3TG5A

Structure of smyd2 in complex with p53 and sah
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
425
structure length
425
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human SMYD2 reveals the basis of p53 tumor suppressor methylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords N-lysine methyltransferase SMYD2
total genus 137
structure length 425
sequence length 425
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3tg5A03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 3tg5A01
2WQHA 4H7YA 1IYGA 5JHNA 3OXGA 1N6CA 4W9RA 3K5KA 3GZ2A 3OOIA 4AY6A 2FO7A 3SZ7A 3M55A 3URZA 3ZGQA 1NA3A 2VQ2A 4HOQA 3HNAA 1PEGA 3CBMA 2ONDA 5D0QD 3QKYA 3Q5MA 2KC7A 4HOSA 4BTBA 2UWJG 5JIYA 1KT1A 2RFIA 4U07A 4GA0A 4YPEA 3O48A 3EDTB 3MO2A 3QWVA 3WXXA 4RZ0A 4B94A 5HQ8A 5KJKA 4U04A 3CK7A 3S7FA 1ZKKA 4XIFA 4HOTA 5CHEE 4NVQA 3F9YA 5AYFA 2PZIA 4GCNA 3MO5A 4GA1A 4J8FA 2BUGA 4GZ6A 5KJNA 5HI7A 4UQXA 3MEKA 2VGXB 4ME2A 4G2VA 2FF4A 5CCLA 2XCBA 4GYYA 3LCAA 3Q47B 4LDGA 1ELWA 3NF1A 3TAXA 3SF4A 3DB5A 2XGSA 3S8PA 4Y6WA 5FZQA 2WPVA 2C2LA 2UY1A 2KCVA 4JDSA 4MI0A 2C0LA 3CBOA 3ZN3A 1O9SA 4AU7A 2I6HA 3SWCA 3N71A 4UI9J 3RJVA 5JJ7A 4XI9A 4WNEA 2NC9A 3OXFA 5ARFA 3ZHEA 4GYOA 4YPAA 5G04C 3AS8A 5KJLA 4GPKA 2AVPA 3CVPA 5EG2A 1HZ4A 3ZPJA 3VUZA 3K9IA 4JL0A 3LPZA 2LSVA 3RO2A 5C1DA 4ABNA 1MUFA 4IJ8A 3Q15A 4JLGA 5F59A 4KBQA 3CVLA 3KMAA 3AS5A 3PE4A 3ASFA 4RG6A 3M56A 4O30A 4JHRA 5JJ6A 3ZFWA 3HYMB 5EKQD 2VGXA 4BUPA 3VTYA 2V5FA 4U0SA 3S7DA 1Y8MA 5TTFA 4E47A 4Z4PA 5FJYA 4C1QA 2FEZA 4I2ZA 1KLXA 4CGWA 2W5ZA 3RJWA 3FPDA 3ASGA 4J0UA 4WNGA 3Q49B 4NRHB 1MVHA 4WNFA 3PE3A 5ARGA 2Y4UA 3FP3A 3VTXA 2Y4TA 3AS4A 5D0OD 5LSZA 5EX3A 4H7XA 4G23A 3KS2A 5CPRB 3MV3B 3RKVA 4G25A 1MVXA 3MO0A 4GA2A 5CCMA 4HORA 4J83A 3M58A 1A17A 4CDRA 4I51A 3UPVA 3QDNA 3S7JA 3RAYA 4BWRA 4N2QA 2PL2A 2G46A 3QOUA 3VV0A 4N3BA 4JA9A 2VSNA 3MV2B 1FCHA 5G04J 2JLBA 1ML9A 3KMJA 1ZU2A 4I9CA 3CK9A 3E4BA 2HYZA 5JINA 4AY5A 4N3AA 5FZSA 3QWPA 3OPEA 5T0KA 4QENA 3QWWA 3CV0A 4QEOA 3FWVA 2XPIA 4GCOA 3CEQA 5FTPA 3JYSA 2J9QA 5BT1A 4G24A 2LSUA 4YNDA 2IGQA 3DALA 1QZ2A 1ELRA 1E96B 3LY8A 2P58C 4BTAA 5A6CA 2HO1A 2O8JA 5FZRA 4J7IA 3R9AB 3IEGA 1W3BA 2IFUA 3LY7A 2QPWA 3MA5A 4IJDA 2F69A 2UY1B 4U0ZA 5G05C 4G26A 5M72A 4KYOB 2E2EA 4GZ5A 2LNIA 4I2WA 3TG5A 4YPUA 3M54A 1NZNA 3M57A 3S7BA 2YQ8A 3TGOA 3ZHEB 5F6LA 1ZBPA 1KT0A 3LYAA 4KXKB 3BEEA 1WM5A 4G1TA 2JV0A 5LSXA 3F9ZA 5DBKA 3ASHA 5BNWA 2IF4A 3CVNA 2C0MA 3KMTA 3UUXA 5A7DB 4AIFA 2Q7FA 3CK8A 3MKRA 4O6FA 4WUYA 5EX0A 5LCWC 1NA0A 5FT9A 3M53A 2VSYA 4I17A 1XQHA 3GZ1A 3RIBA 5JJ0A 5G05J 2QFCA 4A1SA 4N5CA 1YA0A 4MI5A 5T0MA 4LEUA 5JJTA 4YNMA 4BT8A 3F9XA 3CKCA 2FBNA 3ULQA 4U0UA 4N3CA 4YVQC 2OOEA 5TEGA 3UQ3A 3FFLA 3SW9A 2GW1A 4GZ3A 4IN3B 4NQ0A 1OUVA 2YHCA 2L6JA 4YVOA 4RG9A 5LCWJ 3OXLA 3LKUA 4J8DA 2KATA 3CKBA 1IHGA 2BQZA 5TH7A 4N2SA 3LY9A 5KJMA 4Y6CA 2KCKA 3KAEA 5T5GA 2XCCA 2R5SA 2PQNA 4J7FA 4JA7A 4BT9A 2W5YA 4GYWA 1QQEA 1P5QA 3U4TA 2XGMA 2MHKA 4H12A 1N6AA 3TG4A 2PQRA 1MT6A 1WAO1 4QEPA 4UQYA 3ESKA 4FMUA 3CBPA 3F9WA 4J8EA 1TJCA 3CVQA 3OS5A 2HR2A 2VGYA 3U3WA 4UI9C 2XEVA 4F3VA 3M59A 4I1AA 4UQZA 1B89A 1H3IA 3PDNA 4WNDA 4APOA 3RU0A 4CGVA 3M5AA 2R3AA 4YNPA 2VYIA 4NJ5A 1HXIA 2DBAA 5F5EA 4UI9K 4EQFA 3RQ4A 4N39A 4I9EA 2FI7A 4XI0A 5F6KC 2KCLA 5DIZA 3KD7A 5AYWD 3RO3A 1N3JA 3GYZA 2XGOA 3BO5A 1XNFA 4J8OA 3EP0A 4HOUA 1HH8A 5BW8C 1PC2A 3ASDA 3GW4A 4AM9A 3IHXA 3Q4AB
chains in the Genus database with same CATH superfamily
4HI9A 5LP0A 4X8QA 2WM9A 3S2AA 3E33A 3HHMA 1NP7A 4EBAA 3SZ7A 4IYPA 3DPYA 3ZGQA 1SA4A 1KPSB 1JCSA 5D0QD 2RG8A 3Q9NC 1TYQG 3QKYA 3BQOA 4U7EB 3UI2A 1MJ0A 3BUAA 3FU0A 3B7SA 3DSUA 4F6RD 1DCQA 4U07A 2NXPA 3O48A 4TV3A 4RZ0A 2IY0C 1S70B 4DX5D 3SY2A 4B8CB 3S7FA 1E7UA 5CHEE 2R02A 3G2VA 4GA1A 3PZ2A 2ILRA 1Q2ZA 5HI7A 3G2UA 4UQXA 3MEKA 4AJWA 2GRRB 4L1BA 5T3RA 3Q47B 1N4SA 3NF1A 2F8XK 5AQ9A 2YINA 2XGSA 4JDSA 4JPSA 3CBOA 3ZN3A 5AN8A 3KSLA 4AU7A 4NACA 4CEMA 1UJJA 3SHFA 4UI9J 3UXGA 1N54A 1X81A 4XI9A 4WNEA 2NC9A 5ARFA 4GYOA 4GTOA 2AVPA 1ELKA 2P9LG 3MKQA 5KCMA 4JL0A 2QZAA 2LXMA 1MUFA 3Q15A 4JLGA 4KBQA 1AWCB 3FEXA 3M56A 2J4DA 5H7PA 3PZ3A 2DYSE 4DLQA 2CG2A 5BXUA 1PY1A 4DK5A 3SFZA 3RRNB 2P9IG 1BLXB 1Z6TA 4WWPA 2CFUA 3PNLB 1FT1A 4LRZA 1DNPA 2HE0A 5ENTD 5TTFA 4E47A 4Z4PA 2FEZA 4BX9A 2W5ZA 1S0PA 3RJWA 3FPDA 3FH8A 3V31A 3Q49B 2P9KG 2BF0X 5JA4D 5BUZA 4WNFA 2AJAA 1K1AA 3VTXA 5T8IA 2Y4TA 5LSZA 2JABA 5AJLA 1H6OA 4NURA 3FU3A 3L6AA 1MVXA 2WXKA 5BV0A 3L82A 2XRZA 3UPVA 3FUEA 3QDNA 2NYJA 2PL2A 3G2SA 2MYOA 3CIAA 2VSNA 3EJNA 5ENOD 4RQIA 2JLBA 3NBNB 4V3IA 1K3ZD 1N94A 4C0EA 3KMJA 4G8LA 1ZU2A 2GRLA 3UIPC 3SFYA 3MJWA 4A63B 3I4GA 3UKUG 1N9AA 3E4BA 2KXPC 4ACLA 3LVRE 3J5PA 2DYRE 5FZSA 3EHRA 4MS6A 3OPEA 2I9CA 3SFXA 3UTMA 4U8VD 1O1RA 4HBDA 2I1KA 4BESA 4N5QA 3TXNA 1E8YA 4G24A 2LSUA 4PS7A 4GTTA 3LY8A 3HXFA 4A55A 2V0PA 3FULA 2DVWA 2O8JA 4MLPA 5FZRA 3T9KA 3ENEA 1FT2A 1W3BA 2IFUA 4U96D 2CG3A 2F69A 2DWZA 5G05C 4HLLA 2LNIA 4ANXA 2A5EA 4I2WA 3TG5A 3EHMA 1OCOE 3E32A 3CSFA 3P2BA 3S7BA 3ZHEB 4KXKB 3T5VA 3D9OA 2JV0A 5AJDA 3SBSA 3F9ZA 3Q73A 3ASHA 2XS1A 1FVFA 3Q7AA 5G2NA 3ML9A 2IF4A 3KMTA 3UM2A 4OAVB 2PM6A 4O6FA 1TNBA 3PS6A 3SGHA 5EX0A 3DXKG 3FTVA 4EZKA 5CBOA 4I43A 4PS8A 2QYUA 1TNZA 4N5CA 3B7BA 1E8WA 1YA0A 1N52A 3UT4A 1HU3A 2XEEA 4K0RA 3DSTA 4U0UA 4CT4A 4OVUA 2MOWA 2GRNB 3KSQA 3ASNE 4KVOA 1D8EA 4O60A 2LAIA 1OUVA 1OWNA 4YVOA 1NI1A 4FULA 3OXLA 1E90A 2KATA 3TWVA 3ABLE 4FJZA 2XZTG 4BEPA 4FU3A 5AAOA 5T5GA 2R5SA 2X6KA 4FLHA 4BT9A 4H12A 5B1AE 5KWDA 3TG4A 2PQRA 4EZJA 1TN6A 2IONA 3VLEA 3LJ3A 3OS5A 2XZDG 3F6QA 5EYLA 2RFMA 4UQZA 5A23A 3PZ1A 1V54E 4I6EA 4YNPA 3PRZA 4NJ5A 3PZ4A 3FUHA 2I2OA 4DX2A 3RQ4A 3DEOA 3ESLA 5FINA 2KCLA 2IEJA 5AYWD 3JUIA 3L17A 2QYJA 3L16A 4UUCA 3EU9A 1HH8A 5G55A 5ENPD 4K5BA 3ZXPA 1RZ4A 1IYGA 3FTZA 1JWFA 3Q7FA 5CERB 3C72A 1N6CA 4GTVA 3K5KA 3PVLA 4AY6A 5T4YA 2CHWA 4UWGA 3URZA 1NA3A 2VQ2A 5LOZA 4LERA 1OXJA 3ZYKA 3FUFA 2LO6A 5E75A 2H6IA 4PDXA 3T5XA 3CVVA 2WMNA 3CHOA 4J6IA 1DCEA 2UWJG 3QARA 1OWOA 4J7WA 2RFIA 1NFIE 1OT8A 4YPEA 1TN8A 3EU5A 5LX8A 4L2YA 5HQ8A 3UM1A 3B13A 4U04A 2I1JA 1EPUA 2PM7A 3QAQA 1UN8A 2XS8A 3HXCA 3F9YA 4TUMA 2PZIA 4GCNA 4APFA 4J8FA 2VTBA 4GZ6A 1KZOA 4ME2A 4G2VA 3B7TA 4CRWA 2FF4A 5CCLA 2J49A 3DSWA 3SF4A 3IHYA 1IHBA 2F37A 2WPVA 3D9IA 4GTPA 2C0LA 2FO1E 1O9SA 2XEHA 2R59A 2OEWA 3U64A 3RJVA 5JJ7A 4B0ZA 1E8XA 3ZHEA 2WXRA 3FUKA 5KJLA 3AG3E 2IU1A 4GTSA 3ZPJA 4FA6A 3Q79A 3SI5A 2L6BA 2X38A 3LPZA 2LSVA 4A3TA 2HM8A 1TNYA 2ETBA 1TNOA 5AQ7A 3CVLA 4RG6A 1O1TA 3FDHA 4XX5A 2VGXA 3RK6A 4BUPA 4U0SA 4TXQA 5FQ6A 4XZ4A 3T8MA 4I2ZA 3TWWA 3HG0D 4CGWA 2R05A 3QC1A 2VJ8A 5FQ7A 2WXMA 3SD5A 1MVHA 4YDWA 3PE3A 4JC8A 3QB2A 1H19A 4CT0A 3PREA 3RRMB 1DVPA 2KBXA 2ZGGA 5D0OD 3U66A 4H7XA 4GMLA 3ULYA 4B89A 3MO0A 2OVBA 1N4QA 1JUQA 2IJGX 4DLOA 3DSVA 4PUCA 3M58A 3FH7A 4I51A 3S7JA 4N2QA 4BSZB 2G46A 1PAQA 4RLYA 4XEIG 3JQ0A 4JA9A 1FCHA 3KEAA 4LNUD 4OYSA 2WXPA 3Q78A 5E76A 2CHXA 3BG1B 2HYZA 2WXFA 3CQGB 1MZCA 4N3AA 3QJZA 2FULA 3PEVB 1JWGA 2LXLA 3DSXA 4G8KA 3QWPA 4RSYA 3NB2A 3CVYA 3TXMA 1OCZE 2WXNA 4YNDA 4IRUA 2WXHA 4HRLA 4A1GA 1UOHA 1E96B 3W9FA 2P58C 1H6PA 5A6CA 2HO1A 2AWIA 2Y3AA 3ZIMA 2P2CP 3FUNA 3IEGA 2P9SG 1JPLA 2QPWA 5HRYA 3MA5A 4IJDA 3AG4E 3WG7E 1MYOA 3HVEB 1OCCE 4G26A 2E2EA 2VSXE 4HQDA 4XKBA 2X6FA 3CHMA 4YPUA 3MYVA 1UJKA 3TGOA 5EYPF 2ZIRA 1TR4A 1ZBPA 1LF8A 2BKGA 5LSXA 4U8HA 5DBKA 4GAAA 4TXRA 1G3NB 3TJPA 1EF1C 3CVNA 2C0MA 4KMOA 2GRPB 5JHBA 1UN9A 1YMPA 3HRAA 4AIFA 4HNAD 1U2VG 3FUIA 5BPPA 5LCWC 1NA0A 2E0IA 3M53A 4L23A 2VSYA 4YDEA 4FC8A 3GZ1A 2RFAA 4AV7A 5JJ0A 4EBAG 2QFCA 4A1SA 3RSEG 4FP7A 4HB5A 5T0MA 4C9BB 5J90A 2YNQA 4BT8A 4DI4A 4L9PA 2BEDA 3NZUA 2Y0BG 4BFRA 5EN5D 2ZXWE 1EYHA 2WXGA 1E8ZA 4GZ3A 2BTDA 4NQ0A 3ULEG 4RG9A 4RVBA 2J09A 1O1SA 3R7QA 1E7VA 2BQZA 1SW6A 4KT6B 4WWOA 3SNXA 3KAEA 3G2TA 1HX8A 4J7FA 2ETAA 1INZA 3AJIA 2OVFA 4GYWA 1P5QA 4LCTA 2XGMA 1WY6A 2IQCA 1RW2A 1MT6A 3FY4A 4UQYA 1MX6A 1IKND 4FHKA 4J8EA 3CVWA 3HVEA 2HR2A 3D3MA 3NAWA 3TL5A 2VGYA 3D9PA 4DX1A 3M59A 3KEZA 1B89A 4O1PA 3B7UX 3PDNA 4A3VA 3I3NA 3RU0A 4CGVA 3APDA 4GMRA 2EQXA 4LG6A 4UI9K 4AEZC 2WQ6A 4C48B 4CCAA 4I9EA 1Y6IA 2F8YA 4ATGA 2X6HA 1XGWA 1QNFA 2QC9A 3ABKE 5LFAA 4ILHB 1HG5A 3RO3A 1N3JA 3MZLB 4HLEA 2J07A 4I6JA 3EP0A 3RAUA 5ENSD 3Q4AB 5EIBE 4BSXA 4CZ2D 1UG3A 1N4RA 3LS8A 5EILA 3IHVA 3MGBA 2FO7A 1SQMA 3M55A 1H0AA 4HOQA 2ONDA 5CEDB 2VSOE 4KZCA 1Z3YA 4LNBA 4WWNA 3I5PA 3Q5MA 2KC7A 4BTBA 1BI8B 3JXJA 1IQRA 5JIYA 1KT1A 4JVSA 3L08A 3ZYMA 3QWVA 3AU5A 3WXXA 5ENRD 1BD8A 4JEHA 3ML8A 3TWTA 3QNKA 5ENQD 1MX2A 3CK7A 5IY5E 3DEPA 1ZKKA 4HOTA 3JCKC 4NVQA 1H2VC 5AYFA 3MO5A 3UT8A 3V2OA 1FVHA 4DJAA 2VGXB 3CSTA 4B93B 2AXUA 2XCBA 1TEZA 4GYYA 4LDGA 3C5RA 1VDYA 1ELWA 2Y69E 3TAXA 2QY7A 5FWQA 1K8KG 4BY6A 2XQ0A 4Y6WA 2M63A 2C2LA 2UY1A 2IO3C 3ZEFA 3JXIA 3APCA 2I6HA 5CECB 3SWCA 3N71A 1HF8A 3ZUVB 5KBAA 3MKQB 3U9WA 3LDZA 4Q96A 3OXFA 4ANUA 2B6CA 3AS8A 2P9PG 4GPKA 5EG2A 4M7CA 2R17C 1HZ4A 1EDUA 4OVVA 3K9IA 3AG1E 3MX3A 3RO2A 3FTXA 3VLDA 4NIKA 1OCRE 5KNGA 2VTBB 4PH4B 4IJ8A 3AU4A 4URKA 2J8SD 3HIZA 3KMAA 3UINC 2P9NG 4D10C 3APFA 4O30A 5JJ6A 3ZFWA 2B0OE 3HYMB 5EKQD 3NOCD 3FEYA 3G2WA 3VTYA 2V5FA 3S7DA 2X6JA 4C0MA 4DUIA 3C3OA 5FJYA 4C1QA 3C98A 2EIME 2BKKB 3ASGA 4M3OA 4IULA 2P9UG 3FUDA 4J0UA 4WNGA 3IHXA 3CVUA 5ARGA 3FTUA 3SQVA 2Y4UA 3FP3A 3B95A 3FTSA 5D2MC 2OCCE 2L0TB 5EX3A 4G23A 3KS2A 3R9MA 3MV3B 4TUUA 3RKVA 3ZKJA 4G25A 4GA2A 4HS2A 4HORA 2KM4A 4GPMA 4J83A 4CDRA 3L54A 2F0YA 2LAHA 4Q94A 4Z68A 3D9JA 3CHRA 3QOUA 4AVXA 2Y1LE 3VV0A 4HXIA 3MV2B 5G04J 1ML9A 3CGHA 3EUVA 4AP2A 3D9NA 3UX4A 3CK9A 2AW6A 4DRXE 1S63A 3TWXA 4WAFA 3D9HA 3NQPA 3Q75A 1GW6A 3TWSA 5T0KA 2WMOA 4UWHA 3CV0A 4QEOA 3GZSA 5ANRA 3FWVA 2XPIA 3CEQA 5FTPA 3JYSA 2J9QA 3IBEA 4GTMA 4HFGA 2IGQA 2GRQB 4Q69A 5JHAA 3DALA 1ELRA 4BTAA 2WXLA 1H2TC 3I4RB 3FUMA 1JCQA 3L22A 5M72A 3V30A 3DSSA 4JD2G 4JB8P 5CBNA 2V5QC 1D8DA 5C2YA 3M54A 4HI8A 1WDYA 1NZNA 3PNTB 3FUJA 3FH5A 3M57A 5CEAA 3BU8A 4LSZE 1FPPA 1KT0A 1OWMA 3BEEA 2LUHA 2IOLA 2V4HC 1WM5A 1Z3XA 4G1TA 3P1UA 4QFVA 5BNWA 2WXJA 2V4LA 1K1BA 3ONKA 3MCXA 5A7DB 1OWLA 2WXOA 5BXOA 1SVXA 3UIOC 4K5CA 4WUYA 3BG0B 1AP7A 2GGFA 4I1OB 4DX7D 4I17A 3TWQA 4GTRA 2MRIA 3D9LA 3UKRG 4F53A 2KZTA 5J08A 4I6GA 2J4BA 1N0QA 4MI5A 4LEUA 5JJTA 4I1MA 1MHQA 4L2LA 5JMND 3IXEA 4U95D 4AXHA 4K03A 3ULQA 4L7TA 4N3CA 3L13A 4YDOA 1WG0A 3SW9A 3ABME 1OWPA 4IN3B 4GZCA 5CRUA 3ZW3A 2YHCA 3Q9UC 5CMWA 4J8DA 3CKBA 1IHGA 4MBGA 3E34A 4N2SA 1HS6A 3PEUB 5ANLA 3QK0A 4R7LA 1ZB1A 2XCCA 2V8SE 2A5UA 4JA7A 2W5YA 4FJYA 3J5QB 2MHKA 1N6AA 4HVBA 1O5MA 4GZDA 3HXBA 1WAO1 4QEPA 2OEVA 2CFZA 3CVQA 2WQ7A 1QBQA 2XPZA 4LUNU 4UI9C 2XEVA 2WXQA 4I1AA 1N11A 4HRNA 1TJFA 4EECA 3SBTB 4TRQA 4WNDA 2CHZA 3HDXA 4G11A 1L5JA 4MKTA 3ZVVA 2GRMA 2DZNA 2OV8A 3CHQA 3OTNA 4N39A 3RRUA 2FI7A 3PUKA 4XI0A 3PH0C 5DIZA 4JZYA 2EIKE 3CQCB 2A4ZA 3NZSA 3HXDA 4J8SA 3GYZA 5BV1A 2XGOA 4CDMA 3BO5A 1XNFA 1H6KA 4J8OA 2XRYA 4U8YD 4JW1A 3TWRA 4AM9A 4AOFA 3IV0A 4HRMB 2WQHA 3ZRHA 1S64A 5EDSA 3CVXA 1SA5A 5AARA 4H7YA 5JHNA 4YDYA 3OXGA 2XENA 4W9RA 3GZ2A 3TWUA 3OOIA 3EHNA 3UMVA 3HNAA 3B7RL 1PEGA 3CBMA 3O4ZA 2GROB 4E85A 3ZYLA 2EIJE 1U3DA 1JCRA 1IQUA 4HOSA 4GU5A 1BU9A 4KZ0A 3SO8A 4GA0A 4JXTA 4K5AB 3EDTB 3MO2A 3DWLG 3UT7A 2L0IA 4B94A 3CR3A 4EPZA 5KJKA 3CHPA 1TNUA 4OAUC 2DZOA 4XIFA 3HXEA 3ONLA 5ENNA 4B8AA 2EILE 2BUGA 3D9KA 3EIQC 5KJNA 2H6GA 4ATZD 1YCSB 2J08A 3LCAA 5HKPA 5EIDA 3DRAA 4FADA 3DB5A 3S8PA 5FZQA 3V2XA 2KCVA 4MI0A 2AXVA 3LXUX 2L9BA 2XPYA 3LJNA 4LNGA 4YPAA 5G04C 3IKOB 3CVPA 1MX4A 4BETA 3VUZA 5C1DA 4ABNA 5F59A 2R2LA 2R03A 3JQ1A 1N95A 3AS5A 3PE4A 3ASFA 4FLBA 4JHRA 4JHKA 1HFAA 4E6HA 4U63A 4O1OA 5ITZF 4EZLA 1Y8MA 3ZYQA 2EINE 3E30A 4ZFHA 1KLXA 2IO2C 2RD0A 3W9GA 2WVIA 4QQIA 1HE8A 4NRHB 4DPRA 3R7RA 3ASOE 4UWLA 4JEUA 1HO8A 1Z5SC 3AS4A 3FTYA 5CRVA 1LD7A 5CPRB 5AENA 3ISMC 2KZTB 1N4PA 2IOSA 5CCMA 1A17A 3NOGD 3OAWA 1X5BA 3RAYA 4BWRA 5FIOA 4N3BA 4GTQA 2ZISA 1NL4A 3E37A 4ZHBA 2XHEA 2YHEA 4I9CA 5JINA 4AY5A 4F1SA 3V79K 4FHJA 4QENA 3QWWA 4UWFA 4GCOA 2DIWA 4J8YA 4ACKA 5BT1A 1KZPA 2AXZA 1LD8A 1SZ9A 3X2QE 1QZ2A 4CYMD 4ANWA 3FHEA 5AQBA 4J7IA 3R9AB 4DX6D 3LY7A 4MRUA 3ZU7B 3AAAC 3UM0A 2UY1B 4U0ZA 4KYOB 1LTXA 3T8KA 4GZ5A 3DBSA 3C3QA 3ZNGA 2YQ8A 5F6LA 3LYAA 5D66A 3CHSA 4EHMA 2NSZA 1IXVA 5B3SE 2ZGDA 3LEWA 3DPDA 5AIJA 1BPOA 3C3RA 3FU5A 3UUXA 2Q7FA 3CK8A 3MKRA 5AQAA 1H2UA 1DC2A 4JHJA 3VLFA 5FT9A 4XKCA 1XQHA 3RIBA 2ETCA 1HG2A 4GMJA 5G05J 1A5EA 3LVQE 5FQ8A 3EHQA 4F7AA 3PUJA 2RKKA 3UM3A 2H6HA 4YNMA 3F9XA 3CKCA 2FBNA 3AG2E 2X3MA 1BI7B 4YVQC 2OOEA 1QYMA 5TEGA 4PS3A 3FFLA 3UQ3A 2GW1A 4ILIA 2L6JA 4KVMA 5LCWJ 2DCPA 3LKUA 2WB2A 5TH7A 3JUEA 3ZXSA 3LY9A 5KJMA 1SZAA 4Y6CA 2KCKA 5FQ4A 2PNNA 4BX8A 4UWKA 1N0RA 1TN7A 2PQNA 1QQEA 3U4TA 5KNHD 4GB9A 2JEKA 4XE0A 4P29A 5CMYA 1U3CA 2ZU6B 1D9SA 3ESKA 4FMUA 3CBPA 3DXMG 3F9WA 1TJCA 3FTWA 1YYHA 4ILGA 2H6FA 2VGEA 3D9MA 4ANVA 1UW4B 3U3WA 4F3VA 4DI3A 3EIJA 3L9TA 1H3IA 1MQSA 4APOA 3M5AA 2R3AA 2VYIA 1HXIA 1OY3D 2DBAA 2WXIA 5F5EA 4EQFA 2X6IA 5B1BE 4F1PA 5F6KC 1V55E 4TXPA 3CLJA 3FU6A 3KD7A 4CDNA 4HOUA 5BW8C 1PC2A 3ASDA 3GW4A 5HS0A 3PZDA 4BERA
chains in the Genus database with same CATH topology
3IV0A 2WQHA 3ZRHA 5LP0A 5EDSA 3CVXA 4H7YA 4BSXA 1IYGA 5JHNA 1UG3A 3FTZA 1JWFA 2WM9A 3LS8A 3OXGA 3S2AA 1N6CA 4W9RA 3K5KA 3GZ2A 3HHMA 3IHVA 1NP7A 3PVLA 3MGBA 3OOIA 4EBAA 4AY6A 2FO7A 5T4YA 3EHNA 3SZ7A 2CHWA 1SQMA 4UWGA 4IYPA 3M55A 3URZA 3ZGQA 1NA3A 3UMVA 1H0AA 2VQ2A 4HOQA 5LOZA 3HNAA 3B7RL 4LERA 3ZYKA 1PEGA 3CBMA 2ONDA 3FUFA 5D0QD 2VSOE 4KZCA 2RG8A 3O4ZA 2LO6A 4E85A 3ZYLA 1Z3YA 5E75A 1U3DA 4WWNA 3QKYA 3I5PA 4PDXA 3T5XA 3Q5MA 1IQUA 2WMNA 3CHOA 2KC7A 4J6IA 3CVVA 4GU5A 4HOSA 4BTBA 2UWJG 3FU0A 1IQRA 3QARA 4KZ0A 5JIYA 1OWOA 3B7SA 1KT1A 2RFIA 4U07A 4JVSA 3L08A 2NXPA 4GA0A 4YPEA 3O48A 4JXTA 3EDTB 4TV3A 3ZYMA 3MO2A 3QWVA 3AU5A 3WXXA 3UT7A 5LX8A 4L2YA 4JEHA 3ML8A 4RZ0A 2L0IA 3QNKA 4B94A 3CR3A 5HQ8A 4EPZA 5KJKA 3CHPA 3B13A 4U04A 4B8CB 2I1JA 3CK7A 1EPUA 3S7FA 1E7UA 2PM7A 1ZKKA 3QAQA 4XIFA 1UN8A 4HOTA 5CHEE 3JCKC 4NVQA 1H2VC 3F9YA 5AYFA 3ONLA 5ENNA 2PZIA 4GCNA 3MO5A 3G2VA 3UT8A 4GA1A 4J8FA 4APFA 4B8AA 2BUGA 3D9KA 2VTBA 4GZ6A 3EIQC 5KJNA 2ILRA 5HI7A 3G2UA 4UQXA 3MEKA 4AJWA 1FVHA 4DJAA 2J08A 2VGXB 3CSTA 4L1BA 4ME2A 2AXUA 3B7TA 4G2VA 2FF4A 2XCBA 4CRWA 4GYYA 3LCAA 3Q47B 5T3RA 5CCLA 1TEZA 4LDGA 1VDYA 2J49A 1ELWA 3NF1A 3TAXA 2YINA 4FADA 3SF4A 2QY7A 5FWQA 3DB5A 2XGSA 4BY6A 2XQ0A 4Y6WA 3S8PA 3IHYA 5FZQA 2M63A 2WPVA 2C2LA 2UY1A 2KCVA 3D9IA 3ZEFA 4JDSA 4MI0A 4JPSA 2C0LA 3CBOA 2AXVA 3LXUX 3ZN3A 1O9SA 4AU7A 2L9BA 3APCA 2R59A 4NACA 2I6HA 4CEMA 1UJJA 3SHFA 3N71A 3SWCA 3U64A 4UI9J 1HF8A 1N54A 2XPYA 3MKQB 3RJVA 3U9WA 5JJ7A 3LDZA 4XI9A 4WNEA 4B0ZA 4Q96A 2NC9A 3OXFA 5ARFA 1E8XA 4GYOA 2WXRA 3ZHEA 3FUKA 4ANUA 5G04C 4YPAA 3IKOB 3AS8A 5KJLA 4GPKA 2AVPA 2IU1A 3CVPA 1ELKA 2R17C 5EG2A 3MKQA 1HZ4A 5KCMA 3ZPJA 4FA6A 1EDUA 4OVVA 3VUZA 3K9IA 4JL0A 3SI5A 2X38A 3LPZA 3MX3A 2LSVA 3RO2A 3FTXA 3VLDA 4A3TA 5C1DA 4ABNA 2HM8A 1MUFA 2VTBB 4PH4B 4IJ8A 3Q15A 4JLGA 5F59A 3AU4A 4KBQA 4URKA 3HIZA 3CVLA 3FEXA 3JQ1A 3KMAA 3AS5A 3PE4A 3ASFA 4RG6A 4FLBA 3M56A 4D10C 2J4DA 3APFA 4O30A 3FDHA 4JHRA 5JJ6A 3ZFWA 4DLQA 2CG2A 4JHKA 1HFAA 1PY1A 3HYMB 5EKQD 3SFZA 4DK5A 3RRNB 4E6HA 4U63A 4XX5A 1Z6TA 3FEYA 4WWPA 2VGXA 3G2WA 3RK6A 2CFUA 3PNLB 4BUPA 3VTYA 2V5FA 4U0SA 3S7DA 5FQ6A 4EZLA 2X6JA 4C0MA 1Y8MA 1DNPA 4LRZA 4XZ4A 3ZYQA 5TTFA 3T8MA 4E47A 4Z4PA 5FJYA 4C1QA 2FEZA 4I2ZA 1KLXA 4BX9A 4CGWA 3C98A 3QC1A 2VJ8A 2W5ZA 1S0PA 3RJWA 3FPDA 3ASGA 2RD0A 4M3OA 2WXMA 5FQ7A 4IULA 2WVIA 3FUDA 4J0UA 4WNGA 3SD5A 3FH8A 3Q49B 1HE8A 2BF0X 4NRHB 4DPRA 1MVHA 5BUZA 3IHXA 4WNFA 3R7RA 3PE3A 3CVUA 4JC8A 5ARGA 3FTUA 3QB2A 2Y4UA 3FP3A 4UWLA 1H19A 3VTXA 4CT0A 3PREA 4JEUA 3FTSA 5T8IA 3RRMB 1HO8A 1DVPA 2L0TB 2Y4TA 3AS4A 5D0OD 3U66A 3FTYA 5AJLA 4H7XA 4GMLA 4G23A 5EX3A 5LSZA 3KS2A 5AENA 5CPRB 3MV3B 4TUUA 3RKVA 2KZTB 4NURA 3FU3A 3L6AA 4G25A 4B89A 4EECA 1MVXA 2IOSA 3MO0A 2OVBA 4GA2A 5CCMA 1JUQA 2WXKA 2IJGX 4HS2A 4HORA 4DLOA 2KM4A 5BV0A 4PUCA 4J83A 3M58A 3FH7A 1A17A 4CDRA 3OAWA 2XRZA 4I51A 1X5BA 3L54A 3UPVA 3FUEA 3QDNA 3S7JA 3RAYA 2LAHA 4BWRA 4Q94A 4N2QA 3D9JA 2PL2A 2G46A 1PAQA 3CHRA 3QOUA 4AVXA 3G2SA 3VV0A 4N3BA 3JQ0A 4JA9A 3CIAA 3EJNA 2VSNA 4HXIA 3MV2B 1FCHA 5G04J 2JLBA 1ML9A 3CGHA 4V3IA 4C0EA 4OYSA 4AP2A 3KMJA 2XHEA 3D9NA 2WXPA 1ZU2A 5E76A 2GRLA 2CHXA 2YHEA 3MJWA 4I9CA 3UX4A 3CK9A 3I4GA 3BG1B 3E4BA 2AW6A 2HYZA 2WXFA 5JINA 3CQGB 4ACLA 4AY5A 4N3AA 3QJZA 4F1SA 2FULA 3PEVB 3LVRE 1JWGA 4WAFA 5FZSA 3NQPA 4MS6A 4FHJA 3QWPA 1GW6A 4RSYA 3OPEA 2I9CA 2WMOA 5T0KA 4QENA 4UWHA 3QWWA 3CV0A 4QEOA 3GZSA 5ANRA 3FWVA 2XPIA 4UWFA 4GCOA 2I1KA 2DIWA 3CEQA 3TXMA 5FTPA 3JYSA 4ACKA 2J9QA 3CVYA 5BT1A 3IBEA 3TXNA 1E8YA 4HFGA 2AXZA 4G24A 2LSUA 2WXNA 4YNDA 4IRUA 2WXHA 4PS7A 2IGQA 4Q69A 1SZ9A 4A1GA 5JHAA 3DALA 1QZ2A 1ELRA 1E96B 3LY8A 4A55A 2P58C 2V0PA 3FULA 4BTAA 5A6CA 2HO1A 2O8JA 2AWIA 4ANWA 3FHEA 2Y3AA 3ZIMA 4MLPA 5FZRA 2WXLA 3ENEA 4J7IA 1H2TC 3FUNA 3R9AB 3IEGA 1W3BA 2IFUA 1JPLA 3LY7A 4MRUA 2QPWA 3I4RB 2CG3A 3MA5A 4IJDA 2F69A 2UY1B 3FUMA 4U0ZA 3L22A 3HVEB 5G05C 4G26A 5M72A 4KYOB 2E2EA 2VSXE 4GZ5A 2LNIA 4ANXA 4XKBA 3DBSA 4I2WA 3TG5A 2X6FA 3CHMA 4YPUA 5C2YA 3M54A 3EHMA 3MYVA 1NZNA 3CSFA 3PNTB 3FUJA 3P2BA 3FH5A 3M57A 3S7BA 1UJKA 2YQ8A 3TGOA 3ZHEB 5F6LA 1ZBPA 1KT0A 3LYAA 4KXKB 1OWMA 3BEEA 3T5VA 2IOLA 3CHSA 3D9OA 1LF8A 1WM5A 1Z3XA 4G1TA 2JV0A 2NSZA 5LSXA 5AJDA 4U8HA 3SBSA 5DBKA 3P1UA 3ASHA 3F9ZA 4QFVA 4GAAA 2WXJA 1FVFA 5BNWA 3LEWA 5G2NA 3DPDA 5AIJA 3ML9A 2IF4A 1EF1C 1BPOA 2V4LA 3CVNA 3TJPA 3ONKA 2C0MA 3MCXA 3FU5A 3KMTA 3UUXA 4KMOA 5JHBA 1UN9A 5A7DB 4AIFA 2Q7FA 3CK8A 1OWLA 2WXOA 3MKRA 2PM6A 4O6FA 4WUYA 3BG0B 3PS6A 3SGHA 1H2UA 3FUIA 5EX0A 5BPPA 5LCWC 4JHJA 2GGFA 1NA0A 4I1OB 3VLFA 3FTVA 5FT9A 2E0IA 3M53A 4L23A 2VSYA 4XKCA 4EZKA 4I17A 4FC8A 4I43A 2MRIA 1XQHA 3GZ1A 4PS8A 3RIBA 3D9LA 4AV7A 5JJ0A 4F53A 2KZTA 1HG2A 5J08A 4GMJA 5G05J 4EBAG 2QFCA 3LVQE 4A1SA 5FQ8A 4N5CA 4F7AA 3PUJA 4I6GA 1E8WA 1YA0A 2J4BA 4FP7A 1N52A 4MI5A 5T0MA 4C9BB 4LEUA 3UT4A 5J90A 1HU3A 2YNQA 5JJTA 4BT8A 4YNMA 4I1MA 1MHQA 3F9XA 4L2LA 4DI4A 3CKCA 2FBNA 4K0RA 4AXHA 4K03A 4U0UA 4L7TA 3ULQA 4N3CA 2X3MA 3NZUA 4OVUA 3L13A 4CT4A 2MOWA 4YVQC 2OOEA 5TEGA 4KVOA 4BFRA 4PS3A 3FFLA 3UQ3A 3SW9A 2GW1A 1EYHA 2WXGA 4ILIA 1E8ZA 4GZ3A 1OWPA 2BTDA 2LAIA 4GZCA 4IN3B 4NQ0A 1OUVA 1OWNA 2YHCA 3ZW3A 2L6JA 4YVOA 4RG9A 4KVMA 2J09A 4FULA 4RVBA 3OXLA 5LCWJ 2DCPA 5CMWA 3LKUA 1E90A 1E7VA 3R7QA 4J8DA 2KATA 3CKBA 1IHGA 2BQZA 2WB2A 5TH7A 4KT6B 4WWOA 4N2SA 1HS6A 3PEUB 5ANLA 3ZXSA 3LY9A 5KJMA 4FJZA 1SZAA 4Y6CA 2KCKA 3QK0A 4FU3A 4R7LA 5FQ4A 3KAEA 3SNXA 3G2TA 1HX8A 4BX8A 5T5GA 4UWKA 2XCCA 2R5SA 2V8SE 2A5UA 2X6KA 2PQNA 4J7FA 4FLHA 4JA7A 4BT9A 1INZA 2W5YA 4GYWA 1QQEA 2OVFA 1P5QA 3U4TA 4FJYA 4LCTA 2XGMA 2MHKA 4H12A 4GB9A 1N6AA 2JEKA 4HVBA 4XE0A 4P29A 4GZDA 5CMYA 3TG4A 1U3CA 1WY6A 2IQCA 2ZU6B 2PQRA 1MT6A 1WAO1 4EZJA 3FY4A 4QEPA 4UQYA 3ESKA 4FMUA 3CBPA 2IONA 4FHKA 3F9WA 4J8EA 3CVWA 2CFZA 3VLEA 1TJCA 3FTWA 3LJ3A 3HVEA 3CVQA 4ILGA 3D9MA 3OS5A 2WQ7A 4ANVA 2HR2A 3D3MA 1UW4B 3TL5A 2XPZA 2VGYA 3D9PA 4LUNU 3U3WA 4UI9C 2XEVA 2WXQA 4F3VA 4DI3A 3M59A 3KEZA 4I1AA 3EIJA 4UQZA 1B89A 5A23A 1H3IA 3B7UX 1TJFA 3PDNA 1MQSA 3I3NA 4I6EA 4TRQA 4WNDA 3RU0A 2CHZA 3SBTB 3HDXA 4A3VA 3APDA 4G11A 4APOA 4CGVA 2R3AA 2EQXA 3M5AA 4YNPA 1L5JA 4MKTA 3ZVVA 2VYIA 3PRZA 4NJ5A 1HXIA 2GRMA 3FUHA 2DBAA 2WXIA 5F5EA 4UI9K 4AEZC 2I2OA 2OV8A 3CHQA 3OTNA 2X6IA 4N39A 4EQFA 2WQ6A 3RQ4A 3RRUA 4CCAA 4I9EA 2FI7A 1Y6IA 3PUKA 4XI0A 4ATGA 2X6HA 3PH0C 5F6KC 3ESLA 1XGWA 2KCLA 5DIZA 1QNFA 3CLJA 3FU6A 4JZYA 3CQCB 3KD7A 5AYWD 4CDNA 5LFAA 2A4ZA 3NZSA 4ILHB 1HG5A 3RO3A 4J8SA 1N3JA 3GYZA 5BV1A 2XGOA 4CDMA 3BO5A 3JUIA 1XNFA 3MZLB 4HLEA 1H6KA 2J07A 3L17A 4I6JA 2XRYA 3L16A 4HOUA 3EP0A 4J8OA 4JW1A 1HH8A 5BW8C 1PC2A 3ASDA 3GW4A 4AM9A 3PZDA 5G55A 3Q4AB 4AOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WQH A;  4H7Y A;  1IYG A;  5JHN A;  3OXG A;  1N6C A;  4W9R A;  3K5K A;  3GZ2 A;  3OOI A;  4AY6 A;  2FO7 A;  3SZ7 A;  3M55 A;  3URZ A;  3ZGQ A;  1NA3 A;  2VQ2 A;  4HOQ A;  3HNA A;  1PEG A;  3CBM A;  2OND A;  5D0Q D;  3QKY A;  3Q5M A;  2KC7 A;  4HOS A;  4BTB A;  2UWJ G;  5JIY A;  1KT1 A;  2RFI A;  4U07 A;  4GA0 A;  4YPE A;  3O48 A;  3EDT B;  3MO2 A;  3QWV A;  3WXX A;  4RZ0 A;  4B94 A;  5HQ8 A;  5KJK A;  4U04 A;  3CK7 A;  3S7F A;  1ZKK A;  4XIF A;  4HOT A;  5CHE E;  4NVQ A;  3F9Y A;  5AYF A;  2PZI A;  4GCN A;  3MO5 A;  4GA1 A;  4J8F A;  2BUG A;  4GZ6 A;  5KJN A;  5HI7 A;  4UQX A;  3MEK A;  2VGX B;  4ME2 A;  4G2V A;  2FF4 A;  5CCL A;  2XCB A;  4GYY A;  3LCA A;  3Q47 B;  4LDG A;  1ELW A;  3NF1 A;  3TAX A;  3SF4 A;  3DB5 A;  2XGS A;  3S8P A;  4Y6W A;  5FZQ A;  2WPV A;  2C2L A;  2UY1 A;  2KCV A;  4JDS A;  4MI0 A;  2C0L A;  3CBO A;  3ZN3 A;  1O9S A;  4AU7 A;  2I6H A;  3SWC A;  3N71 A;  4UI9 J;  3RJV A;  5JJ7 A;  4XI9 A;  4WNE A;  2NC9 A;  3OXF A;  5ARF A;  3ZHE A;  4GYO A;  4YPA A;  5G04 C;  3AS8 A;  5KJL A;  4GPK A;  2AVP A;  3CVP A;  5EG2 A;  1HZ4 A;  3ZPJ A;  3VUZ A;  3K9I A;  4JL0 A;  3LPZ A;  2LSV A;  3RO2 A;  5C1D A;  4ABN A;  1MUF A;  4IJ8 A;  3Q15 A;  4JLG A;  5F59 A;  4KBQ A;  3CVL A;  3KMA A;  3AS5 A;  3PE4 A;  3ASF A;  4RG6 A;  3M56 A;  4O30 A;  4JHR A;  5JJ6 A;  3ZFW A;  3HYM B;  5EKQ D;  2VGX A;  4BUP A;  3VTY A;  2V5F A;  4U0S A;  3S7D A;  1Y8M A;  5TTF A;  4E47 A;  4Z4P A;  5FJY A;  4C1Q A;  2FEZ A;  4I2Z A;  1KLX A;  4CGW A;  2W5Z A;  3RJW A;  3FPD A;  3ASG A;  4J0U A;  4WNG A;  3Q49 B;  4NRH B;  1MVH A;  4WNF A;  3PE3 A;  5ARG A;  2Y4U A;  3FP3 A;  3VTX A;  2Y4T A;  3AS4 A;  5D0O D;  5LSZ A;  5EX3 A;  4H7X A;  4G23 A;  3KS2 A;  5CPR B;  3MV3 B;  3RKV A;  4G25 A;  1MVX A;  3MO0 A;  4GA2 A;  5CCM A;  4HOR A;  4J83 A;  3M58 A;  1A17 A;  4CDR A;  4I51 A;  3UPV A;  3QDN A;  3S7J A;  3RAY A;  4BWR A;  4N2Q A;  2PL2 A;  2G46 A;  3QOU A;  3VV0 A;  4N3B A;  4JA9 A;  2VSN A;  3MV2 B;  1FCH A;  5G04 J;  2JLB A;  1ML9 A;  3KMJ A;  1ZU2 A;  4I9C A;  3CK9 A;  3E4B A;  2HYZ A;  5JIN A;  4AY5 A;  4N3A A;  5FZS A;  3QWP A;  3OPE A;  5T0K A;  4QEN A;  3QWW A;  3CV0 A;  4QEO A;  3FWV A;  2XPI A;  4GCO A;  3CEQ A;  5FTP A;  3JYS A;  2J9Q A;  5BT1 A;  4G24 A;  2LSU A;  4YND A;  2IGQ A;  3DAL A;  1QZ2 A;  1ELR A;  1E96 B;  3LY8 A;  2P58 C;  4BTA A;  5A6C A;  2HO1 A;  2O8J A;  5FZR A;  4J7I A;  3R9A B;  3IEG A;  1W3B A;  2IFU A;  3LY7 A;  2QPW A;  3MA5 A;  4IJD A;  2F69 A;  2UY1 B;  4U0Z A;  5G05 C;  4G26 A;  5M72 A;  4KYO B;  2E2E A;  4GZ5 A;  2LNI A;  4I2W A;  3TG5 A;  4YPU A;  3M54 A;  1NZN A;  3M57 A;  3S7B A;  2YQ8 A;  3TGO A;  3ZHE B;  5F6L A;  1ZBP A;  1KT0 A;  3LYA A;  4KXK B;  3BEE A;  1WM5 A;  4G1T A;  2JV0 A;  5LSX A;  3F9Z A;  5DBK A;  3ASH A;  5BNW A;  2IF4 A;  3CVN A;  2C0M A;  3KMT A;  3UUX A;  5A7D B;  4AIF A;  2Q7F A;  3CK8 A;  3MKR A;  4O6F A;  4WUY A;  5EX0 A;  5LCW C;  1NA0 A;  5FT9 A;  3M53 A;  2VSY A;  4I17 A;  1XQH A;  3GZ1 A;  3RIB A;  5JJ0 A;  5G05 J;  2QFC A;  4A1S A;  4N5C A;  1YA0 A;  4MI5 A;  5T0M A;  4LEU A;  5JJT A;  4YNM A;  4BT8 A;  3F9X A;  3CKC A;  2FBN A;  3ULQ A;  4U0U A;  4N3C A;  4YVQ C;  2OOE A;  5TEG A;  3UQ3 A;  3FFL A;  3SW9 A;  2GW1 A;  4GZ3 A;  4IN3 B;  4NQ0 A;  1OUV A;  2YHC A;  2L6J A;  4YVO A;  4RG9 A;  5LCW J;  3OXL A;  3LKU A;  4J8D A;  2KAT A;  3CKB A;  1IHG A;  2BQZ A;  5TH7 A;  4N2S A;  3LY9 A;  5KJM A;  4Y6C A;  2KCK A;  3KAE A;  5T5G A;  2XCC A;  2R5S A;  2PQN A;  4J7F A;  4JA7 A;  4BT9 A;  2W5Y A;  4GYW A;  1QQE A;  1P5Q A;  3U4T A;  2XGM A;  2MHK A;  4H12 A;  1N6A A;  3TG4 A;  2PQR A;  1MT6 A;  1WAO 1;  4QEP A;  4UQY A;  3ESK A;  4FMU A;  3CBP A;  3F9W A;  4J8E A;  1TJC A;  3CVQ A;  3OS5 A;  2HR2 A;  2VGY A;  3U3W A;  4UI9 C;  2XEV A;  4F3V A;  3M59 A;  4I1A A;  4UQZ A;  1B89 A;  1H3I A;  3PDN A;  4WND A;  4APO A;  3RU0 A;  4CGV A;  3M5A A;  2R3A A;  4YNP A;  2VYI A;  4NJ5 A;  1HXI A;  2DBA A;  5F5E A;  4UI9 K;  4EQF A;  3RQ4 A;  4N39 A;  4I9E A;  2FI7 A;  4XI0 A;  5F6K C;  2KCL A;  5DIZ A;  3KD7 A;  5AYW D;  3RO3 A;  1N3J A;  3GYZ A;  2XGO A;  3BO5 A;  1XNF A;  4J8O A;  3EP0 A;  4HOU A;  1HH8 A;  5BW8 C;  1PC2 A;  3ASD A;  3GW4 A;  4AM9 A;  3IHX A;  3Q4A B; 
#chains in the Genus database with same CATH topology
 4HI9 A;  5LP0 A;  4X8Q A;  2WM9 A;  3S2A A;  3E33 A;  3HHM A;  1NP7 A;  4EBA A;  3SZ7 A;  4IYP A;  3DPY A;  3ZGQ A;  1SA4 A;  1KPS B;  1JCS A;  5D0Q D;  2RG8 A;  3Q9N C;  1TYQ G;  3QKY A;  3BQO A;  4U7E B;  3UI2 A;  1MJ0 A;  3BUA A;  3FU0 A;  3B7S A;  3DSU A;  4F6R D;  1DCQ A;  4U07 A;  2NXP A;  3O48 A;  4TV3 A;  4RZ0 A;  2IY0 C;  1S70 B;  4DX5 D;  3SY2 A;  4B8C B;  3S7F A;  1E7U A;  5CHE E;  2R02 A;  3G2V A;  4GA1 A;  3PZ2 A;  2ILR A;  1Q2Z A;  5HI7 A;  3G2U A;  4UQX A;  3MEK A;  4AJW A;  2GRR B;  4L1B A;  5T3R A;  3Q47 B;  1N4S A;  3NF1 A;  2F8X K;  5AQ9 A;  2YIN A;  2XGS A;  4JDS A;  4JPS A;  3CBO A;  3ZN3 A;  5AN8 A;  3KSL A;  4AU7 A;  4NAC A;  4CEM A;  1UJJ A;  3SHF A;  4UI9 J;  3UXG A;  1N54 A;  1X81 A;  4XI9 A;  4WNE A;  2NC9 A;  5ARF A;  4GYO A;  4GTO A;  2AVP A;  1ELK A;  2P9L G;  3MKQ A;  5KCM A;  4JL0 A;  2QZA A;  2LXM A;  1MUF A;  3Q15 A;  4JLG A;  4KBQ A;  1AWC B;  3FEX A;  3M56 A;  2J4D A;  5H7P A;  3PZ3 A;  2DYS E;  4DLQ A;  2CG2 A;  5BXU A;  1PY1 A;  4DK5 A;  3SFZ A;  3RRN B;  2P9I G;  1BLX B;  1Z6T A;  4WWP A;  2CFU A;  3PNL B;  1FT1 A;  4LRZ A;  1DNP A;  2HE0 A;  5ENT D;  5TTF A;  4E47 A;  4Z4P A;  2FEZ A;  4BX9 A;  2W5Z A;  1S0P A;  3RJW A;  3FPD A;  3FH8 A;  3V31 A;  3Q49 B;  2P9K G;  2BF0 X;  5JA4 D;  5BUZ A;  4WNF A;  2AJA A;  1K1A A;  3VTX A;  5T8I A;  2Y4T A;  5LSZ A;  2JAB A;  5AJL A;  1H6O A;  4NUR A;  3FU3 A;  3L6A A;  1MVX A;  2WXK A;  5BV0 A;  3L82 A;  2XRZ A;  3UPV A;  3FUE A;  3QDN A;  2NYJ A;  2PL2 A;  3G2S A;  2MYO A;  3CIA A;  2VSN A;  3EJN A;  5ENO D;  4RQI A;  2JLB A;  3NBN B;  4V3I A;  1K3Z D;  1N94 A;  4C0E A;  3KMJ A;  4G8L A;  1ZU2 A;  2GRL A;  3UIP C;  3SFY A;  3MJW A;  4A63 B;  3I4G A;  3UKU G;  1N9A A;  3E4B A;  2KXP C;  4ACL A;  3LVR E;  3J5P A;  2DYR E;  5FZS A;  3EHR A;  4MS6 A;  3OPE A;  2I9C A;  3SFX A;  3UTM A;  4U8V D;  1O1R A;  4HBD A;  2I1K A;  4BES A;  4N5Q A;  3TXN A;  1E8Y A;  4G24 A;  2LSU A;  4PS7 A;  4GTT A;  3LY8 A;  3HXF A;  4A55 A;  2V0P A;  3FUL A;  2DVW A;  2O8J A;  4MLP A;  5FZR A;  3T9K A;  3ENE A;  1FT2 A;  1W3B A;  2IFU A;  4U96 D;  2CG3 A;  2F69 A;  2DWZ A;  5G05 C;  4HLL A;  2LNI A;  4ANX A;  2A5E A;  4I2W A;  3TG5 A;  3EHM A;  1OCO E;  3E32 A;  3CSF A;  3P2B A;  3S7B A;  3ZHE B;  4KXK B;  3T5V A;  3D9O A;  2JV0 A;  5AJD A;  3SBS A;  3F9Z A;  3Q73 A;  3ASH A;  2XS1 A;  1FVF A;  3Q7A A;  5G2N A;  3ML9 A;  2IF4 A;  3KMT A;  3UM2 A;  4OAV B;  2PM6 A;  4O6F A;  1TNB A;  3PS6 A;  3SGH A;  5EX0 A;  3DXK G;  3FTV A;  4EZK A;  5CBO A;  4I43 A;  4PS8 A;  2QYU A;  1TNZ A;  4N5C A;  3B7B A;  1E8W A;  1YA0 A;  1N52 A;  3UT4 A;  1HU3 A;  2XEE A;  4K0R A;  3DST A;  4U0U A;  4CT4 A;  4OVU A;  2MOW A;  2GRN B;  3KSQ A;  3ASN E;  4KVO A;  1D8E A;  4O60 A;  2LAI A;  1OUV A;  1OWN A;  4YVO A;  1NI1 A;  4FUL A;  3OXL A;  1E90 A;  2KAT A;  3TWV A;  3ABL E;  4FJZ A;  2XZT G;  4BEP A;  4FU3 A;  5AAO A;  5T5G A;  2R5S A;  2X6K A;  4FLH A;  4BT9 A;  4H12 A;  5B1A E;  5KWD A;  3TG4 A;  2PQR A;  4EZJ A;  1TN6 A;  2ION A;  3VLE A;  3LJ3 A;  3OS5 A;  2XZD G;  3F6Q A;  5EYL A;  2RFM A;  4UQZ A;  5A23 A;  3PZ1 A;  1V54 E;  4I6E A;  4YNP A;  3PRZ A;  4NJ5 A;  3PZ4 A;  3FUH A;  2I2O A;  4DX2 A;  3RQ4 A;  3DEO A;  3ESL A;  5FIN A;  2KCL A;  2IEJ A;  5AYW D;  3JUI A;  3L17 A;  2QYJ A;  3L16 A;  4UUC A;  3EU9 A;  1HH8 A;  5G55 A;  5ENP D;  4K5B A;  3ZXP A;  1RZ4 A;  1IYG A;  3FTZ A;  1JWF A;  3Q7F A;  5CER B;  3C72 A;  1N6C A;  4GTV A;  3K5K A;  3PVL A;  4AY6 A;  5T4Y A;  2CHW A;  4UWG A;  3URZ A;  1NA3 A;  2VQ2 A;  5LOZ A;  4LER A;  1OXJ A;  3ZYK A;  3FUF A;  2LO6 A;  5E75 A;  2H6I A;  4PDX A;  3T5X A;  3CVV A;  2WMN A;  3CHO A;  4J6I A;  1DCE A;  2UWJ G;  3QAR A;  1OWO A;  4J7W A;  2RFI A;  1NFI E;  1OT8 A;  4YPE A;  1TN8 A;  3EU5 A;  5LX8 A;  4L2Y A;  5HQ8 A;  3UM1 A;  3B13 A;  4U04 A;  2I1J A;  1EPU A;  2PM7 A;  3QAQ A;  1UN8 A;  2XS8 A;  3HXC A;  3F9Y A;  4TUM A;  2PZI A;  4GCN A;  4APF A;  4J8F A;  2VTB A;  4GZ6 A;  1KZO A;  4ME2 A;  4G2V A;  3B7T A;  4CRW A;  2FF4 A;  5CCL A;  2J49 A;  3DSW A;  3SF4 A;  3IHY A;  1IHB A;  2F37 A;  2WPV A;  3D9I A;  4GTP A;  2C0L A;  2FO1 E;  1O9S A;  2XEH A;  2R59 A;  2OEW A;  3U64 A;  3RJV A;  5JJ7 A;  4B0Z A;  1E8X A;  3ZHE A;  2WXR A;  3FUK A;  5KJL A;  3AG3 E;  2IU1 A;  4GTS A;  3ZPJ A;  4FA6 A;  3Q79 A;  3SI5 A;  2L6B A;  2X38 A;  3LPZ A;  2LSV A;  4A3T A;  2HM8 A;  1TNY A;  2ETB A;  1TNO A;  5AQ7 A;  3CVL A;  4RG6 A;  1O1T A;  3FDH A;  4XX5 A;  2VGX A;  3RK6 A;  4BUP A;  4U0S A;  4TXQ A;  5FQ6 A;  4XZ4 A;  3T8M A;  4I2Z A;  3TWW A;  3HG0 D;  4CGW A;  2R05 A;  3QC1 A;  2VJ8 A;  5FQ7 A;  2WXM A;  3SD5 A;  1MVH A;  4YDW A;  3PE3 A;  4JC8 A;  3QB2 A;  1H19 A;  4CT0 A;  3PRE A;  3RRM B;  1DVP A;  2KBX A;  2ZGG A;  5D0O D;  3U66 A;  4H7X A;  4GML A;  3ULY A;  4B89 A;  3MO0 A;  2OVB A;  1N4Q A;  1JUQ A;  2IJG X;  4DLO A;  3DSV A;  4PUC A;  3M58 A;  3FH7 A;  4I51 A;  3S7J A;  4N2Q A;  4BSZ B;  2G46 A;  1PAQ A;  4RLY A;  4XEI G;  3JQ0 A;  4JA9 A;  1FCH A;  3KEA A;  4LNU D;  4OYS A;  2WXP A;  3Q78 A;  5E76 A;  2CHX A;  3BG1 B;  2HYZ A;  2WXF A;  3CQG B;  1MZC A;  4N3A A;  3QJZ A;  2FUL A;  3PEV B;  1JWG A;  2LXL A;  3DSX A;  4G8K A;  3QWP A;  4RSY A;  3NB2 A;  3CVY A;  3TXM A;  1OCZ E;  2WXN A;  4YND A;  4IRU A;  2WXH A;  4HRL A;  4A1G A;  1UOH A;  1E96 B;  3W9F A;  2P58 C;  1H6P A;  5A6C A;  2HO1 A;  2AWI A;  2Y3A A;  3ZIM A;  2P2C P;  3FUN A;  3IEG A;  2P9S G;  1JPL A;  2QPW A;  5HRY A;  3MA5 A;  4IJD A;  3AG4 E;  3WG7 E;  1MYO A;  3HVE B;  1OCC E;  4G26 A;  2E2E A;  2VSX E;  4HQD A;  4XKB A;  2X6F A;  3CHM A;  4YPU A;  3MYV A;  1UJK A;  3TGO A;  5EYP F;  2ZIR A;  1TR4 A;  1ZBP A;  1LF8 A;  2BKG A;  5LSX A;  4U8H A;  5DBK A;  4GAA A;  4TXR A;  1G3N B;  3TJP A;  1EF1 C;  3CVN A;  2C0M A;  4KMO A;  2GRP B;  5JHB A;  1UN9 A;  1YMP A;  3HRA A;  4AIF A;  4HNA D;  1U2V G;  3FUI A;  5BPP A;  5LCW C;  1NA0 A;  2E0I A;  3M53 A;  4L23 A;  2VSY A;  4YDE A;  4FC8 A;  3GZ1 A;  2RFA A;  4AV7 A;  5JJ0 A;  4EBA G;  2QFC A;  4A1S A;  3RSE G;  4FP7 A;  4HB5 A;  5T0M A;  4C9B B;  5J90 A;  2YNQ A;  4BT8 A;  4DI4 A;  4L9P A;  2BED A;  3NZU A;  2Y0B G;  4BFR A;  5EN5 D;  2ZXW E;  1EYH A;  2WXG A;  1E8Z A;  4GZ3 A;  2BTD A;  4NQ0 A;  3ULE G;  4RG9 A;  4RVB A;  2J09 A;  1O1S A;  3R7Q A;  1E7V A;  2BQZ A;  1SW6 A;  4KT6 B;  4WWO A;  3SNX A;  3KAE A;  3G2T A;  1HX8 A;  4J7F A;  2ETA A;  1INZ A;  3AJI A;  2OVF A;  4GYW A;  1P5Q A;  4LCT A;  2XGM A;  1WY6 A;  2IQC A;  1RW2 A;  1MT6 A;  3FY4 A;  4UQY A;  1MX6 A;  1IKN D;  4FHK A;  4J8E A;  3CVW A;  3HVE A;  2HR2 A;  3D3M A;  3NAW A;  3TL5 A;  2VGY A;  3D9P A;  4DX1 A;  3M59 A;  3KEZ A;  1B89 A;  4O1P A;  3B7U X;  3PDN A;  4A3V A;  3I3N A;  3RU0 A;  4CGV A;  3APD A;  4GMR A;  2EQX A;  4LG6 A;  4UI9 K;  4AEZ C;  2WQ6 A;  4C48 B;  4CCA A;  4I9E A;  1Y6I A;  2F8Y A;  4ATG A;  2X6H A;  1XGW A;  1QNF A;  2QC9 A;  3ABK E;  5LFA A;  4ILH B;  1HG5 A;  3RO3 A;  1N3J A;  3MZL B;  4HLE A;  2J07 A;  4I6J A;  3EP0 A;  3RAU A;  5ENS D;  3Q4A B;  5EIB E;  4BSX A;  4CZ2 D;  1UG3 A;  1N4R A;  3LS8 A;  5EIL A;  3IHV A;  3MGB A;  2FO7 A;  1SQM A;  3M55 A;  1H0A A;  4HOQ A;  2OND A;  5CED B;  2VSO E;  4KZC A;  1Z3Y A;  4LNB A;  4WWN A;  3I5P A;  3Q5M A;  2KC7 A;  4BTB A;  1BI8 B;  3JXJ A;  1IQR A;  5JIY A;  1KT1 A;  4JVS A;  3L08 A;  3ZYM A;  3QWV A;  3AU5 A;  3WXX A;  5ENR D;  1BD8 A;  4JEH A;  3ML8 A;  3TWT A;  3QNK A;  5ENQ D;  1MX2 A;  3CK7 A;  5IY5 E;  3DEP A;  1ZKK A;  4HOT A;  3JCK C;  4NVQ A;  1H2V C;  5AYF A;  3MO5 A;  3UT8 A;  3V2O A;  1FVH A;  4DJA A;  2VGX B;  3CST A;  4B93 B;  2AXU A;  2XCB A;  1TEZ A;  4GYY A;  4LDG A;  3C5R A;  1VDY A;  1ELW A;  2Y69 E;  3TAX A;  2QY7 A;  5FWQ A;  1K8K G;  4BY6 A;  2XQ0 A;  4Y6W A;  2M63 A;  2C2L A;  2UY1 A;  2IO3 C;  3ZEF A;  3JXI A;  3APC A;  2I6H A;  5CEC B;  3SWC A;  3N71 A;  1HF8 A;  3ZUV B;  5KBA A;  3MKQ B;  3U9W A;  3LDZ A;  4Q96 A;  3OXF A;  4ANU A;  2B6C A;  3AS8 A;  2P9P G;  4GPK A;  5EG2 A;  4M7C A;  2R17 C;  1HZ4 A;  1EDU A;  4OVV A;  3K9I A;  3AG1 E;  3MX3 A;  3RO2 A;  3FTX A;  3VLD A;  4NIK A;  1OCR E;  5KNG A;  2VTB B;  4PH4 B;  4IJ8 A;  3AU4 A;  4URK A;  2J8S D;  3HIZ A;  3KMA A;  3UIN C;  2P9N G;  4D10 C;  3APF A;  4O30 A;  5JJ6 A;  3ZFW A;  2B0O E;  3HYM B;  5EKQ D;  3NOC D;  3FEY A;  3G2W A;  3VTY A;  2V5F A;  3S7D A;  2X6J A;  4C0M A;  4DUI A;  3C3O A;  5FJY A;  4C1Q A;  3C98 A;  2EIM E;  2BKK B;  3ASG A;  4M3O A;  4IUL A;  2P9U G;  3FUD A;  4J0U A;  4WNG A;  3IHX A;  3CVU A;  5ARG A;  3FTU A;  3SQV A;  2Y4U A;  3FP3 A;  3B95 A;  3FTS A;  5D2M C;  2OCC E;  2L0T B;  5EX3 A;  4G23 A;  3KS2 A;  3R9M A;  3MV3 B;  4TUU A;  3RKV A;  3ZKJ A;  4G25 A;  4GA2 A;  4HS2 A;  4HOR A;  2KM4 A;  4GPM A;  4J83 A;  4CDR A;  3L54 A;  2F0Y A;  2LAH A;  4Q94 A;  4Z68 A;  3D9J A;  3CHR A;  3QOU A;  4AVX A;  2Y1L E;  3VV0 A;  4HXI A;  3MV2 B;  5G04 J;  1ML9 A;  3CGH A;  3EUV A;  4AP2 A;  3D9N A;  3UX4 A;  3CK9 A;  2AW6 A;  4DRX E;  1S63 A;  3TWX A;  4WAF A;  3D9H A;  3NQP A;  3Q75 A;  1GW6 A;  3TWS A;  5T0K A;  2WMO A;  4UWH A;  3CV0 A;  4QEO A;  3GZS A;  5ANR A;  3FWV A;  2XPI A;  3CEQ A;  5FTP A;  3JYS A;  2J9Q A;  3IBE A;  4GTM A;  4HFG A;  2IGQ A;  2GRQ B;  4Q69 A;  5JHA A;  3DAL A;  1ELR A;  4BTA A;  2WXL A;  1H2T C;  3I4R B;  3FUM A;  1JCQ A;  3L22 A;  5M72 A;  3V30 A;  3DSS A;  4JD2 G;  4JB8 P;  5CBN A;  2V5Q C;  1D8D A;  5C2Y A;  3M54 A;  4HI8 A;  1WDY A;  1NZN A;  3PNT B;  3FUJ A;  3FH5 A;  3M57 A;  5CEA A;  3BU8 A;  4LSZ E;  1FPP A;  1KT0 A;  1OWM A;  3BEE A;  2LUH A;  2IOL A;  2V4H C;  1WM5 A;  1Z3X A;  4G1T A;  3P1U A;  4QFV A;  5BNW A;  2WXJ A;  2V4L A;  1K1B A;  3ONK A;  3MCX A;  5A7D B;  1OWL A;  2WXO A;  5BXO A;  1SVX A;  3UIO C;  4K5C A;  4WUY A;  3BG0 B;  1AP7 A;  2GGF A;  4I1O B;  4DX7 D;  4I17 A;  3TWQ A;  4GTR A;  2MRI A;  3D9L A;  3UKR G;  4F53 A;  2KZT A;  5J08 A;  4I6G A;  2J4B A;  1N0Q A;  4MI5 A;  4LEU A;  5JJT A;  4I1M A;  1MHQ A;  4L2L A;  5JMN D;  3IXE A;  4U95 D;  4AXH A;  4K03 A;  3ULQ A;  4L7T A;  4N3C A;  3L13 A;  4YDO A;  1WG0 A;  3SW9 A;  3ABM E;  1OWP A;  4IN3 B;  4GZC A;  5CRU A;  3ZW3 A;  2YHC A;  3Q9U C;  5CMW A;  4J8D A;  3CKB A;  1IHG A;  4MBG A;  3E34 A;  4N2S A;  1HS6 A;  3PEU B;  5ANL A;  3QK0 A;  4R7L A;  1ZB1 A;  2XCC A;  2V8S E;  2A5U A;  4JA7 A;  2W5Y A;  4FJY A;  3J5Q B;  2MHK A;  1N6A A;  4HVB A;  1O5M A;  4GZD A;  3HXB A;  1WAO 1;  4QEP A;  2OEV A;  2CFZ A;  3CVQ A;  2WQ7 A;  1QBQ A;  2XPZ A;  4LUN U;  4UI9 C;  2XEV A;  2WXQ A;  4I1A A;  1N11 A;  4HRN A;  1TJF A;  4EEC A;  3SBT B;  4TRQ A;  4WND A;  2CHZ A;  3HDX A;  4G11 A;  1L5J A;  4MKT A;  3ZVV A;  2GRM A;  2DZN A;  2OV8 A;  3CHQ A;  3OTN A;  4N39 A;  3RRU A;  2FI7 A;  3PUK A;  4XI0 A;  3PH0 C;  5DIZ A;  4JZY A;  2EIK E;  3CQC B;  2A4Z A;  3NZS A;  3HXD A;  4J8S A;  3GYZ A;  5BV1 A;  2XGO A;  4CDM A;  3BO5 A;  1XNF A;  1H6K A;  4J8O A;  2XRY A;  4U8Y D;  4JW1 A;  3TWR A;  4AM9 A;  4AOF A;  3IV0 A;  4HRM B;  2WQH A;  3ZRH A;  1S64 A;  5EDS A;  3CVX A;  1SA5 A;  5AAR A;  4H7Y A;  5JHN A;  4YDY A;  3OXG A;  2XEN A;  4W9R A;  3GZ2 A;  3TWU A;  3OOI A;  3EHN A;  3UMV A;  3HNA A;  3B7R L;  1PEG A;  3CBM A;  3O4Z A;  2GRO B;  4E85 A;  3ZYL A;  2EIJ E;  1U3D A;  1JCR A;  1IQU A;  4HOS A;  4GU5 A;  1BU9 A;  4KZ0 A;  3SO8 A;  4GA0 A;  4JXT A;  4K5A B;  3EDT B;  3MO2 A;  3DWL G;  3UT7 A;  2L0I A;  4B94 A;  3CR3 A;  4EPZ A;  5KJK A;  3CHP A;  1TNU A;  4OAU C;  2DZO A;  4XIF A;  3HXE A;  3ONL A;  5ENN A;  4B8A A;  2EIL E;  2BUG A;  3D9K A;  3EIQ C;  5KJN A;  2H6G A;  4ATZ D;  1YCS B;  2J08 A;  3LCA A;  5HKP A;  5EID A;  3DRA A;  4FAD A;  3DB5 A;  3S8P A;  5FZQ A;  3V2X A;  2KCV A;  4MI0 A;  2AXV A;  3LXU X;  2L9B A;  2XPY A;  3LJN A;  4LNG A;  4YPA A;  5G04 C;  3IKO B;  3CVP A;  1MX4 A;  4BET A;  3VUZ A;  5C1D A;  4ABN A;  5F59 A;  2R2L A;  2R03 A;  3JQ1 A;  1N95 A;  3AS5 A;  3PE4 A;  3ASF A;  4FLB A;  4JHR A;  4JHK A;  1HFA A;  4E6H A;  4U63 A;  4O1O A;  5ITZ F;  4EZL A;  1Y8M A;  3ZYQ A;  2EIN E;  3E30 A;  4ZFH A;  1KLX A;  2IO2 C;  2RD0 A;  3W9G A;  2WVI A;  4QQI A;  1HE8 A;  4NRH B;  4DPR A;  3R7R A;  3ASO E;  4UWL A;  4JEU A;  1HO8 A;  1Z5S C;  3AS4 A;  3FTY A;  5CRV A;  1LD7 A;  5CPR B;  5AEN A;  3ISM C;  2KZT B;  1N4P A;  2IOS A;  5CCM A;  1A17 A;  3NOG D;  3OAW A;  1X5B A;  3RAY A;  4BWR A;  5FIO A;  4N3B A;  4GTQ A;  2ZIS A;  1NL4 A;  3E37 A;  4ZHB A;  2XHE A;  2YHE A;  4I9C A;  5JIN A;  4AY5 A;  4F1S A;  3V79 K;  4FHJ A;  4QEN A;  3QWW A;  4UWF A;  4GCO A;  2DIW A;  4J8Y A;  4ACK A;  5BT1 A;  1KZP A;  2AXZ A;  1LD8 A;  1SZ9 A;  3X2Q E;  1QZ2 A;  4CYM D;  4ANW A;  3FHE A;  5AQB A;  4J7I A;  3R9A B;  4DX6 D;  3LY7 A;  4MRU A;  3ZU7 B;  3AAA C;  3UM0 A;  2UY1 B;  4U0Z A;  4KYO B;  1LTX A;  3T8K A;  4GZ5 A;  3DBS A;  3C3Q A;  3ZNG A;  2YQ8 A;  5F6L A;  3LYA A;  5D66 A;  3CHS A;  4EHM A;  2NSZ A;  1IXV A;  5B3S E;  2ZGD A;  3LEW A;  3DPD A;  5AIJ A;  1BPO A;  3C3R A;  3FU5 A;  3UUX A;  2Q7F A;  3CK8 A;  3MKR A;  5AQA A;  1H2U A;  1DC2 A;  4JHJ A;  3VLF A;  5FT9 A;  4XKC A;  1XQH A;  3RIB A;  2ETC A;  1HG2 A;  4GMJ A;  5G05 J;  1A5E A;  3LVQ E;  5FQ8 A;  3EHQ A;  4F7A A;  3PUJ A;  2RKK A;  3UM3 A;  2H6H A;  4YNM A;  3F9X A;  3CKC A;  2FBN A;  3AG2 E;  2X3M A;  1BI7 B;  4YVQ C;  2OOE A;  1QYM A;  5TEG A;  4PS3 A;  3FFL A;  3UQ3 A;  2GW1 A;  4ILI A;  2L6J A;  4KVM A;  5LCW J;  2DCP A;  3LKU A;  2WB2 A;  5TH7 A;  3JUE A;  3ZXS A;  3LY9 A;  5KJM A;  1SZA A;  4Y6C A;  2KCK A;  5FQ4 A;  2PNN A;  4BX8 A;  4UWK A;  1N0R A;  1TN7 A;  2PQN A;  1QQE A;  3U4T A;  5KNH D;  4GB9 A;  2JEK A;  4XE0 A;  4P29 A;  5CMY A;  1U3C A;  2ZU6 B;  1D9S A;  3ESK A;  4FMU A;  3CBP A;  3DXM G;  3F9W A;  1TJC A;  3FTW A;  1YYH A;  4ILG A;  2H6F A;  2VGE A;  3D9M A;  4ANV A;  1UW4 B;  3U3W A;  4F3V A;  4DI3 A;  3EIJ A;  3L9T A;  1H3I A;  1MQS A;  4APO A;  3M5A A;  2R3A A;  2VYI A;  1HXI A;  1OY3 D;  2DBA A;  2WXI A;  5F5E A;  4EQF A;  2X6I A;  5B1B E;  4F1P A;  5F6K C;  1V55 E;  4TXP A;  3CLJ A;  3FU6 A;  3KD7 A;  4CDN A;  4HOU A;  5BW8 C;  1PC2 A;  3ASD A;  3GW4 A;  5HS0 A;  3PZD A;  4BER A; 
#chains in the Genus database with same CATH homology
 3IV0 A;  2WQH A;  3ZRH A;  5LP0 A;  5EDS A;  3CVX A;  4H7Y A;  4BSX A;  1IYG A;  5JHN A;  1UG3 A;  3FTZ A;  1JWF A;  2WM9 A;  3LS8 A;  3OXG A;  3S2A A;  1N6C A;  4W9R A;  3K5K A;  3GZ2 A;  3HHM A;  3IHV A;  1NP7 A;  3PVL A;  3MGB A;  3OOI A;  4EBA A;  4AY6 A;  2FO7 A;  5T4Y A;  3EHN A;  3SZ7 A;  2CHW A;  1SQM A;  4UWG A;  4IYP A;  3M55 A;  3URZ A;  3ZGQ A;  1NA3 A;  3UMV A;  1H0A A;  2VQ2 A;  4HOQ A;  5LOZ A;  3HNA A;  3B7R L;  4LER A;  3ZYK A;  1PEG A;  3CBM A;  2OND A;  3FUF A;  5D0Q D;  2VSO E;  4KZC A;  2RG8 A;  3O4Z A;  2LO6 A;  4E85 A;  3ZYL A;  1Z3Y A;  5E75 A;  1U3D A;  4WWN A;  3QKY A;  3I5P A;  4PDX A;  3T5X A;  3Q5M A;  1IQU A;  2WMN A;  3CHO A;  2KC7 A;  4J6I A;  3CVV A;  4GU5 A;  4HOS A;  4BTB A;  2UWJ G;  3FU0 A;  1IQR A;  3QAR A;  4KZ0 A;  5JIY A;  1OWO A;  3B7S A;  1KT1 A;  2RFI A;  4U07 A;  4JVS A;  3L08 A;  2NXP A;  4GA0 A;  4YPE A;  3O48 A;  4JXT A;  3EDT B;  4TV3 A;  3ZYM A;  3MO2 A;  3QWV A;  3AU5 A;  3WXX A;  3UT7 A;  5LX8 A;  4L2Y A;  4JEH A;  3ML8 A;  4RZ0 A;  2L0I A;  3QNK A;  4B94 A;  3CR3 A;  5HQ8 A;  4EPZ A;  5KJK A;  3CHP A;  3B13 A;  4U04 A;  4B8C B;  2I1J A;  3CK7 A;  1EPU A;  3S7F A;  1E7U A;  2PM7 A;  1ZKK A;  3QAQ A;  4XIF A;  1UN8 A;  4HOT A;  5CHE E;  3JCK C;  4NVQ A;  1H2V C;  3F9Y A;  5AYF A;  3ONL A;  5ENN A;  2PZI A;  4GCN A;  3MO5 A;  3G2V A;  3UT8 A;  4GA1 A;  4J8F A;  4APF A;  4B8A A;  2BUG A;  3D9K A;  2VTB A;  4GZ6 A;  3EIQ C;  5KJN A;  2ILR A;  5HI7 A;  3G2U A;  4UQX A;  3MEK A;  4AJW A;  1FVH A;  4DJA A;  2J08 A;  2VGX B;  3CST A;  4L1B A;  4ME2 A;  2AXU A;  3B7T A;  4G2V A;  2FF4 A;  2XCB A;  4CRW A;  4GYY A;  3LCA A;  3Q47 B;  5T3R A;  5CCL A;  1TEZ A;  4LDG A;  1VDY A;  2J49 A;  1ELW A;  3NF1 A;  3TAX A;  2YIN A;  4FAD A;  3SF4 A;  2QY7 A;  5FWQ A;  3DB5 A;  2XGS A;  4BY6 A;  2XQ0 A;  4Y6W A;  3S8P A;  3IHY A;  5FZQ A;  2M63 A;  2WPV A;  2C2L A;  2UY1 A;  2KCV A;  3D9I A;  3ZEF A;  4JDS A;  4MI0 A;  4JPS A;  2C0L A;  3CBO A;  2AXV A;  3LXU X;  3ZN3 A;  1O9S A;  4AU7 A;  2L9B A;  3APC A;  2R59 A;  4NAC A;  2I6H A;  4CEM A;  1UJJ A;  3SHF A;  3N71 A;  3SWC A;  3U64 A;  4UI9 J;  1HF8 A;  1N54 A;  2XPY A;  3MKQ B;  3RJV A;  3U9W A;  5JJ7 A;  3LDZ A;  4XI9 A;  4WNE A;  4B0Z A;  4Q96 A;  2NC9 A;  3OXF A;  5ARF A;  1E8X A;  4GYO A;  2WXR A;  3ZHE A;  3FUK A;  4ANU A;  5G04 C;  4YPA A;  3IKO B;  3AS8 A;  5KJL A;  4GPK A;  2AVP A;  2IU1 A;  3CVP A;  1ELK A;  2R17 C;  5EG2 A;  3MKQ A;  1HZ4 A;  5KCM A;  3ZPJ A;  4FA6 A;  1EDU A;  4OVV A;  3VUZ A;  3K9I A;  4JL0 A;  3SI5 A;  2X38 A;  3LPZ A;  3MX3 A;  2LSV A;  3RO2 A;  3FTX A;  3VLD A;  4A3T A;  5C1D A;  4ABN A;  2HM8 A;  1MUF A;  2VTB B;  4PH4 B;  4IJ8 A;  3Q15 A;  4JLG A;  5F59 A;  3AU4 A;  4KBQ A;  4URK A;  3HIZ A;  3CVL A;  3FEX A;  3JQ1 A;  3KMA A;  3AS5 A;  3PE4 A;  3ASF A;  4RG6 A;  4FLB A;  3M56 A;  4D10 C;  2J4D A;  3APF A;  4O30 A;  3FDH A;  4JHR A;  5JJ6 A;  3ZFW A;  4DLQ A;  2CG2 A;  4JHK A;  1HFA A;  1PY1 A;  3HYM B;  5EKQ D;  3SFZ A;  4DK5 A;  3RRN B;  4E6H A;  4U63 A;  4XX5 A;  1Z6T A;  3FEY A;  4WWP A;  2VGX A;  3G2W A;  3RK6 A;  2CFU A;  3PNL B;  4BUP A;  3VTY A;  2V5F A;  4U0S A;  3S7D A;  5FQ6 A;  4EZL A;  2X6J A;  4C0M A;  1Y8M A;  1DNP A;  4LRZ A;  4XZ4 A;  3ZYQ A;  5TTF A;  3T8M A;  4E47 A;  4Z4P A;  5FJY A;  4C1Q A;  2FEZ A;  4I2Z A;  1KLX A;  4BX9 A;  4CGW A;  3C98 A;  3QC1 A;  2VJ8 A;  2W5Z A;  1S0P A;  3RJW A;  3FPD A;  3ASG A;  2RD0 A;  4M3O A;  2WXM A;  5FQ7 A;  4IUL A;  2WVI A;  3FUD A;  4J0U A;  4WNG A;  3SD5 A;  3FH8 A;  3Q49 B;  1HE8 A;  2BF0 X;  4NRH B;  4DPR A;  1MVH A;  5BUZ A;  3IHX A;  4WNF A;  3R7R A;  3PE3 A;  3CVU A;  4JC8 A;  5ARG A;  3FTU A;  3QB2 A;  2Y4U A;  3FP3 A;  4UWL A;  1H19 A;  3VTX A;  4CT0 A;  3PRE A;  4JEU A;  3FTS A;  5T8I A;  3RRM B;  1HO8 A;  1DVP A;  2L0T B;  2Y4T A;  3AS4 A;  5D0O D;  3U66 A;  3FTY A;  5AJL A;  4H7X A;  4GML A;  4G23 A;  5EX3 A;  5LSZ A;  3KS2 A;  5AEN A;  5CPR B;  3MV3 B;  4TUU A;  3RKV A;  2KZT B;  4NUR A;  3FU3 A;  3L6A A;  4G25 A;  4B89 A;  4EEC A;  1MVX A;  2IOS A;  3MO0 A;  2OVB A;  4GA2 A;  5CCM A;  1JUQ A;  2WXK A;  2IJG X;  4HS2 A;  4HOR A;  4DLO A;  2KM4 A;  5BV0 A;  4PUC A;  4J83 A;  3M58 A;  3FH7 A;  1A17 A;  4CDR A;  3OAW A;  2XRZ A;  4I51 A;  1X5B A;  3L54 A;  3UPV A;  3FUE A;  3QDN A;  3S7J A;  3RAY A;  2LAH A;  4BWR A;  4Q94 A;  4N2Q A;  3D9J A;  2PL2 A;  2G46 A;  1PAQ A;  3CHR A;  3QOU A;  4AVX A;  3G2S A;  3VV0 A;  4N3B A;  3JQ0 A;  4JA9 A;  3CIA A;  3EJN A;  2VSN A;  4HXI A;  3MV2 B;  1FCH A;  5G04 J;  2JLB A;  1ML9 A;  3CGH A;  4V3I A;  4C0E A;  4OYS A;  4AP2 A;  3KMJ A;  2XHE A;  3D9N A;  2WXP A;  1ZU2 A;  5E76 A;  2GRL A;  2CHX A;  2YHE A;  3MJW A;  4I9C A;  3UX4 A;  3CK9 A;  3I4G A;  3BG1 B;  3E4B A;  2AW6 A;  2HYZ A;  2WXF A;  5JIN A;  3CQG B;  4ACL A;  4AY5 A;  4N3A A;  3QJZ A;  4F1S A;  2FUL A;  3PEV B;  3LVR E;  1JWG A;  4WAF A;  5FZS A;  3NQP A;  4MS6 A;  4FHJ A;  3QWP A;  1GW6 A;  4RSY A;  3OPE A;  2I9C A;  2WMO A;  5T0K A;  4QEN A;  4UWH A;  3QWW A;  3CV0 A;  4QEO A;  3GZS A;  5ANR A;  3FWV A;  2XPI A;  4UWF A;  4GCO A;  2I1K A;  2DIW A;  3CEQ A;  3TXM A;  5FTP A;  3JYS A;  4ACK A;  2J9Q A;  3CVY A;  5BT1 A;  3IBE A;  3TXN A;  1E8Y A;  4HFG A;  2AXZ A;  4G24 A;  2LSU A;  2WXN A;  4YND A;  4IRU A;  2WXH A;  4PS7 A;  2IGQ A;  4Q69 A;  1SZ9 A;  4A1G A;  5JHA A;  3DAL A;  1QZ2 A;  1ELR A;  1E96 B;  3LY8 A;  4A55 A;  2P58 C;  2V0P A;  3FUL A;  4BTA A;  5A6C A;  2HO1 A;  2O8J A;  2AWI A;  4ANW A;  3FHE A;  2Y3A A;  3ZIM A;  4MLP A;  5FZR A;  2WXL A;  3ENE A;  4J7I A;  1H2T C;  3FUN A;  3R9A B;  3IEG A;  1W3B A;  2IFU A;  1JPL A;  3LY7 A;  4MRU A;  2QPW A;  3I4R B;  2CG3 A;  3MA5 A;  4IJD A;  2F69 A;  2UY1 B;  3FUM A;  4U0Z A;  3L22 A;  3HVE B;  5G05 C;  4G26 A;  5M72 A;  4KYO B;  2E2E A;  2VSX E;  4GZ5 A;  2LNI A;  4ANX A;  4XKB A;  3DBS A;  4I2W A;  3TG5 A;  2X6F A;  3CHM A;  4YPU A;  5C2Y A;  3M54 A;  3EHM A;  3MYV A;  1NZN A;  3CSF A;  3PNT B;  3FUJ A;  3P2B A;  3FH5 A;  3M57 A;  3S7B A;  1UJK A;  2YQ8 A;  3TGO A;  3ZHE B;  5F6L A;  1ZBP A;  1KT0 A;  3LYA A;  4KXK B;  1OWM A;  3BEE A;  3T5V A;  2IOL A;  3CHS A;  3D9O A;  1LF8 A;  1WM5 A;  1Z3X A;  4G1T A;  2JV0 A;  2NSZ A;  5LSX A;  5AJD A;  4U8H A;  3SBS A;  5DBK A;  3P1U A;  3ASH A;  3F9Z A;  4QFV A;  4GAA A;  2WXJ A;  1FVF A;  5BNW A;  3LEW A;  5G2N A;  3DPD A;  5AIJ A;  3ML9 A;  2IF4 A;  1EF1 C;  1BPO A;  2V4L A;  3CVN A;  3TJP A;  3ONK A;  2C0M A;  3MCX A;  3FU5 A;  3KMT A;  3UUX A;  4KMO A;  5JHB A;  1UN9 A;  5A7D B;  4AIF A;  2Q7F A;  3CK8 A;  1OWL A;  2WXO A;  3MKR A;  2PM6 A;  4O6F A;  4WUY A;  3BG0 B;  3PS6 A;  3SGH A;  1H2U A;  3FUI A;  5EX0 A;  5BPP A;  5LCW C;  4JHJ A;  2GGF A;  1NA0 A;  4I1O B;  3VLF A;  3FTV A;  5FT9 A;  2E0I A;  3M53 A;  4L23 A;  2VSY A;  4XKC A;  4EZK A;  4I17 A;  4FC8 A;  4I43 A;  2MRI A;  1XQH A;  3GZ1 A;  4PS8 A;  3RIB A;  3D9L A;  4AV7 A;  5JJ0 A;  4F53 A;  2KZT A;  1HG2 A;  5J08 A;  4GMJ A;  5G05 J;  4EBA G;  2QFC A;  3LVQ E;  4A1S A;  5FQ8 A;  4N5C A;  4F7A A;  3PUJ A;  4I6G A;  1E8W A;  1YA0 A;  2J4B A;  4FP7 A;  1N52 A;  4MI5 A;  5T0M A;  4C9B B;  4LEU A;  3UT4 A;  5J90 A;  1HU3 A;  2YNQ A;  5JJT A;  4BT8 A;  4YNM A;  4I1M A;  1MHQ A;  3F9X A;  4L2L A;  4DI4 A;  3CKC A;  2FBN A;  4K0R A;  4AXH A;  4K03 A;  4U0U A;  4L7T A;  3ULQ A;  4N3C A;  2X3M A;  3NZU A;  4OVU A;  3L13 A;  4CT4 A;  2MOW A;  4YVQ C;  2OOE A;  5TEG A;  4KVO A;  4BFR A;  4PS3 A;  3FFL A;  3UQ3 A;  3SW9 A;  2GW1 A;  1EYH A;  2WXG A;  4ILI A;  1E8Z A;  4GZ3 A;  1OWP A;  2BTD A;  2LAI A;  4GZC A;  4IN3 B;  4NQ0 A;  1OUV A;  1OWN A;  2YHC A;  3ZW3 A;  2L6J A;  4YVO A;  4RG9 A;  4KVM A;  2J09 A;  4FUL A;  4RVB A;  3OXL A;  5LCW J;  2DCP A;  5CMW A;  3LKU A;  1E90 A;  1E7V A;  3R7Q A;  4J8D A;  2KAT A;  3CKB A;  1IHG A;  2BQZ A;  2WB2 A;  5TH7 A;  4KT6 B;  4WWO A;  4N2S A;  1HS6 A;  3PEU B;  5ANL A;  3ZXS A;  3LY9 A;  5KJM A;  4FJZ A;  1SZA A;  4Y6C A;  2KCK A;  3QK0 A;  4FU3 A;  4R7L A;  5FQ4 A;  3KAE A;  3SNX A;  3G2T A;  1HX8 A;  4BX8 A;  5T5G A;  4UWK A;  2XCC A;  2R5S A;  2V8S E;  2A5U A;  2X6K A;  2PQN A;  4J7F A;  4FLH A;  4JA7 A;  4BT9 A;  1INZ A;  2W5Y A;  4GYW A;  1QQE A;  2OVF A;  1P5Q A;  3U4T A;  4FJY A;  4LCT A;  2XGM A;  2MHK A;  4H12 A;  4GB9 A;  1N6A A;  2JEK A;  4HVB A;  4XE0 A;  4P29 A;  4GZD A;  5CMY A;  3TG4 A;  1U3C A;  1WY6 A;  2IQC A;  2ZU6 B;  2PQR A;  1MT6 A;  1WAO 1;  4EZJ A;  3FY4 A;  4QEP A;  4UQY A;  3ESK A;  4FMU A;  3CBP A;  2ION A;  4FHK A;  3F9W A;  4J8E A;  3CVW A;  2CFZ A;  3VLE A;  1TJC A;  3FTW A;  3LJ3 A;  3HVE A;  3CVQ A;  4ILG A;  3D9M A;  3OS5 A;  2WQ7 A;  4ANV A;  2HR2 A;  3D3M A;  1UW4 B;  3TL5 A;  2XPZ A;  2VGY A;  3D9P A;  4LUN U;  3U3W A;  4UI9 C;  2XEV A;  2WXQ A;  4F3V A;  4DI3 A;  3M59 A;  3KEZ A;  4I1A A;  3EIJ A;  4UQZ A;  1B89 A;  5A23 A;  1H3I A;  3B7U X;  1TJF A;  3PDN A;  1MQS A;  3I3N A;  4I6E A;  4TRQ A;  4WND A;  3RU0 A;  2CHZ A;  3SBT B;  3HDX A;  4A3V A;  3APD A;  4G11 A;  4APO A;  4CGV A;  2R3A A;  2EQX A;  3M5A A;  4YNP A;  1L5J A;  4MKT A;  3ZVV A;  2VYI A;  3PRZ A;  4NJ5 A;  1HXI A;  2GRM A;  3FUH A;  2DBA A;  2WXI A;  5F5E A;  4UI9 K;  4AEZ C;  2I2O A;  2OV8 A;  3CHQ A;  3OTN A;  2X6I A;  4N39 A;  4EQF A;  2WQ6 A;  3RQ4 A;  3RRU A;  4CCA A;  4I9E A;  2FI7 A;  1Y6I A;  3PUK A;  4XI0 A;  4ATG A;  2X6H A;  3PH0 C;  5F6K C;  3ESL A;  1XGW A;  2KCL A;  5DIZ A;  1QNF A;  3CLJ A;  3FU6 A;  4JZY A;  3CQC B;  3KD7 A;  5AYW D;  4CDN A;  5LFA A;  2A4Z A;  3NZS A;  4ILH B;  1HG5 A;  3RO3 A;  4J8S A;  1N3J A;  3GYZ A;  5BV1 A;  2XGO A;  4CDM A;  3BO5 A;  3JUI A;  1XNF A;  3MZL B;  4HLE A;  1H6K A;  2J07 A;  3L17 A;  4I6J A;  2XRY A;  3L16 A;  4HOU A;  3EP0 A;  4J8O A;  4JW1 A;  1HH8 A;  5BW8 C;  1PC2 A;  3ASD A;  3GW4 A;  4AM9 A;  3PZD A;  5G55 A;  3Q4A B;  4AOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...