3TG5A

Structure of smyd2 in complex with p53 and sah
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
425
structure length
425
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Structure of human SMYD2 reveals the basis of p53 tumor suppressor methylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 137
structure length 425
sequence length 425
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3tg5A03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3tg5A01
3MO5A 1O9SA 4QEOA 4GYOA 3GYZA 1KLXA 3OXGA 4IJ8A 5JJ7A 3ZFWA 3UUXA 1PC2A 2XCCA 4GCOA 4ME2A 2VSYA 3LCAA 3RO3A 2FF4A 4YPAA 2XCBA 4GA0A 3ASGA 3Q4AB 1P5QA 1IYGA 2OOEA 2VYIA 3M59A 5HQ8A 1MUFA 4NVQA 3SZ7A 3MO0A 5EG2A 1TJCA 3F9YA 4A1SA 2VSNA 3IHXA 3CV0A 4BTBA 4UI9C 4UI9J 3Q47B 3M56A 5LCWC 5LCWJ 5HI7A 2IGQA 5T5GA 4H7XA 4GZ3A 3UQ3A 2VQ2A 4J7FA 2W5YA 4WNEA 2AVPA 4KXKB 1ZKKA 1ELRA 2XGMA 1NZNA 4GYYA 4O6FA 1B89A 4BWRA 4GYWA 1XQHA 5G04J 2VGYA 3F9XA 3OPEA 1HZ4A 4N3AA 1YA0A 5DIZA 2NC9A 4GPKA 2C0LA 5FZQA 4G23A 1H3IA 4WNGA 3IEGA 3U4TA 5BT1A 4G24A 4GZ6A 2UY1A 3AS8A 2HYZA 3M54A 3QDNA 1NA3A 1HXIA 5D0QD 3ZPJA 5C1DA 4AM9A 4J7IA 4GCNA 4XI9A 4KYOB 5CHEE 4QEPA 1FCHA 2LNIA 3ZHEB 4AY6A 5TH7A 3RU0A 4RG6A 5LSZA 3ASFA 4Z4PA 4G25A 4CGWA 3LY9A 3CBOA 5D0OD 4H7YA 2JV0A 2QPWA 5FJYA 2QFCA 3SWCA 4U0SA 2PZIA 3UPVA 5JIYA 3S7DA 4W9RA 3ASDA 2LSVA 3RAYA 5F59A 4G1TA 3GW4A 3RIBA 2FI7A 2O8JA 1Y8MA 1QQEA 2BQZA 2MHKA 4C1QA 3OS5A 1XNFA 5FT9A 2J9QA 1W3BA 4AY5A 4I1AA 3M55A 4GA2A 3ASHA 3Q49B 3GZ2A 4NQ0A 3OXFA 4H12A 1HH8A 4JDSA 2FEZA 4YNMA 2R3AA 5TEGA 3MA5A 3LKUA 5EX3A 1WAO1 4JA7A 3EP0A 4J8OA 3VTYA 3QWPA 3MKRA 1NA0A 4GA1A 1IHGA 2Y4TA 4MI5A 3Q5MA 2WPVA 5T0KA 5ARGA 1KT0A 4N5CA 3RJWA 4APOA 3CK8A 4I9EA 3SW9A 5G05C 5F6LA 3BO5A 5JHNA 2FBNA 4U0UA 3CK7A 2JLBA 2FO7A 2KCLA 2YHCA 3ESKA 3M5AA 4YNDA 5FZSA 4O30A 4BT8A 3RJVA 3OXLA 2C0MA 4YPEA 2V5FA 3CVQA 2UWJG 4XIFA 1MT6A 1N6CA 2PL2A 4RG9A 3RKVA 4YVOA 2RFIA 4WNFA 5AYWD 2L6JA 4Y6WA 4BUPA 5A7DB 4AIFA 1WM5A 4UQXA 5FZRA 4ABNA 2YQ8A 5FTPA 5ARFA 5JJ0A 1ML9A 1QZ2A 3AS5A 3ZHEA 2KC7A 3VTXA 3CEQA 3HNAA 3E4BA 4BT9A 2VGXB 1N3JA 3MEKA 1N6AA 5KJMA 4F3VA 4BTAA 3LY8A 3BEEA 2HO1A 4I51A 3GZ1A 4NJ5A 3N71A 3KMJA 3S7FA 4IJDA 4EQFA 4YVQC 4HORA 5CPRB 4JLGA 3TG5A 5JJ6A 4YPUA 4NRHB 1PEGA 3K9IA 3SF4A 4AU7A 2IF4A 4FMUA 5T0MA 4UI9K 3Q15A 4JL0A 3LPZA 2F69A 4UQZA 5CCMA 3MO2A 1E96B 4G26A 4JHRA 2HR2A 5DBKA 2GW1A 3QWVA 4J83A 3DALA 4YNPA 4I2ZA 3JYSA 4G2VA 3F9WA 1ZBPA 5BW8C 5KJLA 3S7BA 5F5EA 3CK9A 4E47A 3O48A 4U0ZA 3QWWA 4N3CA 3TGOA 3M57A 3KD7A 3VV0A 4N39A 2I6HA 5G05J 3ULQA 3QOUA 1A17A 2KCVA 2W5ZA 3S8PA 4XI0A 4MI0A 4LDGA 1OUVA 2P58C 3QKYA 1MVXA 3KS2A 4HOQA 3KAEA 2C2LA 2PQNA 3CVPA 3FFLA 3LY7A 3MV3B 2BUGA 4U07A 2E2EA 5BNWA 4QENA 4LEUA 5JJTA 4GZ5A 5KJKA 2LSUA 3PDNA 4IN3B 2KCKA 4KBQA 2KATA 3EDTB 5LSXA 3PE4A 3HYMB 4HOSA 3F9ZA 3OOIA 4N2SA 4J0UA 4I9CA 5AYFA 5G04C 2XGOA 3CBPA 3M58A 3TG4A 4I17A 1KT1A 3ZN3A 3URZA 2XGSA 2Q7FA 2VGXA 2UY1B 1ELWA 4WUYA 3S7JA 2R5SA 2Y4UA 2WQHA 3RQ4A 4HOUA 4CGVA 4I2WA 4N2QA 4RZ0A 3CVLA 3CVNA 3LYAA 4WNDA 4Y6CA 3MV2B 1ZU2A 5EX0A 5TTFA 2PQRA 3CKCA 5F6KC 5JINA 3R9AB 3U3WA 4J8EA 4J8DA 1MVHA 3VUZA 4B94A 3TAXA 4HOTA 4U04A 3RO2A 4J8FA 2DBAA 5KJNA 3ZGQA 3FPDA 2ONDA 2XPIA 4N3BA 3FWVA 3M53A 5M72A 2IFUA 3AS4A 5CCLA 3K5KA 5A6CA 3CKBA 3NF1A 3FP3A 3KMAA 4JA9A 4CDRA 2G46A 3KMTA 3DB5A 3CBMA 4UQYA 5EKQD 3PE3A 2XEVA 3WXXA
chains in the Genus database with same CATH superfamily
4EHMA 4QEOA 2X38A 2XRYA 4GYOA 3OXGA 2DIWA 5JJ7A 1NP7A 4AVXA 4GCOA 4ME2A 2VSYA 4J8SA 3RO3A 3MGBA 4GA0A 3Q9NC 3M59A 2OOEA 2VYIA 1N94A 5HQ8A 5ITZF 2RFMA 3F9YA 4YDYA 2AJAA 3FUEA 3SY2A 3LXUX 3Q79A 4A3VA 3HDXA 2IOSA 3Q78A 4B89A 4A1GA 4UWFA 2ETAA 3LS8A 3CHMA 1ZKKA 1ELRA 2XGMA 2BEDA 4O60A 4GYYA 4O6FA 1B89A 3LVQE 4BWRA 3CIAA 2MOWA 1N4SA 2RG8A 5J90A 3OPEA 4WNGA 4BESA 5BT1A 1K8KG 3NBNB 1HS6A 2DZOA 3MKQB 4P29A 2XPYA 4J7IA 2DYSE 3DSSA 4F6RD 2ETBA 4KYOB 4A63B 2AWIA 1N4PA 3NZSA 5CHEE 4QEPA 1KZOA 4OAUC 4RG6A 2QYJA 1HE8A 3F6QA 5D0OD 2BKGA 3B7RL 1MX4A 3UT7A 2Y3AA 2QFCA 3SWCA 2V0PA 2IU1A 4CT4A 1SVXA 3E34A 3FTYA 1BLXB 1H19A 3PNLB 3RAYA 3I4GA 3GW4A 1JPLA 1FPPA 4CDNA 2VTBA 1QQEA 3OS5A 1XNFA 5FT9A 3V2OA 3L08A 4GTSA 4RSYA 3ASHA 4NQ0A 3RK6A 3OXFA 3EHQA 2XEHA 4YNMA 4GPMA 5TEGA 1UJJA 3CLJA 4HI8A 1INZA 3JUEA 4YDEA 4YDWA 3FH7A 1IHGA 3VLFA 2Y4TA 1KPSB 3Q5MA 3UINC 4N5CA 3TWTA 3UT8A 3SW9A 3SFXA 4I6JA 3CQGB 4DI3A 3CHPA 3J5PA 4U95D 2FBNA 1L5JA 4U0UA 2JLBA 4ZFHA 2KCLA 4RVBA 1N95A 4XX5A 4GMLA 4YNDA 1KZPA 2R02A 3HVEA 3OXLA 2JEKA 4YPEA 3AG4E 3SI5A 3CVQA 3L54A 4YVOA 2I1JA 2X6FA 3MJWA 3IBEA 5CBOA 1ZB1A 5A7DB 4AIFA 5AQ9A 5FZRA 4GTVA 2OVBA 5CRUA 5ARFA 3UIOC 3T5VA 4C9BB 4CT0A 3D9HA 3TXMA 3VTXA 2R05A 1FT2A 4G8LA 3FY4A 4CCAA 2ETCA 1E8YA 1OWMA 3U66A 4DX2A 2DVWA 3FUKA 1LF8A 4JHKA 1GW6A 1OCRE 1H6KA 3DPYA 3ISMC 3QAQA 3S7FA 4IJDA 4YVQC 3B13A 1TN7A 3G2VA 4PUCA 4XE0A 3ZIMA 1MQSA 1BPOA 3KEZA 4AU7A 4FMUA 3PUKA 1OY3D 4D10C 1O5MA 3LPZA 4EBAA 4E6HA 2GRQB 3ZEFA 2WXJA 4YNPA 4I2ZA 3JYSA 1OCOE 3ZYMA 4TV3A 5KJLA 3PZDA 4A3TA 4E85A 1WY6A 1YCSB 2VSOE 4DLOA 2I9CA 3O48A 3ZYLA 2DZNA 1E7VA 1JCSA 4N39A 5ANRA 3QOUA 1A17A 3S8PA 4XI0A 2RKKA 2LAHA 2R17C 1TJFA 1TNOA 2P58C 3QKYA 1MVXA 3KS2A 3NZUA 4AOFA 2C2LA 2EIKE 1QYMA 2BUGA 1H0AA 2E2EA 5BNWA 3FUHA 4LEUA 5JJTA 4IN3B 5D66A 4CZ2D 1H2TC 2CFZA 1SZAA 5J08A 4KZCA 5E76A 5EIBE 2MRIA 4J0UA 5AYFA 3DSTA 3L13A 4I1MA 3I5PA 4JVSA 3M58A 3SQVA 4JW1A 4I17A 2Q7FA 1N11A 2KZTB 2CG2A 2UY1B 4L2YA 3S7JA 3QB2A 2ZISA 3KSLA 2X6JA 3DXMG 3D9JA 5JHBA 3C98A 1NI1A 3RQ4A 4DK5A 4CGVA 2GGFA 2XS1A 3UXGA 4BX8A 1DVPA 3CVLA 3LYAA 4GTTA 1OT8A 2F8YA 2PQRA 5JINA 4EECA 3U3WA 4U8YD 2XQ0A 4J8EA 3MCXA 1MVHA 5FQ8A 4BETA 4HOTA 2X6IA 3AG1E 1IKND 5KJNA 1Z6TA 5FIOA 3ENEA 3ZNGA 2Y0BG 4AP2A 4N3BA 3ZXPA 4C0MA 2IFUA 3AS4A 3PZ2A 5HRYA 3KMTA 4FP7A 4UQYA 5EKQD 3UIPC 3PE3A 2VJ8A 2RFAA 2NSZA 2OVFA 2OCCE 1MHQA 2WM9A 3RRNB 2WVIA 3AJIA 1TR4A 4PS8A 5BXOA 2XCCA 4UWGA 3UMVA 2A5EA 5KBAA 4C48B 3DBSA 4FLHA 1QBQA 4NVQA 3CSFA 3C5RA 3SZ7A 3MO0A 5EG2A 2VSNA 3CV0A 3PEUB 4BTBA 3E37A 3IV0A 3Q47B 3M56A 2X3MA 4BX9A 1YMPA 5T5GA 4H7XA 4GZ3A 3ABLE 2J8SD 5B3SE 4KXKB 4GYWA 5AARA 2P9SG 2M63A 3F9XA 1EF1C 3ONKA 2C0LA 5FZQA 2H6IA 3AS8A 3SD5A 3M54A 4N5QA 4Q96A 3ML8A 4B8CB 1Z5SC 4PS7A 4GCNA 4FHKA 4ANWA 1FCHA 3ZHEB 3J5QB 3RU0A 5LSZA 3ASFA 3D9KA 3CBOA 1MYOA 2IQCA 1A5EA 2BTDA 4H7YA 3FTSA 4LUNU 3SFZA 2XZTG 1BU9A 4U0SA 2PZIA 5KNHD 4BFRA 1H6OA 4J8YA 4ANVA 3B7UX 3S7DA 4HRLA 2IY0C 4I1OB 4BERA 3ASDA 4AEZC 4XKBA 2WQ6A 4G1TA 4K0RA 1S64A 1Y8MA 3ULEG 3RAUA 5FQ6A 3B7SA 4C1QA 5CBNA 4GTOA 1E90A 1BI8B 1W3BA 4AY5A 2J4BA 2WXPA 3M55A 4WWPA 2CHXA 1K1AA 1DCQA 4L9PA 3T8KA 2E0IA 2KXPC 3Q49B 1HX8A 4DI4A 1TNZA 1O1TA 2EILE 2FEZA 1SW6A 3MA5A 3U9WA 3FULA 1WAO1 1S63A 3E32A 2VGEA 3EP0A 4F7AA 3QWPA 2L6BA 3RRUA 1NA0A 4GA1A 4MI5A 3BQOA 3RJWA 1KT0A 3LDZA 4I9EA 2NYJA 4JEUA 3BO5A 5JHNA 3PUJA 5ENPD 1TNBA 1IXVA 1K3ZD 4L2LA 4UWLA 5G55A 4ANXA 3M5AA 3Q7FA 5AQAA 3TWSA 4HS2A 3DEOA 4BT8A 3RJVA 2WXRA 5BUZA 4B8AA 4XIFA 2PL2A 1EDUA 4MBGA 3RKVA 3MKQA 2RFIA 3V30A 3ZU7B 2L6JA 4Y6WA 3CHQA 2VSXE 1WM5A 4ABNA 2YQ8A 5FTPA 1ML9A 1TN6A 4LRZA 4V3IA 4GMRA 5EDSA 4BT9A 4HRMB 1LD8A 4TRQA 4O1PA 2VGXB 1N3JA 4MLPA 3APFA 3TL5A 2H6FA 5EILA 1N4RA 3B7BA 4L23A 3PNTB 3N71A 3FUFA 4TUMA 5CPRB 3EIJA 4TXPA 3T5XA 3TG5A 4FULA 4TUUA 5JJ6A 3FH8A 2WQ7A 1PEGA 3JXJA 4ILHB 4LERA 1DCEA 2F69A 1Z3XA 3T8MA 4UQZA 1TNUA 1E96B 1MX6A 4ATZD 2F0YA 3FDHA 5B1BE 3ONLA 2HR2A 2CFUA 2GW1A 3LJ3A 4J83A 3CHSA 2DYRE 3F9WA 1PAQA 2A4ZA 3DSVA 5F5EA 3P2BA 4HNAD 3R9MA 3FU3A 3DWLG 4N3CA 2V5QC 3TGOA 2I6HA 4GMJA 4I43A 3PREA 4JZYA 3JUIA 1NL4A 3C3OA 2IONA 3TWVA 5KNGA 4HBDA 3FFLA 3LY7A 4ZHBA 1DNPA 3HXCA 1N54A 3HXBA 2CHZA 1IQUA 4EZLA 5AJLA 3L6AA 5KJKA 2J49A 3D9IA 3FTXA 4KBQA 3ZYKA 2KATA 3EDTB 4GZCA 5LSXA 3PE4A 4BY6A 4KMOA 3AU4A 4I9CA 3TWRA 5G04C 2V4HC 5HKPA 3DXKG 3R7RA 3TG4A 3W9FA 5C2YA 1N4QA 3URZA 2R2LA 3TWWA 4K5BA 3R7QA 1ELWA 3HXDA 2XRZA 1OCCE 1OWNA 3CHOA 3MYVA 1TN8A 4FJZA 3IHVA 3CVNA 1HF8A 3NOCD 1S0PA 2Y69E 3UM0A 3NB2A 1LTXA 5EX0A 3CKCA 3AAAC 4APFA 2X6KA 4FU3A 4IULA 4J8DA 3VUZA 2YINA 4U04A 1OCZE 3RO2A 3UX4A 4TXRA 1WG0A 2ZXWE 2GRMA 3ZGQA 3FPDA 2ONDA 1XGWA 4ILGA 3FWVA 5CCLA 2WB2A 1H2VC 3NF1A 3PVLA 4JPSA 1AP7A 3DB5A 4FADA 3CBMA 3DSWA 3C72A 4AV7A 1KLXA 3V31A 3PEVB 3ZFWA 3UUXA 3CR3A 2J07A 2WXGA 1BD8A 4XZ4A 4JB8P 3TJPA 4GTPA 2FF4A 4YPAA 2HE0A 2XCBA 3ASNE 3ASGA 3Q4AB 1IYGA 2WXMA 3B95A 4URKA 4GB9A 1MUFA 1NFIE 4UUCA 4A1SA 5CEAA 2L9BA 1OWLA 2OEVA 4UI9J 3DSXA 3HRAA 3UKUG 3G2UA 5LCWJ 4MKTA 5HI7A 2IGQA 3UM1A 4OVVA 2B0OE 4XEIG 2EINE 1H2UA 2ZGGA 4CEMA 4J7FA 2AXVA 2IO3C 4WNEA 2W5YA 2AVPA 3RRMB 1VDYA 3BU8A 3C3QA 1E8WA 1Z3YA 1XQHA 2WXQA 2YHEA 4DX6D 1ELKA 2VGYA 5G04J 2LXLA 4N3AA 5DIZA 3B7TA 3VLEA 1H3IA 4G23A 3IEGA 2KZTA 1IQRA 4G24A 3SO8A 2UY1A 3ABME 2HYZA 1QNFA 2I1KA 4MRUA 3QDNA 1NA3A 2JABA 1HXIA 3ZRHA 5D0QD 3ZPJA 1SQMA 3D9OA 5C1DA 4AM9A 2ILRA 4TXQA 1V54E 1EPUA 1BI7B 2GRRB 2LNIA 4AY6A 5FWQA 2QYUA 4DLQA 4G25A 4CGWA 3LY9A 4K5CA 3BG0B 2QPWA 5FJYA 3SBTB 4K5AB 3CVWA 3APDA 2OEWA 2LAIA 5JIYA 1OXJA 2WMOA 2P9LG 3IHYA 5CECB 3JQ0A 3DSUA 2DCPA 2WXOA 4JC8A 5F59A 1MX2A 3RIBA 4UWHA 5AQBA 5FINA 2R03A 2P9IG 5BPPA 4I1AA 1MJ0A 1U3CA 3HXEA 2QZAA 4GA2A 2FO1E 4EZKA 4ACKA 3GZ2A 4H12A 4JXTA 1FVFA 4U96D 1TYQG 4Z68A 1E8ZA 1OWOA 3ESLA 2QY7A 3PS6A 4J8OA 4G8KA 3QARA 3MKRA 3D9MA 3LEWA 3UM2A 5ARGA 4APOA 3CK8A 1JWFA 3CGHA 2PM6A 4LNGA 2FO7A 3RSEG 1JWGA 2YHCA 3OTNA 3ESKA 4DJAA 1OWPA 1S70B 2LUHA 4ACLA 5FQ7A 4M7CA 3O4ZA 4FJYA 4QFVA 5FQ4A 3NQPA 4WWNA 3FUDA 4U7EB 3WG7E 2NXPA 4KZ0A 5AYWD 4XKCA 4BUPA 4WAFA 4UQXA 4GZDA 1HG5A 4Q94A 3FU5A 1QZ2A 3ZHEA 1U3DA 4KVOA 3L16A 2KC7A 3S2AA 5LFAA 3HNAA 3E4BA 3PZ1A 1D8EA 3ZW3A 3MEKA 1N6AA 5ENOD 4F3VA 3G2WA 4U8VD 3LY8A 2HO1A 4I51A 3GZ1A 3CVUA 4LG6A 3D9NA 3UT4A 3TWXA 3PH0C 2ZIRA 3CVVA 4DX5D 2EIJE 2P9KG 4HORA 1EYHA 1WDYA 3FEXA 2L0TB 5ENTD 5ENQD 3V79K 3CQCB 5IY5E 3G2SA 4YPUA 4NRHB 3UI2A 3SF4A 2IF4A 4RQIA 4KVMA 5AQ7A 5T0MA 4UI9K 3OAWA 2FULA 4A55A 3BUAA 5CCMA 3ABKE 4FHJA 4GAAA 1ZBPA 4IRUA 4G11A 1U2VG 4HXIA 1D9SA 1IHBA 3EHMA 4EPZA 4U0ZA 2XHEA 2DWZA 4HQDA 2IJGX 3NOGD 3ASOE 3ULQA 2B6CA 2W5ZA 3Q75A 3AG2E 3LJNA 4B93B 4L7TA 2WXLA 4B0ZA 3I3NA 4HOQA 5ENNA 2PQNA 3CVPA 3MV3B 2BF0X 2BKKB 4U07A 3EU9A 2J08A 3ULYA 4QENA 4GTMA 4I6EA 2XEEA 2LSUA 2MYOA 1YYHA 4BSZB 3CSTA 2J4DA 4DX7D 3HYMB 4HOSA 3F9ZA 4BEPA 3OOIA 2XGOA 3CBPA 3CVXA 2LO6A 3KSQA 4DPRA 5AJDA 5HS0A 4DRXE 3ZN3A 5AENA 3SNXA 2VGXA 4WUYA 3HIZA 3SHFA 1K1BA 4F53A 3C3RA 2KM4A 2CHWA 5T3RA 4HOUA 4I2WA 4RZ0A 3G2TA 1MZCA 3L9TA 3P1UA 4JD2G 1HU3A 2XENA 1FT1A 3MV2B 1ZU2A 5TTFA 3L22A 1JCRA 1JUQA 4NURA 4B94A 1D8DA 3TAXA 1Y6IA 1UG3A 4J8FA 2R59A 2DBAA 2WMNA 5H7PA 5ENRD 4F1PA 3IXEA 5M72A 5A6CA 2IEJA 1Q2ZA 3FP3A 3KMAA 2PNNA 4CDRA 2G46A 3D9PA 5ANLA 1RZ4A 2WXFA 4K03A 3FUIA 3MO5A 1O9SA 3GYZA 4OYSA 4IJ8A 2VTBB 2ZGDA 1DC2A 1PC2A 2H6HA 3V2XA 3LCAA 4HFGA 3FUJA 3QC1A 3X2QE 3DPDA 3QK0A 4J6IA 1P5QA 2IOLA 2XPZA 4QQIA 5BV1A 2PM7A 2Y1LE 4HI9A 4O1OA 3EHNA 3I4RB 1TJCA 3FTZA 4LNBA 3FH5A 3IHXA 2A5UA 4UI9C 2LXMA 4ILIA 5LCWC 4HLEA 2WXHA 5KCMA 4HB5A 4U8HA 4FLBA 3UQ3A 2VQ2A 3FUNA 1NZNA 3FEYA 3NAWA 3W9GA 5B1AE 5CMWA 3FTWA 1HZ4A 3HVEB 4ANUA 1YA0A 3MX3A 2NC9A 4GPKA 1N0QA 2H6GA 2WXIA 1JCQA 3U4TA 4GZ6A 5EYPF 5AIJA 1SA4A 2AW6A 1FVHA 3E33A 4XI9A 3ZKJA 3CHRA 5TH7A 5CERB 4Z4PA 1O1RA 3FTVA 3E30A 2JV0A 4L1BA 3SBSA 4X8QA 4KT6B 2GRPB 3IKOB 4YDOA 2KBXA 3UPVA 4DX1A 4GTRA 1G3NB 4MS6A 3HXFA 4PS3A 3U64A 4W9RA 3QJZA 1UN9A 2LSVA 3AG3E 4NIKA 2X6HA 2FI7A 5EN5D 2O8JA 2BQZA 2MHKA 1HO8A 2J9QA 5ENSD 2YNQA 2GRNB 3MZLB 4J7WA 3JCKC 1HH8A 3L82A 4JDSA 5JMND 1O1SA 3UM3A 3FHEA 2R3AA 3ZXSA 4C0EA 3LKUA 5EX3A 4JA7A 2IO2C 5BXUA 5AAOA 3KEAA 3VTYA 3EIQC 4HRNA 3FU0A 5LP0A 2WPVA 3EHRA 5T0KA 5T4YA 5G05C 5F6LA 4EBAG 5EIDA 5JHAA 3CK7A 1N0RA 3JQ1A 2F37A 5FZSA 4O30A 3D9LA 3PZ4A 2V4LA 5LX8A 4DUIA 5CMYA 2C0MA 4JEHA 4R7LA 2V5FA 2UWJG 3LVRE 1MT6A 1N6CA 4HVBA 1PY1A 4RG9A 3Q7AA 5E75A 4WNFA 4U63A 2I2OA 2EIME 3Q73A 5JJ0A 2XS8A 3AS5A 1TNYA 4EZJA 3DEPA 3CEQA 3HHMA 4AXHA 3EUVA 2GROB 4WWOA 3Q9UC 4F1SA 3ML9A 5KJMA 4LCTA 1UW4B 4Q69A 4BTAA 1X81A 3BEEA 1TEZA 1X5BA 4NJ5A 2AXZA 3QNKA 3FU6A 3KMJA 1AWCB 4IYPA 4EQFA 2EQXA 4JLGA 4HLLA 4BSXA 4NACA 5JA4D 2L0IA 3K9IA 2AXUA 3D3MA 2P9NG 3Q15A 4JL0A 5KWDA 1V55E 4PH4B 3MO2A 3ZUVB 3EU5A 4G26A 1E7UA 4JHRA 5DBKA 3T9KA 3QWVA 2HM8A 3DALA 2XZDG 3SFYA 1UN8A 4G2VA 1HFAA 2J09A 3FTUA 3ZVVA 5BW8C 3CVYA 3S7BA 4CYMD 3JXIA 2QC9A 4LSZE 3CK9A 5CEDB 4M3OA 4E47A 3QWWA 3M57A 3KD7A 4FC8A 1N52A 5A23A 2P9UG 3VV0A 3TWQA 5G05J 2ZU6B 2F8XK 2P2CP 1E8XA 2KCVA 3FUMA 3AU5A 4MI0A 4GTQA 4LNUD 3TXNA 4LDGA 3VLDA 1OUVA 3ZYQA 4FA6A 1N9AA 3APCA 3KAEA 5D2MC 4CRWA 3HG0D 4GZ5A 3PDNA 1UJKA 2KCKA 1RW2A 2GRLA 3UTMA 2WXNA 5LOZA 4ATGA 3L17A 4GU5A 3TWUA 2CG3A 4N2SA 4JHJA 4RLYA 3PZ3A 1KT1A 1SZ9A 2XGSA 4OAVB 2R5SA 2Y4UA 2RD0A 2WQHA 4UWKA 5G2NA 4N2QA 4I6GA 3UKRG 4PDXA 3GZSA 4WNDA 1H6PA 1SA5A 4Y6CA 1HG2A 5EYLA 5BV0A 3PRZA 5F6KC 3R9AB 2WXKA 4AJWA 1UOHA 5AN8A 4OVUA 2XPIA 2OV8A 3DRAA 3SGHA 3M53A 2V8SE 3EJNA 1LD7A 3K5KA 3CKBA 5CRVA 2P9PG 4JA9A 5T8IA 3BG1B 4CDMA 2XEVA 3WXXA
chains in the Genus database with same CATH topology
3MO5A 1O9SA 2NSZA 4QEOA 2X38A 2XRYA 4GYOA 2OVFA 4AV7A 3GYZA 4OYSA 1KLXA 3OXGA 1MHQA 2DIWA 2VTBB 4IJ8A 5JJ7A 1NP7A 3PEVB 3ZFWA 2WM9A 3RRNB 3UUXA 2WVIA 3CR3A 4PS8A 4AVXA 1PC2A 2J07A 2WXGA 2XCCA 4GCOA 4UWGA 4ME2A 4XZ4A 2VSYA 3LCAA 4HFGA 4J8SA 3FUJA 3UMVA 3TJPA 3RO3A 2FF4A 3QC1A 4YPAA 2XCBA 3DPDA 3MGBA 3QK0A 4J6IA 4GA0A 3ASGA 3Q4AB 1P5QA 1IYGA 2IOLA 2OOEA 2VYIA 2WXMA 2XPZA 3M59A 4URKA 5HQ8A 3DBSA 4GB9A 5BV1A 1MUFA 2PM7A 4FLHA 4NVQA 3CSFA 3SZ7A 3EHNA 3I4RB 3MO0A 5EG2A 1TJCA 3F9YA 4A1SA 2VSNA 3FTZA 3FH5A 3CV0A 2A5UA 3IHXA 2L9BA 3PEUB 4BTBA 1OWLA 4UI9C 4UI9J 3FUEA 3IV0A 3Q47B 3G2UA 4ILIA 5LCWC 5LCWJ 4HLEA 3M56A 2X3MA 4MKTA 5HI7A 4BX9A 2WXHA 2IGQA 5KCMA 4OVVA 3LXUX 4A3VA 3HDXA 5T5GA 4H7XA 4U8HA 4FLBA 4GZ3A 3UQ3A 2IOSA 2VQ2A 3FUNA 1H2UA 4B89A 4CEMA 4J7FA 2AXVA 4A1GA 4WNEA 2W5YA 4UWFA 2AVPA 3CHMA 3LS8A 4KXKB 1ZKKA 3RRMB 1ELRA 1VDYA 2XGMA 1NZNA 4GYYA 4O6FA 1B89A 3FEYA 3LVQE 4BWRA 4GYWA 1E8WA 1Z3YA 1XQHA 3CIAA 2MOWA 2WXQA 2YHEA 5CMWA 1ELKA 2VGYA 2RG8A 2M63A 5G04J 3F9XA 5J90A 3OPEA 3FTWA 1HZ4A 3HVEB 1EF1C 3ONKA 4ANUA 4N3AA 1YA0A 3MX3A 5DIZA 2NC9A 3B7TA 2C0LA 5FZQA 4G23A 3VLEA 4GPKA 4WNGA 1H3IA 2WXIA 2KZTA 1IQRA 3IEGA 4G24A 4GZ6A 3U4TA 2UY1A 5BT1A 3AS8A 2HYZA 3SD5A 1QNFA 3M54A 2I1KA 4MRUA 5AIJA 3QDNA 1NA3A 1HS6A 1HXIA 4Q96A 3ZRHA 5D0QD 2AW6A 1SQMA 3D9OA 3ML8A 3MKQB 4P29A 3ZPJA 5C1DA 4B8CB 4AM9A 2XPYA 1FVHA 2ILRA 4J7IA 4PS7A 4GCNA 4XI9A 1EPUA 4KYOB 4FHKA 2AWIA 3NZSA 3CHRA 5CHEE 4QEPA 4ANWA 1FCHA 2LNIA 3ZHEB 4AY6A 5FWQA 5TH7A 4DLQA 3RU0A 4RG6A 5LSZA 3ASFA 1HE8A 3D9KA 3FTVA 4G25A 4Z4PA 4CGWA 3LY9A 3CBOA 2IQCA 2BTDA 5D0OD 4H7YA 3FTSA 3B7RL 2JV0A 4LUNU 3SFZA 3UT7A 3BG0B 4L1BA 3SBSA 2Y3AA 2QPWA 5FJYA 2QFCA 4KT6B 3SWCA 3IKOB 2V0PA 4U0SA 2PZIA 3SBTB 2IU1A 4CT4A 4BFRA 3UPVA 3CVWA 3APDA 2LAIA 4MS6A 4ANVA 5JIYA 2WMOA 3B7UX 3IHYA 3S7DA 4PS3A 3FTYA 3U64A 4I1OB 4W9RA 3ASDA 3JQ0A 1H19A 3PNLB 3QJZA 4AEZC 1UN9A 2DCPA 2WXOA 2LSVA 4XKBA 3I4GA 3RAYA 2WQ6A 4JC8A 5F59A 4G1TA 3GW4A 3RIBA 2X6HA 4UWHA 2FI7A 1JPLA 4K0RA 2O8JA 1Y8MA 3ZYQA 4CDNA 2VTBA 1QQEA 2BQZA 2MHKA 5FQ6A 3B7SA 3OS5A 1XNFA 4C1QA 1E90A 5FT9A 1HO8A 2J9QA 2YNQA 1W3BA 5BPPA 4AY5A 2J4BA 2WXPA 4I1AA 3L08A 4WWPA 3M55A 2CHXA 1U3CA 3MZLB 4RSYA 3JCKC 4GA2A 2E0IA 3ASHA 3Q49B 4ACKA 3GZ2A 1HX8A 4EZKA 4NQ0A 3RK6A 3OXFA 4H12A 1HH8A 4DI4A 4JXTA 1FVFA 4JDSA 2FEZA 4YNMA 3FHEA 2R3AA 5TEGA 1E8ZA 1OWOA 3ZXSA 1UJJA 3MA5A 3U9WA 3LKUA 3FULA 1WAO1 2QY7A 3ESLA 4JA7A 5EX3A 4C0EA 3PS6A 3CLJA 3EP0A 4F7AA 4J8OA 3QARA 3VTYA 3QWPA 3RRUA 3EIQC 1INZA 3MKRA 1NA0A 3D9MA 4GA1A 3FH7A 1IHGA 3VLFA 3FU0A 2Y4TA 4MI5A 3Q5MA 3LEWA 5LP0A 2WPVA 5T0KA 5ARGA 1KT0A 4N5CA 3RJWA 4APOA 3LDZA 3UT8A 3CK8A 4I9EA 4I6JA 3SW9A 5T4YA 5G05C 3CQGB 4DI3A 3CHPA 5F6LA 1JWFA 3CGHA 4JEUA 4EBAG 3BO5A 5JHNA 2PM6A 3PUJA 2FBNA 1L5JA 5JHAA 4U0UA 3CK7A 2JLBA 2FO7A 2KCLA 1JWGA 2YHCA 4L2LA 4RVBA 4FA6A 4UWLA 3OTNA 5G55A 3ESKA 4XX5A 3JQ1A 4ANXA 3M5AA 4GMLA 4YNDA 5FZSA 4DJAA 4HS2A 4O30A 3D9LA 4BT8A 2V4LA 5LX8A 3RJVA 1OWPA 3HVEA 3OXLA 5CMYA 2WXRA 5BUZA 4ACLA 2JEKA 2C0MA 4JEHA 5FQ7A 4B8AA 4YPEA 4R7LA 3O4ZA 2V5FA 3SI5A 3CVQA 4FJYA 2UWJG 4QFVA 5FQ4A 3LVRE 4XIFA 1MT6A 1N6CA 3L54A 3NQPA 4WWNA 4HVBA 1PY1A 3FUDA 2PL2A 4RG9A 1EDUA 3RKVA 4YVOA 2I1JA 5E75A 3MKQA 2RFIA 2X6FA 2NXPA 4WNFA 3MJWA 4KZ0A 5AYWD 4XKCA 2L6JA 3IBEA 4Y6WA 4U63A 2I2OA 3CHQA 4BUPA 5A7DB 4AIFA 4WAFA 2VSXE 1WM5A 4GZDA 4UQXA 5FZRA 4ABNA 1HG5A 2OVBA 2YQ8A 4Q94A 5ARFA 5FTPA 5JJ0A 3FU5A 1ML9A 3T5VA 1QZ2A 3AS5A 3ZHEA 4C9BB 1U3DA 4KVOA 4CT0A 3L16A 4LRZA 3TXMA 2KC7A 3VTXA 4EZJA 4V3IA 3CEQA 3HHMA 3S2AA 4AXHA 3FY4A 4CCAA 5EDSA 5LFAA 3HNAA 3E4BA 4BT9A 1E8YA 1OWMA 3U66A 4TRQA 4WWOA 3ZW3A 2VGXB 4F1SA 1N3JA 3MEKA 3ML9A 5KJMA 1N6AA 4LCTA 4MLPA 1UW4B 4F3VA 4Q69A 3APFA 3G2WA 3FUKA 4BTAA 3TL5A 1LF8A 3LY8A 3BEEA 2HO1A 4I51A 3GZ1A 3CVUA 4JHKA 1GW6A 4L23A 3PNTB 1TEZA 1X5BA 4NJ5A 3D9NA 3UT4A 2AXZA 1H6KA 3QNKA 3FU6A 3PH0C 3QAQA 3N71A 3CVVA 3FUFA 3KMJA 4IYPA 3S7FA 4IJDA 4EQFA 1EYHA 2EQXA 4YVQC 4HORA 5CPRB 4JLGA 3EIJA 3B13A 3FEXA 3G2VA 3T5XA 2L0TB 4PUCA 4XE0A 3TG5A 4FULA 3ZIMA 1MQSA 3CQCB 4BSXA 4TUUA 5JJ6A 3FH8A 3G2SA 4NACA 4YPUA 1BPOA 3KEZA 2WQ7A 4NRHB 1PEGA 2L0IA 3K9IA 3SF4A 4ILHB 4AU7A 2AXUA 2IF4A 4FMUA 3PUKA 4KVMA 3D3MA 4D10C 5T0MA 4UI9K 3Q15A 4LERA 4JL0A 3LPZA 3OAWA 2F69A 2FULA 4B0ZA 4EBAA 1Z3XA 3T8MA 4A55A 4PH4B 4UQZA 4E6HA 5CCMA 3MO2A 1E96B 4G26A 1E7UA 3FDHA 4JHRA 3ONLA 2HR2A 4FHJA 5DBKA 2WXJA 3ZEFA 2CFUA 2GW1A 3LJ3A 3QWVA 4J83A 2HM8A 3CHSA 3DALA 4GAAA 1UN8A 4I2ZA 4YNPA 3JYSA 1HFAA 4G2VA 3ZYMA 3F9WA 1PAQA 1ZBPA 2J09A 3FTUA 2A4ZA 4TV3A 5BW8C 3ZVVA 3PZDA 4A3TA 3S7BA 4IRUA 4G11A 4E85A 4HXIA 3CVYA 5F5EA 3P2BA 1WY6A 3EHMA 3CK9A 2VSOE 3FU3A 4DLOA 4EPZA 4M3OA 2I9CA 4E47A 3O48A 2XHEA 3QWWA 4U0ZA 3ZYLA 4N3CA 3TGOA 3M57A 3KD7A 4FC8A 1N52A 5A23A 3VV0A 1E7VA 2IJGX 4N39A 5ANRA 2I6HA 2ZU6B 5G05J 3ULQA 3QOUA 4GMJA 1A17A 1E8XA 2KCVA 3FUMA 4I43A 2W5ZA 3S8PA 3PREA 4XI0A 4JZYA 3AU5A 3JUIA 2LAHA 2R17C 4MI0A 3TXNA 4L7TA 4LDGA 1TJFA 2IONA 2WXLA 3VLDA 1OUVA 2P58C 3I3NA 3PE3A 3QKYA 3APCA 3KS2A 3NZUA 3KAEA 4HOQA 5ENNA 1MVXA 4AOFA 2C2LA 2PQNA 3CVPA 3FFLA 3LY7A 3MV3B 2BUGA 1DNPA 2BF0X 1H0AA 1N54A 4CRWA 4U07A 2E2EA 2J08A 5BNWA 2CHZA 4QENA 3FUHA 1IQUA 4LEUA 5JJTA 5KJLA 4I6EA 4EZLA 4GZ5A 3L6AA 5AJLA 2J49A 5KJKA 2LSUA 3D9IA 3PDNA 1UJKA 4IN3B 2KCKA 1H2TC 2CFZA 1SZAA 2GRLA 3CSTA 3FTXA 4KBQA 3ZYKA 2J4DA 5J08A 2KATA 2WXNA 3EDTB 4GZCA 5LOZA 4ATGA 5LSXA 3L17A 3PE4A 4GU5A 3HYMB 4KZCA 5E76A 4BY6A 4HOSA 4KMOA 3F9ZA 3OOIA 2CG3A 4N2SA 2MRIA 4J0UA 3AU4A 4I9CA 4JHJA 5AYFA 5G04C 2XGOA 3CBPA 3L13A 4I1MA 3I5PA 4JVSA 3CVXA 3R7RA 2LO6A 3VUZA 4DPRA 5AJDA 4JW1A 3TG4A 3M58A 4I17A 1KT1A 1SZ9A 5C2YA 3ZN3A 5AENA 3URZA 3SNXA 2XGSA 2Q7FA 2KZTB 2CG2A 2VGXA 2UY1B 1ELWA 4WUYA 3R7QA 4L2YA 3S7JA 3HIZA 3QB2A 3SHFA 2X6JA 4F53A 3D9JA 1OWNA 2R5SA 5JHBA 2XRZA 2Y4UA 2RD0A 3C98A 2KM4A 3CHOA 2WQHA 3RQ4A 2CHWA 4UWKA 3MYVA 5T3RA 4DK5A 4HOUA 4CGVA 5G2NA 4I2WA 4N2QA 2GGFA 4BX8A 4FJZA 1DVPA 3IHVA 4RZ0A 4I6GA 3CVLA 3CVNA 4PDXA 1HF8A 3G2TA 3LYAA 1S0PA 3GZSA 3P1UA 4WNDA 1HU3A 4Y6CA 1HG2A 3MV2B 1ZU2A 5EX0A 5TTFA 5BV0A 2PQRA 3CKCA 3L22A 4APFA 2X6KA 3PRZA 4FU3A 5F6KC 4IULA 3R9AB 4EECA 3U3WA 5JINA 2XQ0A 4J8EA 1JUQA 3MCXA 4J8DA 4NURA 3TAXA 2YINA 4B94A 5FQ8A 1MVHA 4HOTA 1Y6IA 2X6IA 1UG3A 4U04A 3RO2A 2WXKA 4J8FA 4AJWA 2R59A 2DBAA 2WMNA 3UX4A 5KJNA 2GRMA 3ZGQA 3FPDA 1Z6TA 2ONDA 3ENEA 1XGWA 4OVUA 2XPIA 4AP2A 4N3BA 2OV8A 4ILGA 3FWVA 3SGHA 4C0MA 2V8SE 3EJNA 5M72A 2IFUA 3AS4A 5CCLA 3M53A 3K5KA 2WB2A 5A6CA 3CKBA 1H2VC 3NF1A 3PVLA 4JPSA 3FP3A 3KMAA 4JA9A 4CDRA 2G46A 3KMTA 4FP7A 3DB5A 3D9PA 4FADA 4UQYA 5EKQD 5ANLA 3CBMA 5T8IA 3BG1B 2WXFA 4K03A 2VJ8A 4CDMA 2XEVA 3WXXA 3FUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MO5 A;  1O9S A;  4QEO A;  4GYO A;  3GYZ A;  1KLX A;  3OXG A;  4IJ8 A;  5JJ7 A;  3ZFW A;  3UUX A;  1PC2 A;  2XCC A;  4GCO A;  4ME2 A;  2VSY A;  3LCA A;  3RO3 A;  2FF4 A;  4YPA A;  2XCB A;  4GA0 A;  3ASG A;  3Q4A B;  1P5Q A;  1IYG A;  2OOE A;  2VYI A;  3M59 A;  5HQ8 A;  1MUF A;  4NVQ A;  3SZ7 A;  3MO0 A;  5EG2 A;  1TJC A;  3F9Y A;  4A1S A;  2VSN A;  3IHX A;  3CV0 A;  4BTB A;  4UI9 C;  4UI9 J;  3Q47 B;  3M56 A;  5LCW C;  5LCW J;  5HI7 A;  2IGQ A;  5T5G A;  4H7X A;  4GZ3 A;  3UQ3 A;  2VQ2 A;  4J7F A;  2W5Y A;  4WNE A;  2AVP A;  4KXK B;  1ZKK A;  1ELR A;  2XGM A;  1NZN A;  4GYY A;  4O6F A;  1B89 A;  4BWR A;  4GYW A;  1XQH A;  5G04 J;  2VGY A;  3F9X A;  3OPE A;  1HZ4 A;  4N3A A;  1YA0 A;  5DIZ A;  2NC9 A;  4GPK A;  2C0L A;  5FZQ A;  4G23 A;  1H3I A;  4WNG A;  3IEG A;  3U4T A;  5BT1 A;  4G24 A;  4GZ6 A;  2UY1 A;  3AS8 A;  2HYZ A;  3M54 A;  3QDN A;  1NA3 A;  1HXI A;  5D0Q D;  3ZPJ A;  5C1D A;  4AM9 A;  4J7I A;  4GCN A;  4XI9 A;  4KYO B;  5CHE E;  4QEP A;  1FCH A;  2LNI A;  3ZHE B;  4AY6 A;  5TH7 A;  3RU0 A;  4RG6 A;  5LSZ A;  3ASF A;  4Z4P A;  4G25 A;  4CGW A;  3LY9 A;  3CBO A;  5D0O D;  4H7Y A;  2JV0 A;  2QPW A;  5FJY A;  2QFC A;  3SWC A;  4U0S A;  2PZI A;  3UPV A;  5JIY A;  3S7D A;  4W9R A;  3ASD A;  2LSV A;  3RAY A;  5F59 A;  4G1T A;  3GW4 A;  3RIB A;  2FI7 A;  2O8J A;  1Y8M A;  1QQE A;  2BQZ A;  2MHK A;  4C1Q A;  3OS5 A;  1XNF A;  5FT9 A;  2J9Q A;  1W3B A;  4AY5 A;  4I1A A;  3M55 A;  4GA2 A;  3ASH A;  3Q49 B;  3GZ2 A;  4NQ0 A;  3OXF A;  4H12 A;  1HH8 A;  4JDS A;  2FEZ A;  4YNM A;  2R3A A;  5TEG A;  3MA5 A;  3LKU A;  5EX3 A;  1WAO 1;  4JA7 A;  3EP0 A;  4J8O A;  3VTY A;  3QWP A;  3MKR A;  1NA0 A;  4GA1 A;  1IHG A;  2Y4T A;  4MI5 A;  3Q5M A;  2WPV A;  5T0K A;  5ARG A;  1KT0 A;  4N5C A;  3RJW A;  4APO A;  3CK8 A;  4I9E A;  3SW9 A;  5G05 C;  5F6L A;  3BO5 A;  5JHN A;  2FBN A;  4U0U A;  3CK7 A;  2JLB A;  2FO7 A;  2KCL A;  2YHC A;  3ESK A;  3M5A A;  4YND A;  5FZS A;  4O30 A;  4BT8 A;  3RJV A;  3OXL A;  2C0M A;  4YPE A;  2V5F A;  3CVQ A;  2UWJ G;  4XIF A;  1MT6 A;  1N6C A;  2PL2 A;  4RG9 A;  3RKV A;  4YVO A;  2RFI A;  4WNF A;  5AYW D;  2L6J A;  4Y6W A;  4BUP A;  5A7D B;  4AIF A;  1WM5 A;  4UQX A;  5FZR A;  4ABN A;  2YQ8 A;  5FTP A;  5ARF A;  5JJ0 A;  1ML9 A;  1QZ2 A;  3AS5 A;  3ZHE A;  2KC7 A;  3VTX A;  3CEQ A;  3HNA A;  3E4B A;  4BT9 A;  2VGX B;  1N3J A;  3MEK A;  1N6A A;  5KJM A;  4F3V A;  4BTA A;  3LY8 A;  3BEE A;  2HO1 A;  4I51 A;  3GZ1 A;  4NJ5 A;  3N71 A;  3KMJ A;  3S7F A;  4IJD A;  4EQF A;  4YVQ C;  4HOR A;  5CPR B;  4JLG A;  3TG5 A;  5JJ6 A;  4YPU A;  4NRH B;  1PEG A;  3K9I A;  3SF4 A;  4AU7 A;  2IF4 A;  4FMU A;  5T0M A;  4UI9 K;  3Q15 A;  4JL0 A;  3LPZ A;  2F69 A;  4UQZ A;  5CCM A;  3MO2 A;  1E96 B;  4G26 A;  4JHR A;  2HR2 A;  5DBK A;  2GW1 A;  3QWV A;  4J83 A;  3DAL A;  4YNP A;  4I2Z A;  3JYS A;  4G2V A;  3F9W A;  1ZBP A;  5BW8 C;  5KJL A;  3S7B A;  5F5E A;  3CK9 A;  4E47 A;  3O48 A;  4U0Z A;  3QWW A;  4N3C A;  3TGO A;  3M57 A;  3KD7 A;  3VV0 A;  4N39 A;  2I6H A;  5G05 J;  3ULQ A;  3QOU A;  1A17 A;  2KCV A;  2W5Z A;  3S8P A;  4XI0 A;  4MI0 A;  4LDG A;  1OUV A;  2P58 C;  3QKY A;  1MVX A;  3KS2 A;  4HOQ A;  3KAE A;  2C2L A;  2PQN A;  3CVP A;  3FFL A;  3LY7 A;  3MV3 B;  2BUG A;  4U07 A;  2E2E A;  5BNW A;  4QEN A;  4LEU A;  5JJT A;  4GZ5 A;  5KJK A;  2LSU A;  3PDN A;  4IN3 B;  2KCK A;  4KBQ A;  2KAT A;  3EDT B;  5LSX A;  3PE4 A;  3HYM B;  4HOS A;  3F9Z A;  3OOI A;  4N2S A;  4J0U A;  4I9C A;  5AYF A;  5G04 C;  2XGO A;  3CBP A;  3M58 A;  3TG4 A;  4I17 A;  1KT1 A;  3ZN3 A;  3URZ A;  2XGS A;  2Q7F A;  2VGX A;  2UY1 B;  1ELW A;  4WUY A;  3S7J A;  2R5S A;  2Y4U A;  2WQH A;  3RQ4 A;  4HOU A;  4CGV A;  4I2W A;  4N2Q A;  4RZ0 A;  3CVL A;  3CVN A;  3LYA A;  4WND A;  4Y6C A;  3MV2 B;  1ZU2 A;  5EX0 A;  5TTF A;  2PQR A;  3CKC A;  5F6K C;  5JIN A;  3R9A B;  3U3W A;  4J8E A;  4J8D A;  1MVH A;  3VUZ A;  4B94 A;  3TAX A;  4HOT A;  4U04 A;  3RO2 A;  4J8F A;  2DBA A;  5KJN A;  3ZGQ A;  3FPD A;  2OND A;  2XPI A;  4N3B A;  3FWV A;  3M53 A;  5M72 A;  2IFU A;  3AS4 A;  5CCL A;  3K5K A;  5A6C A;  3CKB A;  3NF1 A;  3FP3 A;  3KMA A;  4JA9 A;  4CDR A;  2G46 A;  3KMT A;  3DB5 A;  3CBM A;  4UQY A;  5EKQ D;  3PE3 A;  2XEV A;  3WXX A; 
#chains in the Genus database with same CATH topology
 4EHM A;  4QEO A;  2X38 A;  2XRY A;  4GYO A;  3OXG A;  2DIW A;  5JJ7 A;  1NP7 A;  4AVX A;  4GCO A;  4ME2 A;  2VSY A;  4J8S A;  3RO3 A;  3MGB A;  4GA0 A;  3Q9N C;  3M59 A;  2OOE A;  2VYI A;  1N94 A;  5HQ8 A;  5ITZ F;  2RFM A;  3F9Y A;  4YDY A;  2AJA A;  3FUE A;  3SY2 A;  3LXU X;  3Q79 A;  4A3V A;  3HDX A;  2IOS A;  3Q78 A;  4B89 A;  4A1G A;  4UWF A;  2ETA A;  3LS8 A;  3CHM A;  1ZKK A;  1ELR A;  2XGM A;  2BED A;  4O60 A;  4GYY A;  4O6F A;  1B89 A;  3LVQ E;  4BWR A;  3CIA A;  2MOW A;  1N4S A;  2RG8 A;  5J90 A;  3OPE A;  4WNG A;  4BES A;  5BT1 A;  1K8K G;  3NBN B;  1HS6 A;  2DZO A;  3MKQ B;  4P29 A;  2XPY A;  4J7I A;  2DYS E;  3DSS A;  4F6R D;  2ETB A;  4KYO B;  4A63 B;  2AWI A;  1N4P A;  3NZS A;  5CHE E;  4QEP A;  1KZO A;  4OAU C;  4RG6 A;  2QYJ A;  1HE8 A;  3F6Q A;  5D0O D;  2BKG A;  3B7R L;  1MX4 A;  3UT7 A;  2Y3A A;  2QFC A;  3SWC A;  2V0P A;  2IU1 A;  4CT4 A;  1SVX A;  3E34 A;  3FTY A;  1BLX B;  1H19 A;  3PNL B;  3RAY A;  3I4G A;  3GW4 A;  1JPL A;  1FPP A;  4CDN A;  2VTB A;  1QQE A;  3OS5 A;  1XNF A;  5FT9 A;  3V2O A;  3L08 A;  4GTS A;  4RSY A;  3ASH A;  4NQ0 A;  3RK6 A;  3OXF A;  3EHQ A;  2XEH A;  4YNM A;  4GPM A;  5TEG A;  1UJJ A;  3CLJ A;  4HI8 A;  1INZ A;  3JUE A;  4YDE A;  4YDW A;  3FH7 A;  1IHG A;  3VLF A;  2Y4T A;  1KPS B;  3Q5M A;  3UIN C;  4N5C A;  3TWT A;  3UT8 A;  3SW9 A;  3SFX A;  4I6J A;  3CQG B;  4DI3 A;  3CHP A;  3J5P A;  4U95 D;  2FBN A;  1L5J A;  4U0U A;  2JLB A;  4ZFH A;  2KCL A;  4RVB A;  1N95 A;  4XX5 A;  4GML A;  4YND A;  1KZP A;  2R02 A;  3HVE A;  3OXL A;  2JEK A;  4YPE A;  3AG4 E;  3SI5 A;  3CVQ A;  3L54 A;  4YVO A;  2I1J A;  2X6F A;  3MJW A;  3IBE A;  5CBO A;  1ZB1 A;  5A7D B;  4AIF A;  5AQ9 A;  5FZR A;  4GTV A;  2OVB A;  5CRU A;  5ARF A;  3UIO C;  3T5V A;  4C9B B;  4CT0 A;  3D9H A;  3TXM A;  3VTX A;  2R05 A;  1FT2 A;  4G8L A;  3FY4 A;  4CCA A;  2ETC A;  1E8Y A;  1OWM A;  3U66 A;  4DX2 A;  2DVW A;  3FUK A;  1LF8 A;  4JHK A;  1GW6 A;  1OCR E;  1H6K A;  3DPY A;  3ISM C;  3QAQ A;  3S7F A;  4IJD A;  4YVQ C;  3B13 A;  1TN7 A;  3G2V A;  4PUC A;  4XE0 A;  3ZIM A;  1MQS A;  1BPO A;  3KEZ A;  4AU7 A;  4FMU A;  3PUK A;  1OY3 D;  4D10 C;  1O5M A;  3LPZ A;  4EBA A;  4E6H A;  2GRQ B;  3ZEF A;  2WXJ A;  4YNP A;  4I2Z A;  3JYS A;  1OCO E;  3ZYM A;  4TV3 A;  5KJL A;  3PZD A;  4A3T A;  4E85 A;  1WY6 A;  1YCS B;  2VSO E;  4DLO A;  2I9C A;  3O48 A;  3ZYL A;  2DZN A;  1E7V A;  1JCS A;  4N39 A;  5ANR A;  3QOU A;  1A17 A;  3S8P A;  4XI0 A;  2RKK A;  2LAH A;  2R17 C;  1TJF A;  1TNO A;  2P58 C;  3QKY A;  1MVX A;  3KS2 A;  3NZU A;  4AOF A;  2C2L A;  2EIK E;  1QYM A;  2BUG A;  1H0A A;  2E2E A;  5BNW A;  3FUH A;  4LEU A;  5JJT A;  4IN3 B;  5D66 A;  4CZ2 D;  1H2T C;  2CFZ A;  1SZA A;  5J08 A;  4KZC A;  5E76 A;  5EIB E;  2MRI A;  4J0U A;  5AYF A;  3DST A;  3L13 A;  4I1M A;  3I5P A;  4JVS A;  3M58 A;  3SQV A;  4JW1 A;  4I17 A;  2Q7F A;  1N11 A;  2KZT B;  2CG2 A;  2UY1 B;  4L2Y A;  3S7J A;  3QB2 A;  2ZIS A;  3KSL A;  2X6J A;  3DXM G;  3D9J A;  5JHB A;  3C98 A;  1NI1 A;  3RQ4 A;  4DK5 A;  4CGV A;  2GGF A;  2XS1 A;  3UXG A;  4BX8 A;  1DVP A;  3CVL A;  3LYA A;  4GTT A;  1OT8 A;  2F8Y A;  2PQR A;  5JIN A;  4EEC A;  3U3W A;  4U8Y D;  2XQ0 A;  4J8E A;  3MCX A;  1MVH A;  5FQ8 A;  4BET A;  4HOT A;  2X6I A;  3AG1 E;  1IKN D;  5KJN A;  1Z6T A;  5FIO A;  3ENE A;  3ZNG A;  2Y0B G;  4AP2 A;  4N3B A;  3ZXP A;  4C0M A;  2IFU A;  3AS4 A;  3PZ2 A;  5HRY A;  3KMT A;  4FP7 A;  4UQY A;  5EKQ D;  3UIP C;  3PE3 A;  2VJ8 A;  2RFA A;  2NSZ A;  2OVF A;  2OCC E;  1MHQ A;  2WM9 A;  3RRN B;  2WVI A;  3AJI A;  1TR4 A;  4PS8 A;  5BXO A;  2XCC A;  4UWG A;  3UMV A;  2A5E A;  5KBA A;  4C48 B;  3DBS A;  4FLH A;  1QBQ A;  4NVQ A;  3CSF A;  3C5R A;  3SZ7 A;  3MO0 A;  5EG2 A;  2VSN A;  3CV0 A;  3PEU B;  4BTB A;  3E37 A;  3IV0 A;  3Q47 B;  3M56 A;  2X3M A;  4BX9 A;  1YMP A;  5T5G A;  4H7X A;  4GZ3 A;  3ABL E;  2J8S D;  5B3S E;  4KXK B;  4GYW A;  5AAR A;  2P9S G;  2M63 A;  3F9X A;  1EF1 C;  3ONK A;  2C0L A;  5FZQ A;  2H6I A;  3AS8 A;  3SD5 A;  3M54 A;  4N5Q A;  4Q96 A;  3ML8 A;  4B8C B;  1Z5S C;  4PS7 A;  4GCN A;  4FHK A;  4ANW A;  1FCH A;  3ZHE B;  3J5Q B;  3RU0 A;  5LSZ A;  3ASF A;  3D9K A;  3CBO A;  1MYO A;  2IQC A;  1A5E A;  2BTD A;  4H7Y A;  3FTS A;  4LUN U;  3SFZ A;  2XZT G;  1BU9 A;  4U0S A;  2PZI A;  5KNH D;  4BFR A;  1H6O A;  4J8Y A;  4ANV A;  3B7U X;  3S7D A;  4HRL A;  2IY0 C;  4I1O B;  4BER A;  3ASD A;  4AEZ C;  4XKB A;  2WQ6 A;  4G1T A;  4K0R A;  1S64 A;  1Y8M A;  3ULE G;  3RAU A;  5FQ6 A;  3B7S A;  4C1Q A;  5CBN A;  4GTO A;  1E90 A;  1BI8 B;  1W3B A;  4AY5 A;  2J4B A;  2WXP A;  3M55 A;  4WWP A;  2CHX A;  1K1A A;  1DCQ A;  4L9P A;  3T8K A;  2E0I A;  2KXP C;  3Q49 B;  1HX8 A;  4DI4 A;  1TNZ A;  1O1T A;  2EIL E;  2FEZ A;  1SW6 A;  3MA5 A;  3U9W A;  3FUL A;  1WAO 1;  1S63 A;  3E32 A;  2VGE A;  3EP0 A;  4F7A A;  3QWP A;  2L6B A;  3RRU A;  1NA0 A;  4GA1 A;  4MI5 A;  3BQO A;  3RJW A;  1KT0 A;  3LDZ A;  4I9E A;  2NYJ A;  4JEU A;  3BO5 A;  5JHN A;  3PUJ A;  5ENP D;  1TNB A;  1IXV A;  1K3Z D;  4L2L A;  4UWL A;  5G55 A;  4ANX A;  3M5A A;  3Q7F A;  5AQA A;  3TWS A;  4HS2 A;  3DEO A;  4BT8 A;  3RJV A;  2WXR A;  5BUZ A;  4B8A A;  4XIF A;  2PL2 A;  1EDU A;  4MBG A;  3RKV A;  3MKQ A;  2RFI A;  3V30 A;  3ZU7 B;  2L6J A;  4Y6W A;  3CHQ A;  2VSX E;  1WM5 A;  4ABN A;  2YQ8 A;  5FTP A;  1ML9 A;  1TN6 A;  4LRZ A;  4V3I A;  4GMR A;  5EDS A;  4BT9 A;  4HRM B;  1LD8 A;  4TRQ A;  4O1P A;  2VGX B;  1N3J A;  4MLP A;  3APF A;  3TL5 A;  2H6F A;  5EIL A;  1N4R A;  3B7B A;  4L23 A;  3PNT B;  3N71 A;  3FUF A;  4TUM A;  5CPR B;  3EIJ A;  4TXP A;  3T5X A;  3TG5 A;  4FUL A;  4TUU A;  5JJ6 A;  3FH8 A;  2WQ7 A;  1PEG A;  3JXJ A;  4ILH B;  4LER A;  1DCE A;  2F69 A;  1Z3X A;  3T8M A;  4UQZ A;  1TNU A;  1E96 B;  1MX6 A;  4ATZ D;  2F0Y A;  3FDH A;  5B1B E;  3ONL A;  2HR2 A;  2CFU A;  2GW1 A;  3LJ3 A;  4J83 A;  3CHS A;  2DYR E;  3F9W A;  1PAQ A;  2A4Z A;  3DSV A;  5F5E A;  3P2B A;  4HNA D;  3R9M A;  3FU3 A;  3DWL G;  4N3C A;  2V5Q C;  3TGO A;  2I6H A;  4GMJ A;  4I43 A;  3PRE A;  4JZY A;  3JUI A;  1NL4 A;  3C3O A;  2ION A;  3TWV A;  5KNG A;  4HBD A;  3FFL A;  3LY7 A;  4ZHB A;  1DNP A;  3HXC A;  1N54 A;  3HXB A;  2CHZ A;  1IQU A;  4EZL A;  5AJL A;  3L6A A;  5KJK A;  2J49 A;  3D9I A;  3FTX A;  4KBQ A;  3ZYK A;  2KAT A;  3EDT B;  4GZC A;  5LSX A;  3PE4 A;  4BY6 A;  4KMO A;  3AU4 A;  4I9C A;  3TWR A;  5G04 C;  2V4H C;  5HKP A;  3DXK G;  3R7R A;  3TG4 A;  3W9F A;  5C2Y A;  1N4Q A;  3URZ A;  2R2L A;  3TWW A;  4K5B A;  3R7Q A;  1ELW A;  3HXD A;  2XRZ A;  1OCC E;  1OWN A;  3CHO A;  3MYV A;  1TN8 A;  4FJZ A;  3IHV A;  3CVN A;  1HF8 A;  3NOC D;  1S0P A;  2Y69 E;  3UM0 A;  3NB2 A;  1LTX A;  5EX0 A;  3CKC A;  3AAA C;  4APF A;  2X6K A;  4FU3 A;  4IUL A;  4J8D A;  3VUZ A;  2YIN A;  4U04 A;  1OCZ E;  3RO2 A;  3UX4 A;  4TXR A;  1WG0 A;  2ZXW E;  2GRM A;  3ZGQ A;  3FPD A;  2OND A;  1XGW A;  4ILG A;  3FWV A;  5CCL A;  2WB2 A;  1H2V C;  3NF1 A;  3PVL A;  4JPS A;  1AP7 A;  3DB5 A;  4FAD A;  3CBM A;  3DSW A;  3C72 A;  4AV7 A;  1KLX A;  3V31 A;  3PEV B;  3ZFW A;  3UUX A;  3CR3 A;  2J07 A;  2WXG A;  1BD8 A;  4XZ4 A;  4JB8 P;  3TJP A;  4GTP A;  2FF4 A;  4YPA A;  2HE0 A;  2XCB A;  3ASN E;  3ASG A;  3Q4A B;  1IYG A;  2WXM A;  3B95 A;  4URK A;  4GB9 A;  1MUF A;  1NFI E;  4UUC A;  4A1S A;  5CEA A;  2L9B A;  1OWL A;  2OEV A;  4UI9 J;  3DSX A;  3HRA A;  3UKU G;  3G2U A;  5LCW J;  4MKT A;  5HI7 A;  2IGQ A;  3UM1 A;  4OVV A;  2B0O E;  4XEI G;  2EIN E;  1H2U A;  2ZGG A;  4CEM A;  4J7F A;  2AXV A;  2IO3 C;  4WNE A;  2W5Y A;  2AVP A;  3RRM B;  1VDY A;  3BU8 A;  3C3Q A;  1E8W A;  1Z3Y A;  1XQH A;  2WXQ A;  2YHE A;  4DX6 D;  1ELK A;  2VGY A;  5G04 J;  2LXL A;  4N3A A;  5DIZ A;  3B7T A;  3VLE A;  1H3I A;  4G23 A;  3IEG A;  2KZT A;  1IQR A;  4G24 A;  3SO8 A;  2UY1 A;  3ABM E;  2HYZ A;  1QNF A;  2I1K A;  4MRU A;  3QDN A;  1NA3 A;  2JAB A;  1HXI A;  3ZRH A;  5D0Q D;  3ZPJ A;  1SQM A;  3D9O A;  5C1D A;  4AM9 A;  2ILR A;  4TXQ A;  1V54 E;  1EPU A;  1BI7 B;  2GRR B;  2LNI A;  4AY6 A;  5FWQ A;  2QYU A;  4DLQ A;  4G25 A;  4CGW A;  3LY9 A;  4K5C A;  3BG0 B;  2QPW A;  5FJY A;  3SBT B;  4K5A B;  3CVW A;  3APD A;  2OEW A;  2LAI A;  5JIY A;  1OXJ A;  2WMO A;  2P9L G;  3IHY A;  5CEC B;  3JQ0 A;  3DSU A;  2DCP A;  2WXO A;  4JC8 A;  5F59 A;  1MX2 A;  3RIB A;  4UWH A;  5AQB A;  5FIN A;  2R03 A;  2P9I G;  5BPP A;  4I1A A;  1MJ0 A;  1U3C A;  3HXE A;  2QZA A;  4GA2 A;  2FO1 E;  4EZK A;  4ACK A;  3GZ2 A;  4H12 A;  4JXT A;  1FVF A;  4U96 D;  1TYQ G;  4Z68 A;  1E8Z A;  1OWO A;  3ESL A;  2QY7 A;  3PS6 A;  4J8O A;  4G8K A;  3QAR A;  3MKR A;  3D9M A;  3LEW A;  3UM2 A;  5ARG A;  4APO A;  3CK8 A;  1JWF A;  3CGH A;  2PM6 A;  4LNG A;  2FO7 A;  3RSE G;  1JWG A;  2YHC A;  3OTN A;  3ESK A;  4DJA A;  1OWP A;  1S70 B;  2LUH A;  4ACL A;  5FQ7 A;  4M7C A;  3O4Z A;  4FJY A;  4QFV A;  5FQ4 A;  3NQP A;  4WWN A;  3FUD A;  4U7E B;  3WG7 E;  2NXP A;  4KZ0 A;  5AYW D;  4XKC A;  4BUP A;  4WAF A;  4UQX A;  4GZD A;  1HG5 A;  4Q94 A;  3FU5 A;  1QZ2 A;  3ZHE A;  1U3D A;  4KVO A;  3L16 A;  2KC7 A;  3S2A A;  5LFA A;  3HNA A;  3E4B A;  3PZ1 A;  1D8E A;  3ZW3 A;  3MEK A;  1N6A A;  5ENO D;  4F3V A;  3G2W A;  4U8V D;  3LY8 A;  2HO1 A;  4I51 A;  3GZ1 A;  3CVU A;  4LG6 A;  3D9N A;  3UT4 A;  3TWX A;  3PH0 C;  2ZIR A;  3CVV A;  4DX5 D;  2EIJ E;  2P9K G;  4HOR A;  1EYH A;  1WDY A;  3FEX A;  2L0T B;  5ENT D;  5ENQ D;  3V79 K;  3CQC B;  5IY5 E;  3G2S A;  4YPU A;  4NRH B;  3UI2 A;  3SF4 A;  2IF4 A;  4RQI A;  4KVM A;  5AQ7 A;  5T0M A;  4UI9 K;  3OAW A;  2FUL A;  4A55 A;  3BUA A;  5CCM A;  3ABK E;  4FHJ A;  4GAA A;  1ZBP A;  4IRU A;  4G11 A;  1U2V G;  4HXI A;  1D9S A;  1IHB A;  3EHM A;  4EPZ A;  4U0Z A;  2XHE A;  2DWZ A;  4HQD A;  2IJG X;  3NOG D;  3ASO E;  3ULQ A;  2B6C A;  2W5Z A;  3Q75 A;  3AG2 E;  3LJN A;  4B93 B;  4L7T A;  2WXL A;  4B0Z A;  3I3N A;  4HOQ A;  5ENN A;  2PQN A;  3CVP A;  3MV3 B;  2BF0 X;  2BKK B;  4U07 A;  3EU9 A;  2J08 A;  3ULY A;  4QEN A;  4GTM A;  4I6E A;  2XEE A;  2LSU A;  2MYO A;  1YYH A;  4BSZ B;  3CST A;  2J4D A;  4DX7 D;  3HYM B;  4HOS A;  3F9Z A;  4BEP A;  3OOI A;  2XGO A;  3CBP A;  3CVX A;  2LO6 A;  3KSQ A;  4DPR A;  5AJD A;  5HS0 A;  4DRX E;  3ZN3 A;  5AEN A;  3SNX A;  2VGX A;  4WUY A;  3HIZ A;  3SHF A;  1K1B A;  4F53 A;  3C3R A;  2KM4 A;  2CHW A;  5T3R A;  4HOU A;  4I2W A;  4RZ0 A;  3G2T A;  1MZC A;  3L9T A;  3P1U A;  4JD2 G;  1HU3 A;  2XEN A;  1FT1 A;  3MV2 B;  1ZU2 A;  5TTF A;  3L22 A;  1JCR A;  1JUQ A;  4NUR A;  4B94 A;  1D8D A;  3TAX A;  1Y6I A;  1UG3 A;  4J8F A;  2R59 A;  2DBA A;  2WMN A;  5H7P A;  5ENR D;  4F1P A;  3IXE A;  5M72 A;  5A6C A;  2IEJ A;  1Q2Z A;  3FP3 A;  3KMA A;  2PNN A;  4CDR A;  2G46 A;  3D9P A;  5ANL A;  1RZ4 A;  2WXF A;  4K03 A;  3FUI A;  3MO5 A;  1O9S A;  3GYZ A;  4OYS A;  4IJ8 A;  2VTB B;  2ZGD A;  1DC2 A;  1PC2 A;  2H6H A;  3V2X A;  3LCA A;  4HFG A;  3FUJ A;  3QC1 A;  3X2Q E;  3DPD A;  3QK0 A;  4J6I A;  1P5Q A;  2IOL A;  2XPZ A;  4QQI A;  5BV1 A;  2PM7 A;  2Y1L E;  4HI9 A;  4O1O A;  3EHN A;  3I4R B;  1TJC A;  3FTZ A;  4LNB A;  3FH5 A;  3IHX A;  2A5U A;  4UI9 C;  2LXM A;  4ILI A;  5LCW C;  4HLE A;  2WXH A;  5KCM A;  4HB5 A;  4U8H A;  4FLB A;  3UQ3 A;  2VQ2 A;  3FUN A;  1NZN A;  3FEY A;  3NAW A;  3W9G A;  5B1A E;  5CMW A;  3FTW A;  1HZ4 A;  3HVE B;  4ANU A;  1YA0 A;  3MX3 A;  2NC9 A;  4GPK A;  1N0Q A;  2H6G A;  2WXI A;  1JCQ A;  3U4T A;  4GZ6 A;  5EYP F;  5AIJ A;  1SA4 A;  2AW6 A;  1FVH A;  3E33 A;  4XI9 A;  3ZKJ A;  3CHR A;  5TH7 A;  5CER B;  4Z4P A;  1O1R A;  3FTV A;  3E30 A;  2JV0 A;  4L1B A;  3SBS A;  4X8Q A;  4KT6 B;  2GRP B;  3IKO B;  4YDO A;  2KBX A;  3UPV A;  4DX1 A;  4GTR A;  1G3N B;  4MS6 A;  3HXF A;  4PS3 A;  3U64 A;  4W9R A;  3QJZ A;  1UN9 A;  2LSV A;  3AG3 E;  4NIK A;  2X6H A;  2FI7 A;  5EN5 D;  2O8J A;  2BQZ A;  2MHK A;  1HO8 A;  2J9Q A;  5ENS D;  2YNQ A;  2GRN B;  3MZL B;  4J7W A;  3JCK C;  1HH8 A;  3L82 A;  4JDS A;  5JMN D;  1O1S A;  3UM3 A;  3FHE A;  2R3A A;  3ZXS A;  4C0E A;  3LKU A;  5EX3 A;  4JA7 A;  2IO2 C;  5BXU A;  5AAO A;  3KEA A;  3VTY A;  3EIQ C;  4HRN A;  3FU0 A;  5LP0 A;  2WPV A;  3EHR A;  5T0K A;  5T4Y A;  5G05 C;  5F6L A;  4EBA G;  5EID A;  5JHA A;  3CK7 A;  1N0R A;  3JQ1 A;  2F37 A;  5FZS A;  4O30 A;  3D9L A;  3PZ4 A;  2V4L A;  5LX8 A;  4DUI A;  5CMY A;  2C0M A;  4JEH A;  4R7L A;  2V5F A;  2UWJ G;  3LVR E;  1MT6 A;  1N6C A;  4HVB A;  1PY1 A;  4RG9 A;  3Q7A A;  5E75 A;  4WNF A;  4U63 A;  2I2O A;  2EIM E;  3Q73 A;  5JJ0 A;  2XS8 A;  3AS5 A;  1TNY A;  4EZJ A;  3DEP A;  3CEQ A;  3HHM A;  4AXH A;  3EUV A;  2GRO B;  4WWO A;  3Q9U C;  4F1S A;  3ML9 A;  5KJM A;  4LCT A;  1UW4 B;  4Q69 A;  4BTA A;  1X81 A;  3BEE A;  1TEZ A;  1X5B A;  4NJ5 A;  2AXZ A;  3QNK A;  3FU6 A;  3KMJ A;  1AWC B;  4IYP A;  4EQF A;  2EQX A;  4JLG A;  4HLL A;  4BSX A;  4NAC A;  5JA4 D;  2L0I A;  3K9I A;  2AXU A;  3D3M A;  2P9N G;  3Q15 A;  4JL0 A;  5KWD A;  1V55 E;  4PH4 B;  3MO2 A;  3ZUV B;  3EU5 A;  4G26 A;  1E7U A;  4JHR A;  5DBK A;  3T9K A;  3QWV A;  2HM8 A;  3DAL A;  2XZD G;  3SFY A;  1UN8 A;  4G2V A;  1HFA A;  2J09 A;  3FTU A;  3ZVV A;  5BW8 C;  3CVY A;  3S7B A;  4CYM D;  3JXI A;  2QC9 A;  4LSZ E;  3CK9 A;  5CED B;  4M3O A;  4E47 A;  3QWW A;  3M57 A;  3KD7 A;  4FC8 A;  1N52 A;  5A23 A;  2P9U G;  3VV0 A;  3TWQ A;  5G05 J;  2ZU6 B;  2F8X K;  2P2C P;  1E8X A;  2KCV A;  3FUM A;  3AU5 A;  4MI0 A;  4GTQ A;  4LNU D;  3TXN A;  4LDG A;  3VLD A;  1OUV A;  3ZYQ A;  4FA6 A;  1N9A A;  3APC A;  3KAE A;  5D2M C;  4CRW A;  3HG0 D;  4GZ5 A;  3PDN A;  1UJK A;  2KCK A;  1RW2 A;  2GRL A;  3UTM A;  2WXN A;  5LOZ A;  4ATG A;  3L17 A;  4GU5 A;  3TWU A;  2CG3 A;  4N2S A;  4JHJ A;  4RLY A;  3PZ3 A;  1KT1 A;  1SZ9 A;  2XGS A;  4OAV B;  2R5S A;  2Y4U A;  2RD0 A;  2WQH A;  4UWK A;  5G2N A;  4N2Q A;  4I6G A;  3UKR G;  4PDX A;  3GZS A;  4WND A;  1H6P A;  1SA5 A;  4Y6C A;  1HG2 A;  5EYL A;  5BV0 A;  3PRZ A;  5F6K C;  3R9A B;  2WXK A;  4AJW A;  1UOH A;  5AN8 A;  4OVU A;  2XPI A;  2OV8 A;  3DRA A;  3SGH A;  3M53 A;  2V8S E;  3EJN A;  1LD7 A;  3K5K A;  3CKB A;  5CRV A;  2P9P G;  4JA9 A;  5T8I A;  3BG1 B;  4CDM A;  2XEV A;  3WXX A; 
#chains in the Genus database with same CATH homology
 3MO5 A;  1O9S A;  2NSZ A;  4QEO A;  2X38 A;  2XRY A;  4GYO A;  2OVF A;  4AV7 A;  3GYZ A;  4OYS A;  1KLX A;  3OXG A;  1MHQ A;  2DIW A;  2VTB B;  4IJ8 A;  5JJ7 A;  1NP7 A;  3PEV B;  3ZFW A;  2WM9 A;  3RRN B;  3UUX A;  2WVI A;  3CR3 A;  4PS8 A;  4AVX A;  1PC2 A;  2J07 A;  2WXG A;  2XCC A;  4GCO A;  4UWG A;  4ME2 A;  4XZ4 A;  2VSY A;  3LCA A;  4HFG A;  4J8S A;  3FUJ A;  3UMV A;  3TJP A;  3RO3 A;  2FF4 A;  3QC1 A;  4YPA A;  2XCB A;  3DPD A;  3MGB A;  3QK0 A;  4J6I A;  4GA0 A;  3ASG A;  3Q4A B;  1P5Q A;  1IYG A;  2IOL A;  2OOE A;  2VYI A;  2WXM A;  2XPZ A;  3M59 A;  4URK A;  5HQ8 A;  3DBS A;  4GB9 A;  5BV1 A;  1MUF A;  2PM7 A;  4FLH A;  4NVQ A;  3CSF A;  3SZ7 A;  3EHN A;  3I4R B;  3MO0 A;  5EG2 A;  1TJC A;  3F9Y A;  4A1S A;  2VSN A;  3FTZ A;  3FH5 A;  3CV0 A;  2A5U A;  3IHX A;  2L9B A;  3PEU B;  4BTB A;  1OWL A;  4UI9 C;  4UI9 J;  3FUE A;  3IV0 A;  3Q47 B;  3G2U A;  4ILI A;  5LCW C;  5LCW J;  4HLE A;  3M56 A;  2X3M A;  4MKT A;  5HI7 A;  4BX9 A;  2WXH A;  2IGQ A;  5KCM A;  4OVV A;  3LXU X;  4A3V A;  3HDX A;  5T5G A;  4H7X A;  4U8H A;  4FLB A;  4GZ3 A;  3UQ3 A;  2IOS A;  2VQ2 A;  3FUN A;  1H2U A;  4B89 A;  4CEM A;  4J7F A;  2AXV A;  4A1G A;  4WNE A;  2W5Y A;  4UWF A;  2AVP A;  3CHM A;  3LS8 A;  4KXK B;  1ZKK A;  3RRM B;  1ELR A;  1VDY A;  2XGM A;  1NZN A;  4GYY A;  4O6F A;  1B89 A;  3FEY A;  3LVQ E;  4BWR A;  4GYW A;  1E8W A;  1Z3Y A;  1XQH A;  3CIA A;  2MOW A;  2WXQ A;  2YHE A;  5CMW A;  1ELK A;  2VGY A;  2RG8 A;  2M63 A;  5G04 J;  3F9X A;  5J90 A;  3OPE A;  3FTW A;  1HZ4 A;  3HVE B;  1EF1 C;  3ONK A;  4ANU A;  4N3A A;  1YA0 A;  3MX3 A;  5DIZ A;  2NC9 A;  3B7T A;  2C0L A;  5FZQ A;  4G23 A;  3VLE A;  4GPK A;  4WNG A;  1H3I A;  2WXI A;  2KZT A;  1IQR A;  3IEG A;  4G24 A;  4GZ6 A;  3U4T A;  2UY1 A;  5BT1 A;  3AS8 A;  2HYZ A;  3SD5 A;  1QNF A;  3M54 A;  2I1K A;  4MRU A;  5AIJ A;  3QDN A;  1NA3 A;  1HS6 A;  1HXI A;  4Q96 A;  3ZRH A;  5D0Q D;  2AW6 A;  1SQM A;  3D9O A;  3ML8 A;  3MKQ B;  4P29 A;  3ZPJ A;  5C1D A;  4B8C B;  4AM9 A;  2XPY A;  1FVH A;  2ILR A;  4J7I A;  4PS7 A;  4GCN A;  4XI9 A;  1EPU A;  4KYO B;  4FHK A;  2AWI A;  3NZS A;  3CHR A;  5CHE E;  4QEP A;  4ANW A;  1FCH A;  2LNI A;  3ZHE B;  4AY6 A;  5FWQ A;  5TH7 A;  4DLQ A;  3RU0 A;  4RG6 A;  5LSZ A;  3ASF A;  1HE8 A;  3D9K A;  3FTV A;  4G25 A;  4Z4P A;  4CGW A;  3LY9 A;  3CBO A;  2IQC A;  2BTD A;  5D0O D;  4H7Y A;  3FTS A;  3B7R L;  2JV0 A;  4LUN U;  3SFZ A;  3UT7 A;  3BG0 B;  4L1B A;  3SBS A;  2Y3A A;  2QPW A;  5FJY A;  2QFC A;  4KT6 B;  3SWC A;  3IKO B;  2V0P A;  4U0S A;  2PZI A;  3SBT B;  2IU1 A;  4CT4 A;  4BFR A;  3UPV A;  3CVW A;  3APD A;  2LAI A;  4MS6 A;  4ANV A;  5JIY A;  2WMO A;  3B7U X;  3IHY A;  3S7D A;  4PS3 A;  3FTY A;  3U64 A;  4I1O B;  4W9R A;  3ASD A;  3JQ0 A;  1H19 A;  3PNL B;  3QJZ A;  4AEZ C;  1UN9 A;  2DCP A;  2WXO A;  2LSV A;  4XKB A;  3I4G A;  3RAY A;  2WQ6 A;  4JC8 A;  5F59 A;  4G1T A;  3GW4 A;  3RIB A;  2X6H A;  4UWH A;  2FI7 A;  1JPL A;  4K0R A;  2O8J A;  1Y8M A;  3ZYQ A;  4CDN A;  2VTB A;  1QQE A;  2BQZ A;  2MHK A;  5FQ6 A;  3B7S A;  3OS5 A;  1XNF A;  4C1Q A;  1E90 A;  5FT9 A;  1HO8 A;  2J9Q A;  2YNQ A;  1W3B A;  5BPP A;  4AY5 A;  2J4B A;  2WXP A;  4I1A A;  3L08 A;  4WWP A;  3M55 A;  2CHX A;  1U3C A;  3MZL B;  4RSY A;  3JCK C;  4GA2 A;  2E0I A;  3ASH A;  3Q49 B;  4ACK A;  3GZ2 A;  1HX8 A;  4EZK A;  4NQ0 A;  3RK6 A;  3OXF A;  4H12 A;  1HH8 A;  4DI4 A;  4JXT A;  1FVF A;  4JDS A;  2FEZ A;  4YNM A;  3FHE A;  2R3A A;  5TEG A;  1E8Z A;  1OWO A;  3ZXS A;  1UJJ A;  3MA5 A;  3U9W A;  3LKU A;  3FUL A;  1WAO 1;  2QY7 A;  3ESL A;  4JA7 A;  5EX3 A;  4C0E A;  3PS6 A;  3CLJ A;  3EP0 A;  4F7A A;  4J8O A;  3QAR A;  3VTY A;  3QWP A;  3RRU A;  3EIQ C;  1INZ A;  3MKR A;  1NA0 A;  3D9M A;  4GA1 A;  3FH7 A;  1IHG A;  3VLF A;  3FU0 A;  2Y4T A;  4MI5 A;  3Q5M A;  3LEW A;  5LP0 A;  2WPV A;  5T0K A;  5ARG A;  1KT0 A;  4N5C A;  3RJW A;  4APO A;  3LDZ A;  3UT8 A;  3CK8 A;  4I9E A;  4I6J A;  3SW9 A;  5T4Y A;  5G05 C;  3CQG B;  4DI3 A;  3CHP A;  5F6L A;  1JWF A;  3CGH A;  4JEU A;  4EBA G;  3BO5 A;  5JHN A;  2PM6 A;  3PUJ A;  2FBN A;  1L5J A;  5JHA A;  4U0U A;  3CK7 A;  2JLB A;  2FO7 A;  2KCL A;  1JWG A;  2YHC A;  4L2L A;  4RVB A;  4FA6 A;  4UWL A;  3OTN A;  5G55 A;  3ESK A;  4XX5 A;  3JQ1 A;  4ANX A;  3M5A A;  4GML A;  4YND A;  5FZS A;  4DJA A;  4HS2 A;  4O30 A;  3D9L A;  4BT8 A;  2V4L A;  5LX8 A;  3RJV A;  1OWP A;  3HVE A;  3OXL A;  5CMY A;  2WXR A;  5BUZ A;  4ACL A;  2JEK A;  2C0M A;  4JEH A;  5FQ7 A;  4B8A A;  4YPE A;  4R7L A;  3O4Z A;  2V5F A;  3SI5 A;  3CVQ A;  4FJY A;  2UWJ G;  4QFV A;  5FQ4 A;  3LVR E;  4XIF A;  1MT6 A;  1N6C A;  3L54 A;  3NQP A;  4WWN A;  4HVB A;  1PY1 A;  3FUD A;  2PL2 A;  4RG9 A;  1EDU A;  3RKV A;  4YVO A;  2I1J A;  5E75 A;  3MKQ A;  2RFI A;  2X6F A;  2NXP A;  4WNF A;  3MJW A;  4KZ0 A;  5AYW D;  4XKC A;  2L6J A;  3IBE A;  4Y6W A;  4U63 A;  2I2O A;  3CHQ A;  4BUP A;  5A7D B;  4AIF A;  4WAF A;  2VSX E;  1WM5 A;  4GZD A;  4UQX A;  5FZR A;  4ABN A;  1HG5 A;  2OVB A;  2YQ8 A;  4Q94 A;  5ARF A;  5FTP A;  5JJ0 A;  3FU5 A;  1ML9 A;  3T5V A;  1QZ2 A;  3AS5 A;  3ZHE A;  4C9B B;  1U3D A;  4KVO A;  4CT0 A;  3L16 A;  4LRZ A;  3TXM A;  2KC7 A;  3VTX A;  4EZJ A;  4V3I A;  3CEQ A;  3HHM A;  3S2A A;  4AXH A;  3FY4 A;  4CCA A;  5EDS A;  5LFA A;  3HNA A;  3E4B A;  4BT9 A;  1E8Y A;  1OWM A;  3U66 A;  4TRQ A;  4WWO A;  3ZW3 A;  2VGX B;  4F1S A;  1N3J A;  3MEK A;  3ML9 A;  5KJM A;  1N6A A;  4LCT A;  4MLP A;  1UW4 B;  4F3V A;  4Q69 A;  3APF A;  3G2W A;  3FUK A;  4BTA A;  3TL5 A;  1LF8 A;  3LY8 A;  3BEE A;  2HO1 A;  4I51 A;  3GZ1 A;  3CVU A;  4JHK A;  1GW6 A;  4L23 A;  3PNT B;  1TEZ A;  1X5B A;  4NJ5 A;  3D9N A;  3UT4 A;  2AXZ A;  1H6K A;  3QNK A;  3FU6 A;  3PH0 C;  3QAQ A;  3N71 A;  3CVV A;  3FUF A;  3KMJ A;  4IYP A;  3S7F A;  4IJD A;  4EQF A;  1EYH A;  2EQX A;  4YVQ C;  4HOR A;  5CPR B;  4JLG A;  3EIJ A;  3B13 A;  3FEX A;  3G2V A;  3T5X A;  2L0T B;  4PUC A;  4XE0 A;  3TG5 A;  4FUL A;  3ZIM A;  1MQS A;  3CQC B;  4BSX A;  4TUU A;  5JJ6 A;  3FH8 A;  3G2S A;  4NAC A;  4YPU A;  1BPO A;  3KEZ A;  2WQ7 A;  4NRH B;  1PEG A;  2L0I A;  3K9I A;  3SF4 A;  4ILH B;  4AU7 A;  2AXU A;  2IF4 A;  4FMU A;  3PUK A;  4KVM A;  3D3M A;  4D10 C;  5T0M A;  4UI9 K;  3Q15 A;  4LER A;  4JL0 A;  3LPZ A;  3OAW A;  2F69 A;  2FUL A;  4B0Z A;  4EBA A;  1Z3X A;  3T8M A;  4A55 A;  4PH4 B;  4UQZ A;  4E6H A;  5CCM A;  3MO2 A;  1E96 B;  4G26 A;  1E7U A;  3FDH A;  4JHR A;  3ONL A;  2HR2 A;  4FHJ A;  5DBK A;  2WXJ A;  3ZEF A;  2CFU A;  2GW1 A;  3LJ3 A;  3QWV A;  4J83 A;  2HM8 A;  3CHS A;  3DAL A;  4GAA A;  1UN8 A;  4I2Z A;  4YNP A;  3JYS A;  1HFA A;  4G2V A;  3ZYM A;  3F9W A;  1PAQ A;  1ZBP A;  2J09 A;  3FTU A;  2A4Z A;  4TV3 A;  5BW8 C;  3ZVV A;  3PZD A;  4A3T A;  3S7B A;  4IRU A;  4G11 A;  4E85 A;  4HXI A;  3CVY A;  5F5E A;  3P2B A;  1WY6 A;  3EHM A;  3CK9 A;  2VSO E;  3FU3 A;  4DLO A;  4EPZ A;  4M3O A;  2I9C A;  4E47 A;  3O48 A;  2XHE A;  3QWW A;  4U0Z A;  3ZYL A;  4N3C A;  3TGO A;  3M57 A;  3KD7 A;  4FC8 A;  1N52 A;  5A23 A;  3VV0 A;  1E7V A;  2IJG X;  4N39 A;  5ANR A;  2I6H A;  2ZU6 B;  5G05 J;  3ULQ A;  3QOU A;  4GMJ A;  1A17 A;  1E8X A;  2KCV A;  3FUM A;  4I43 A;  2W5Z A;  3S8P A;  3PRE A;  4XI0 A;  4JZY A;  3AU5 A;  3JUI A;  2LAH A;  2R17 C;  4MI0 A;  3TXN A;  4L7T A;  4LDG A;  1TJF A;  2ION A;  2WXL A;  3VLD A;  1OUV A;  2P58 C;  3I3N A;  3PE3 A;  3QKY A;  3APC A;  3KS2 A;  3NZU A;  3KAE A;  4HOQ A;  5ENN A;  1MVX A;  4AOF A;  2C2L A;  2PQN A;  3CVP A;  3FFL A;  3LY7 A;  3MV3 B;  2BUG A;  1DNP A;  2BF0 X;  1H0A A;  1N54 A;  4CRW A;  4U07 A;  2E2E A;  2J08 A;  5BNW A;  2CHZ A;  4QEN A;  3FUH A;  1IQU A;  4LEU A;  5JJT A;  5KJL A;  4I6E A;  4EZL A;  4GZ5 A;  3L6A A;  5AJL A;  2J49 A;  5KJK A;  2LSU A;  3D9I A;  3PDN A;  1UJK A;  4IN3 B;  2KCK A;  1H2T C;  2CFZ A;  1SZA A;  2GRL A;  3CST A;  3FTX A;  4KBQ A;  3ZYK A;  2J4D A;  5J08 A;  2KAT A;  2WXN A;  3EDT B;  4GZC A;  5LOZ A;  4ATG A;  5LSX A;  3L17 A;  3PE4 A;  4GU5 A;  3HYM B;  4KZC A;  5E76 A;  4BY6 A;  4HOS A;  4KMO A;  3F9Z A;  3OOI A;  2CG3 A;  4N2S A;  2MRI A;  4J0U A;  3AU4 A;  4I9C A;  4JHJ A;  5AYF A;  5G04 C;  2XGO A;  3CBP A;  3L13 A;  4I1M A;  3I5P A;  4JVS A;  3CVX A;  3R7R A;  2LO6 A;  3VUZ A;  4DPR A;  5AJD A;  4JW1 A;  3TG4 A;  3M58 A;  4I17 A;  1KT1 A;  1SZ9 A;  5C2Y A;  3ZN3 A;  5AEN A;  3URZ A;  3SNX A;  2XGS A;  2Q7F A;  2KZT B;  2CG2 A;  2VGX A;  2UY1 B;  1ELW A;  4WUY A;  3R7Q A;  4L2Y A;  3S7J A;  3HIZ A;  3QB2 A;  3SHF A;  2X6J A;  4F53 A;  3D9J A;  1OWN A;  2R5S A;  5JHB A;  2XRZ A;  2Y4U A;  2RD0 A;  3C98 A;  2KM4 A;  3CHO A;  2WQH A;  3RQ4 A;  2CHW A;  4UWK A;  3MYV A;  5T3R A;  4DK5 A;  4HOU A;  4CGV A;  5G2N A;  4I2W A;  4N2Q A;  2GGF A;  4BX8 A;  4FJZ A;  1DVP A;  3IHV A;  4RZ0 A;  4I6G A;  3CVL A;  3CVN A;  4PDX A;  1HF8 A;  3G2T A;  3LYA A;  1S0P A;  3GZS A;  3P1U A;  4WND A;  1HU3 A;  4Y6C A;  1HG2 A;  3MV2 B;  1ZU2 A;  5EX0 A;  5TTF A;  5BV0 A;  2PQR A;  3CKC A;  3L22 A;  4APF A;  2X6K A;  3PRZ A;  4FU3 A;  5F6K C;  4IUL A;  3R9A B;  4EEC A;  3U3W A;  5JIN A;  2XQ0 A;  4J8E A;  1JUQ A;  3MCX A;  4J8D A;  4NUR A;  3TAX A;  2YIN A;  4B94 A;  5FQ8 A;  1MVH A;  4HOT A;  1Y6I A;  2X6I A;  1UG3 A;  4U04 A;  3RO2 A;  2WXK A;  4J8F A;  4AJW A;  2R59 A;  2DBA A;  2WMN A;  3UX4 A;  5KJN A;  2GRM A;  3ZGQ A;  3FPD A;  1Z6T A;  2OND A;  3ENE A;  1XGW A;  4OVU A;  2XPI A;  4AP2 A;  4N3B A;  2OV8 A;  4ILG A;  3FWV A;  3SGH A;  4C0M A;  2V8S E;  3EJN A;  5M72 A;  2IFU A;  3AS4 A;  5CCL A;  3M53 A;  3K5K A;  2WB2 A;  5A6C A;  3CKB A;  1H2V C;  3NF1 A;  3PVL A;  4JPS A;  3FP3 A;  3KMA A;  4JA9 A;  4CDR A;  2G46 A;  3KMT A;  4FP7 A;  3DB5 A;  3D9P A;  4FAD A;  4UQY A;  5EKQ D;  5ANL A;  3CBM A;  5T8I A;  3BG1 B;  2WXF A;  4K03 A;  2VJ8 A;  4CDM A;  2XEV A;  3WXX A;  3FUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...