A;  1FVH A;  3KD7 A;  4L2Y A;  2QFC A;  3CBM A;  1MQS A;  2Y4T A;  4N5C A;  1QQE A;  2KAT A;  2RD0 A;  2WXK A;  2FI7 A;  4FUL A;  3FH7 A;  4J6I A;  3C98 A;  3SBS A;  1E7U A;  3TGO A;  1U3C A;  3ZVV A;  3MKR A;  3UQ3 A;  3G2W A;  2CHZ A;  3LPZ A;  1E96 B;  2CHW A;  2O8J A;  1FVF A;  3SGH A;  3M54 A;  4PDX A;  3SWC A;  4BFR A;  4B0Z A;  3JQ0 A;  1MUF A;  4J83 A;  1OWN A;  2WXJ A;  2XGO A;  3DBS A;  4I6G A;  3TG5 A;  4ABN A;  4FJZ A;  2XCB A;  3FUF A;  2MOW A;  3CK8 A;  5T4Y A;  5AIJ A;  1N6C A;  4OVU A;  3DPD A;  3ML9 A;  2BTD A;  3AU5 A;  4OYS A;  5J08 A;  2X6F A;  4I51 A;  3B7R L;  2HR2 A;  3CHM A;  1NP7 A;  2J07 A;  4G26 A;  2XRZ A;  1PC2 A;  3MZL B;  1ZU2 A;  3QKY A;  4WWN A;  4U07 A;  2YIN A;  5JJ7 A;  5M72 A;  3UX4 A;  5BV1 A;  4WND A;  2NC9 A;  2XCC A;  1N52 A;  4JHR A;  3OXG A;  3MKQ B;  3ASG A;  5LX8 A;  1MVX A;  2VGX A;  2LSU A;  3SZ7 A;  3UT4 A;  1UW4 B;  5FZR A;  4CDR A;  2FEZ A;  2WXO A;  5FT9 A;  3B7U X;  2PM6 A;  2DCP A;  4AM9 A;  3M56 A;  2GGF A;  3Q5M A;  2IFU A;  3PUJ A;  4D10 C;  4C0M A;  4DI4 A;  1H19 A;  5G05 C;  3FY4 A;  3VLF A;  3L6A A;  2OVB A;  3BG1 B;  3QWV A;  2WXQ A;  1EF1 C;  3FH8 A;  3MYV A;  4W9R A;  3QWW A;  4WWP A;  3QOU A;  3FTU A;  4I17 A;  3RRN B;  4GZ5 A;  4XE0 A;  1ELK A;  4A3T A;  3VV0 A;  3FUK A;  3OXF A;  1W3B A;  4PUC A;  4UQZ A;  3EHM A;  5ARG A;  3FFL A;  4U8H A;  2X6H A;  3MEK A;  4MI0 A;  1JWG A;  5LSX A;  4JPS A;  3GYZ A;  5LOZ A;  3S2A A;  4UWH A;  3FTX A;  5DBK A;  3HVE A;  5JHN A;  3RJV A;  3S7J A;  3FTW A;  2DBA A;  5EG2 A;  5F59 A;  3QDN A;  2XQ0 A;  3SFZ A;  2KCK A;  3UT7 A;  4J7F A;  2EQX A;  4QEO A;  3KMT A;  1DVP A;  2Y3A A;  3D9O A;  5CMW A;  4XIF A;  4M3O A;  3ZYK A;  3CHO A;  3RQ4 A;  3QJZ A;  4G2V A;  4JA7 A;  3LCA A;  4YVO A;  5EKQ D;  3ZYQ A;  4CEM A;  3OOI A;  2X6J A;  4GYY A;  4F3V A;  2KCV A;  3CVV A;  3KMA A;  3CEQ A;  5BUZ A;  3FTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...